4ER3A

Crystal structure of human dot1l in complex with inhibitor epz004777
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
328
structure length
311
Chain Sequence
b'KLELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMENYVLIDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTTQPMKLNTRPSTGLLRHILQQVYNHSVTDPEKLNNETSFDLVAQMIDEIKMTDDDLFVDLGSGVGQVVLQVAAATNCKHHYGVEKADIPAKYAETMDREFRKWMKWYGKKHAEYTLERGDFLSEEWRERIANTSVIFVNNFAFGPEVDHQLKERFANMKEGGRIVSSKPFAPLNFRINSRNLSDIGTIMRVVELSPLKGSVSYYLHTIDRTILENYFSSLKN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone-lysine N-methyltransferase, H3 lysine-79 specific
molecule tags Transferase/transferase inhibitor
source organism Homo sapiens
publication title Catalytic site remodelling of the DOT1L methyltransferase by selective inhibitors.
pubmed doi rcsb
total genus 93
structure length 311
sequence length 328
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2012-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08123 DOT1 Histone methylation protein DOT1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.60 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) 434 Repressor (Amino-terminal Domain) 4er3A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4er3A02
5E2AA 1G6Q1 3LDGA 5EHIA 1VP3A 3MQ2A 4GOOD 3MGGA 4FT4A 4KDRA 4PIPA 3OZSA 1WXXA 5LSAA 2PKWA 4QDJA 4RTMA 4FZVA 3G5LA 1VE3A 1VQ1A 2JG3A 4M36A 2NP7A 4PINA 4A6DA 3O31A 2AVNA 3IV6A 5E1DA 3ER8A 3EMDA 4RVHA 1BC5A 5CVEA 3PFGA 2XVAA 4HC4A 2C7PA 1JG4A 2G70A 3GRZA 3OU6A 3PB3A 5E9JA 1HMYA 2CKDA 4PYLA 4RTJA 5C9ZA 1VBFA 1D2HA 2OO3A 4QDKA 3WSTA 3ELUA 3T0IA 3TM4A 1P1BA 1MHTA 9MHTA 5GM2A 3PTAA 4BY9E 3B3FA 4P7GA 4CKBA 4ATNA 2CMGA 4DKJA 2YQZA 3UA4A 4WXHA 1ZGAA 3R3HA 5DM2A 5EGSA 2ZULA 3DP7A 1EQAA 5HIIA 2QY6A 1ORHA 2UYOA 5DSTA 1QYRA 1KP9A 2XBMA 2PV0A 1ZKDA 3KQPA 2NXEA 3KQYA 4RSRA 1O9GA 5DX8A 1N7JA 4GF5A 1R00A 5EKXA 2WA2A 3BT7A 1L9KA 3NMUF 2EJTA 8MHTA 3EMBA 4YMHA 2NXJA 4X41A 3LKDA 2FK7A 2H11A 5CIYA 3BWBA 3HCCA 4X1OA 1MJFA 1NW7A 2VP3A 4PWYA 3P9NA 5M5BA 5DRTA 2DULA 5EVJA 4F85A 2VDWA 2Y1XA 3HA3A 5HIKA 1FBNA 3GU3A 3TFWA 4QQKA 3FTDA 3A27A 3G2PA 4FSDA 2OYRA 4QVGA 3UA3A 4RTQA 3EVGA 4R8RA 1QAOA 2P7HA 3B3GA 3LCVB 4KDCA 2YUIA 3KU1A 2IH2A 5HILA 4GOMD 2OB1A 2VDVE 3RW9A 1SVUA 2R3SA 3UJ7A 2PXAA 1JR4A 4CWAA 3UJ9A 3EGVA 3I9FA 1UWVA 3GNLA 1SUIA 3C0KA 4MTLA 4HGZA 1WY7A 3CVOA 3IYLW 5CVVA 5CCBA 2UYHA 3MTEA 5EZSA 1XVAA 3VC1A 1DL5A 5EIWA 2FPOA 4IV0A 3HVKA 4ER6A 3G7UA 1X1DA 3G2OA 3SSMA 3LDUA 2VDUE 1QANA 3BXOA 3M4XA 4GUAA 4GOLD 3C3YA 3THRA 5K09A 4OA5A 5FHRA 1NKVA 1PRYA 1SG9A 2JHAA 4RTPA 2ZIGA 5FWAA 4QPPA 3DXZA 4HTFB 2CL5A 3FRIA 3LCCA 3P8ZA 2BZGA 2O07A 2PWYA 4DZRA 5JUWA 2OZVA 2O0LA 2P3QA 3O7WA 4LWPA 5HIMA 3OPNA 3ER9A 1YFLA 2BR3A 3BKWA 3NVKI 3E8SA 1FJXA 1P91A 5DTQA 2AVDA 3NDIA 1RI1A 2QRVA 4AUKA 3IEIA 3AXSA 3JWJA 2FRXA 3KR2A 4PCAA 3DLCA 3GRVA 1JQEA 5K0JA 4UOEA 2KW5A 3KQVA 1XDZA 4L7VA 3G8AA 3P9IA 1QAQA 2AOXA 4PCLA 4X63A 4XCXA 5T64A 5FA8A 2NXCA 3DXXA 3FTFA 2ZFUA 1WXWA 2YXLA 4C03A 1G60A 4EVIA 4OBWA 3P71T 3K0BA 3PS9A 1H1DA 2ADMA 3I5UA 1WG8A 2H00A 3A4TA 3DMGA 2CMHA 4P7FA 5ERGB 5GM1A 2AN4A 1R18A 5KVAA 1G55A 5CD1A 3FPJA 7MHTA 1RJEA 3GRUA 2AOTB 3RIEA 3GGDA 1YB2A 1EJ0A 3CCFA 2AS0A 5IKMA 4Y30A 5CM2Z 3OU7A 2ZBRA 2VS1A 2WK1A 3TRKA 2LD4A 3GJYA 3UZUA 4E30A 3KPJA 3K6RA 3NDJA 2PX4A 2JH9A 2ZBQA 3RODA 4C08A 2ZLBA 4PGHA 1YZHA 3BUSA 4RWZA 3AXTA 5HEKA 3KKZA 3DH0A 2E5WA 3MCTA 3SR4A 4M7RA 1BHJA 3T7SA 4E32A 1NV9A 2NXNA 2PSSA 3P97A 2IIPA 2BM8A 2PXXA 4PYNA 5HFJA 3EVDA 2IFTA 5FCDA 3CJQA 1M0EA 3QV2A 4ER0A 2F8LA 1M6YA 3GDHA 3PX3A 1RJGA 1U2ZA 5DXAA 3C3PA 3BGIA 5LQNA 3KR9A 2GA9A 2YR0A 3DLIA 4H0NA 5EKUA 5G02A 5F2NA 2ZWAA 2GPYA 2UYCA 4YUYA 1L3BA 1WZNA 2AR0A 2K4MA 2P1DA 2PY6A 3KQMA 4PYMA 3KQSA 2OB2A 2AOVA 2PX5A 5DM0A 4DQ0A 5EOVA 5EQJB 2B9EA 1F38A 3PVCA 1XDSA 5EMMA 4R6XA 3VYWA 3ORHA 4P7JA 3B89A 2PT6A 1I1NA 3EVZA 3DUWA 3EVCA 1NW3A 2XVMA 3G2QA 3HCEA 2B3TA 3JWHA 5K03A 1M6EX 1R6AA 1G38A 2IH5A 3P9CA 4GOND 2Z6UA 5FADA 10MHA 4OQDA 4E2ZA 3TKYA 4AZTA 1Z3CA 1P39A 4KRGA 4LWOA 5EEHA 2Z6QA 3ANXA 1NBIA 2FCAA 3LECA 5EEGA 5EIFA 5K01A 2QE6A 5U4XA 3A25A 4FR0A 2JHCA 2C7RA 2G1PA 2ZWVA 5CUQA 3F4KA 2Y1WA 3BZBA 4YUXA 5F2KA 4U7TB 1R8YA 3E7PA 4QVKA 2EX4A 5EG5A 5FTWA 3TOSA 3CGGA 4C07A 3P2IA 3UBTA 3ME5A 2ORED 2GS9A 4IWNA 3SSNA 3OCJA 3AWIA 1JTFA 2NP6A 5LQKA 5KQSA 4BLUA 4YV2A 5CVJA 2YXDA 4BP1A 3VC2A 3HP7A 4QPNA 4HTFA 5FQNA 4C4AA 3V8VA 5K0NA 3TMAA 5K05A 4YUZA 3SXJA 2HMYB 3T7RA 2R6ZA 3FPFA 1N2XA 4GEKA 2FK8A 2UZ4A 4AX8A 3R9XB 3B3JA 2PWPA 3A7DA 3CJRA 5FA5A 1T43A 2HV9A 3MAGA 5EPEA 3M33A 4OQEA 2IBSA 3H2BA 5DX1A 5CCXA 3B7PA 3LKZA 1D2CA 1X19A 1SQGA 2XYQA 3DOUA 1I4WA 3OE4A 5EMJA 4RYLA 5E1MA 4AZSA 3UJBA 3EGIA 5E8RA 4RVDA 5KQRA 2EFJA 1AQJA 3DMHA 3R24A 1ZGJA 3HVIA 3I53A 3LX6A 4ER7A 2P41A 4V0RA 1YZ3A 2P40A 3DMFA 1SQFA 3S68A 5BP7A 5GIPE 1DCTA 1OR8A 2IDKA 5E9QA 3KPYA 1RI4A 2AOTA 3LBYA 4EKIA 3OZTA 4DMGA 2EG5A 3JWIA 2C7QA 3E05A 2OKCA 3LHDA 1QAMA 4RTRA 2HTEA 2B78A 2ZZKA 1UFKA 1KR5A 3M70A 1N7IA 3O4FA 5IH3A 3FUTA 4RVGA 4QTTB 3FPHA 3TKAA 5K0GA 4DCMA 4KW7A 1RI5A 3TQSA 5MHTA 1KIAA 2Z6AA 5HIJA 3CJTA 5LQCA 3LL7A 1JG1A 1L3IA 2FHPA 