4ER3A

Crystal structure of human dot1l in complex with inhibitor epz004777
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
328
structure length
311
Chain Sequence
b'KLELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMENYVLIDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTTQPMKLNTRPSTGLLRHILQQVYNHSVTDPEKLNNETSFDLVAQMIDEIKMTDDDLFVDLGSGVGQVVLQVAAATNCKHHYGVEKADIPAKYAETMDREFRKWMKWYGKKHAEYTLERGDFLSEEWRERIANTSVIFVNNFAFGPEVDHQLKERFANMKEGGRIVSSKPFAPLNFRINSRNLSDIGTIMRVVELSPLKGSVSYYLHTIDRTILENYFSSLKN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone-lysine N-methyltransferase, H3 lysine-79 specific
publication title Catalytic site remodelling of the DOT1L methyltransferase by selective inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 93
structure length 311
sequence length 328
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2012-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08123 DOT1 Histone methylation protein DOT1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.60 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) 434 Repressor (Amino-terminal Domain) 4er3A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4er3A02
3VC1A 2ZLBA 5ICFA 4BLVA 3MGGA 5LQCA 3AY0A 5HFJA 5EGSA 3BKWA 1KYWA 5DM0A 5E2AA 1SKMA 4FR0A 3I5UA 3O4FA 5LQKA 4RTRA 2PLWA 3DULA 2P3LA 2XYRA 3EEOA 4BP3A 2PV0A 2GB4A 3KQWA 4R6XA 2FCAA 3K0BA 3Q87B 4PIMA 5DX8A 5T6BA 4CKEA 1B42A 2I6GA 3EGVA 3GRZA 5EG5A 5EKXA 5HIKA 4ER6A 2ZBPA 1R00A 2OZVA 3PFHA 5G02A 3DH0A 1G60A 5HIMA 4YUXA 1KXZA 2OYRA 1P1CA 3HVIA 1Z3CA 2VZ9A 5EMKA 2O06A 5FWDA 4C06A 1QAQA 1SQGA 1QYRA 3DP7A 4ER5A 3FUWA 1EIZA 4FSXA 1O9GA 2ZIEA 1HMYA 2XVAA 5D1HA 1SQFA 1G8AA 2B25A 4Y2HA 2VDWA 3FPFA 3TMAA 2BM9A 1SUIA 2ZWAA 3E05A 3FUTA 3LDUA 4IV0A 4X60A 2BZGA 2EJUA 3R9XB 3EVDA 2C7QA 2NP6A 2ZZNA 4GQBA 5F2NA 3UJ8A 4U7PB 5LQJA 3DUWA 2HMYB 2GS9A 5GOZA 5LR6A 2PBFA 4F85A 1FP1D 3LHDA 2ADMA 4QTTB 3GRRA 3OPNA 4M38A 5LQUA 4PINA 2IBSA 4DKJA 1RI1A 1JSZA 3RIEA 2JH8A 2PSSA 3K6RA 5E1BA 5EPEA 4QVKA 3SX0A 3AWIA 3CBGA 2PT9A 2PX2A 5DRTA 4U7TB 5CUQA 2H00A 2O0LA 2V74B 3FPGA 3GJYA 3KQOA 5K0LA 4C08A 1YFLA 2AZTA 2IH2A 3OCJA 4KRGA 2IDKA 3ELYA 3TR6A 3HNRA 4R8SA 4YV1A 2EFJA 2IH5A 5CM2Z 4MTLA 4QPNA 4KIFA 1R74A 4XCXA 2UYQA 4IWNA 4DZRA 4HTFB 5E9JA 3G2MA 2BR4A 2G71A 2PXXA 3UFBA 2R6ZA 2N47A 1FP2A 1L1EA 3NDIA 4OBWA 5EC8A 4CWAA 4DMGA 3MHTA 2PT6A 2Q41A 2AOXA 2ORED 4FSDA 4XUCA 3FRIA 1QAMA 5K8VA 1L3IA 2XYQA 2WK1A 2I9KA 2PX4A 3FTCA 3PT9A 2UYHA 2H1RA 5T67A 2FYTA 3BWYA 1SUSA 2JHCA 3MTIA 1VL5A 4LG1A 3UJ6A 4DA4A 2C7RA 1KPIA 1NV8A 1JQ3A 2C7PA 1KIAA 2UYCA 3KQMA 3CGGA 5EMLA 4KDRA 3FRHA 4AX8A 2BH2A 1UWVA 4X41A 1KR5A 3M6XA 3THRA 3G88A 5CVUA 3M6WA 5K01A 3KQYA 4KW7A 1G8SA 1O9HA 2OY0A 3T7RA 1F38A 4C03A 5EEHA 3NMUF 3DR5A 3JWJA 5DLYA 5E8RA 3FTFA 5KS2A 4P7FA 3GRYA 5C0OE 4M37A 1X1BA 1FJXA 4RTSA 1UFKA 4E2XA 2HNKA 4EQZA 2VP3A 2BR3A 1JQEA 2B78A 3BWMA 1EJ6A 3T7SA 3I53A 3TRKA 4E32A 5K09A 4V0RA 3DOUA 2NXCA 1UIRA 3M4XA 5K0FA 5BP7A 2IPXA 3GCZA 3TFWA 3RODA 2ZIFA 3E8SA 1YUBA 3GIWA 3FPJA 5B1SA 3EMBA 1NT2A 4OQDA 3PS9A 2F8LA 1VP9A 5MHTA 3A25A 3G89A 4OA5A 4RTPA 3EEYA 5DXAA 1ZGAA 5FQNA 5D1NA 3P9IA 2R3SA 4PYJA 5FHRA 3SMQA 4YMHA 1G55A 1R6AA 2AN5A 4RX1A 3OZSA 3KR9A 1TPYA 4BY9E 1ZG3A 4H0NA 4M36A 1JTFA 1M6YA 3G2PA 2O05A 4ISCA 3EVFA 3R3HA 3HP7A 4DCGA 3HCDA 1WZNA 3IEIA 4F84A 5HILA 1Q0SA 3A7DA 2B2CA 2IBTA 1F3LA 4WXHA 3UJCA 3UA4A 1MJFA 1XCLA 2OB2A 3IHTA 3BKXA 3LCUA 4AZVA 1KHHA 4MIKA 3TKAA 1IM8A 1KPGA 3HVHA 4HG2A 1PJZA 2B3TA 5FUBA 3V97A 1EQAA 3TKYA 2PXCA 2AOUA 2NNWB 2P7HA 2ZZMA 4PYOA 3I9FA 4KVZA 2ZBQA 1TW3A 3I58A 3LBYA 5KQSA 2Z6UA 5CVDA 4RSRA 3KPWA 1D2HA 1BKYA 1VPTA 5DX1A 4QTUB 4FGZA 1VQ1A 1P91A 4YUZA 2PWPA 3C3PA 4PGHA 3M6UA 5EIWA 3UA3A 4ER3A 3SVZA 4UOEA 2HWKA 1FPQA 1I9GA 3KQTA 4MHTA 3FPEA 1WXWA 3OFKA 1M6EX 4EKIA 2QYOA 5F2KA 1INLA 3HM2A 4FZVA 2AS0A 1VBFA 1I4WA 3P9KA 1SVUA 4IV8A 2HTEA 2VDUE 3P2KA 2YTZA 1G38A 4PGGA 3MTEA 3MCZA 3BXOA 4HGYA 1XXLA 2ZTHA 2BM8A 1XCJA 3MQ2A 3R6TA 5CVEA 4JXJA 1KP9A 2GA9A 3CCFA 3Q7EA 1ZKDA 1VP3A 3G5TA 1PRYA 2AOTA 2PKWA 2YXDA 3O31A 4C07A 4OX9Y 2NXJA 2ZBRA 4A6EA 3REOA 2VDVE 2DULA 3HA3A 4KIGA 5E9WA 3HCAA 4PYNA 1AQJA 4OBXA 3PTAA 2IH4A 4IKPA 5K0JA 2XBMA 3ELDA 2UYOA 3KKZA 3KQSA 5ICEA 4E31A 4PYMA 4Y30A 4GC5A 4A6DA 4RTOA 3M70A 2QRVA 3NWEA 4C04A 1BOOA 3HTXA 3P2EA 2FK8A 3NJRA 5CVJA 2JHAA 5CVVA 2DPMA 3I64A 5EMJA 2A14A 5HIIA 4MQ4A 2CMHA 4DF3A 3BWCA 4GOND 2KW5A 3UJAA 3TLJA 4ER0A 2OO3A 1N7JA 4PYLA 10MHA 3BZBA 3LKZA 1NBIA 3OFJA 1RJDA 4E2ZA 2C7OA 4BLUA 3GXOA 1FBNA 3AXSA 2P35A 3FUXA 3O7WA 4YV0A 5LQRA 1SG9A 2XVMA 3LL7A 2ZULA 3AXTA 3DXZA 3EVZA 3JWGA 3C6MA 3OE5A 1RI3A 3PX3A 1AQIA 2AN4A 3DMFA 3PFGA 5EEGA 3MAGA 5E1OA 1EG2A 3KPYA 3M33A 4R8RA 3DXYA 3NDJA 3A7EA 5K0NA 5DM2A 5M5BA 3P2IA 2IFTA 3U81A 3D2LA 2BR5A 3BGIA 4DCMA 1ORIA 3OE4A 4K6MA 4G56A 1NBHA 2IP2A 3IV6A 4EVIA 3VYWA 2G70A 3UWPA 3FYCA 4P7GA 5LQNA 3SSNA 5BW4A 3BUSA 2YX1A 4F86A 4R05A 1DUSA 1WS6A 3OU6A 3CJRA 2EX4A 3KPVA 1MHTA 2ZIGA 