3MERA 4MQ4A 2PXCA 3BKXA 3KR1A 1XDUA 1D2GA 1XCLA 2ZTHA 3FUVA 2AOUB 3TR6A 1YFJA 4HH4A 1AF7A 2EJUA 2PBFA 5BXYA 3BGDA 4PYOA 1XTPA 2YVLA 4C05A 3V97A 4DCGA 3EEYA 5DPMA 3KPVA 3HNRA 3FTEA 4HSGA 2VZ9A 3TPZA 3CC8A 2ESRA 1ZHFA 3UJ8A 2XYRA 2YTZA 5DM1A 2ZBPA 5ICFA 3HA5A 5DWQA 5KS2A 4KIFA 4X60A 3FUUA 3KPWA 5E9WA 3D2LA 3ERCA 3KQWA 3AJDA 2JJQA 3HVJA 4HGYA 1ZQ9A 2N47A 4P58A 3NW9A 3UFBA 2JHPA 4XUEA 2CWWA 1IY9A 3C6MA 5DSXA 1VLMA 4MWZA 5HOQA 4QTUB 2BR5A 2WA1A 2Q41A 3I58A 2P7IA 5FWDA 5ICEA 1NBHA 3DULA 1NW8A 3EVEA 5LQAA 5GINE 4Z2YA 2OBFA 5E2BA 4RV9A 2O05A 5EZQA 1G8SA 2AZTA 4Y2HA 2ZZNA 3OFJA 5EHGA 3UJDA 3MB5A 3SMQA 1NE2A 1Q0TA 4GC9A 4DF3A 4KVZA 4ER5A 5DTMA 4YV1A 5LR6A 1QZZA 5DRYA 2P3LA 1WS6A 3HCBA 3MCZA 4NECA 1TW2A 5T67A 4FGZA 2IP2A 3KR0A 4P7KA 1JG3A 3G2MA 3EGEA 2PJDA 3EVFA 4BP3A 2ZCJA 2OPBA 2PT9A 2BR4A 2PX2A 2G8NA 2BH2A 2FYTA 2IPXA 4KWCA 3GRRA 1O9HA 1HNNA 3BWYA 2ONZA 2YX1A 3G88A 5GIOE 1SUSA 4EMSA 5D1NA 1JTEA 1VL5A 2AOUA 5E1BA 4HRAA 5K0LA 4YV0A 2QYOA 2H1RA 4EKGA 4ER3A 1FPQA 2GAFA 3E23A 3X0DA 4CXMA 4DA4A 3VSEA 5DXJA 3M6WA 1IM8A 4G56A 3ELWA 3M6XA 5DLYA 2PVCA 3G8BA 2ERCA 4QQNA 2HNKA 4YUVA 1XXLA 2ZSUA 4POOA 1INLA 3REOA 3HM2A 5FQOA 3G5TA 4CTJA 2I6GA 3NWEA 4LECA 4E2YA 5GP1A 1XJ5A 4X61A 5ICGA 1ZG3A 5GOZA 1JSZA 3CBGA 4RTKA 1NV8A 5D1HA 3UJCA 2BM9A 2IGTA 2QRVB 3OFKA 3DXYA 4MHTA 1EG2A 4IKPA 2P3OA 4FS8A 3M6VA 5BW5A 5DTRA 5CVUA 4E31A 4KIGA 4V0QA 1KYWA 1F3LA 1P1CA 2GB4A 3OE5A 4PNEA 3LGAA 5K8VA 4PIMA 1TPYA 4PYQA 4U7PB 3SM3A 2GH1A 1NW5A 3SGLA 2ZZMA 3HA7A 3GCZA 5DX0A 1ORIA 3KHKA 3M6UA 5FUBA 3JWGA 1KHHA 2PGXA 3FPEA 5KYGA 4M37A 3EPPA 4GC5A 4PONA 3MTIA 1RJDA 3C6KA 2B2CA 4GQBA 4DM3A 1FP2A 4YUWA 4IV8A 4K6MA 5C1IA 1DUSA 3EVBA 5HZMA 2G71A 1IXKA 4JXJA 3GO4A 4OX9Y 1RI2A 3KQTA 3FRHA 2NYUA 5P8WA 3UJAA 3CKKA 4A6EA 2I7CA 3FPGA 4RTLA 5K0FA 3L8DA 3KQQA 4M38A 3R0QA 3U81A 1Q0SA 3HCDA 4RTOA 1EJ6A 3Q87B 1YUBA 1JG2A 2XYVA 5LQRA 3EEOA 3NWBA 1EIZA 4XUCA 4CKEA 4EK9A 3T7TA 1L3CA 5K0BA 1TW3A 5EMKA 3UJ6A 4E33A 2GLUA 1YF3A 1O54A 3ELDA 5C0OE 1JQDA 3GWZA 3SSOA 3HEMA 4BLWA 2ZW9A 4BLVA 4CKCA 3Q7EA 2G72A 3HVHA 4RX1A 3QOWA 2ZIEA 2ZVJA 3KPUA 1RJFA 3LSTA 1VP9A 2IBTA 1JSXA 3BWMA 4OA8A 4MIKA 5T6BA 2PX8A 4FP9A 5EMLA 5JR3A 2I9KA 4ZTBA 5K0EA 3EVAA 4C06A 3A7EA 2P35A 5B1SA 3IHTA 2NNWB 3AY0A 3KQOA 4RVFA 1XCJA 4YMGA 4GBED 1SKMA 5CVDA 4PGGA 3FYCA 4E70A 1RI3A 3HTXA 1G8AA 2AOWA 1VPTA 3ID6C 3LBFA 3NJRA 3NTVA 5BW4A 3B5IA 3R6TA 1EAMA 1NT2A 2O57A 2OY0A 3PT9A 4B17A 2AN3A 1Y8CA 3I64A 3GRYA 4F84A 2IH4A 5DT2A 2V74B 4R6WA 3LPMA 3PFHA 5ICCA 4RTNA 2A14A 3DR5A 4C04A 2ZIFA 1AQIA 4R8SA 4E2XA 1L1EA 3GXOA 1PJZA 3P2EA 1X1CA 3PLAE 1B42A 3LCUA 4R05A 4AZVA 2C7OA 2O06A 3UWPA 4F86A 4FT2A 3TLJA 2YXEA 1KPIA 3LDFA 2UYQA 4WVLA 5E8JA 3FYDA 1NW6A 3A26A 3PX2A 5K0CA 4O29A 3FTCA 3OU2A 2PLWA 3G89A 3SX0A 4ISCA 5F2OA 5LQUA 5FHQA 2HWKA 3THSA 1BOOA 1JQ3A 1FP1D 1BKYA 1X1BA 3FUWA 3DTNA 4PYKA 3OZRA 3BGVA 2OXTA 2I62A 5FULA 2HR1A 3FUXA 3SVZA 4E2WA 5DM4A 4EQZA 5EC8A 4RTSA 2B25A 2JH8A 4HG2A 4PYJA 2QM3A 3BWCA 4AZWA 3P9KA 2P8JA 5GWXA 3GIWA 1I9GA 1KPHA 4LG1A 5H02A 1R74A 3FZGA 2DPMA 1R8XA 3TM5A 3P2KA 4XUDA 2ONYA 4FSXA 3ELYA 1AV6A 2AN5A 1V39A 5E1OA 3MHTA 4PYIA 3NVMB 2V7EA 4CTKA 2IDJA 1VIDA 1UIRA 1KPGA 5LQJA 3QOXA 1X1AA 3HCFA 1KXZA 4OBXA 1KYZA 3HCAA
chains in the Genus database with same CATH superfamily
1XL0A 3C7CB 5A5FA 1HE8B 1BVYF 2OFXA 1NI4B 3H87A 1LNSA 4PZ9A 1WXXA 2C1EA 3FIUA 4QDJA 3WTCA 4AIIA 1M8FA 1U0SY 5HP4A 2CHUA 1RYZA 2NP7A 4RUKA 4KZPA 5FTJA 2AVNA 2GPJA 1PW5A 3I2HA 2FWPA 5GADl 3JD3A 5AVKA 1Y63A 4D3XA 3ZZTA 3NPMA 1YMVA 1D6SA 4WLFA 3OU6A 4F4CA 1EM8B 3UGTA 3NIDB 2CKDA 3ZDFA 2UXCB 2Z5VA 1VBFA 2O5RA 2XRFA 3G68A 1PWZA 5HZHA 3P9RA 3HJTA 2RKBA 5GM2A 5JADA 4BY9E 3DKRA 1JIUA 3KEFA 1TO1E 2E4UA 1G0NA 1MX1A 2AD5A 2OYCA 3WIUA 2JD2A 4GPBA 5ED0A 4OB4A 4M55A 3GFQA 2VAVA 5ADVA 4GO1A 4B7UA 1JQ5A 3W3ZB 1E7MA 2Z43A 1XRJA 2GHRA 5DSTA 3NBMA 2LZ0A 4XYEA 2XBMA 1KAHA 1T4MA 4BX9A 1Z33A 1WMAA 3QXJA 1STOA 4NZNA 4MUAA 3TQIA 5GONF 1QYDA 4BNMA 1FYXA 3NCTA 1GY8A 1LCCA 3ORYA 5BSMA 4BB0A 3BHJA 3MMNA 1OC2A 3D8BA 5F98A 1L9KA 1DHRA 4HSEA 1SUFA 1KWKA 4NJMA 3TPCA 5GAHi 2YV4A 4IM7A 5ELLA 2C95A 1N9GA 1TNDA 4QEDA 3RTEA 5AJTA 4TSFD 1D03A 1MJFA 5IUJC 1QYIA 2QXUA 3N6VA 1Z8FA 3HGQA 4X4HA 3RUHA 1FX1A 3ICVA 4G24A 4GZLA 2HHCA 5F5NA 1IY8A 3CN9A 4CM5A 4YDQA 4OJTA 1XAGA 4CMJA 1FBNA 1GTMA 4CTMA 1EUZA 3ST7A 2OYRA 5FL7A 4TYMA 2XHEA 2WF5A 4DN6A 3PNLA 3MJRA 5T4BA 3OEWA 4RBNA 1FUEA 2EKQA 2EJVA 1KYXA 2YFKA 3IAM1 3AOGA 4YAFA 1UBJS 1CKEA 4OKIA 1KYVA 1ODJA 4GSYA 1ZN9A 3T1OA 2CLDX 3GJZA 3TPFA 2OGUA 2QW8A 2Z4SA 1OHHD 4NAHA 4NF2A 4GVPA 2QTFA 5HK9A 1OXUA 3COJA 3AUAA 3DHYA 2AI2A 2FEOA 3AO0B 7YASA 1AGPA 1JA0A 2M1ZA 2FPMA 4UM5A 3HVKA 4I4LA 3BTSA 3H5WA 4JOBA 5HF8A 5PGMA 5CBPA 5AIAA 3S81A 3O5AA 3SXUB 3M6AA 4WZBE 4RSHA 1AA9A 3KB2A 4RD1A 2I03A 1NOJA 4OA5A 3VGPA 5L45A 2GN2A 1GFZA 2VN8A 5ERXA 3EFOB 4BU1A 8ATCA 1UMKA 1R1DA 4MUBA 3ISVA 3DLTA 4XAQA 1MAHA 5GPBA 1DBIA 1UKVY 2KWIA 5A62A 4WCFA 2OBMA 1IC8A 1KDTA 2BF7A 3GOQA 3MBIA 4GPIB 4Q9IA 3T3OA 1LZLA 3IDZA 3U61B 4OYLA 1GTVA 1ZD2P 1AQUA 1XTVA 2A57A 4C5CA 3DLCA 2BSXA 3A9UA 1DC6A 2FVXA 2PL9A 2YL2A 2QSJA 2ZTVA 1ZM2A 2IL1A 1F2VA 1GRVA 2WB4A 1F48A 5IUKC 3ZI4A 3MN1A 2BZSA 