4YUWA 1NW7A 3LDFA 1XDZA 2ESRA 4CTKA 3FTDA 4PCAA 5KVAA 3JWHA 5FA8A 3DMGA 2CMGA 3UJDA 3FPHA 4FP9A 3EGIA 1ORHA 1P39A 2QE6A 4RWZA 4KWCA 7MHTA 5DM4A 2G8NA 3GGDA 3MCTA 2NYUA 3MERA 3CJQA 2YXLA 3LX6A 4RYLA 1U2ZA 4PYQA 3ID6C 4YUYA 1Q0TA 1JSXA 1JG1A 2P3OA 3H2BA 5K0CA 2FPOA 2PX5A 5DX0A 2AOTB 4EKGA 5LSAA 1AV6A 2V7EA 2ZZKA 1QZZA 2OB1A 2LD4A 3G8BA 3P8ZA 4CKBA 1NW5A 3DTNA 1NW8A 4OA8A 3UJ9A 1IY9A 5GIOE 3EGEA 3T7TA 5EZQA 5DWQA 2WA2A 1JQDA 1L9KA 1X1CA 5FHQA 4AUKA 1JR4A 4CKCA 4E70A 2CWWA 5FQOA 2GH1A 3BWBA 4XUEA 2WA1A 3EVEA 2QRVB 3FYDA 8MHTA 4FT2A 3SGLA 3VC2A 3ORHA 4QVGA 2FHPA 3G7UA 3B7PA 1NW6A 2EJTA 3GO4A 4POOA 3HA5A 4LECA 4HC4A 3DXXA 4RTLA 4P58A 3ER9A 2O07A 2HV9A 5DRYA 5EKUA 4R6WA 1I1NA 1X1DA 3GNLA 4HTFA 5ERGB 2NP7A 3GDHA 4O29A 1X19A 2O57A 2NXEA 1Y8CA 3G8AA 4P7JA 3RW9A 4PNEA 4P7KA 4YV2A 4EK9A 4GF5A 3DLCA 3KR0A 3MB5A 3UJBA 5E8JA 1RJFA 4PWYA 2ZVJA 5CCXA 3ER8A 1KPHA 4GBED 1IXKA 1O54A 1RJGA 3FZGA 5EHIA 3V8VA 3BT7A 5K0GA 3NWBA 4QPPA 3EMDA 4X63A 2P1DA 4YMGA 2ZW9A 3KR2A 4PYIA 3HVKA 3A4TA 3SXJA 3DMHA 3TOSA 5GINE 1JG2A 3G2QA 2UZ4A 2YXEA 5DPMA 3AJDA 5EMMA 2JJQA 3C3YA 3LKDA 4LWOA 2VS1A 3E23A 5HEKA 3P71T 2Y1XA 3A27A 2P7IA 4CXMA 5P8WA 2I62A 4C05A 5DT2A 3NVKI 4GOMD 1WXXA 3EVGA 4DM3A 1VLMA 5GP1A 5DTMA 3SSOA 4RTJA 3GRVA 3NTVA 4QQNA 5ICGA 4RTMA 3PLAE 1XDSA 2ERCA 4ZTBA 3EVAA 3HCBA 4M7RA 4EMSA 3LPMA 3KPJA 4AZWA 1RJEA 2AN3A 3THSA 4AZSA 5CCBA 5FA5A 3SR4A 1P1BA 5HOQA 3SSMA 1XTPA 1N2XA 2IIPA 2IDJA 2OPBA 5DTQA 2YVLA 1WY7A 3FUUA 4B17A 2XYVA 4RTKA 3JWIA 5ICCA 1WG8A 3KR1A 3SM3A 1BC5A 4X1OA 4LWPA 1DCTA 1N7IA 1AF7A 2YUIA 1VE3A 2PVCA 1NV9A 3DLIA 4PIPA 5DSTA 5T64A 3GRUA 1EAMA 1JG3A 4RTNA 4V0QA 5GWXA 3ME5A 4KDCA 5HIJA 5BXYA 2G72A 3HCCA 3CJTA 5EQJB 3TM4A 4BLWA 3HVJA 5EOVA 5KQRA 2JG3A 3KPUA 4FT4A 5C1IA 1G6Q1 3UZUA 3GWZA 4WVLA 2YR0A 3B5IA 3P9NA 2FK7A 4XUDA 4C4AA 4OQEA 2E5WA 3WSTA 2ZCJA 5EVJA 3ELUA 5FULA 1XJ5A 3LCCA 4RVDA 3OU7A 2P40A 2P8JA 1HNNA 3KHKA 5FWAA 1NE2A 1QANA 4PYKA 2AOUB 5K0BA 3HA7A 2OKCA 4DQ0A 4GC9A 4ER7A 2H11A 3S68A 5FTWA 5IH3A 2QY6A 3EVBA 4BP1A 5C9ZA 2Z6AA 3LECA 1X1AA 3LSTA 4RVHA 2AVNA 3T0IA 3LGAA 1RI2A 2ZFUA 2JH9A 1EJ0A 4GOLD 5K0EA 3LDGA 3QV2A 4PCLA 1YZ3A 4QQKA 2QM3A 2ZSUA 2PXAA 3E7PA 5EZSA 5FADA 3QOXA 1L3BA 4AZTA 2G1PA 2B9EA 5E9QA 2ZWVA 3CVOA 5JR3A 4E33A 4QDJA 2PWYA 3EPPA 2AOVA 1H1DA 1VIDA 2ONZA 3LCVB 4RVFA 4RVGA 3P97A 4YUVA 2PGXA 5HZMA 2GLUA 4QDKA 3TQSA 3ERCA 5E1MA 5JUWA 3F4KA 3CC8A 1L3CA 3L8DA 3NW9A 3PX2A 4E30A 1R8YA 5CD1A 1RI4A 3HEMA 1QAOA 4GUAA 5K05A 1KYZA 4X61A 5DTRA 1R18A 3C6KA 4GOOD 1XDUA 2Y1WA 5DSXA 2EG5A 1JG4A 3C0KA 3PVCA 1YFJA 1TW2A 1ZHFA 2GPYA 9MHTA 2P41A 2PY6A 3M6VA 3OZRA 4HSGA 2ONYA 3KU1A 5KYGA 5F2OA 4PONA 1XVAA 2YQZA 3G2OA 4HGZA 4NECA 5EHGA 2OBFA 3G5LA 3FTEA 3NVMB 1JTEA 3HCFA 1ZGJA 4L7VA 4Z2YA 5H02A 4MWZA 3UBTA 3OZTA 5E2BA 1ZQ9A 2OXTA 1BHJA 5IKMA 5BW5A 2JHPA 1OR8A 3PB3A 3TPZA 1R8XA 4GEKA 3B3FA 5E1DA 3GU3A 2I7CA 3VSEA 4CTJA 2Z6QA 3B3GA 3KQQA 2AOWA 4HH4A 5GM1A 2K4MA 5EIFA 3BGVA 5LQAA 3ELWA 3HCEA 4E2WA 1DL5A 2AVDA 4ATNA 3B3JA 3P9CA 3LBFA 3TM5A 2GAFA 1T43A 1NKVA 3BGDA 1D2CA 2PJDA 1YF3A 1D2GA 3B89A 3R0QA 5DM1A 3FUVA 3KQVA 3ANXA 1YB2A 1RI5A 5CIYA 3EVCA 3UJ7A 1V39A 2CKDA 1NW3A 2NXNA 2P3QA 3R24A 5K03A 2PX8A 4FS8A 3KQPA 4RV9A 4HRAA 1M0EA 2CL5A 3OU2A 2FRXA 3QOWA 2HR1A 2AR0A 5GIPE 3A26A 3IYLW 3X0DA 5FCDA 5DXJA 2IGTA 4E2YA 4RTQA 5GM2A 5U4XA 3CKKA 1YZHA
chains in the Genus database with same CATH superfamily
2CBXA 2NUPB 2WJ3A 4BLVA 1I4LD 5GAHi 2B82A 4BLTA 5G3YA 2QLLA 3W7BA 4AX4A 1Z4MA 3PDCA 1XAGA 1JDBB 1Z6YA 5L7TA 1LXCA 3DE1X 4FR0A 4N4AA 4UNNA 4ZICA 3QUAA 4GYYA 3KZ1E 3GT4A 2Z43A 4BEJA 4OMCA 4HTAA 3V33A 2GB4A 4XIIA 1IDOA 1YDWA 5TGTA 1LPNA 3DZJA 3EGVA 4ITUA 4CUJA 1EM6A 1TC2A 5HIKA 2ZBPA 3RV4A 4JBXA 2OZVA 3H05A 5B7PA 5UKDA 4MWDA 1WD7A 3R9WA 2AX3A 4W4TA 4DUYB 2VK4A 5FWDA 4BECA 1SQGA 1QIJA 2ZR9A 4IGEA 1GPUA 3HU2A 4RENA 4N8SA 2NT3A 3Q6NA 1PJCA 1IBCA 2DFDA 2BM9A 2OORA 3PNLA 1E8NA 2WMYA 1FJ2A 2DMRA 4KLAA 4O4IB 2BZGA 3G2JA 1KOJA 5JWOA 2CNDA 4ZOLA 3U3ZA 1QP7A 4PZCA 2HMYB 3G5UA 3SDBA 5A3QA 4XDZA 3DHVA 4TMWA 2LYPA 4D0SA 1R0CA 1OILA 2FX3A 3RIHA 3V55A 3GRRA 5J58A 3FHTA 2XRYA 4B83A 3AESB 4PINA 3OECA 3I2GA 4QO7A 5MFZA 1FC0A 2YVQA 1IHDA 3PGXA 4OSEA 3SBDA 3HY3A 3QY9A 3AUJB 5GV8A 5EIXA 5KVAA 3CUKA 1T2AA 3U4IA 4GGPA 2RH8A 4OQLA 4R2LA 3H5AA 4AXBA 2XKKA 2BFDA 1SO8A 1W36C 1ACLA 2B8JA 3M82A 3ZOKA 2G5CA 3OCJA 1QO0D 4KE8A 2HHCA 3U48A 4FDTA 4Q3NA 1BJKA 2FPPB 3N2ZB 4YJDA 3G0TA 2HLDD 3RVPA 2ENWA 2JGJA 4OUDB 1GG8A 4M4SA 3TW4A 2UYQA 1NMXA 4U3JB 2RI0A 3T1NA 3NANA 4AJPA 1RCUA 2G71A 1NRXA 4EI9A 5K6TA 4B7AA 2N47A 2C0CA 1Q7CA 4KQHA 5HKKA 3ICQB 2VRBA 2WZDA 4RADA 3Q8LA 5IULC 4B9EA 2IPNA 2AUTA 3AZQA 2WK1A 3SZGA 2UYHA 4CQJA 4EZIA 2I33A 2VBGA 2B5AA 4AKEA 4AK9A 2BC9A 1DEXA 1EP9A 2QTAA 3KWJA 1THTA 2BPOA 4FW8A 4TV9F 1KPIA 1ITZA 2IHYA 1L4NA 1Z18A 3UAGA 5EMLA 1P0QA 4FFPA 4II7A 4ES6A 1I3LA 1RADA 3W9BA 3DA8A 4GR9A 2Z98A 3FPLA 2VXCA 4L8FA 4ZEVA 2Q29A 5DNEA 1WV1A 2B92A 3KQYA 4JT9A 5AVVA 3JZMA 3Q8XB 1GU1A 2LYKA 5D6OA 5EEHA 1ZRSA 2H2DA 1SVMA 4GWLA 1Z4KA 3A9YA 3SEQA 3KD3A 1AQUA 4ZARA 4EJFA 3DVAB 1KJQA 3QUSA 4ZEXA 5B37A 1FF9A 2V9CA 2H85A 2BF4A 4PZPA 2Y1KA 1LBHA 1SBQA 2J67A 2P2YA 3G17A 5FO0A 3ROGA 4W7HA 1XK6A 3DAYA 7YASA 1RC0A 1FFDA 1AB5A 3NM6B 4R9NA 4YAWA 4ZZ0A 1Y9ZA 1H0SA 3UPTA 3WAJA 2ZIFA 3K94A 4JUAA 3RTCA 3STTA 1HDRA 3AJRA 1VMIA 5CT8A 1PG2A 1ZICA 4L57A 5EWLA 3AERB 4PE5B 3RSHA 2QN7A 2B7LA 3VR6H 4NS4A 4FBIA 3M8KA 2QMOA 3WLSA 2DHDA 2OILA 5BOVA 5GZ1A 1OFIA 1JP7A 1WMBA 1FZQA 4DAEA 2XJ3A 2NPFA 2FFBA 4L02A 2XMPA 1ZSNA 1RYEA 3Q0IA 4UEQA 3VOSA 4H3KB 1U8FO 1UXKA 4TPKA 3SYRA 1ML4A 2A4KA 3C85A 1QYDA 5T8KA 1DAIA 1NM5C 3LM8A 1SZPA 4LNUB 4I5IA 3WICA 3MJ4A 4KDFA 2H08A 1I2DA 2BFAA 2XSZA 4EPYA 4CIAA 1KGDA 4D81A 1E1QD 2PRSA 4XXHA 3SIRA 1RJ9A 2RH4A 3IQZA 1PF7E 1CS4C 4JC5A 4HG2A 5FUBA 1Q0HA 2PXCA 4JYPA 3PGA1 1D6MA 3MRXA 4PYOA 4YRBA 5SICE 2ZBQA 1P7PA 3TE6A 1CDZA 2IEAA 3OF3A 4QSMA 3VU8A 4EFMA 2PLRA 3BH7A 3T9FA 3D7KA 4P4NA 1LBEA 3ZYZA 4HZIA 2C3UA 4P31A 3EIFA 1Z5PA 2J7UA 2AI2A 4HYTA 2VNSA 3ND7A 4MCHA 2D1TA 5FPHA 4GPIB 5CDFA 5LLTA 3IQDB 4JI3B 3AO0B 3D6TB 4DSTA 4AIRA 4OYRA 1GIAA 3TUIC 4BHTA 1CQIA 3MOSA 1R0YA 2XV1A 3N2IA 3SX2A 1JQAA 2POCA 4UVDA 2C07A 2F9MA 3T5DA 5TQ2A 3VKFA 3BXOA 4C7OB 2OLEA 3GX1A 1O8BA 2FQQA 3G9UA 4TWZA 2VRCD 2ATIA 2HSEA 4QD3A 1FFXB 3B1YA 4L8YA 4TTRA 5IVDA 4FI3C 2YV2A 3NGXA 4J1SA 4ALMA 3A9XA 1VLJA 5KYWB 1JB1A 5IK2A 4FQ5A 3IQGX 4Q3KA 2XNKA 4W7SA 4M54A 3UH1A 4A6EA 4C9BA 4QQFA 2QM7A 1SVIA 2XWJI 3OFNA 2ZB2A 1CJTC 4WFKA 1TIKA 3HLKA 1BGWA 1KEEB 4S2UA 1QHGA 1MN6A 4Z4GA 1PJ8A 4JEHA 1P2GA 2WVHA 5HRCA 2WSBA 3TOZA 5LP6A 4F3TA 1MQ9A 5ULLA 5JCOC 1NC3A 1GUAA 4RZXA 1Q2XA 4E31A 1H69A 3VTZA 4A8JC 3F3MA 2H1CA 1N8TA 3EH1A 3F49S 1VJ5A 3QBJA 3A32A 3X2EA 3PRHA 4J0CA 2WSYB 4KOAA 4AJLA 4H4EA 1R2QA 1NRJB 1BMQA 3WB2A 2C29D 2CMHA 3N86A 4UVEA 3D0RA 3Q9NA 4C0LA 4UXHA 2XMRA 3SSAA 5IUKC 1VPLA 3V1MA 1TJNA 1A9ZA 3DBHB 3OFJA 3QPUA 1XVUA 2C99A 4Q9IA 3QIAA 4G3XA 3EPRA 4GP9A 4QRHA 3SCGA 3LBAA 4GL4A 5FPSA 1FMFA 4WNYA 3DXZA 3TW8A 3ZHIA 1K9VF 1X94A 3QEOA 4MP8A 4PZYA 3W3AA 4BJ3A 3D1VA 2CF6A 1QG2A 4BMCA 1LLCA 1RXCA 2IYSA 4XLTA 2VZ8A 3ZG6A 2QQ5A 3FLBA 3KPYA 1ECLA 2A78A 2CSUA 4XOUA 2P0YA 5DWDA 4ZHQB 1G41A 4EIWA 1K3FA 2FW6A 2QRQA 1Y5IA 3D2LA 2NGRA 3DW1X 3N2GA 4WUTA 4DA8A 3GJ8A 4JROA 5LA6F 4D1YA 1TQ2A 1IB6A 2FEAA 4JQOA 1Q1GA 1U4OA 3HRIA 4R05A 4CTOA 4LYYA 2OHJA 3NTUA 2QD5A 4JLOA 5B36A 2AC7A 1QBKC 1YR7A 1ZN7A 2J3MA 3ESCA 3TRIA 5DGIA 4WLVA 1DRUA 3N9IA 1UBRS 3N8HA 4XUGB 3V9PA 1TXGA 5JJ5A 3FNFA 1JJVA 2PUEA 3FTDA 3IB3A 3LJKA 3OOEA 3P19A 4UASA 4XIGS 2JLYA 3E82A 3TN7A 3LBHA 3U7GA 2I0FA 1QVAA 1T6BY 2ZRMA 3U80A 2A0YA 4MCIA 4M1OA 2G8NA 5JSQA 1D5CA 2X7JA 4B31A 1BRMA 4ZOAA 3EIQA 4YJKA 3QMMA 4RYLA 3GNTA 3A9UA 1WHTB 1JG1A 1JSXA 1TZBA 3QLVA 1HORA 2CBGA 4HEJA 4WBXC 5ISMA 4DR7B 1Z83A 5JROA 3ZCTA 1NQAO 2WFZA 1JN0A 3WS7A 4JSYA 2NW6A 4MQEB 4NYJQ 3A31A 3M9LA 5M34A 5IPFA 1W85B 3QOFA 4K9MA 3M0EA 4BNMA 2X77A 1X1CA 1ZSYA 1F2TB 3JR7A 4WHMA 1JPUA 4B7UA 3KL2A 5KCZA 1A8PA 1U28A 2GH1A 4AKTA 1UPCA 2ACWA 1GFIA 1ZK3A 3FYDA 4YMVA 4I81A 1G2PA 1QUFA 5J63A 1Q0PA 1WR8A 5JY1A 2C9DA 2VC2B 2FHPA 3HYTA 1MGOA 4ZAYA 5KYUB 2ZWPA 5JJCA 3OOSA 3QE2A 4R31A 2D62A 4IIVA 1RCTE 3AU9A 4OL9A 3VYTB 1PZGA 2CDAA 3E3OA 3GH3A 1ZCFA 4QPJC 1IN4A 2D2XA 1E63A 2BW0A 3SC4A 3D3QA 1LFDB 4O6VA 1X1DA 1YNOA 2AFHE 2O2GA 2Q9CA 1QK5A 2D4HA 2LE0A 1W47A 2AJLI 2V6MA 2XUGA 1CUFA 3Q3EA 4WKNA 3K32A 5CIQA 4DHEA 4YV2A 5TC4A 4ZTZB 5GAGi 4P54A 2ECQA 5JS1A 3CZ5A 4I36A 1C8LA 1RTKA 3PFCA 3WWYA 5A03A 1U9ZA 2OR1L 3OTWA 1O54A 3N0XA 4YH1A 4C1BA 1M2WA 5A2GA 2V59A 3NWBA 2I1VB 3GDFA 2P1DA 2A5YB 3I9V6 4RA9B 4F4IA 2D0PB 2GZSA 1DWKA 2GAOA 3VZBA 1XZQA 2QZPA 2UZ4A 5EMMA 1KETA 3AJDA 4PX2A 1WOMA 1PS9A 3B12A 4ZT7A 4KR3A 5EHNA 3R5FA 1GZ6A 4G81A 3HKDB 5ESXA 1WVIA 1EEXB 4JBGA 2C78A 4R40A 4C05A 4PSDA 3ZYCA 1ZL0A 2MXDA 2HSDA 3DFUA 3ESQA 3CY6A 3NB0A 4EFLA 3WLJA 4D4MA 1UK7A 2NSHA 3NNSA 3SSOA 2EJCA 3K35A 3VPHA 4BCCA 1JZQA 3JQ7B 4G41A 3TOCA 4J1TA 3A70A 3RAPR 2J3DA 3TGPA 2VEDA 2P4UA 2QPLA 1LKZA 2XYPA 5I8ZA 4WECA 3THSA 4G0YA 1DP4A 3RZZA 3JATA 4LWZA 1QLJA 1LSOA 2PXFA 3SSMA 4B6EA 2BDTA 1H2FA 1AN9A 1WY7A 1MB0A 2DBRA 2VSYA 3BJMA 2QN3A 2BOVA 3KIPA 4I5GA 1WKVA 2L1PA 1VA5A 4AP5A 3HU3A 4E1AA 1T5HX 2JLSA 1LI4A 3QKRA 2AF3C 2G4CA 2LDBA 3HDHA 5H83A 5T6MA 3WRYA 4O4HF 1J7JA 1R5JA 4KIWA 1H4VB 3NHYA 1ODTC 3ZUGA 4COOA 5M29A 5DISB 4C6RA 1HFWA 3YASA 4BKMA 3QXHA 3ZE0B 4CKCB 2LP4Y 2GNAA 2PMFA 1Y5MA 2QVBA 3FLAA 2CYAA 5KQRA 1NURA 4BLWA 2Y76A 2W2QA 4FT4A 4MARA 1CUEA 4DB2A 2E4AA 3RUCA 3UZUA 1MA3A 4N5LA 1SD1A 1Y1LA 2C5SA 4V3BA 3W9UA 3QMWA 3WSTA 1H23A 1E6EA 4HAYA 2G88A 5EVJA 4D3XA 2A9QA 1DAFA 1P62B 2AKAB 3QUBA 4DE8A 2GI4A 4B87A 1KTVA 3HFGA 4QYTA 3RF6A 4G84A 2NZ8A 4Y98A 4IYRA 3GP8A 3WV4A 1QNLA 3FA2A 4ZAFA 3IBFA 3TOVA 2P9EA 3ZEIA 2BFBB 1V7CA 1JBQA 3PNKA 3ECAA 1G6HA 4U4AA 4KCGA 4HPXB 4BPRA 3CVJA 1ZWKA 2ZFUA 1N4DA 4NBKA 4QICA 1ZW6A 4LRQA 3AIMA 5KX5A 1DNPA 1FNMA 1W0JD 2QRUA 4QQKA 4B81A 4C6SA 1NBMD 3D0QA 4CIYA 1U0LA 5DTIA 1LDEA 5HRAA 3ESAA 3W77A 4EABA 3AEQB 2B4RO 2XWBF 3O47A 5JW6A 1RMQA 