1XCGB 4RSGA 1C4XA 4ALMA 1WLSA 3NLLA 1RC8A 2GZ3A 2PMCA 1NN0A 3DMGA 2DY0A 5THXA 2ZM6B 3FPSA 1XWFA 3O4JA 3ZDRA 4Z54A 3T1HB 1VL0A 3NU1A 4ECAA 2HT1A 1RJEA 3IPAA 1L7DA 4DE8A 1VB5A 2D6FA 3RIEA 2DSNA 4OKNA 5AI6A 4C3ZA 3GHHA 4W4TA 1P0FA 4K05A 1V9SA 3O1HB 1KSFX 2XB6A 3F8WA 4G3XA 4OHOA 2V8BA 3PSAA 2AXNA 3ROZA 4MI9A 3VOTA 4BFTA 4EUKA 1UINA 3MLEA 3K6RA 3O92A 5GONA 2RBGA 4FMDF 3MUEA 1QH0A 1QIIA 5ECGC 3KKZA 2IYFA 4N5NA 3NNDA 4URYR 3P97A 1G64A 1VCMA 3IQFA 4J0EA 2XOKA 4HNSA 5B64A 5C52B 1DQPA 3QEMA 3ROFA 1VLVA 2FXVA 4I9FA 2XNSA 1ZD5A 5LM3A 2CLFB 3HPRA 4LAFA 3HNOA 5EKSA 5F5LA 1SBIA 3W9UA 4HBZA 2AW3A 3N6RA 1JQBA 1ULUA 5BSKA 4LYJA 5D84A 1YZLA 3F90A 3KQSA 4PYMA 5KKAA 2H1SA 7REQB 2NQTA 2OC9A 5DM0A 1MTOA 2FSPA 1IN1A 1F4LA 1C9YA 1Z68A 3I9JA 4RXTA 5EMMA 1JHOA 4R6XA 1K8QA 1YAJA 4ZI2A 2VQ3A 4L8FA 3EA0A 3B89A 3OOYA 5A6SB 3G59A 4GXRA 2IUUA 1NW3A 2BONA 3BM5A 1A50B 1NRJB 1U9IA 2W6IA 2XMQA 4XTCS 1AA6A 2OWDA 4BKRA 1SK8A 3JVVA 3IEKA 3MJCA 1OBFO 2BSAA 2BNOA 4S2EA 2RGBA 3HP4A 4DILA 2FX2A 5JSUA 1C3VA 1RZRD 1A4IA 2I4IA 5FWYB 5TRTA 2ZJOA 4A8TA 4G5FA 5EEGA 3VVBA 3CPJB 3IQDB 3LYLA 4UNSA 2E6KA 4F9FA 5ARBA 4L76A 3NJ4A 4MKZA 2O3JA 2X8JB 2X7HA 3AERB 1NM5C 5F2KA 2W70A 5JYCA 3ASUA 4QVKA 4I14A 2YJ4A 5TE9A 3TQFA 3EZXA 2P9FA 2NYAA 2WHYA 1R0SA 3HKDB 1Z63A 1XTRA 2P8SA 3ABZA 2X7XA 4EKYA 5IASA 4HP8A 2QRLA 3MWJA 5I45A 2C7BA 3EIWA 1P4JA 3B6JA 5CDSA 4IJ6A 2BISA 2Y6UA 1CY0A 2RHRA 3ADKA 4QPNA 1SKAA 3U1BA 1ORWA 4LOKA 3IRVA 4X20A 3B1KA 3A9TA 3H99A 4V0ME 4OM7A 3DM9B 2C8VA 3HSSA 1LVUA 4L27A 2C57A 4HH1A 3CH6A 3R7DA 4AX8A 4C6TA 3CJRA 2ZJ3A 4L9WA 3FLBA 1DFHA 3QUAA 1N2HA 1N2GA 5DYNA 1WJGA 4ETMA 2CN1A 4EX7A 3I8XA 4Y3UA 5JBIA 1H8EA 1NOIA 1VLJA 4IMIB 2GLTA 2P30A 3L41A 2A94A 3NROA 2WLTA 3IURA 4NBTA 1ZNQO 4XB1A 4WT7A 4IV5A 1DMRA 2OHXA 5KQPA 2O4CA 2I22A 1CUAA 1PE0A 3FOAA 4GP7A 3HLYA 2AI1A 4WHMA 4XPIA 3ZWCA 3DMFA 1W8IA 2O2XA 4TRNA 3AKYA 7GPBA 1Y1PA 4HS9A 2CEKA 1UIMA 2WUGA 3QQPA 4RK6A 5IVIA 4LXHA 3KYIB 5G40A 2PSHA 2H17A 1P72A 2B78A 3WXBA 3G5GA 5HTOA 1AHIA 1N36B 2ZT5A 1N7IA 1T6YA 3ZIAA 1KI7A 4QTTB 1LNQA 2FZGA 1QKKA 3CZPA 1VCHA 4QARA 1YZUA 2FNAA 1DFIA 1GVNB 4K8RB 1E3QA 2GASA 3I8SA 4X20B 2F7SA 2NUAB 4ZALA 3R7WB 2QUKA 2CSFA 4GT1A 1JG1A 4YRDA 3BHIA 1V26A 4TXHA 2ZQZA 3U26A 3PFCA 2H4JA 2B8WA 2WF8A 3L43A 3R0XA 2YVLA 4FS3A 5IJAA 3B5EA 3BQMB 3ND7A 4DDVA 2XY4A 4M3NA 3HL4A 4XVQA 4S3MA 2ESRA 4R9VA 2JB9A 4URZR 1WL8A 3PUZA 5BWOA 2B1RA 1M6VA 1BGXT 1OWOA 3HA5A 3FX2A 5DASA 4BP9A 5KCZA 5KTRA 2GO1A 2HFJA 1W0JA 2WUEA 1SIWA 3KPWA 3TGWA 1ISIA 1AKRA 1MRSA 2ASVA 5E9WA 1B2LA 1ZX1A 3HHEA 3FMPB 4LDPA 4C7VA 3ERCA 1CYEA 1SC6A 3I2KA 2JJQA 5L7WA 4CPDA 4AKHA 4DREA 4YAOA 5LXTA 3KC2A 2ES4A 4HRVA 3VZQA 3CWZA 4X90A 3K1TA 1R9MA 4BAUA 4POAA 1BFKA 4A2WA 3C3DA 2BGLA 1U0RA 2QM8A 5KTOA 1TL7C 2XGJA 4QTUB 5I7RA 4N6OA 4UDYX 2BR5A 3BH6A 3FI0A 1DIHA 1K8RA 1OC4A 2HY7A 3QNUA 4N8EA 4LI0A 1PVDA 4DVJA 3RVJA 4YS6A 1Y8QA 2PXVA 1R0RE 5DULA 5JALA 5GINE 4RHFA 1I6MA 4RV9A 2O05A 4BLOA 3EIUA 3CNQS 3IHWA 4K9NA 2JAOA 4M0MA 1U0OC 3GZDC 1UT6A 4GYWA 1N9KA 3RSFA 1X9IA 1D2EA 2HU7A 3SIXA 4DF3A 4EJ6A 2FWAA 1JYEA 1G8YA 1VG1A 3CLTD 3G2NA 1V4BA 3QKRA 3F8TA 3LX4A 2B7CA 2PH5A 3U13A 3MCZA 1YQXA 3CUUA 4BKMA 4WV3A 3WL7A 2LDBA 1PQ4A 2IP2A 3A37A 2H1CA 5BOSB 421PA 4RPCA 3L4BA 2BTQA 4L5IA 2CD7A 2RE8A 2BR4A 3GVPA 1HQ1A 2W2TA 2GXUA 2CXPA 4K9MA 5CX1A 5KOYA 1AH2A 3UVEA 1IBMB 3NHWA 3HN6A 3KJXA 4IJUA 5DXFA 5FNVB 1QPZA 3H1BA 1BQ3A 2X15A 4OK6A 4N03A 3KZOA 3FNRA 1SHTX 1E62A 1RQNA 1S1MA 1NKTA 1SURA 2QN9A 5ER9A 1PL6A 4OB7A 1FTSA 4QUGA 1HSOA 4YY3B 1XTJA 2EGUA 2J6BA 1Z56C 5AFSA 3OX3A 1AK9A 1RM5A 1U3DA 1Q95A 4CM9D 3HRIA 3LHIA 3IAEA 4ARCA 1B93A 1HDYA 4KWHA 2JCVA 4NVRA 5C1OA 3QEAZ 1JMKC 3SNHA 3CLSD 5JAHA 5FQOA 3NYIA 1VHLA 2PT7A 3PV0A 5BT8A 2HEIA 3T7JA 4EGAA 1WTAA 5ICGA 5TF4A 1YJ8A 4OG2A 3R7SA 4B33A 1YRLA 1C14A 3CBGA 3THYA 1DAPA 2HBRA 5IP5A 5A4KA 5I4IA 1A9OA 2Y66A 2ZTUA 4D96A 2BELA 3OHPA 4MHTA 1EG2A 3HUUA 3QLTA 2M6LA 4Z6KA 3JAKA 4KP7A 1KVRA 2EP5A 2PKRA 3FB4A 1DC8A 1UDXA 3CIOA 3OE5A 4NQRA 3SLKA 4TUYB 1BYUA 3WNVA 5B2FA 1RRMA 3EG5A 4HNVA 3DBRA 4PYQA 1NRXA 5C3UA 1GZ4A 1YTUA 4DEVA 5ADHA 4F2GA 4BVFA 1MW8X 1HNWB 1HG0A 1HH4A 1SUDA 1YR2A 4L5YA 3H0EA 1CY8A 3GUYA 4CG1A 4YBRA 1TJ5A 1AN0A 4LX0A 1BHO1 3T41A 1VCOA 3N2KB 4IWYA 2FHSA 4LHVA 3FAKA 4GM4A 4L8WB 1OCEA 2YJZA 2O2ZA 2HPVA 3PITA 4LF8B 1Z0JA 4YQFA 5HZMA 1SM4A 2OCXA 4RFVA 5I3CA 1BIFA 1YCFA 1Z06A 2OM6A 3DONA 1P4HA 3O84A 5C80A 4RTLA 2P2DA 4MMZB 5B2ZA 3P0HA 4QZVA 4M9XA 5K0FA 1X1TA 1IIBA 2F9LA 3GZCA 3U3RA 2X9QA 1DJOA 4DPMA 4AWAA 2PMBA 4MAFA 9LDTA 2C5HA 3WISA 2H7CA 2W58A 1R2QA 16PKA 1PQWA 3ZD7A 5KOJA 3SYKA 1SXPA 1QC5A 1WHSA 2P9JA 1P8JA 3GCGA 2JNWA 1ZUGA 3GN5A 3UN1A 3JAKB 4I8TA 1R4NB 2DC1A 3C8MA 3D6UA 4G1EB 1KF0A 4KVAA 5DCWA 1T5BA 4JB8A 3S0JA 4F5DA 4Z5XA 5C2JB 3ZUGA 4OFZA 2I4RA 2ZS7A 2ZVJA 2PXDA 3PRJA 1MRZA 3VR6D 3ZYZA 4CLOA 1QCDA 1CUGA 1NMYA 1PHRA 4WI1A 2Y2VA 1NFRA 2PX8A 4F6LA 3ANSA 3KLOA 3LRPA 5ALOA 4BUZA 1J8FA 5L7TA 3EVAA 3IAXA 4C2TA 2CYBA 5D5HA 5FLKA 3FYAA 4DLKA 2XSZA 3ZOKA 2RG1A 3HGTA 4FE3A 1MEEA 2QTWB 3MRTA 3NR2A 1KZ4A 3FPLA 3LUAA 4LEIA 2Q4TA 3UV3A 1IOZA 1NR7A 4I3HA 3ZX5A 1A2OA 4E33A 2B2XA 5IJ0A 4X85A 4G4SP 3DAYA 4PPYA 3EQ7A 4EHLA 5C8YF 5JECA 