2YYSA 4MUMA 3EIHA 3PHHA 4IQ4A 2E2WA 1HTBA 1UBHS 2QTNA 4YUVA 3RABA 4PNHA 3E8XA 4FJ0A 4RK4A 1XK7A 3BXHA 3TQSA 2V8BA 3T8YA 3MBOA 4M83A 1AS3A 1L3CA 3WRXC 4FCCA 1DQYA 3FPCA 3G0OA 2BMVA 4QT4A 3S2SA 5K05A 3V7FA 1QFXA 5DTRA 5FWYA 2XNHA 5JMOA 3LMKA 1Y1KE 3AEYA 3N8IA 2R00C 1Z0IA 3BWEA 2CLMB 3GZNB 3L0SA 3OCWA 4ZYWA 1GQOA 4KMMA 1ESNA 1XJQA 1CY6A 2V96A 1PNVA 3CLHA 3DOJA 3DE2X 1AURA 1IZ8A 2MSWA 2QUKA 4OU5A 1NXPA 2YDXA 4WOJA 2WZQA 1XGKA 2GK4A 2O8DA 1ZGJA 4NI5A 4R16A 3IS3A 4MWZA 4DUZB 1ZQ9A 3F74A 2Y67A 4J75A 1XZCA 4GG1A 2I7CA 2VT2A 2AOWA 4Z58A 1XA4A 4U0JA 2CK3D 5EIFA 1LDYA 3IMFA 3OHSX 1UP4A 1AN0A 3JQAB 1FSGA 3JQDA 4YJGA 4DMUB 3O8RA 4BO2A 5LDHA 3BGDA 5JECA 3FDJA 1WW3A 3KQVA 4YPVA 5DGXA 4L73A 1GNVA 4CKYA 2NXNA 2P9GA 4W8OA 5TXGA 1OC4A 3EUAA 4RV9A 1DAOA 2XB2A 1E96A 1IM5A 3PFBA 3WNQA 4R5MA 2HR1A 4DNXA 3QOWA 1XZMA 2JGFA 2X13A 3FSGD 4EX6A 2P5YA 2ORYA 1XTUA 2ZSAA 2EF0A 4J0HA 2UYYA 2PXDA 1U8UA 4LQCA 2WHPB 1XZFA 2WSSD 3NETA 4XCQA 1EX1A 1H6CA 2Q4OA 4CGYA 3HI6A 5LQCA 4MWEA 4YGYA 2XQVA 3NROA 1NP6A 3C7CB 4OBBA 3GLUA 1CFJA 1TCAA 1KKMA 4E1BA 1TNDA 2H59A 2Y4OA 5FTMA 2PQ2A 2P5UA 5AKHA 5FXMA 3T7AA 4TMKA 2RBKA 2D2IA 1ADGA 2HDNB 3QF3A 2DY1A 3Q85A 4KLRA 4NHOA 4MPTA 4ENTA 2VP9A 3DNFA 1P0IA 5EWJA 2FCAA 4NQRA 5EE0A 2I1WA 4MVJE 1MFZA 5AVQA 1EP2B 1XA3A 2IYEA 3BQMB 3IE0A 3E22B 2OP0A 4D6YA 1SPXA 1MQAA 2Q9BA 5K7SA 4BB9A 1P1CA 1E9VA 4KH0A 1JQLB 5AM1A 1C7FA 2O06A 2QD1A 1Z0SA 1TMOA 3BHMA 3OIYA 4QAJA 5F4ZA 5A71A 1A04A 3MUFA 5CT9A 2H4HA 4X4EA 1EIZA 1MC5A 1U0OC 2A35A 2BEJA 3VX3A 3WLTA 3PUZA 1E2IA 4MVCA 5KAMA 1MO5A 1SUIA 2DKOA 2ZWAA 4BJ1A 4IV0A 1LLFA 2JAQA 2XTJA 4J91A 2CUNA 3LRPA 1JV2B 3SNHA 2O8EA 5J4VA 1CF4A 1DAHA 1F0KA 3OWQA 4XW2A 5LQJA 4LOIA 5JRDS 1H2HA 3H11B 2J5RA 3F8SA 2L49A 2CMDA 2I4OA 1PHRA 4KXMA 3WHPA 3R3UA 2M4HA 3HHEA 1HT2E 4BNHA 3SX0A 1XQVA 1YQEA 5F64A 5H4GA 1Q1ZA 2O0LA 1M10A 2V74B 4YP5A 1PNQA 1HMPA 3NASA 4IRMA 3PZBA 1C1DA 1OVMA 3FCSB 4XEHA 5AI6A 3V8EA 4B6GA 2WJIA 4A8PA 1GUDA 4TUYF 1XKTA 1YC5A 2IXDA 2YNMA 2YJ4A 3LH5A 3VHXA 2Y0DA 5DLYA 5J9FA 5CYPA 4KHPB 4ZQHA 1JE1A 3LTEA 1U0SY 4DSUA 1BWSA 3MF4A 1YAHA 4PGMA 1JAXA 1D8TA 4JCXA 3B1VA 3WG9A 4AIIA 5LIPA 2QRKA 1NDUA 6GPBA 3ZGZA 4GFDA 5E4JA 1J33A 1SXIA 1KOGA 3HLYA 5IJ0B 4NAHA 2IWHA 1NKSA 2ZCUA 5B3JA 5FR2A 1PT6A 4DCSA 5K8LA 4OYYA 3STYA 3JX9A 2QLJA 3HUDA 3B9PA 3BWYA 3INRA 4WBNB 5DIZA 1EUYA 3DAGA 4LN1A 1LBIA 5CA0A 3U19A 4H7IA 1FNBA 3F4BA 1C14A 3EXIA 1FU7A 4TSFD 1PQ4A 1PEDA 3TOXA 2GN9A 3FYSA 3HPQA 2BH2A 3QU9A 5IJ9B 3B6ZA 3M6FA 1W73A 5HDQA 5K1ZA 4C2AA 3D3EA 1N1EA 1YIAA 4LHXA 5D3MA 3AKYA 2WUDA 4Q6WA 4XD2A 1ZISA 2HD4A 3O8OA 2WF6A 1IC6A 4Z54A 5BWOA 5FKJA 1KI1A 2HJSA 4HWPA 4PBRA 1ZR2A 2ZUEA 4BRWA 1ZD3A 3CNEA 5C0OE 4NU5A 4CHGA 2GPNA 3INTA 4HRYA 4M8NE 5JY6A 2B5WA 3OURA 3JALA 4E2XA 5JFGA 3JQCA 4DUGA 2ASEA 4Q4CA 4JNCA 3MD0A 5JSYA 1OLOA 1GCAA 1LRJA 2ZBFA 3UOGA 3S8YA 1PLLA 3TRKA 2ZQZA 5EJ8A 1UBCA 2J0UB 3E7FA 4FYHA 4EYSA 1KZ1A 1GAWA 3G8DA 4HNHA 5AKKA 4D41A 5T7BA 4FD3A 1WMDA 2WHEA 3ZBQA 4B2PA 3DEZA 3H2JA 3HXKA 3TTWA 3JS5A 4U2KA 5BUQA 2WHYA 2JJ1A 4QLBA 2ZRFA 3KAJA 3I04A 1FTWA 2A3RA 2OD2A 3OY2A 4XGQA 4MWBA 4PG8A 3A4YA 2O8NA 5F21A 4YMHA 1N5LA 3B13B 3BK7A 3PUJA 1F51E 5FOSA 4IM7A 1XC7A 1KZ4A 2WAOA 5KWJA 5JYCA 3T5MA 3WDSA 2CJWB 2YS6A 5ENZA 2F3QA 1JDJA 4ETMA 3KTDA 3NRCA 4EKYA 3OVMA 1A8IA 3IEIA 3T95A 4FX2A 3M4NA 3O21A 2XZTA 1C7ZA 3QVVA 1JWAB 4CM9A 3KZNA 4YJFA 4IIJB 2O2DA 1LBQA 4KHZA 1PFYA 4WUVA 2WC1A 2AKEA 4OP1A 1T4MA 4O25A 1PJZA 2QXTA 1GGNA 3KKKA 4TTSA 2QA5A 4QSHA 4BMNA 2WMNB 5CW1A 5CCXA 1O9BA 1XDBA 4RZSA 5EESA 2Z6UA 4B3GA 2DHEA 3V8RA 2NU9A 1BX1A 2P0AA 1Z39A 2RG7A 5IAOA 4H31A 2V7PA 2DC1A 1WABA 4MP6A 4TS1A 3RS3A 2JKYA 4JLAA 5AKJA 1C2YA 4AURA 1R5BA 1VGRA 3QVTA 1RWXA 5B3LA 3FPEA 4RKRA 2QLTA 3OFKA 5I9TA 1P2VA 2PWZA 1WDTA 4CKZA 1A97A 3L4SO 4TWAA 1IQPA 1XZKA 4YGXB 4CQMA 2QT9A 1K5HA 2R1UA 1KDVA 5FOXA 2B8NA 4MRMA 2W2KA 3AU8A 3H2IA 1QJCA 1FW6A 2MYNA 1GRQA 3QLJA 4W7IA 1BOFA 1LVUA 2FDXA 2CY0A 4ALIA 3RBZA 2V0NA 5EMHA 4LHWA 1C30A 4KGXA 3FBWA 4ZVPA 3TL6A 6PFKA 4YBAA 1F0NA 4JLNA 1BU5A 2EZ8A 2H63A 4JXJA 4IJUA 1SBTA 1ZVVA 1XT6A 3CCFA 3VHQA 2BGLA 2W42A 1YFZA 1TEXA 4MW6A 3ZN2A 5F23A 2YXDA 4L51A 3WGVA 1JDZA 4G1BA 4TKVA 1Y6ZA 1IZ9A 3L4BC 5E9WA 4CTNA 5HFAA 1AQJA 3KETA 2ZJ0A 1ETHA 1L5HA 4LAFA 1V3QE 5AVOA 4NLLA 1W5EA 4Y30A 1LX6A 4GBMA 1JTVA 5D87A 3NWEA 5I7FA 5E7JA 2H5LA 3OTGA 5C7OO 3DYIA 1V47A 1YBAA 1MBZA 4J0JA 1ZZ7A 1POUA 4LI3X 2E21A 4P38A 5EMJA 4C0AC 2ZXUA 4WADA 2A14A 3ZHZA 3R75A 2BKXA 4DJAA 2XCSB 1R0WA 3NNNA 4X92A 4KJXA 4EJSC 1Q1QA 2AA3A 3PQ4A 3DO5A 2CXSA 1W8IA 4U1RA 3JTEA 3BXFA 1P29A 2RI1A 3F97A 2PSHA 1QIMA 1WAMA 1XYGA 3IUBA 1F8UA 1SCAA 2ST1A 3JQBA 4OHBA 4X8MA 2O6HA 4BX0A 1NM5A 2QUHA 1LF0A 1E4EB 2ZULA 3GFFA 5BUSA 1W34A 2VHWA 3ZHSA 1VZ2A 2AN4A 3MUOA 2BFPA 4QGFA 4KXNA 2VDRB 2QMQA 2Q2WA 3OPYI 2XUHA 4JLSA 4NOKA 1EE1A 1WMSA 1K66A 3CLKA 3DDCA 4HEQA 2OEPA 4I55A 3IFSA 4M21A 3IMCA 4IZHA 2Q3MA 1LI7A 1M76A 1UBGA 1QH1B 3HO8A 2JIRA 1QYVA 1A2OA 1NUQA 2I4IA 3GLFE 1KH1A 2NAPA 3AHFA 3TG2A 1CJBA 3CLVA 2HLNA 4YV7A 2IZ1A 1ABBA 2P27A 2QNIA 2W4MA 2GQ0A 1BO6A 3VDMA 1GTVA 4A15A 1YZNA 3K9LA 3W5CA 3PEYA 3NGLA 3DMDA 2QVZX 5K4HA 3BIFA 4FMCF 1EVYA 4NR0A 2KZ8A 4OHXA 4REOA 2O5RA 4PU3C 5AK3A 1V6AA 4FP9A 4LZOA 2BN4A 2VJCA 4RH1A 4O4LB 1YB4A 3QU2A 1YVUA 1JQKA 1TKRA 2CXRA 4CMHA 4KAXA 1AKVA 1M1ZA 3GDOA 3Q98A 3F5MA 4GWKA 2IA5A 4LDJA 4X6YA 5BN1A 1N33B 1QOPB 2VCEA 3C3MA 3H2BA 1FOEB 1NTOA 1KDOA 1KF0A 3WJ2A 4R8VA 1IOVA 2WHXA 5DX0A 1DQSA 2PUGA 2IYLD 1BROA 5DYNA 4ZODA 5BMVF 3NHAA 1QE3A 2OB1A 1VFPA 3AJ9A 3G8BA 4ZQGA 4JI1B 3RS2A 1AKEA 3PQCA 4U7DA 4FLMA 1UTXA 1CQTA 1TYBE 4QODA 2FLWA 3RB8A 4PU7A 5JCOA 5GZ6A 1ABEA 4A8JA 3IV9A 2BT4A 3RKSA 5BQXA 1O4VA 5EJ9A 1OHHD 2ZT7A 3AOEC 4FDLA 3H8JA 5FBVB 2RI6A 4KLCA 3O90A 2ZAOA 2OLKA 4CT4B 4NJMB 4E1VA 1T9BA 3FNRA 2CL6X 3ONVA 5DSZA 3WLOA 2IQIA 1GADO 2J3JA 4QDOA 4HQFA 4BTLA 5AKXA 4Q7EA 4F3YA 5B3KA 2PMEA 1KK3A 2QJTA 5TPZA 4YDSA 1E3OC 3CPJB 1K7CA 2F90A 3H86A 3SM9A 1H2EA 1Z12A 4TZKA 2YV1A 1XX6A 2OCKA 3V9AA 4BMVA 4ID9A 1L7EA 4ESOA 1U5AA 3Q0EA 2ZYHA 2NXEA 5EHZA 1N0UA 3FMIA 2DM6A 3QWBA 4P7KA 4EB6B 3KVVA 4JODA 2X2OA 1V41E 5BSGA 2Z3WA 3TWOA 3UJBA 3PFWO 4JJ4A 1U2RA 5HRUA 1GA4A 3PR3A 1Z2DA 3QHPA 4DAOA 1H8HD 5BQOA 4MW9A 3RNOA 1Y6GA 3KQUA 1GUFA 4QA9A 4TXLA 1RBQA 1UXIA 3LLVA 3EXAA 3K0CA 1EKXA 4CU2A 3OQNA 1O5TA 2JJQA 1MG5A 2H1OA 5A6SB 2JLAA 2C4UA 4IIFA 1PNOA 3PPWA 2IXFA 3ZWBA 1NMSA 3ORFA 1PD0A 1AK2A 4K8RB 3ULKA 5JH7B 5LP6F 4I6JA 1TEVA 2H6EA 5FNVB 3K2QA 5LN1A 1H3NA 3LPDA 3TSZA 2F43A 4NCHA 1QZUA 3SPXA 1EX7A 1NQVA 5BNIA 3CW8X 4I9HA 4MDHA 1JKJA 3T1YB 1NJFA 4LJ7A 3DTVA 5IJAA 2KYRA 2V5UA 4AZSA 1Y8RA 3GJ4A 5B1HA 4RPIA 2W6JD 4CMBA 4DMCA 4Q4HA 1XQ1A 2IDZA 4GPAA 5CYFA 3DM5A 3VPDA 4NNJA 3LHSA 3AR2A 3RDPA 4MW5A 4PC6A 3SM3A 3WWZA 2X8JA 1T3HA 3QYPA 1DG3A 5ENDA 3QFRA 2PBZA 4KPUA 4O4IA 4A5SA 5CB4A 2OWEA 1JWBB 1OWLA 4K1XA 3RIYA 2OCPA 4B3SB 3CEJA 3KELA 5L7YA 4JJAA 1WH8A 3ME5A 3PHJA 3QBEA 4N8EA 4QXMA 3THWB 1M2KA 5A6SA 3CO0S 2Y3IA 3IQIX 3WYNA 3CJTA 2COKA 2DFKB 2WMDA 3VGJA 1O95A 4PR0A 2LUOA 5COBA 1F4LA 3VPBA 1I5EA 1D7AA 3CCBA 3IP5A 1PNRA 1L8XA 2XRFA 4XR4A 3ZWMA 1WPGA 3FR7A 4BMPB 2LWIA 1TC1A 1ECFA 1U0RA 3OKFA 2QORA 2DOKA 5KWSA 1UJ4A 2UKDA 5FWAA 1C9EA 2VUTA 2W2PA 4IOLA 1ZPQA 1ZD1A 2BGUA 2WU1A 3BORA 1FSZA 3COZA 4ZK2A 1C3LA 5BNZA 4PPNA 4ND8A 4F91B 2W4IA 4B6PA 2IC5A 2WD7B 3UCXA 4XQCA 3AVXA 1M6NA 3NH6A 3E9QA 1TRKA 1YL7A 1GQRA 1Z62A 4LZJA 4MRVA 4Q47A 4AJEA 5JCJD 2DSTA 1YRHA 4IGIA 4CJXA 5IM4A 4B4DA 1E3LA 1ULAA 1L8QA 2AC2A 2VIIA 1YCHA 2GHRA 2D2FA 5KJEA 5JISA 4RCVA 4WNAB 3COJA 4CCWA 4Q1BA 1SUAA 1M1XB 1L7OA 3JASB 2AOVA 2WG1A 4RTLA 1GEEA 1U63A 1BRTA 1CJSA 2WFLB 3MB8A 3F4KA 4N82A 3WL6A 3WIVA 3MJTA 1R8YA 1E2LA 2GPSA 2W6ID 4O1IA 4RV5A 4XDYA 5KYXB 2LVBA 2B83A 2JIZD 3RS7A 1XTZA 1IG0A 1T9ZA 2RAFA 5IBCA 2BJWA 4K3VA 3MWFA 2ZM6B 3L8HA 3BJZA 4GSLA 5FWNA 3B6JA 3NNDA 3D4NA 5F2OA 4MQFB 2CDNA 3BMOA 3BWXA 3KKOA 4B4VA 1OV4A 3OEHA 3Q8WA 3TLBA 2O2IA 4MMXB 1MKYA 5IKMA 2WKQA 2MTBA 5J1SB 3WC4A 3GQBB 3GAFA 3OPXA 4YLEA 2ZM5A 1P19A 2JJ2D 3DP9A 1Z4LA 3QEMB 4K87A 1UK6A 3Q7QA 5GM1A 2X4GA 1OFHA 2QAGA 2WR8A 2G09A 4E2WA 3KXPA 2JLRA 3PC6A 2XIQA 3SFZA 1TU0A 3DE3X 3HLTA 4HEA1 4DRXB 4WGGA 2W90A 1GGVA 3DNVB 3NBAA 2I2CA 2CW5A 1DFHA 3B89A 3PYXA 4UXIA 4DLNA 4HB2A 5HDBB 3VKVA 3ZHCA 1C0PA 4KO2S 5ALOA 2DEUA 4LE2A 1AUVA 2ZJ5A 4KACA 5CLGA 3UXHA 5DMHA 4G0WA 5B30A 5DK4A 2CL5A 3LQFA 3W78A 4OHPA 5DYTA 5IT0A 5ITZB 2X9LA 2H0RA 5HBRA 3REGA 2EIHA 2P9CA 2A1TS 4PG6A 1CB7A 4CR6A 3ONDA 2N42A 3I6BA 2W70A 3OSUA 4XYMA 1PGNA 1YQGA 4OP3A 5I7EA 5JTTA 3KZ3A 4Z7OB 1R6BX 1JHRA 4MITA 3HKCB 3RE1A 1DJNA 1YS2X 2GF9A 3F98A 1MF7A 2AWOA 2QVLA 2XCLA 4LGVA 3D9QX 3I5UA 1FZTA 5AVKA 1ZESA 2G1UA 1YZUA 3PDWA 3EY9A 4HNSA 4EHIA 1QGYA 2NUBA 4AYWA 3PRYA 5C34B 1SOWA 4CKEA 2V8OA 4E46A 3WRWA 5C8XA 1QDUA 2N9UA 2O8CB 5E3HA 1V8BA 2LV8A 1QV6A 3DH0A 1W88B 2NTYC 3I9OA 3P32A 2Q2VA 4GNRA 2WPDD 3LP5A 4WDQA 2W6CX 3PPYA 2BH9A 2F1IA 5AKZA 5EMKA 1XE3A 4OAOA 2PS3A 3JAMA 3KV3O 1U1GA 4OYLA 3U7RA 4AY2A 5EKDA 2SECE 1MEJA 1RQPA 2FE1A 3UW3A 4A2QA 4CPDA 4WESB 3WRXA 2Q49A 4XM0A 2LW7A 4X6XA 4I6UA 4LCJA 3FSEA 2IVFA 5F33A 3NHBA 1P8JA 2LCQA 4HAIA 2Z2JA 1RWPA 1T5LA 3PGVA 3JVUA 2R00A 5F2NA 3NBXX 3DUWA 2GS9A 3IEVA 1C9DB 1H2YA 4LRXA 3V42A 1XSEA 3CKYA 3WLAA 1QUEA 4QTTB 1G4UR 5AJTA 5A05A 3QXJA 2FDCA 5AUNB 4HN4B 1IAVA 4UHEA 1YR2A 4TQ9A 1OYOA 2G9NA 1P7WA 4FKZA 1KE1A 2GYWA 2YWHA 3EARA 4KFSA 1DJMA 1S4MA 3QG5A 1UT8A 3E81A 2H00A 1Y81A 1VA4A 1N6OA 2XF2A 3I6YA 2JAHA 3GZTB 2NTNA 2CXXA 2W2VA 1YVEI 1RR6A 3JAWB 4ND3A 3F6SA 5TMDA 4DLRA 4O02B 5C8DA 2WZCA 4ENVA 5JQWA 1JIVA 2IH2A 3CW9A 5AW5A 5JRJA 2QT0A 1F5SA 3AR6A 2IHTA 3M6LA 5D00A 1TMKA 3KWLA 3PDIA 7MDHA 1QQ7A 2CCGA 3F6RA 3IT0A 3P9SA 3SLKA 5JPIA 2FV8A 2OC4A 4HZUB 1G5IA 3RTBA 4HH1A 3I2IA 3QWGA 3NWJA 2ERYA 2Z30A 4C4PA 3OZXA 1A50B 2QGNA 2Y0BA 2IW1A 1L3IA 2XYQA 3CWZA 5FLEX 1GITA 5BWCA 3TW0A 1RMYA 1Z0FA 1G21A 1R0KA 4HUTA 3SI7A 2B1IA 3CZ9A 4FBMA 4JQZA 4NZOA 1ZAKA 4M7OA 3ZGXA 2FN8A 1D6JA 1SB9A 2APJA 2VTBA 1FP7A 1HETA 1UK9A 3D5QA 4BJ5A 2C7PA 1N1MA 1CTQA 3CGGA 3NP9A 3GJTA 5E7MA 4B79A 3S55A 