5M04A 2AFVA 3O4RA 3RVSA 5GONB 3VPSA 3OLVA 5DWVA 1G2OA 1YB6A 3O1JC 5JS8A 4FR2A 3RM3A 2VOJA 5DT2A 2D2VA 1RWPA 3KUDA 4D74A 1E0JA 3TQHA 2R60A 1PR3A 3DNMA 1T2CA 3E81A 2FQXA 4M6WB 1CP2A 3JYPA 5JCZA 1YK1A 1B41A 1KPIA 3JQGA 4P33A 2HW8A 3LDFA 2R8PA 4MVJI 1GT91 3UMSA 2O8DA 2RK4A 1BKSB 4RH3A 3PX2A 5IFKA 1F0PA 2ISCA 1WE2A 4MKRA 5FBZA 3SX0A 1GYRA 5LQUA 3D6FA 4WOCA 4AXBA 1U2DA 1X1BA 1QQAA 1GPAA 3DTNA 3PIDA 4HN9A 1L6IA 5B4TA 2OXTA 1LBHA 3T9AA 1OX6A 2Z1NA 3FUXA 2Q8PA 1IC6A 3X1MA 1DRUA 4PYJA 2FZKA 1KVSA 5A6SA 3PGKA 3TF5A 3AHHA 1OQAA 2GXQA 2WJGA 5GWXA 2JZNA 1EJBA 3CZAA 2P9HA 1L5VA 4DHEA 4I6GA 3EN0A 1ZBDA 1Z2AA 5DN9A 3G9ZA 3REQA 4ERNA 2BJCA 4OL0A 4LBZA 4B0OA 3MHTA 5JJCA 1B3BA 1P9LA 2C00A 3QOXA 2XRYA 1A76A 1BDJA 3AIIA 1PX2A 3JASA 3M8KA 3LGXA 2E48A 1VP3A 3AERA 4QU0A 5HJEA 1L7BA 1Y1RA 4Z7QB 4PC1A 1J2UA 2P9YA 4PZUA 4B83A 4D9MA 3I5YA 3MSCA 3HBJA 3PG5A 1CJGA 3MW8A 4X97A 5BVHA 3URMA 2BNNA 1Z4MA 3ONNA 2VJQA 4Z0TA 5E1DA 4MVWA 4PFSA 2DEUA 4OBEA 3WFIA 4EG6A 4KQ9A 2VHXA 2WJZB 1JEQA 2ZUDA 4GWGA 2X4GA 3LV8A 3O8LA 4HX2A 1G3IA 3FFAA 3LHKA 4KSYA 1PJTA 4PQEA 1L5RA 4KI0A 2ACVA 5DNWA 3V2HA 4A16A 2IS4A 4EG3A 1YV9A 4PGMA 4H3HB 3WAJA 2AKAB 1NXTA 3DFUA 2FOXA 4FHCA 4ZO7A 1P3JA 4RL6A 4TV8B 1ATZA 1NMQA 4JCCA 3KYDA 5EGSA 5HOEA 1TU3A 3V4PB 3AEQA 4G65A 3AU8A 4HADA 4V03A 2GAAA 4ARZA 3E9RA 3K4HA 3TSCA 3AY6A 3A11A 4AS2A 4DRXB 2X8AA 3H83A 5DCYA 3ZHZA 1JMYA 4R51A 2VRCA 2ZDQA 4A7PA 2OLKA 1SVSA 1WCXA 2FE1A 1FMLA 3DOFA 4JDPA 4PZPA 1FMFA 3DPUA 2UAGA 3FMYA 2WA2A 3OEHD 3C5VA 4L16A 1L5LA 2DWPA 1CQWA 5A3RA 4QBTA 1FOEB 3CWQA 2NXJA 1SD2A 4TWJA 1C7JA 3RSHA 1UBLS 3I61A 3B85A 4JFRA 5HZKA 1ZRNA 1BXRA 4U9IS 3UKDA 5ADWA 2XITA 5I8PA 4MINA 3B7GA 3SZMA 4ZCSA 3T3MB 1ST3A 5DRTA 2ZE7A 2YWBA 2FEMA 4FIZA 2A9KA 3G23A 4UE2A 1RRCA 1ZVVA 3SU8A 3F73A 5D8DA 1WF3A 2DVMA 5AI4A 4B3RB 1Y1LA 3WNDA 4U2DA 4WLNA 3PR2B 1R6DA 4H1TA 1GNVA 4YARA 2V54A 4FZRA 4K9KA 5AXBA 5AJUA 1RLTA 1E3IA 1SU7A 3CB4A 5JNWA 1M8JA 1Q12A 1I4TD 3NP9A 4ROTA 2BEKA 1UJMA 3IA2A 3BAFA 4U39A 1JR4A 4EY6A 1EXDA 3ZCSA 3I9FA 4C29A 2EAUA 4DPKA 2I9KA 1NR5A 1SUPA 3KQHA 2ZR7A 3BIXA 2FMKA 1P31A 3BD6A 4EJSC 2UYHA 3A2KA 1FZTA 2PS1A 4M8KA 2JIQA 1XZPA 4IQ8A 2MHCA 4KU4A 2RHOA 5EWJB 1N5OX 2VHUA 2QZZA 2PNJA 3L0CA 2FOLA 3G2OA 3SSMA 4B46A 4F5ZA 5LMZA 4GOXA 3AEXA 3H9BA 4MWBA 1FDVA 3QLEA 4RY2A 2VUTA 1QIEA 3A9XA 4P3PA 1ULZA 1E63A 5FBHA 1BXRB 5ESXA 4UTNA 4Z9XA 4O2BF 4MK4A 2F1KA 5FBQB 1E99A 3B1YA 3LCCA 2O07A 2BZ0A 2R85A 3ONFA 4C43A 3BHMA 2D4AA 5JXJA 1NE7A 3V32A 4TLDA 1TXGA 3GVIA 4MI3A 4AG5A 4RKYA 3I32A 4HWSA 2ET6A 4DIKA 5KNBD 4UU7A 1B8OA 2CVHA 2P90A 2Y1LA 1JQEA 3KR2A 1ENOA 3QBTA 4LSWA 1KE2A 4ZCMA 3PYMA 4B76A 3VVLA 2A6CA 1WPXA 1C0IA 1N2IA 3MEQA 3NAQA 2V3WA 3D31A 3NEJA 3RROA 3HUTA 2PAAA 3UV7A 1GRRA 4ZYYA 5C5IA 4LTMA 2B0CA 2FRDC 5KHAA 2EWVA 2HRBA 2VK8A 3MJEA 1JTVA 4DDUA 1JQAA 2HJHA 4D4IA 5B3JC 1H5UA 4NI5A 4UZSA 3VZSA 4OHKA 5CYPA 1RIFA 1XEWY 4CL8A 1L7QA 3HFJA 1AUOA 5IKMA 1B8UA 221PA 4GYJA 4LY6A 1YBHA 1E1RA 5JJ5A 2K2QB 4CKYA 3SZUA 3UPDA 1HSZA 2D0DA 1GSHA 1UZAA 2PV7A 3OT1A 4H1HA 1W29A 1C8LA 2KJQA 4PM4A 3DO5A 1NSYA 4ZO9A 4DSTA 1IHDA 2FQWA 2O5CA 3LZCA 2BEVA 4OLAA 4JP2A 1TCBA 3MCTA 3TUIC 3BGOS 4H77A 1I4DD 1V5EA 4RDHA 3X3HA 4PS0A 2IUTA 4DQLA 2NXNA 1VCNA 3AY3A 4QNMA 5HFJA 1FVHA 3BCHA 1UKYA 5BSTA 1MOSA 1ZK1A 3CE6A 3TINA 1TB4A 1OXKB 4U2FA 4YJ3F 1MQSA 3CB2A 1YRBA 3AFHA 1F2UB 3RFVA 4JLBA 2GK4A 1IQRA 2HAEA 4OLFA 1YD7A 4LYAA 3OJ0A 3ESDA 3O90A 2Q50A 2XUAA 3GLHB 4DEXA 2I2AA 2BFCB 1PT6A 2GPNA 2LXNA 1W93A 4J1TA 1BO6A 2OB2A 3D5TA 4PPGA 1ZUIA 4TMFA 2VP0A 6PFKA 5MN5A 1IMOA 3A1VA 2GHQA 3U0VA 4CL0A 1MJ5A 2UUCB 1BWQA 3E7XA 1UQTA 2PFGA 5K3CA 3DMNA 1G2QA 5A2QA 1LV8A 1XNHA 1SCAA 2IX3A 5BRAA 1Y3FE 1PFUA 3FHLA 2XVMA 2HSJA 3H9EO 4MUGA 4JU8A 4KE9A 5FPHA 2KSQA 4FOPA 2IEBA 2CDNA 2YMLA 2C83A 3I6ZA 4O2RA 4NYMQ 1WCV1 2XTAA 4RGVA 4KRGA 3F6RA 1CYDA 5EVCA 2G0AA 4XB2A 2XMCA 1Z7WA 1GAJA 3OLWA 4PO1A 3WVNA 5BR4A 1H2YA 5AVSA 3IOEA 5GGXA 5J40A 3W7VA 3VISA 5F21A 4L9AA 4WA8A 4B3CA 2PTGA 3QITA 4BJ6A 3M1YA 3ACCA 4MWTA 1VI5A 1R37A 1R8YA 2DLNA 4H7IA 5CDFE 5LP6A 1YRAA 4GMXA 5EG5A 3IXMA 3LUHA 2IV2X 3TOSA 5IZCC 5FPQA 1QKJA 1H2RS 1W76A 4JBIA 2XR1A 4H7FA 4X1KA 4KWIA 3BL8A 3I76A 4RNCA 3ICEA 2WHPA 4GOJA 1IE3A 2JW5A 2VO1A 3CRQA 3INYA 4MWCA 4ZZ0A 3PNMA 2AMJA 5KQSA 2ZKLA 1IJEA 3ASZA 3WL6A 1TM1E 4O8CA 4XGNA 1KMNA 2PRJA 3SXJA 1JJBA 3D1JA 5CFOA 3DGFC 4MULA 2R6ZA 3RC8A 2OCAA 3K6KA 3PA6A 1D4OA 4JCYA 1ZK2A 1OH7A 2XDAA 4PFKA 5IAGA 4LW8A 4X00A 1XZ8A 4UHDA 4A1FA 4MXDA 1XMSA 5EJAA 4C21A 1J90A 1SQGA 4X7PA 2A9RA 1FU7A 4N5MA 3UJBA 1QIFA 3V8NA 1CRPA 2TYSB 5IM5A 4HYQA 4PZDA 3S8EA 2ERXA 3R24A 1J0EA 2Y0BA 2GILA 4DSZA 4W5TA 2R6HA 4YCLA 1DG1G 3GJ4A 3IP9A 4CMGA 2HJWA 5K3AA 1N3YA 3KPYA 1W5FA 4II7A 2AOTA 3PJDA 3R8CA 1GKLA 2NVOA 1EGHA 1Y7IA 3A1NA 2Z2ZA 4GH5A 1M1YE 2B99A 4HAYA 4U3JB 5DISB 3VOSA 2GQ0A 4UUPA 4EI8A 1I7SB 3LYAA 1SXIA 2I6UA 2IOFK 3HKEA 1A1VA 1HTBA 5B57C 4G5SA 3R23A 4PYRA 2AQKA 5L3RA 1S9DA 1WNFA 1AUPA 3ZBPA 4RZHA 1AXEA 6ADHA 4MVJP 5L6MB 2OCGA 4K9QA 2XA2A 2X13A 1ACMA 2WV9A 3NH6A 3JQ9A 2FHPA 3K8ZA 3O2NA 3PLNA 3Q41A 4MQ4A 2RHMA 4XVUA 1I5OA 3RS2A 1QYXA 4Q4AB 1OTXA 2XCUA 1T3GA 1JJ7A 1VRVA 1C1XB 4X4GA 1FX0B 3RSOA 1KFEB 3V97A 2W6JD 3LVQE 