5C5IA 5P21A 3RT1A 3QI2A 4HUQA 4B6JA 1FP4A 1E59A 3AFOA 1G66A 1RYZA 4PLYA 5K01A 3CRMA 4CT5A 3DR5A 1E9AA 1ECPA 3DONA 3REFA 4R8KA 4JHLA 4LFCB 2DBZA 2PIAA 3GRYA 4NV1A 2PIJA 2JA2A 3IT2A 5H68A 2RBEA 3CTMA 3UJPA 4D5EA 4ZYLA 4N76A 5DHFA 3D2AA 4KN5A 2GJ9A 2G9RA 2PMCA 4XZ3A 2VJKA 3OZCA 4FIZA 2R2GA 4JEUA 4DG9A 5AUOB 3H3XA 4FS3A 3WIEA 3UC5A 2V6FA 3GI1A 4ZCLA 1WUKS 4UUPA 4IRXA 5I01A 5EZ5A 3OKCA 2UZ0A 5A3JA 4H7HA 3PE6A 4LBYA 3GCZA 3BOSA 5JSKA 5LU9A 5GVSA 3WB0A 4MYTA 3WB9A 1VP9A 1N6NA 4OA5A 4I0WB 4ZC8A 3N5CA 3S3TA 5F76A 5BVGB 1JDUA 1V2HE 5FEMA 1X9GA 3GFPA 3L7IA 4GZLA 2HWYA 2ZDHA 5HF8A 4RTRA 3JQ8B 5BR4A 1G8PA 5D5QA 4HFRA 1UWLA 2V3CC 3K1YA 4TTPA 4MI1A 4ZVRA 4J0EA 4DXDA 2J3EA 2XCQA 2OE2A 2QGZA 1C8VB 2ZR7A 3EASA 1PO7A 1O08A 1ZH4A 2FW0A 3FCUB 4MYDA 2Q3HA 2IE0A 4X6LA 1XRPA 5JQGB 4P0PB 1I7PA 1UBLS 5K3FA 2IXGA 4US1R 3FYUC 4QUIA 2HK8A 4BAZA 2VCHA 1K63A 4CM4A 1NIPA 2Q3LA 3MTQA 4KVZA 4CM5A 5JHHB 5JSZA 4U5QA 2V7GA 2YJGA 1I2MA 4E2FA 1AM4D 1WKBA 2FF5A 1MJGM 1VBNA 4QUHA 5FAXA 4IH9A 1OA0A 2TSYB 3U4HA 3TELA 3QFIA 1JW9B 3A6ZA 2EFEB 5THQA 4A0FA 4ZZ1A 2BGMA 2WQ6A 1D1QA 1ENPA 1PG0A 5F1YA 4FN4A 1W49A 2PWBA 4HLDA 1M1YA 5F2KA 3L6OO 4BLQA 1KY4A 2ZWMA 2JCGA 3DV2A 2C9OA 3EG9A 1AKWA 4LJLA 1EA5A 3RHTA 4BZPA 4D6PA 5JS6A 2BYTA 3R5KA 4XSHA 2IYRA 4E7PA 4AN4A 2ZJ6A 2PFGA 4DCPA 2IVZA 4NRDA 5F7OA 1P17A 2A30A 2G6BA 3QVUA 1MO2A 4C89A 3L7BA 1VKJA 3MQ2A 3T3OA 1NL3A 1VZ3A 5KX5F 3NALA 5A06A 4G0MA 1ST2A 4UJ3A 3Q7EA 5ALQA 1ZKDA 4TTQA 5LP1A 3P94A 5GVRA 4MVJD 1ZRHA 3PBKA 2O8BA 4NDNE 1U1CA 3STUA 2YC2C 2GPTA 4TS3A 4I7EA 4PYNA 1KDYA 3QFTA 1Y42X 2JW5A 3MTAA 4ONEA 2J1LA 1IXRC 4NDZA 3HHPA 4LGYA 1XJCA 1GPAA 4NBVA 2HMUA 1TLFA 3OHMA 4PYMA 4X8OA 4B7CA 2PAAA 2XTMA 1FRZA 2XT6A 3EG5A 3M70A 5AJVB 1CQJA 4TS4A 5AJUA 1I1QB 4HAXA 4WK6A 2WJVA 4YRCA 3VAAA 2SBTA 4YIHA 1Y6JA 2FFRA 2V5AA 3HKBB 1E4VA 4QELA 4JCCA 4FLEA 1HE1C 5KYYB 3SLRA 2PH1A 3CQ9A 4J43A 4GXQA 3O4HA 3PGKA 3V8NA 4AI6A 1RQNA 4ZC1A 1VRWA 3N70A 1C3XA 3D8TA 2HB6A 3WR5A 3PPXA 4OAPA 3F67A 3IV7A 4OATA 2XNCA 3U62A 5HWSA 4K9QA 1J56A 1WDMA 4FFVA 1SBYA 1JDPA 3EC1A 3UH0A 4K81B 4BNXA 3DKPA 3KEGA 1MFPA 1RLIA 2Q6IA 3C4JA 4FYKA 4I4IA 1JDNA 5EJFA 5F1PA 3S2ZA 4KQ2A 5CDFE 4OQZA 1NNSA 1YQXA 1NQOA 3PFNA 4RF4A 4ARVA 1E9BA 3KSBC 1DIBA 1ELOA 5IMSA 4QU5A 2FWMX 2PPVA 2PQ0A 2QYHA 2PXHA 1L5QA 4GGOA 5DNWA 3R7WB 1Z3IX 3BGIA 1SY7A 3ROTA 3PNQA 5H4HA 3WGYA 3ZWAA 4L9WA 1OPXA 4AWBA 1UMKA 3AEZA 4ZV9A 1JJFA 1G5HA 4PXAA 1UQRA 5IF3A 3EQ6A 5ALLA 1GL7A 3OU6A 3ZHVA 2CNWA 4GZMA 3RSZA 1KZ6A 3DHWC 4LMAA 2FOIA 5H7XA 1AXEA 1RD4A 1QIFA 3COSA 1XDZA 3MLBA 1W7AA 2EEZA 1W5AA 2ESRA 2ZUVA 3CBQA 2AQHA 1OXVA 2XKAA 1AKUA 1JG7A 1JIUA 2IF2A 2J4DA 4EY7A 5J2UB 1PDWA 3UJDA 4B4WA 1H2WA 2ZQYA 4ROSA 1HURA 4WE3A 3CX8A 1DULA 1MXFA 2Q0HA 3DKKA 5EIBD 5HM6A 2PUFA 1II8A 2E4ZA 5C8YA 4DRZA 5J4YA 2AZDA 4Z0HO 3ZDQA 1UIMA 1JXAA 4NENA 1A9TA 3PA8A 4LRYA 2ZCVA 3VR6D 3ZE6A 1C4KA 4MRPA 4EDHA 1OH8A 4F4UA 4TWRA 1YOVB 1I4TD 3LVQE 4MROA 1W75A 1P73A 2ZZKA 3PEFA 4E5YA 1T2CA 1PYOA 1W94A 3L4BA 4JJ6A 4NYIR 3D8UA 3EGEA 1SEVA 1P18A 2WA2A 1T36B 5TPWB 4E70A 3ZK7A 1H3FA 2REXB 3E9DA 4KYTA 5FQOA 3BWBA 2Y77A 4DCCA 1A27A 4ZCIA 1JMKC 2AJDA 2V7UA 4UCQA 5B2ZA 3UMMA 3QXCA 4OXRA 1EFRA 1E4OA 5J1TB 3T34A 2PTHA 3K5PA 4TZ0A 5ABPA 3WLFA 1SXJE 1SFRA 5IAGA 3B5EA 2O48X 3AONB 3A4NA 1IU9A 2D1YA 3TZKA 5DM70 1P7YA 1PR2A 4NU6A 5AYVA 1MRNA 1G7CA 1S9DA 3SZ3A 4AMYA 3FXAA 4V0LA 5DHRA 2ZPUA 1S2LA 4MDFA 2WWIA 4KUHA 3GUCA 1GA1A 2XUQA 3MILA 3HKEA 2ODWA 4IQFA 5ED0A 1NNI1 1ZY2A 1E3EA 3WP0A 1RXUA 2F2TA 2X1VA 3BS3A 1DOAA 3BXPA 4QBFA 4P83A 4M0KA 2X8AA 4OFXA 3JVVA 3UPDA 1R5NA 4ARAA 2BFEA 2FMFA 3RRFA 3CLRD 5E8JA 2HZ7A 4P6VF 2Z83A 4IVQA 3DHYA 4UU8A 3CSDA 1QGUB 4HB0A 1RJGA 1V7QA 3FMVA 1ECGA 1KEUA 1OBHA 1BHQ1 2G25A 3G9TA 3NDRA 4FE4A 4JVSB 5K8UA 1T9KA 5LOVB 5B12A 5FO1A 4OPMA 3DMHA 3H3FA 2F1RA 4FILA 4MAAA 4G1MB 4UMDA 2OZEA 5LC1A 4RMJA 1QHHA 2PJUA 3GRAA 4LWOA 3C3YA 3LKDA 4N5DA 4B6RA 1OCTC 4GKJB 3P7MA 4GX2A 4Y2RA 3BRWD 1OV6A 2YV3A 4IGAA 4RA6B 4AMGA 3A2MA 5KINB 5MF6A 3MGCA 1A1SA 2FDRA 2GXQA 1ZMBA 5DTMA 2KEIA 3K0FA 5IWCA 4RTJA 4TKZA 2I5PO 3OJWA 4QHYA 1KO1A 1TM1E 3C1AA 3QVLA 3U3DA 3E5HA 3ZUPA 3PQDA 3PJDA 1RAFA 2P6UA 3G0DA 1X9IA 3SY8A 2VKTA 5ICMA 1GZHB 4Q66C 3WLQA 1PFGA 3ONEA 3ZCUA 2IYWA 3BDAA 3LF1A 3QG1A 4EF6A 5CFMA 2VG8A 2QTTA 4BNIA 4YRKA 3AF0A 1GKYA 2IXTA 3SYTA 2AZXA 3VPFA 2A5DA 4BLRA 1T2DA 1ICIA 2JQEA 5ALIA 2DERA 4WLFA 4JI7B 4W1RA 4AZ3B 5IZCA 1RJWA 2X76A 3VU9A 1DDOA 3W9SA 5BYBA 4EA7A 4F5YA 5A4FS 1PZHA 5JNUA 3JQRA 1UPBA 3PDUA 4V0QA 1M6HA 2G36A 4D3ZA 3IQWA 4I55F 3B1WA 3PQ5A 1JU3A 4BASA 2VI5A 2YW2A 2JI9A 4DDKA 3TQRA 1Z7YA 1VI5A 2CHQA 4AMZA 4M6WA 4MLDA 2BUCA 3ZQ4A 2FQXA 3DXFA 2HPZA 1OIWA 3ELUA 1HT1E 2JK0A 3H2SA 1Y4ZA 3JQGA 3IAM1 5FULA 4BMYA 5ALTA 3T7DA 1VHQA 4P3KA 1VL8A 4PYKA 4UVGA 2AOUB 1WUIS 4HGOA 4TT8A 3IILA 4E4YA 5HF6A 4L4XA 4OB4A 4ZGWA 1Z37A 3H6KA 4EY5A 3UKDA 1VLVA 6ABPA 1NUHA 2WV7A 4C6TA 3U3WA 5IC5A 4WX2B 5KQPA 3B60A 2XRMA 4TROA 4BMOB 5JXIA 1DIOB 2DFTA 2I3AA 2QW1A 2VHCA 3PWKA 4HQ0A 1OI7A 1NAIA 1O94C 