3RHTA 2WTMA 3FTEA 1U11A 3NORA 3QWAA 3W1VA 5TR9A 4W5JA 4RS3A 1YC5A 4WJZA 3KCQA 1NY5A 3ZU6A 5DWQA 3MA0A 3ZXIA 1E3TA 4MS3A 1KI8A 1RXVA 4Q1EA 3RZZA 1FFDA 5BPFA 4I46A 4XYLA 3ADDA 1NURA 1CZRA 3OECA 5C7IO 4I1OA 3JR3A 1JEYB 1IEQA 3I1IA 2C31A 2IYVA 4TXJA 5SZKB 2G5TA 2Q2OA 1RFLA 3EEQA 3OIGA 1T1JA 1G20B 1S2DA 2GM3A 3GLVA 3P2JA 1I7LA 5BRNA 4MWZA 4BLRA 3AR7A 1N1EA 5BVHB 2I2FA 4YLGA 1UM9B 4TTVA 2B98A 1JJIA 1R4MA 2OBLA 2PSFA 1TUEA 4IG4A 2E5FA 3UC9A 1NW8A 2WWHA 4ZIRA 5LQAA 3LLUA 3HFSA 3F7TA 2CXHA 3MCAA 4I4TB 1B14A 4MYDA 1AOXA 2DHCA 4B2IA 1IZ7A 2ZZNA 4HQNA 1W0CA 1FX0A 3KRTA 3C5EA 1JS1X 4WOBA 1CIJA 2R7NA 3QF7A 1QK5A 5A7HA 5ITZA 4G8CA 3Q8XB 1JLRA 4MLPA 3ZU3A 1ZJZA 3A6PC 3U60B 1IEVA 2VDWB 3MB8A 2X2PA 1C0EA 1R0LA 2XMRA 3CR8A 3HCBA 3PC4A 3VAAA 3S1AB 4EEKA 1JJVA 1QP0A 3IP8A 2QUZA 1JB9A 3KR0A 2IV3A 4KR9A 3LUFA 4UPEA 4GBGA 3E9NA 4IH1A 3ZC3A 5COAA 1DIAA 2C1ZA 4FQ8A 2WIDA 5DB4A 4WACA 4KH0A 2G8NA 4P53A 3ORRA 3RS5A 4X66B 4KWCA 2YS7A 2FMXA 4R0MA 1V3QE 4PQGA 4PFQA 1E77A 2WMNB 5KYTA 5FOTA 5TGDA 2YDYA 3CZ4A 1WP4A 3NPAA 4GD3Q 4BVAA 1ID1A 3JVUA 1NNI1 2WZQA 4FFOA 5GJBA 3K05A 4HJRA 3TMYA 4LGYA 1EK1A 2WSLA 2VFAA 1ADFA 2I0FA 3DEIA 3ELWA 4IDGA 2D5BA 3BMOB 4P81A 1BH6A 4JWKA 1VXRA 1Z0IA 1GSIA 1WRBA 3KJEA 4LMPA 3NG1A 4HQRA 4DJDC 1XZCA 1EVJA 4JC5A 1GCOA 1CQXA 4H59A 3SYMA 5CM9C 3HBNA 2GVNA 3QF4A 4FVTA 1T4GA 4OHZA 1DC5A 1NV8A 3TBHA 3UJCA 3VM6A 4DWJA 2FZCA 1T0PA 2XPCA 3CF2A 5ALJA 4C0WA 3AK4A 1PGJA 4IKPA 3C97A 1XN4A 2AXZA 5EIBC 5CW1A 3ZDZB 3U6BA 2ETVA 2WU8A 3QMMA 3TS1A 4LWZA 4KIGA 2HWWA 3R7WA 3ACDA 5K8VA 2BFNA 3WGMA 1DOHA 3P27A 1QDLB 1TF7A 3K6SB 4JYZA 3JQ9C 1F1BA 1P6XA 2AGVA 5JSZB 1ACJA 4FDAA 2EBHX 1XP5A 2O2IA 3B6MA 3AVQA 3IIEA 3KDPA 4ZV7A 1YQ9A 4ZMSA 4G9BA 4K6MA 5F4ZA 2GD2A 2AT1A 4IDHA 3J81k 1Q2UA 4FQ5A 1CJUC 1DFGA 4MRSA 3D8UA 2NSHA 2HZ7A 3OIWA 3WKAA 1V0JA 2QMOA 4IEEA 4UUNA 1XPJA 3LFHA 4O4JF 2D7DA 4TT3A 4YRGA 4C6SA 4IUBS 4MCIA 3JU3A 3R0QA 3ESYA 1MV8A 4NAUA 4HB2A 1LJLA 2H5JA 5KHOC 4KAXA 4AI6A 4PPQA 2O8NA 3COPA 1A9RA 3E82A 2O2CA 4MCAA 5KSPA 2NM0A 2NWQA 1L3CA 4K0RA 5KREA 3TJRA 2P1ZA 2GVZC 2OCLA 1DG9A 4LXYA 3QJGA 4C5BA 3HDQA 4Q3OA 2WUWE 3E48A 1NF2A 3WP0A 1AMOA 4N0EA 1ZM4A 4W1QA 4BYGA 4JLJA 2VHTA 2A5YB 2P91A 2PKYX 1E4EB 1CRQA 1JSCA 1VC2A 1RWNA 2FSGA 2MTBA 3HWX1 3O4IA 5DCLA 4BO9A 1BCRB 4FP9A 5ALIA 3N0TA 2DFVA 3KG2A 4L4RA 4ZTBA 4BVHA 1ODCA 3IP7A 4Y7DA 1SZCA 1D2RA 1D2AA 1M66A 3SQDA 3U4DA 1YB4A 3W4IA 3W8RA 3OPQA 3IGFA 1BGWA 2I33A 3HWSA 4NNOA 5AK4A 4B0PA 2NU6B 2Z56A 4BE7B 2WWTA 4AG6A 1CQIA 1QS0A 1QTQA 2W2LA 4LHXA 3DV9A 4PXYA 3DOJA 2Y4OA 1QMGA 2H4HA 3ZHCA 3D6MA 4I6RA 4ZZ3A 5F23A 1Z13A 3RG2A 5SZHB 5KPDA 5LJIA 2RHHA 3DL2A 3VPHA 1SIOA 1FK8A 3KT0A 3ZEAA 2QR2A 4G23A 2WOJA 3PE4A 1SA0A 3ILHA 3PQ7A 1VJRA 3EXFB 2ZIFA 4OOEA 3KJNA 1DX9A 1L1EA 4R71A 3R9XA 1AURA 1Q7TA 4E7PA 4D57A 4L57A 1SULA 4MRPA 5KJ6A 3FHCB 2HCNA 3ROTA 3UXEA 3K1ZA 4EIWA 1MENA 5AJVB 3GX1A 4A36A 2UYQA 4UHHA 4Y6RA 1DCKA 4JS0A 1D1PA 3DHVA 1GT6A 1OV6A 1HDZA 1K7YA 1E8DA 1FP7A 1TJ3A 1Z5VA 2BLLA 3V4VB 3ROEA 1D8AA 2FW0A 3FUWA 3RT7A 2V7UA 3SICE 2H3HA 1UPFA 4P80A 3T35A 5B7QA 3L6BA 5C5CA 5JAPA 3GEHA 3T5BA 1ESNA 4YRPA 4F7WA 3JTEA 2CD9A 3WFZA 2G9ZA 2PGDA 5FULA 5EJ2A 3JY6A 2SKDA 3GNSA 3W2TA 4O0LA 1LUAA 1K3TA 1UBMS 2JH8A 3C48A 4K86A 3GEMA 5I9SA 5TQVA 2HN9A 1DPFA 1FUIA 2QV0A 2BDTA 4O3FA 2RK6A 2YV3A 3JATA 3TNYA 4KRYA 1H66A 1CQIB 1QS0B 1R8XA 4B85A 4N7MA 1EESA 1OFUX 3SX2A 1H94A 1JZTA 4CG0A 1YTLA 1DKOA 5B55A 5B1IA 1KQGA 4ZFNA 2HQ1A 5BQ3A 1YB1A 1FQWA 3G1TA 3KOXA 1VPEA 3P9PA 5DF1A 1ECCA 5TT0A 3ZLUA 4I6TA 3OM9A 1Q84A 2DTEA 1KQPA 2H4XA 3JZIA 3IO3A 1FSZA 5EKDA 2AV6A 2PJZA 1GNPA 3KTAA 3L1HA 4M36A 4NATA 3FH0A 3O31A 3SF0A 4AX4A 1LQUA 2AWIA 1C3OA 5IWCA 1ZQ1A 2ACKA 2N3ZA 2Q6OA 2WM3A 3PFFA 3G49A 2AH5A 3JAWA 2R65A 3F9IA 1Z5ZA 2C2YA 2IHTA 2AJLI 2CMKA 1FUYB 3K0AA 1QCYA 3KXLA 3LH5A 4E15A 3MYYA 1JG4A 1ISFA 1NVMB 4C30A 2CJWA 2AFIB 2AJBA 3WSTA 3JWPA 2J7WA 1GG9A 4OXIA 2G63A 4U8GA 4YCNA 4LZLA 4XEUA 2WUFA 4HUQA 1CDDA 4ROSA 2ZRAA 4S0ZA 2VDKB 4EA8A 5KJCA 1T2NA 4B80A 5T4EA 1P33A 1QHYA 3DE6X 4XASA 1FYEA 3PIRA 3M6FA 4F2WA 3ZWDA 3O74A 3KBOA 3EIFA 2ZI9A 2YFYA 1MGOA 1OXMA 2LYQA 1PV2A 2Y71A 4I1PA 3DBIA 3H0CA 1DXOA 3NWOA 3FCYA 1AXRA 1HLGA 2EBWA 2NV2B 3I28A 1F6WA 1JRLA 1OFIA 1N7JA 1RYFA 1T5SA 3CNOA 4K9RA 4O2BB 5H70A 1IDOA 3SYNA 5IHPA 4EI7A 2YXBA 2RI0A 3G0CA 2ZATA 3THWB 1JMVA 1IQ0A 2Z0MA 1HE5A 4W9RA 4P3OA 2EW8A 5C1PA 1K5PA 3KHSA 1FQOA 5KDDA 1L5WA 2O4UX 1P17A 2ZJAA 2R6FA 2PZEA 3OVMA 3ZEIA 1FFEA 3SJAA 4KYVA 5M5BA 3D1LA 4ZT7A 2WIGA 5H81A 3PWTA 1P6QA 2QLTA 1AS0A 1KU0A 4HYEA 4TWBA 5BO5A 2Y9PB 4LNHA 4MGIR 1W5AA 3PIIA 3WWYA 3ZE1B 4UREA 4RTQA 2FDXA 5D01A 4KDCA 4PEVA 1W73A 2C8JA 1R5JA 2OVFA 4ZOLA 3N76A 5LOVF 5J59A 5JZSA 1GZDA 1M5TA 2OC4A 4WH0A 5HTKA 4E22A 4GOMD 4UTPA 4X5OA 1FY2A 1ZWKA 3O26A 3EF0A 1YZTA 2P75A 1K6XA 2PXAA 1LDYA 5U4XA 2WM2A 3H11B 4HB3A 4HQLA 1F14A 1ZIDA 1VIAA 3IB3A 4YMLA 5I7WA 2NAFA 4CLHA 4YASA 1MFZA 3BFJA 4HGRA 2PQMA 3SI7A 4V3BA 2VF8A 4AP6A 4CCYB 1C1YA 1LF0A 3YASA 1OFUA 3ZE8A 4GMGA 5AXDA 4M0FA 2BLNA 2P6PA 2WRZA 3BWDD 2PM8A 1FTNA 1Q83A 2I29A 4BC0A 4JI8B 1BWSA 1CJMA 5EZ6B 3DXZA 1G3QA 2I55A 3AW9A 3P8ZA 1KK3A 4J0DA 4HPWA 1M2JA 3FLMA 1T9GS 4I7EA 2WKRA 4NU6A 4ZO4A 3EA5A 5AKXA 1YMQA 5HIMA 3S8YA 3PEWA 3GFRA 2JAHA 3O82A 2PK3A 1GPH1 1OSLA 1QVAA 4NJEB 3OT4A 2QRVA 3IPCA 2WZCA 3IEIA 4OXQA 1DDGA 1KYQA 1VJ5A 2J3MA 4RXMA 4WTOA 3U7QA 6REQB 1FQJA 2CFOA 3NEPX 5CA1F 1GQQA 3RSCA 1XRSB 3GOHA 4RKWA 4YT5A 1H42A 2AK2A 2WSIA 3KOZA 1JH9A 4KUGA 2CY0A 3K9FC 1U8XX 3DYBA 4OXXA 3REGA 1JW9B 2V9CA 3LVBA 4DQVA 4DLTA 1W6RA 4XLLA 3A4LA 3ABOB 5DHUA 4OHYA 1B4DA 2PKQP 4E1VA 3G3EA 3LBIA 3MWYW 4QYXA 4XM2A 5CTJA 4IL5A 2YZNA 4NYIR 1UXKA 3QI7A 3NKLA 1Y9DA 4HRXA 3SR3A 3LAWA 5TVKA 4BRSA 2YMMA 1I4OA 1ENPA 3CCFA 3N74A 4G1UC 5A1TA 3TTTA 4JWTA 3OU7A 2IVFA 1DAKA 4Y67A 4EMBA 5A0TA 6AT1A 3CRZA 4BFVA 2P68A 4LSMA 1Z2EA 1K6MA 5F73A 4FBLA 5FDFA 1GTL1 5ALHA 3NUGA 4P5EA 2E1RA 1SR8A 3PWKA 1MRNA 1VMDA 1AS2A 3H1PA 4TMWA 2MYUA 5JLAA 5CVTA 2P6UA 5INTA 3MYRA 1Y6ZA 1MO2A 2D5LA 2UVPB 2BKXA 2IP4A 4RHXA 3H17A 4UVDA 4QXOA 2HXYA 3I1JA 2IFTA 3G6WA 4G0PA 1M0EA 1K68A 5F3WB 2P0YA 4ODIA 5AVTA 1DWUA 2VQ6A 2ZJ0A 1JA9A 2HDOA 3N8KA 2QVBA 4R9RA 1BJTA 4ASUA 2R751 4DANA 3C7KA 4Z5CA 4U2KA 5T3UA 2H63A 3K3PA 2C77A 1L5SA 2P1DA 2YWGA 3F6PA 3RASA 3AEKA 3HEAA 3JS5A 4P93A 2XWQA 3HEBA 5H83A 4Q19A 1OV4A 3LS2A 1QHEA 4W6ZA 5DI9A 3V4LA 3NJ8A 4HEA6 5I6DA 2VJNA 1SVNA 4X4BA 1MIOA 2ECFA 1Z4NA 3STHA 1CK4A 1L7MA 1N1MA 3BCSA 1ZIPA 4S1NA 4NLLA 4C1BA 4ZYUA 3J81A 3QBDA 4FYXA 2NW6A 5AKEA 2H0QA 4BBZA 2L19A 4REMA 1S3FA 3D6JA 1PR6A 5JH7A 4G0VA 4NCIA 1SXJD 1UMCA 3U9SA 1Y5RA 1RWKA 1O96B 1L8XA 1KAEA 2EP8A 4I4IA 3ZS9A 1GXSA 2XYGA 3TAXA 5EWMA 3AVUA 3A25A 3L0IB 1LEHA 2HDNB 4INPA 3RYTC 1IWOA 2G1PA 4NS4A 5JMTA 5JDCA 1CEXA 2X3YA 2B61A 1T0UA 1CCWA 4NZ9A 1BNCA 2REQA 3CLKA 3KLMX 4PZLA 1ESZA 2LBPA 1SHKA 1K0FA 1O8CA 1ZLYA 4NEQA 4U9HS 1A95A 2IF0A 3VO2A 2JLQA 1U81A 2Z04A 4KREA 1EU1A 3DE1X 1RHQA 5KWSA 3BK7A 2G9RA 2XUFA 1UDBA 3MLAA 2XQKA 3KJIA 3QY9A 3NDPA 3R6WA 4LRTB 3V34A 3RAEC 2FK8A 4MRAA 3I83A 2JK1A 1EK2A 3AHFA 3M0EA 3ZNQA 2O9JA 2E4WA 3AKZA 4JLVA 3ICWA 1DLJA 3A6DA 3KSZO 4KK3A 5E6UA 4D8UA 2DFTA 4MW0A 3WSWA 2XD9A 3L7BA 4UDNA 5JZOA 1VG0B 4IF6A 1I4WA 3R8FA 2PTHA 3Q6MA 3PQ5A 2CSUA 4DV3B 4Q9AA 3I30X 4G0XA 5KOHB 3K1AB 3KZXA 2V45A 2QU8A 1ZEJA 1FPMA 1UBFA 4D4LA 4F2PA 1DBWA 1HXHA 3HDVA 3UHJA 1KBOA 1JQKA 4NJMB 1JT2A 4R5HA 5T4HA 2HK8A 3AZQA 3LBYA 4D3YA 4IIBA 1YKFA 1IU9A 4I1RA 1QVWA 2H5EA 5BSFA 2BHTA 6NULA 2H2HA 2J32A 4G25A 1TVKA 4G0UA 1XVLA 2C3UA 1JHDA 1JHMA 3FUTA 2CF6A 4QLOA 4A2QA 1KTVA 1SY7A 4IYJA 1XHEA 5HM6A 5AQ1A 1T1IA 3DL7A 4YDSA 1XYVA 3VJLA 2BKLA 2P9EA 1A4XA 3DCYA 1ND6A 1NTOA 5TGZA 2FWJA 4HVAA 2YYYA 1XG5A 3CKMA 1KU6A 4YQYA 3DBVO 1HKUA 1D2GA 1KKUA 1T1SA 3RJTA 2AOUB 2PCLA 1HDXA 3GAAA 2FLWA 4ZT2A 5K6AA 1Z4LA 5KYXA 1SAYA 1QHFA 4GXQA 1SCJA 2Y4NA 2VZ9A 1XLTC 4GPD1 1DULA 2JJ1D 3K1AA 5DYGA 3UPTA 1M33A 1ZHFA 3H6HA 4HDQB 4PN7A 1QM5A 2A2ZA 1UBCA 1NYLA 2HFKA 2HBZA 2OM2A 2XCLA 4TLEA 1QPGA 3CW8X 4J2OA 3G5MA 3QNMA 4M89A 5DYIA 3RC9A 3WYDA 1G3MA 2YS6A 4OEHA 1M2HA 3I3OA 3VPGA 2QNBA 5HM8A 2QUIA 3P7MA 3NB0A 5SYMA 1KIMA 2H1LA 1V3TA 2KMLA 2WNHA 3AB7A 4RELA 3UAYA 4EYQA 1CUXA 2VLBA 3GLFB 4PAWA 2ZB3A 1Y0BA 2GTIA 3R9IA 2CWWA 2HF7A 1IY9A 1E1KA 3HY4A 3IE0A 3OTGA 1S7GA 4HDRB 4N4AA 4XGIA 5CU7A 4WJLA 3QLUC 4YAIA 1ESCA 2FUKA 4QG3A 1PBTA 1C0LA 2W2OA 3DFKA 4GSKA 3UTDA 1OSNA 5CT5A 4F9GA 3H1FA 5JYEA 5IVKA 4Y9UA 1ZOLA 2R8YA 5FT9A 3SJCA 3WLSA 3BG5A 3OE1A 1K5DA 4JSYA 4DCPA 1M76A 4ZZIA 4H7EA 3VKGA 3QKSA 3IMKA 2VKTA 3TVDA 1N5RA 5A4MS 1VYVA 1MXHA 1A7JA 2R1ZA 3O8DA 3LMKA 2Q7XA 4AJ4A 2VI5A 2P3LA 3INNA 3VR6H 5HUQA 3C1UA 4CG3A 3OE7A 1JAYA 2HM7A 4NECA 5JVDA 1QYCA 3LD9A 4WZZA 4X8OA 4B7XA 3RK4A 4BP3A 1LDGA 4MV5A 1Q3HA 2ZCJA 2J3DA 1N0UA 2PT9A 1SOWA 2Z58A 5JTUA 4JJAA 4FXOA 2ONZA 1I9CA 4O0MA 1FFBA 1Q22A 5EN4A 1BEZA 1HLDA 1TTQB 1KEPA 3B13B 4KPUB 3BD7A 2XVYA 2RH5A 1O08A 3QQ5A 4QPZA 1X2LA 1GR1A 5G4KB 4QKQA 2RDMA 1ZH4A 4DA4A 2GN4A 1J6UA 3EGWA 3DB1A 4OMUA 4WKPA 2BE9A 5DGXA 2NZYA 4U2GA 1K5GA 3JVEA 4G26A 4ENWA 1YULA 4RZUA 3WAGA 1G16A 1QCCA 1WEHA 1XZJA 2AN1A 3HB7A 1HDGO 1JVSA 1JE1A 1HE1C 3OIFA 4RVUA 5DW3A 1ZL0A 1OXVA 1GNRA 3ITEA 2BM9A 1C2TA 3EVNA 2VQEB 3FNBA 2JBAA 3VKFA 1Z37A 1K8YB 3OQ1A 1JDBC 4RORA 3MC1A 5F33A 1LA2A 4CQJA 5CFRA 2BGKA 1YE3A 2EKLA 1Z6PA 3IE1A 4GM1A 3U3OA 3U3WA 3V3TA 1CR1A 3VTFA 1D8TA 3E9EA 3GCZA 4EEZA 3NUQA 4EGFA 4WW0A 4K2HA 1GCUA 1Z6GA 3FPEA 4YRIA 5A04A 4Y1FA 4MR8A 2JFZA 4CM3A 3L8EA 3CZMA 3MTIA 2ZE6A 3QOFA 4KH1A 4PONA 4IQFA 5AKLA 5UKDA 3VOAA 4CQLB 5BSWA 2OXRA 3KLNA 4FYHA 5G1PA 2ZVDA 4H3KB 2ZWPA 4F2HA 1BEEA 4JXJA 4HT3B 1G8PA 3RTCA 3DQQA 1MQ9A 4RF3A 3CKKA 3AEYA 2Q7DA 1A82A 3O8OA 4M21A 2IBMA 5JRJA 3K70B 2I6TA 3V3KA 2GJSA 3U81A 2ZGVA 1D0VA 1TAQA 4Y1EA 1PZGA 2V5AA 2XXJA 4HLCA 4B9EA 2D4HA 4D99A 1Y1KE 4HQKA 3IJEB 1BE8A 2EDCA 4L22A 4TMYA 4Z99A 4AC9A 1I94B 3IUPA 3HYNA 3CW2A 3KVVA 1YA6A 2JFGA 1I6WA 4C3UA 1RABA 3ZS8A 3L7CA 4ZGGA 3SN6A 1PF7E 2MQKA 4CQMA 3U4GA 1P45A 5JAQA 4CT0A 1TZCA 4JODA 2X9LA 5BPHA 621PA 1VP9A 1P0MA 3SFVA 3DZCA 5MN4A 4KAJA 3UT5B 3WGZA 5KYWA 1PI3A 4JOCA 1WSWA 5D7NA 2PGLA 3TNLA 5GVRA 3HXQA 1DQZA 4BV2A 1ETUA 1ENYA 1ZCZA 5BUQA 1KH1A 3T6KA 1T24A 3WZMA 2QX7A 1Y5IA 4WFKA 1YB7A 1C3XA 4DLNA 3E1SA 5BW4A 1SBHA 2GBPA 4K3UA 1EAMA 4BNDA 4IIXA 4MLZA 3ZV4A 4RENA 3CLHA 4OGWA 2R4QA 2P62A 2ZU0C 1WP9A 3GRYA 3M83A 2UKDA 5DH9A 1IUPA 4K9SA 2V7GA 2VPIA 