2ZJ2A 3H17A 4OM8A 1KI8A 2Z2ZA 1UMBA 3NIDB 4ABTA 4FI3F 2BI7A 1DXOA 2D0OB 2HCJB 3MSXA 3CF6R 5ALJA 3D6FA 1S4QA 4R1QA 2G1PA 4MW0A 4HF7A 4YMUA 3DAOA 2IXAA 4MI3A 2QT1A 1T1JA 3QVSA 3BH6A 3QA9A 4ZEOA 4FZ3A 1HG0A 4Q1EA 3ZU2A 4JXZA 3CUVA 4QDKA 4QGBA 4NP6A 3OF5A 1L7VC 2NU7A 1TAGA 4E22A 1MB9A 3OO0A 3UWMA 2VNKA 1TD1A 1QHYA 2ZG6A 1A96A 3WLKX 2VEOA 3UVEA 1THGA 2XOXA 1UJBA 1GFSA 4X1YA 3U6BA 1V1JA 2DYKA 3DW3X 1T8TA 3KOWA 3LP8A 2CWDA 2HRBA 1PS8A 1NF3A 2EW8A 4JJGA 4UVIA 3OZRA 4BWVA 4W9MC 1B0PA 3ET5A 4Y1GA 1N3LA 5KCMA 2YQZA 1W5SA 2FF7A 4MR7B 4QWWA 3LFHA 2GM3A 3HCFA 4OB6A 5BMOA 4L7VA 3OJFA 2NTJA 1J0BA 1DSSG 4GMGA 1U04A 3CG4A 1ZS9A 1OR8A 4D9MA 3CVYA 2GHTA 4ZHQA 4HB4A 2XI8A 1N0WA 2ZSIA 2YJNA 3QXXA 5KYVA 5LQAA 3IQEA 3B20A 3QYJA 4JYCA 3BHIA 1TZCA 4TTVA 1QB2A 1XZGA 5NULA 3URMA 2J9FA 3RS9A 5B6JA 3PC8C 3EEQA 1HQCA 3TO5A 3AP2A 1JIXA 2QOEA 4JR2A 1YF3A 3O74A 1U99A 1J2YA 5FF9A 3ZDAA 4EI8A 4Z6KA 1NOJA 1U6JA 1E64A 3TFLA 3KNZA 4CLOA 2AZMA 1Z63A 3DF9A 2A67A 1QV7A 1ZMRA 2R1VA 4N6GA 4PLTA 5FIUA 3B82A 3KHUA 4BGIA 3R4CA 3L1KA 4UEWA 4B4OA 3ZW7A 4BDSA 2PZMA 3KUCA 4LNAA 2H4FA 3ZDFA 3L5KA 3MYRA 5D3KA 1GV1A 2AH5A 2PQMA 2X2EA 1SOUA 2JAUA 4G0ZA 1TA9A 3W0LB 3RFCA 3HO6A 3C3WA 5TR9A 5EKSA 1YZHA 4LF7B 2A6PA 4Y2JA 1NBEA 2DR0A 2AI3A 2CUTA 2J3IA 5KPDA 4GPEA 1ZJWA 2EX0A 2RDMA 2YYAA 3O4FA 4M88A 3V2UA 1Y0BA 3SC2B 2QN8A 4MS4A 2ICTA 1O96A 3WK7A 4EW3A 3NBQA 3EZ7A 3QW4B 3DFKA 1ZU4A 4I1YA 2O8FA 1EJBA 4X7BA 2CD7A 3CNOA 1M1NB 4KQEA 4H1VA 4NPCA 4CU5A 4MVJG 3THXB 3V46A 4BQPA 2EHDA 3BE6A 1Q91A 1L7NA 4Q15A 5DYGA 4NULA 4O4IF 1Y1PA 4NOJA 4CLDA 4EBBA 5CB4F 3LIPA 2PANA 5LXTA 4L28A 2VHQA 1N6IA 2IY9A 2VNJA 4CM8B 4JGBA 2GOYA 4DBLC 1KO5A 1O9GA 4M98A 4WZZA 3V4FA 1KVQA 4XX0A 2Q4EA 2HMAA 2IUSA 4G8DA 2XE4A 4DV6B 2BFNA 3FWPA 5ELLA 3PUIA 4IL5A 3CE6A 1VIAA 5DHSA 1JLRA 2OGTA 3BFPA 3NJ8A 4IG4A 3RUPA 4UBNA 4PO1A 5LB4A 1W59A 3WZMA 4KN9S 3I3OA 3TQQA 2EWTA 4MLPA 2EG9A 2VDKB 4GI1A 1BYUA 1RI1A 1JSZA 3U3KA 4UHDA 2P9QA 4Q93A 3ZKWB 3EX7C 1K8RA 2PR7A 3MWGA 3CBGA 4GPBA 2GTIA 5G4KB 1YFLA 3GJYA 2O3JA 2WYIA 4AT1A 4F2HA 2JFGA 3QJ5A 4LHEA 1S89A 3CG0A 5CBKA 3PXBA 4WRRA 4RLQA 1SBNE 4R8SA 4YG4A 1M7BA 2IOFK 1K7YA 5HJEA 5CM2Z 5IM4F 3BERA 1QGZA 1HDYA 2IOQA 2PMKA 4JK3A 4QLAA 5KTRA 3NDIA 4FMDF 3ETJA 5DLEA 3U5ZB 2ONCA 1Q1NA 2QX9A 1XEWY 1XOIA 4DW8A 5CTJA 5AW2A 4FSDA 2I6SA 3HN7A 2XQIA 4WXEA 1JJAA 3TLZA 3CYFA 2HL6A 2IV7A 4YLYA 4JBNA 3GAAA 2BZSA 2Y1EA 3N7AA 1IHUA 1PVVA 1RZ3A 2Z9DA 4JC8A 1KJWA 1Z22A 4N39A 5KTPA 3GEPA 1N6KA 4ZRDA 1IXYA 2XNSA 1JQ3A 4B1FA 4EMTA 1J07A 2Q5IA 2CNOA 2JHGA 1IULA 2VA9A 3GNQA 2XT9A 2H7XA 1LS6A 3H9GA 3L0PA 4B33A 221PA 1ZJJA 4DV1B 4WPGA 4BO5A 4DQUA 1O9HA 2OY0A 2H8RA 4G8BA 2KMLA 1L5ZA 1ZC3A 4MQBA 1SVKA 1Z6ZA 3O0DA 4JUBA 2W2LD 1EXNA 3VU1A 2IPOA 3BFVA 2AFVA 4NCAA 3FTFA 1CIJA 4KJZA 3MPOA 4M46A 5TQVA 3VI4B 1LWNA 3MMNA 5D7BA 3O4RA 1UOOA 2QIPA 1U8EA 4FX5A 1IWOA 4PAGA 2GCEA 4P4UA 1QTIA 4YQYA 3K9CA 2BISA 1K2VN 4QXRA 4ZCPA 4FWTA 2DR2A 3CMCO 2PUVA 4HD8A 2IOHA 4F71A 1XZJA 2YBEA 5B1DA 2QX8A 2TYSB 3E8SA 1UPUA 2BGNA 2DPXA 3EMBA 3P26A 3NONA 5MHTA 1IQ0A 2F7SA 2CLFB 4IR7A 1GRVA 1I9CA 2CDCA 1TLTA 2XGGA 2I4NA 3IIMA 2R8BA 2MSLA 1AZWA 3UAOA 2FKAA 1HZZC 3OZSA 2GXSA 2ZANA 3UCFA 4YK7A 1NBOA 5DN6A 2LNMA 1IFXA 3NRJA 3HP7A 4KMOA 3D2BA 3DOCA 3HCDA 4ZVVA 4IHKA 4CMIA 2B2CA 5FI0B 1YT5A 2X9NA 3H1PA 4JT8A 4JUCA 4EPTA 1HI9A 4G6ZA 2C5AA 4NFYA 4D4KA 4BYMA 4E88A 2D0DA 4EI7A 2B99A 3ANYB 4UUQA 4HAWA 3TSAA 5F3DA 2YL2A 4KYUA 3FBGA 1ZRMA 3M3PA 3G2HA 1D4AA 3K71B 2II6A 3WLLA 1RHUA 4P98A 3ADOA 4K6CA 1A9XA 4BO9A 3W8DA 1FYFA 4Y6PA 3ZI4A 2HDHA 1WB6A 4NJEA 4F3NA 5BY2A 1IJKA 1Z5GA 3TD2A 3QEBZ 2PX0A 3S2UA 3OPVA 4AULA 5AIBA 1KRXA 2HH9A 3UM9A 3SVZA 1T3ZA 4XASA 1T2UA 2H0AA 2YMMA 2HA3A 2JVJA 4U2DA 5FJJA 4DY6A 5BSWA 1J24A 4TMYA 1F8FA 3I52A 2QYOA 2GKGA 2H07A 2IZ0A 3M5CA 3MA0A 5IZ4A 5M04A 1V8DA 1A5SB 2NSJA 3DEKA 1Y8ZA 1JFRA 4Z4HA 3GHYA 1Z15A 4RVUA 2ICAA 4PX5A 2VDUE 2MMCA 4B3FX 4Z7NB 2D2VA 3V1YA 2GLTA 4HDNA 5ES4B 1CUIA 1EZZA 1WTAA 4W5HA 4TV9B 4Q1DA 2CBZA 4FHGA 4FFOA 4Y2UA 1KSFX 1B23P 3I01A 5KNCA 1Z4IA 2NXJA 1QCYA 4YG7B 4M9SA 3S7TA 1JJ7A 3A05A 1W9HA 1RHQA 2V0GA 4CEJA 3LT2A 1G5FA 2C9MA 4ZVLA 1O8CA 2D5BA 3WKAA 2HEGA 3KU4A 5EERA 3CRRA 3KKZA 4UNIA 5A4IS 1YRYE 4AMBA 2VJNA 2YICA 2GBLA 2VJDA 5AO9A 3P2JA 2BDUA 3GCGA 3L3BA 4RTOA 1ACJA 1T9CA 4KXLA 1A72A 4RW0A 3C5EA 2JLZA 3ILYA 1ULBA 1ZJ6A 1XLUA 4LJRA 2R25B 2IU6A 5TLSA 2BLLA 3C48A 3HBJA 1BXRA 4ER0A 4UATA 4ZO4A 5EUBA 4A0SA 4ZZIA 3BZBA 3LKZA 3K2BA 3BCSA 3CR3C 3ROXA 1YGPA 3UFXA 3AXSA 4QYXA 3QENA 1CY8A 4CF3A 2OAQ1 4M99A 1V8OA 1AMOA 4Q9LA 1YI0A 4HO1X 1Z88A 2JGDA 1XXHB 4Z4FA 2HT1A 3OWHA 4WD3A 1QGED 1EK2A 2FPIA 2GO7A 3H5IA 1Q0ZA 4FE3A 1M6VB 2IUYA 3DJYA 4NWIA 3UHJA 3C6YA 4POAA 1K8YB 5AW3A 3VR3D 4LBWA 3K96A 3DXYA 4DLTA 1PQUA 5C4MA 2Z2KA 3KWFA 3FYUA 1CERA 3RYIA 2CXPA 3REQA 4E94A 3D6NB 2FMXA 2EKZA 3F2IA 4K6MA 1M2NA 4EL0A 2JI4A 4W1PA 4XA8A 5JBQA 2RB4A 2VWGA 4BNUA 4ZEWA 2V03A 2ZSHA 1U0JA 4QT0A 3UG7A 5BW4A 4TYWA 4FGLA 3JAKA 4RJTA 4F86A 2H3EA 1JAIA 3GEBA 2Q8PA 4OTZA 2VUHB 4H3HB 