3LWDA 1U2RA 3UWSA 2CT8A 1QPBA 1S4QA 2RH9B 5B7PA 4E2XA 1X1CA 4ZHQF 4ZTUB 1PR4A 5CLHA 3O73A 4LJ7A 2C7OA 1VYUA 4CEJB 2GVDC 3IUYA 3UWPA 4WBNB 3C4JA 1AQ6A 1O4XA 3M5DA 4PG4A 1VKZA 2NPFA 5K7SA 2Q1XA 4FYYA 4WVLA 2BMDA 1IFXA 1A69A 4YR9A 2JJ2D 5K0CA 4DA7A 2RKWA 2R2AA 1AC5A 4ENSA 3N7AA 1GU7A 4IAOA 4WY8A 5JXGA 3X43A 3UFDA 3G13A 3UMYA 3DDOA 5MGBA 2X3UA 4NBWA 721PA 4IDNA 4NP6A 3PQ2A 2O14A 1UF9A 4HG2A 2FGJA 4EMUA 4BZPA 4Y6QA 5CM8B 1SC1A 1OW3B 1UT8A 1MPTA 1V43A 2DPXA 4H3VA 4KE8A 3O9MA 4NBRA 2JANA 4XUDA 3PPYA 4IS3A 4FWTA 2I3BA 2I2DA 1MVNA 3AIMA 3G0DA 2J0UB 2XUHA 1VIDA 3WGQA 1ULSA 1G2PA 3QBJA 1YI1A 3RARA 1XD9A 2VSYA 1IN5A 1HZZA 3VBCA 2AB0A 1SO8A 4GOOD 2C94A 2VYND 4LYDA 2B1IA 3AL2A 4QATA 4N3GA 4BNNA 4RJKA 3CVYA 1UXIA 4AICA 3QVVA 1QNLA 2KEKA 4JI7B 2NO6A 3EF1A 1I7DA 1VYTA 3W5UA 4XCQA 3VZDA 1U3VA 5JNTA 3ORQA 4WKCA 4KXMA 2EBUA 3EHEA 1O77A 4DRYA 2ZRMA 4AY5A 2ZTMA 4G1BA 1U0BB 1DW9A 3HDYA 2E5LB 4QT4A 1I7QB 1J9GA 1QG4A 5JT1A 2PRKA 3L7AA 2CBXA 1DKLA 2X19A 3HLKA 1J5XA 1ZRSA 2DY1A 3EAQA 1IPEA 3G2KA 1Y6JA 4KNWA 4P7GA 4RDCA 4UNRA 4UXIA 4KE6A 2EBYA 3RS0A 1E7SA 3FYMA 2OR3A 5E6UB 1PJAA 3DP7A 1B76A 4K2AA 4BGVA 1E98A 4FFLA 3V2UA 2QRMA 3FWHA 2X41A 1GA6A 3HBLA 4TS9A 3T54A 1ISSA 3AC0A 2HMAA 1CZOA 3WNQA 1N6OA 1X3LA 2YJTD 2VJMA 4G01B 2ZSFA 2A67A 1ZZ8A 1D7OA 1LW7A 3NHAA 3ZU4A 1P4GA 3Q3VA 3Q7SA 2NV6A 4X44A 1US8A 5CBPB 2YRWA 2A3NA 3MOSA 4FFDA 2O7RA 4QD3A 1L6RA 3SXUA 1J23A 4BV9A 4ZYTA 4HDKA 4BLPA 1BDMA 1YS2X 3P5SA 5TMPA 2PH1A 4LBWA 4XLZA 2QE7D 3X2EA 4PWYA 2DULA 3EWAA 3RYHA 1U90A 3C6BA 5FUMA 3M2TA 4XQEA 1QHNA 3TG2A 3GU3A 2H0AA 2XF8A 3TFWA 4RZQA 3G2PA 1KI6B 2P4HX 4UUQA 4M6WA 2XGMA 5EJ9A 5THQA 1VDMA 1RXWA 5JD5A 3LCVB 5DBEX 2YUIA 4AWXA 4WY5A 5FV4A 4BN5A 2JEZA 3L6CA 3TSWA 5K3FA 1DV1A 5ALXA 2G82A 1G7SA 1IHPA 2VDVE 3IJRA 5I51A 3A2NA 4OQQA 4PV7A 1YGPA 5AW6A 3PPWA 3TQOA 4ES6A 5LXTF 1Q7EA 3VR4H 4K7JA 5KNCH 4BN4A 3LLSA 2P79A 3O9VA 3MLFA 2FPOA 1FBTA 4DUGA 2B5WA 1KO4A 1EUCB 2RCNA 1SUWA 4FOSA 4GRIA 2OHJA 3E22B 3JQ7A 4GI5A 5EXSA 3OQNA 4PO9A 4GG1A 3RREA 3A6HA 3QYPA 4Z58A 1N0WA 3LDUA 1SEPA 3R77A 4UBMA 4JASB 5BWNA 4WFJA 4PG6A 1NXQA 4Q66C 4TTTS 5D7BA 3ZK8A 1ZI8A 3HRHA 4IMJB 3BE6A 1TMGE 3ZN2A 1PW7A 1M0SA 1Z26A 3FRIA 1HEYA 1YC2A 2YXNA 3DDZX 1PX0A 3H9CA 3UUFA 3ER9A 5HQJA 2WSSA 5CJJA 2GSDA 1D09A 2PQ0A 5LWQA 2YY6A 3E8SA 2WJAA 3HV0A 1W30A 2BDEA 1V8BA 2MYTA 2VJAA 3NC4A 3TEMA 5FLEX 2VSOA 4CV1A 3SYLA 2RCYA 4X64B 2PS3A 3EZ6A 3DWGA 3OG9A 2HIAA 3PXUA 1Q91A 4RPLA 3GUZA 4Y2TA 1IG3A 5CNIA 5DBFA 2EKPA 4UOEA 4DB4A 2TECE 2FDRA 5AVZA 2G40A 1NX6A 2BEUA 2AOXA 2DMRA 1K6JA 1SWWA 1THGA 2A4KA 4HLUC 4OSPA 4JL5A 4Q2JA 5I5GA 1YS6A 4UAGA 2UUPA 2RHJA 3SS7X 5C4GB 4C03A 4Z2AA 2HADA 4XFJA 1QV7A 1I7PA 3I5UA 4M1MA 5A7FA 4GU5A 4X8HA 3C3JA 4TTJA 3MTQA 3BTVA 2XKBA 3EXIB 1J5PA 1P5RA 2HRQA 5H80A 3TKLA 1ABFA 3B7HA 1E7WA 3FPJA 5JD6A 1EUQA 3RU2A 1X0XA 4MUKA 3A36A 3LE8A 4IXMA 2C9CA 1Q1QA 1T36A 4IS2A 3E8MA 2OFFA 5JAOA 3OQPA 4MB0A 1XTQA 1P4SA 4IICA 1UPUA 2V3CC 2AL7A 2NZ2A 5AK3A 3U4IA 4E30A 4ZYVA 3M89A 1R0BA 2PX4A 3H4IA 3ON5A 4B31A 4AKTA 3F6SA 3ZXSA 5BMVB 2IXGA 3K8OE 4CM7A 3DH0A 3EFHA 3JYHA 4GFDA 4M7RA 4RD2A 3F7OA 3A6LA 1CX9B 2VWGA 4G09A 3TLZA 2COEA 1ADRA 3FUCA 4XSVA 2FI1A 5EWLA 4MQFA 4TZKA 2JRLA 5KYKA 1FSFA 4RAOA 2XYPA 5LA6B 2BKUA 4LRSB 2YJGA 5LD2C 2I7TA 2D74A 1VE5A 1WY5A 3IFSA 3LNTA 5DGDA 2GUGA 2XNCA 5F2NA 3JPWA 1QIKA 3L4BC 4NYMR 4D9HA 2CDBA 2IZZA 3KQMA 2XJ3A 1ZDMA 3VZPA 4KTTE 2F55A 5F1PA 5EOVA 2JBAB 4J90A 1QJ4A 3JWEA 4NMMA 3AM1A 4GE0A 2PR7A 1GN9A 4IFBA 4WNCA 3DEKA 5J5AA 3ZKWB 2G1UA 1CJKC 1A27A 5TMEA 3IR7A 2C96A 2JGFA 3F6WA 4GYKA 4ZP1A 4D5EA 1AKWA 2VCEA 2OECA 3Q0EA 5LQDA 4LWOA 4RCYA 3SOPA 2BFAA 3CH7A 3U6KA 2Z6QA 2YZ7A 4Q1FA 5HE8A 2V3VA 1YVDA 2ZIAA 4DBVO 4TSKA 5CXQA 1PV4A 4HFMA 4DYDA 2D5VA 1PJLA 3HJHA 2H08A 1PDWA 1JKMA 4CUJA 1XWIA 4OHXA 4YUXA 4ZMBA 5JOQA 1VHWA 3RJ5A 2F4VB 5B1EA 2WAMA 5LYJA 3WY9A 1PJBA 3C5CA 2Q3LA 1VLLA 2BM0A 3QVTA 1A88A 2OHHA 2OFPA 3UCXA 2ORED 3E9MA 1EGAA 4LN1A 3T1TA 4XX0B 3GPIA 1RHJA 4IWNA 3WB9A 3FMVA 4DSNA 2K5UA 4LI3X 4BBAA 3TTWA 1G8HA 1C0PA 3TB4A 5HFNA 5KSOA 3CEMA 3AF2A 2QTLA 1UJNA 5AW4A 1UXCA 4DE9A 1J33A 5AKGA 5FQNA 3RUIA 1Y7LA 1U0JA 2PH3A 4NSNA 1H2EA 4O25A 3ZY2A 3CR3C 1N2XA 1TO2E 2YV2A 3BB3A 3U7GA 2J9FA 3G0GA 1O3YA 3A7DA 4OCZA 3IAS1 3WLHA 3TIXB 2W93A 1A9SA 4WPGA 1AKVA 3IB6A 1EWQA 4FBMA 1AZSC 1YR1A 2R1VA 2AC7A 3E7FA 4LZZA 4R1UA 2XYQA 1QFJA 4UEJA 5EFOA 3U9TA 5KX5F 1H4QA 1FIUA 1DTSA 5C5DA 4DBLC 2COUA 2UV8A 2V55B 1Y89A 4HH3C 1ULTA 5E8RA 5KNCA 3WGTA 3K2QA 1H8HD 1AQJA 1M7GA 3HJCA 1MIHA 3W34A 3WLMA 2N1BA 1U5CA 5LPNA 4GHWA 4OFXA 4JHXA 3FKQA 1ZWLA 2VA8A 1S8FA 3KYBA 5DKFA 4NOMA 5BP7A 2W5UA 1V2GA 3HPQA 2CHQA 2FSVA 4DADA 1D6NA 4QOGA 1ZCBA 2APJA 1XC7A 3DFFA 5JI3E 3LZ6A 4MVYA 1LZKA 2HTEA 3HB1A 4F2DA 2HLNA 3OIYA 2FFBA 3NTQA 3QYJA 5EXEA 1NN1A 1RCTE 2J8ZA 2PXUA 3E61A 2MDTA 3Q72A 4ZVTA 2YHAA 3NDBB 2FGKA 1PDVA 4FMPA 4PHCA 1TVEA 3K1JA 1S4MA 2MINB 3VR4A 1L4UA 5IN5A 4CU2A 2QYSA 1A7AA 3AYXB 5LQCA 4HCJA 5EP2A 2LYKA 3M34A 5G2OA 2BKAA 3S2GA 3SMVA 2H65A 3T7EA 2X23A 1FXWA 4MIOA 1T5LA 1X38A 1M10A 4XA8A 1BE1A 2A0XA 2VHYA 3KLPX 2J7PD 1ZJWA 2AMVA 2ZITA 3Q3IA 2ENUA 2GM5A 4M1SA 3DBLB 3GZ4A 1G3RA 2FJPA 3TOZA 1TCUA 5DM60 4BATA 1CQJA 4Z4FA 1JHUA 1DWOA 4P0QB 1F2DA 2E37A 2VHWA 5EZYB 1IN6A 1U1GA 3DDNA 4KO1S 3TDKA 4WLUA 2R6R1 5K4HA 5EIXA 2QWXA 4ZYWA 2JLXA 3OLYA 3WL8A 4MMXB 1TUBB 2ZREA 2XF2A 3IALA 4B48A 3E7DA 1TIPA 4HDNB 3O4GA 2OCDA 2IOHA 3DVAA 5TMDA 3RRZA 2PBZA 2EZTA 3AP3A 1H23A 5FNVA 8OHMA 4AULA 3ENVA 2JHPA 4NL4H 2G0TA 3T61A 1BVUA 5BV2P 3AKDA 1SXJC 2K87A 3B1XA 4IOLA 4JBLA 1MU0A 1O96A 3JARA 4EITA 3QUQA 5C81A 4RMGA 3U3DA 4HXYA 4JP8A 1I32A 3LRXA 1RVDA 5FWDA 3STTA 3E9DA 1W2HA 4G84A 5FPPA 2BEWA 3SS8A 3UMBA 3IUJA 3OLZA 7AT1A 1XZHA 3PHJA 1H6CA 3I04M 5HR5A 5E2BA 1T4BA 4NHEA 5ENDA 1QH9A 4DJAA 3A9VA 2OHOA 3NAZA 4OH7A 1C8VB 1OIXA 3BD9A 1RWBA 4P3NA 1Q0TA 4EL0A 3GLSA 3VK0A 5IT9A 5CHYA 3Q8LA 4ER5A 2AC2A 2XWSA 2QI9C 2C8LA 3R3UA 2X77A 1ZN2A 3V6MA 5CB4B 5SY6A 2JFWA 4KXNA 5GTDA 1I3KA 5EMHA 2XXAA 1L4GA 3GUCA 3OZIA 4MA0A 3UJHA 1BCSA 2RGWA 4X4EA 5CVCA 2LNMA 3T1VA 3F4LA 4IP0A 2C9MA 4JUBA 1EBBA 3W79A 1CUWA 2H2AA 2MCFA 4J2TA 1D2MA 3TTYA 4RMJA 3VR6A 4EYGA 1RAFA 3DMPA 3DVAB 1E9EA 5D1NA 5IARA 1HWYA 2P69A 5KOIA 1U8AA 4FMBB 3IO5A 2QD5A 1KIFA 1RWQA 5K0LA 3WIEA 5KNDD 5ADUS 1XRNA 4Q05A 3GP3A 2VT7A 3F78A 1U0FA 5FFNA 2QAIA 4M60A 4PG7A 3M6WA 2R66A 1YS7A 4U6NA 1XWRA 3UMRA 1W1WA 1ZVMA 4FLEA 2RAPA 2DWCA 3KUUA 2HMTA 1XXLA 2ZSUA 3RGWS 3ORSA 4QYSA 3BRCA 1TO6A 4OUDA 1FF9A 1XJ5A 3PUJA 2PU5A 4BNVA 3EAGA 3X1ZA 4V0SA 1WDWB 2CUTA 1RE0A 1JILA 1IB6A 1WCYA 3H4MA 4DL9A 1H4SA 3GN2A 2YYAA 2PKCA 2GEDA 1EDZA 2P3OA 3NBYC 2WTBA 4X1IB 1KO8A 2AZ4A 2X0IA 5CVUA 5BW5A 2K7FA 5HRAA 1Z5UA 1E0AA 4PNEA 1IB0A 2ZYUX 4GPAA 1NBOA 1CZHA 4JVOA 4Q5IA 4QOEA 5CB0A 3ZIDA 1J8VA 2ZKIA 1Q7BA 1N6IA 3EJ6A 3HA7A 4MPPA 4MV3A 4Q4LA 3RS4A 1XMJA 8ADHA 3DBOB 2NMVA 5KINB 3EZ2A 3T7CA 1H3EA 5LDGA 3EPPA 2YHBA 2Q6TA 4CZ2A 1C30A 2IEGA 2OFYA 4KB5A 1C9NA 1PS9A 2XT0A 1BA3A 1UPXA 2JGMA 3LHFA 4IV8A 4C76A 2VHEA 2NQ2C 3S3TA 2FP4A 2YICA 5J43A 1G42A 3EVBA 1WZ2A 1E3EA 4OX9Y 1CSEE 5BSUA 1G21E 1GKUB 4Z51A 1YI0A 1BRMA 2D5IA 3OO1A 3FDJA 4R98A 4R40A 2EFDB 2DM6A 2NTNA 3ABRB 3Q0TA 3UJNA 4OAPA 5KNLA 3MWFA 2J59A 4D0RA 4D9NA 2CLEB 2NV0A 1YJXA 1A3CA 3CEJA 3QFCA 1VHTA 1Y6RA 4RC9A 2XCJA 2FXIA 1TYEB 4FCCA 5DW0A 4BGUA 3CROL 2QAGA 3N7UA 5I4KA 4M76B 4Q9KA 2QB5A 2M98A 2EG9A 3QPCA 2A59A 2EFHB 3OIUA 3OTQA 4JBXA 3N87A 4E5VA 2X6TA 3K70D 1GU1A 2QX4A 3ZNPA 3TUZC 3CY6A 1PNOA 4PZ0A 3TR0A 2OCBA 3A7EA 1RTKA 2I80A 2ZJZA 3B1JA 2VDNB 3Q9LA 5B1SA 1Y37A 2WZBA 3D3KA 4EPRA 2NZUG 2W2VA 3INGA 2Q4EA 2ZYIA 4F8JA 1O87A 5JVDB 3ANNA 3NTVA 3QI2A 3BMCB 2D1QA 4CLRB 3QENA 2AKEA 1N57A 1NT2A 1SPXA 2O57A 4X6UA 2R8XA 5JIBA 1KQ3A 1Z73A 2AN3A 3AUUA 4JB0A 4XUGB 3TH5A 2VH1A 3CLUD 1YZYA 1E3DA 2FW7A 4BE9A 3OP4A 1LPSA 4B7CA 4C04A 2MSDB 3MSXA 5HKLA 4RQUA 5IAOA 1JGTA 2B34A 3EOBI 4X24A 3K73O 3OEED 3OZAA 4ZO6A 3KJQA 4PTZA 3D64A 3BTOA 4LGMA 4Q7JB 3WGIA 5LZ8A 1Z6ZA 4K6KA 1Q0LA 1E60A 1Q17A 2ZIXB 1NP7A 3BMOA 3Q10A 4LK3A 4P92A 3B70A 3FTCA 4PSKA 4DJJA 3T5CA 4HVCA 1YH3A 4D8XA 3EH1A 1DO2A 3AF5A 2DKOA 3TD9A 3KZVA 4RW0A 3ICPA 3DE2X 4JN6B 5ALWA 4WADA 3PL1A 1EINA 2XKAA 1IVNA 2JD0A 3H4VA 3AMVA 3PEFA 4MUJA 3RRYA 1Z7EA 4P36A 1E69A 1HQCA 3CLVA 4KMOA 3DNVB 4OH1A 3EGXB 2JBWA 3MJDA 4KQWA 1TAUA 1F12A 3F71A 5JJBA 2XECA 3HZIB 4YCBA 2UXBB 4UFPA 2J9RA 3AUXA 1QZUA 3UK6A 4WKGA 1L2TA 1C81A 2HHJA 4B32A 2BMJA 1EZ4A 1BFDA 3LT4A 4G2TA 4Z8XA 2J4DA 4NXNB 2WYOA 1KXJA 1X13A 1RM4A 2BGUA 2JFUA 4M1QA 4DJTA 1EFUA 4KDRA 1IXZA 1T35A 4L85A 5LSAA 1TF2A 1Q6YA 1LK0A 1ZMOA 4L9RA 4I55B 3NHRA 1OLSB 1I30A 3BB1A 5G4KA 3BWXA 5TV2A 1ZS4A 4XWAA 2XAAA 3V4ZA 3OUZA 3OM0A 1ETHA 3Q7IA 5B3JA 1PWHA 3TTUA 3L7JA 1SG0A 3PD0A 5DTIA 1E18A 3KSUA 2OG1A 2Y8EA 3ZZ1A 4W5NA 3LO8A 2WSBA 4ZT3A 1RHUA 4JY7A 1TX4B 1V71A 3B6KA 4XJTA 1MJHA 1PEAA 1CRLA 4JYCA 4TV8F 2FPRA 2P0EA 2YDXA 1O58A 4E0BA 1AMNA 4YAWA 4Y1RA 2W6PA 2F9MA 4LDZA 3GGCA 1RZSA 1L4BA 2YWCA 3A1TA 4DQDA 1B7GO 3BX1A 3HKBA 4RSMA 4RVOA 1Z8NA 4NDNE 1ZZBA 1EP1B 3C3BA 4I0WB 1T6NA 1I3LA 1ADCA 3QXXA 4ZT4A 1X6VA 1DBQA 1RPJA 2D5CA 2UYOA 4M4SA 1W36D 3N58A 1PL8A 4QBFA 2ZJ4A 3T5AA 2ZYAA 1YIAA 3N70A 2P78A 2G1KA 1VTKA 3C3XA 3L6UA 4IDQA 4EO4A 1QTNA 2B7BA 4HH0A 3O2SB 1WBJB 4MV9A 3SY8A 4C2AA 1QR2A 1VKOA 2IITA 3DW3X 1T9DA 1N2SA 3GGJA 1A1SA 2GZDA 3SBOA 3O4VA 1K2VN 3RVNA 2JLAA 3IQWA 3EX7C 3AWDA 3MT9A 1TA0A 4GICA 4OLJA 5FWXB 3GBSA 4OXNA 1CUCA 2GD6A 2G67A 5DI3A 1M1YA 5DSZA 4V2UA 1H6DA 2XOEA 3Q7PA 1PFGA 3BMQB 5EVJA 4EYOA 2HINA 1CUBA 2F3SA 3CX3A 3HLTA 5HIKA 1CUEA 4V1CA 5TPWA 4ZQIA 4NV3A 1DBPA 4QQKA 4ZVPA 1GLGA 2W43A 3HVUA 4US1R 3C43A 1ZMBA 3K32A 4R8RA 5M34A 4M54A 2EHJA 2K6GA 3B3GA 3K20A 3N07A 1CJTC 3JQFA 3PCTA 4Y9DA 5I9BA 1JAHA 1ONNA 4H7JA 3SYTA 4YRTA 1N33B 1C7QA 3RW9A 1X7XA 2LYRA 3OQBA 4AJPA 4LRYA 4UEWA 3GNLA 4BNGA 1WY7A 4J7CA 1FLAA 3PZRA 4Z9YA 2W6ID 3ROQA 3K09A 3W6NA 1BD3A 1TQ8A 1JG6A 1BTOA 1AU9A 1P5JA 2WE8A 4JLWA 3DL0A 4TMTA 4UNNA 4BMXA 2LIPA 4QPDA 3E18A 3L9WA 5H4HA 3S5UA 5C46F 5JH7F 3DDSA 1AGYA 3L0DA 1OAOA 4URWR 3SE0A 2FJRA 2VYVD 3MMSA 4MOWA 2WT9A 3C3YA 1X7HA 3WLIA 3WE7A 4ZK6A 1G5RA 4PY2A 1K7XB 1PG5A 4YJ2F 1OLOA 1GRNA 4IIGA 4Q12A 1HQDA 2YINC 2CHFA 2EP7A 5FUXA 4A8JB 2WI8A 4D9FA 3O7WA 5I47A 2FF7A 4ID3A 4IF4A 4P4NA 1ZN7A 5KWJA 1GV0A 3SCZA 3FOZA 4HGQA 4M9QA 2NOAA 2O7NA 4AUMA 1LSUA 1Y33E 2RIPA 3LC0A 3U09A 2BEWB 1VKRA 1ZXXA 2II6A 4J9UE 4L6AA 4PCAA