2G5GX 2Y8EA 3SF8B 2WTBA 4LRWA 4MA4A 1F2VA 3WB1A 3DB2A 2NZUG 4D9EA 1WPXA 1I4DD 3WNCA 1AXRA 4PCAA 4KOEC 5EJEA 4BNLA 4FJ1A 4FVTA 1B26A 3CH6A 3CISA 1AU7A 3VO9A 2PZKA 3UB3A 5AOCA 1CDDA 2J08A 3AF2A 4HYYA 4LRSB 4QGGA 5AP9A 5A9TA 3TSOA 3OEYA 5IDYA 2YXLA 4Z1MA 2A1IA 4TWIA 2HRCA 4YY3B 1V7PC 2NP7A 1SXHA 4EHNA 3TG8A 1KSHA 1YRAA 4JKIA 5ALGA 1MV5A 5JU6A 4PPYA 5CDHA 3CSUA 2YRFA 3NEPX 5E6SB 2VRCA 1GTRA 5J4HA 4CQNA 3OWOA 5CAEA 3SE0A 1YJAA 2QSYA 4YTEA 3QPCA 2E82A 3IP1A 5FOWA 1YB1A 3IMGA 5DHUA 4CCYB 5BUCA 2AG8A 4ETWA 1IPHA 1HR0B 4OD0A 3ROZA 5TQ0A 3DMTA 1Q2UA 2JH3A 3RHSA 2DLDA 5EAIA 3TUJC 3WMWA 3FHLA 4CIVA 1YD7A 2WA1A 5I4KA 1FCJA 2QHXA 2VDOB 4L8LA 4HY3A 1HEUA 4GXNA 2R44A 5B3AA 1Z26A 2DFNA 1NW6A 1P2SA 4UTRA 4LPSA 2PCJA 3DL0A 2BGRA 4HWRA 1E7WA 4J49A 4TRMA 2XAUA 4TSKA 4KXXA 1Y3IA 5HKKD 1IEWA 5K45A 2I7DA 2FWAA 2QAIA 3KEMA 4N0DA 3WHLA 4BX2A 4Z3KA 4RJKA 1YHNA 1ZINA 2O7VA 2EC5A 4DBZA 3EFEA 2QSJA 2C1ZA 5J2TA 1CLEA 1O5IA 2BTQA 3ISJA 4N0MA 3ZDCA 4LFBB 1CQXA 1YI8A 621PA 2V4UA 2YN4A 2ZVQX 3FZGA 1Z8HA 3I9LA 1MZPA 1WF6A 3IPYA 1K6IA 4WIAA 2WNIA 4ZMBA 3PWTA 3TIVA 1TQ8A 3VNRA 1MU0A 3DQQA 3FPKA 1Z6QA 4RLSA 3FCCA 4CM6A 1X7YA 4B44A 5JSFA 1T25A 2WJWA 4BNGA 2Y9MB 5AI9A 3T7IA 4YP1A 3WL8A 2EWVA 1ADFA 4MLZA 2BDEA 2GKOA 4F46A 4KQIA 4WJKB 5LA6B 1IH8A 1L7DA 5FYQA 1E2BA 1Y8QA 4E5UA 3H9BA 3K1JA 1VG0B 4RTMA 2R1JL 4OJMX 1EE9A 2V1XA 3VH2A 1X7XB 4CHTA 1SGWA 4BWGA 2IV3A 4C14A 3TE7A 3MRVA 4QEKA 1EINA 1E0AA 3DCJA 1QGAA 2XIJA 3L8GA 4IF6A 1NNLA 2OPBA 3OESA 3QWFA 1ORDA 2B34A 3FFAA 2K7ZA 3BF7A 1XAJA 1EUCB 5JO9A 4XSVA 1MXHA 1FP6A 4NATA 2ZU0C 5AHRA 4NEHB 3HGTA 5KQGA 2WIDA 3C1UA 4MS3A 1EH5A 5JSHA 2QP9X 5HCIA 2OENG 4W9NA 4EY8A 3EA0A 4DM7A 3E03A 4IDQA 4KVAA 4DIUA 1KO7A 2BFFA 1CFZA 4X84A 3QLUA 2D0IA 2HU8A 2XSZD 3FSJX 2EATA 4MWGA 1GAXA 1FS4A 1OUMA 4D97A 4H6WA 1AGRA 1ZJ5A 2VXOA 3D7LA 5BPHA 5IFLA 4WVLA 1A9RA 1GT0C 3QUTA 5AXCA 4HQLA 2NZ2A 2CE2X 1E3JA 2Z1MA 2BEWA 5E7QA 5CT6A 3NUGA 4ACBA 1EJ2A 3OU7A 2E4XA 1XRRA 5JS2A 1CUDA 2OZLA 1QIIA 3B6EA 2AV6A 1AJEA 1T9GS 3ETGA 2I2BA 1R8SA 3FVRA 3LV8A 1NUTA 1NVUQ 2BBWA 2OM6A 4Q6BA 1M2JA 2HHAA 4I1IA 3VH1A 3AVYA 2Q9UA 3LGAA 3KP1A 5C8YF 4KITB 1FA9A 1TGVA 1JEQA 3K73O 4JVMA 4BFTA 2FWNA 4CN9A 3IUJA 1M2OB 3VHRA 4NBLA 2QM3A 2WM3A 4MCAA 1MX1A 1ZPDA 2NU8B 4HVCA 5D5HA 1NOKA 3UY4A 3S8EA 4CF7A 4ZQBA 5J40A 3U60B 4RWEA 2RHOA 1ID1A 3G6KA 3ZZUA 1TA0A 1N5IA 4RV4A 1ZRNA 4INZA 1TT5A 3CKLA 4M0MA 3R5SA 2IHZA 4K9DA 4GSYA 5IK2D 1VHWA 3P5SA 2Q6TA 3AF5A 3PX2A 2QU7A 4DA9A 4ZEMA 3OFND 2M6LA 2FMHA 4ALNA 3RVOA 4C4RA 3ZJYA 4JKYA 4PFKA 2FOXA 1ZGCA 1TMYA 3TNFA 3F9CA 4XJVA 3CW2A 1QE0A 1KJJA 4D8WA 1GDHA 1FYVA 2ZTUA 1XFDA 3L6UA 4HSGA 3FW1A 1LLQA 4S0XA 3HCOA 4BB6A 4C0KA 2Z57A 2WE8A 4I6GA 4HUJA 1JTEA 4BLPA 1W1UA 3CXUA 2E49A 2IVGA 2BSQA 2OXTA 1B0ZA 1EEHA 1GLVA 3NC1C 3O3MB 3BDIA 3EGXB 13PKA 4F72A 1J0CA 1N2IA 4QGSA 4CTJA 1LUAA 3AHCA 1KOFA 1KVUA 3PJGA 2VOEA 5H70A 1J6UA 3WI7A 5ALYA 2FJUA 3ELWA 1VB5A 3B1ZA 2JL1A 4ZYTA 2O4AA 5F98A 1G20A 3T4XA 4D99A 3W3AD 3CF4G 3I5AA 1KY2A 4PLVA 1D2GA 1P0PA 1QC5A 3R0QA 1GPLA 1R6UA 5DB4A 4PCUA 4O4HB 4RJJA 2FPSA 1OGIA 1SXJD 1ZVJA 2W9XA 2W2MA 5JNVA 2ZUDA 4PXSA 3S5JA 3ILHA 3NWPA 2GYVA 4H18A 3LYHA 2HXGA 3M4ZA 5DBGA 4LOJA 3ZS9A 1V11B 2VZLA 4NCIA 1WPRA 5HR5A 2Y68A 2NZVG 5DXJA 5I9IA 3ITNA 2G06A 4NYJR 1GEGA 2PRIA 4ZT2A 3DLTA 5CHEA 1YQWA 3MWDB 4OM7A 2ZB7A 3MGGA 4JYAB 3S5UA 4QXAA 3EXHC 1TU3A 2XXBA 5HFJA 1XHFA 1J8DA 5BNFA 4WCFC 4A2PA 4YR7A 2HA7A 2ZOSA 3RUEA 5I7RA 1O94A 4JT2A 4QOHA 1G98A 1X57A 1SURA 3FD8A 4P2BA 4W5QA 2OCYC 2ID9A 3OC6A 1XD2A 2A5LA 3BD6A 4ZYZA 1B42A 2AYXA 3IAFA 2NZWA 2RFLA 3FZQA 1A7UA 4KAAA 5HNKA 1ZA1A 1FL9A 4H1TA 4H35A 1EFCA 3SU8A 1GXSB 3UAYA 3VPGA 3W5IA 2ILTA 3X2FA 2VZ9A 3NIFB 1ISHA 5LD2B 3MTDA 1SPBS 4FYJA 1RBZA 2BHLA 3S1LA 2J6BA 2PD3A 2Z04A 1DJQA 4BFVA 3PKZA 4BZXA 4CE6A 5CG2A 3O93A 4FFNA 3U7QA 2BM1A 1I5OA 3HB0A 5FBZA 3TMAA 4CR7A 4N01A 1BDMA 4EKDA 5TMBA 1IJEA 1MOZA 1OF1A 2KWIA 3N07A 2GCPA 3QPBA 1XTQA 2BNNA 1KQPA 2VHEA 3ZIAA 2C7QA 1SZCA 2EHJA 3AC0A 3DOOA 3EZGA 1FVXA 3UJ8A 1Q6ZA 3C7TA 3VVMA 5CB8A 3IPLA 1CEQA 1D7OA 1S3GA 3RJMA 3R74A 1HV8A 4Z4QA 2Y9PB 1U3DA 1L8OA 3KDPA 4L5CA 1DKPA 3K6RA 2ZT8A 5C1DA 1B8VA 1E5VA 2YDYA 3TRFA 2R6JA 2IKQA 2PN1A 2RC5A 4MEBA 5CM8B 5B5SA 4L4UA 2JI7A 1EFVA 1ZU5A 3Q3GE 1Q3HA 1MJ5A 3ELYA 5E4TA 1M2VA 2XOEA 3PZRA 3PC8A 4MTLA 3WMRA 1XB2A 3QOYA 3MWJA 2QYSA 4EG3A 2CK3A 2W11A 4HTFB 4DZRA 1K7EB 4DA7A 4BQSA 2OD9A 3KJFA 1NRWA 5HFNA 1Z28A 3ZJVA 2AW3A 2BMWA 1E6UA 1ORVA 1ZVKA 2JPDA 1DOHA 3W6PA 4E4RA 5FDFA 1EDEA 5CU7A 5E4YA 2FVYA 3B7WA 1HG1A 3PTLA 5IVIA 1M34B 2IYZA 2YQ5A 1F8GA 3ZY2A 1XRNA 4NBWA 5FPPA 2EQ5A 3T1OA 3QYXA 5KYTA 4N54A 4WCVA 2ZJBA 4J7AA 4XFKA 1CS0B 3W90A 4B3BA 3I1IA 4MUNA 3OD5A 1U2GC 2M1XA 2PZGA 3FSGA 3UENA 1SOAA 4TMXA 3P0FA 5FR1A 4PIVA 1CG6A 4PBTA 1GG5A 2YMLA 1RE1A 3THRA 3H9EO 4LOKA 1AGNA 1XI2A 3M6WA 3GARA 2XUPA 3E15A 1MR3F 1JHZA 4HGQA 4RD2A 1EDZA 1TIPA 1YCGA 2OFOA 1Y5NA 3IDFA 1SCDA 3IP7A 5JZMA 4FU0A 5KS2A 3UTDA 2ZI7A 3VJRA 3BL6A 1U3FA 1GKLA 1APBA 1JS1X 3K0KA 3WKCA 5KOJA 1BKDR 5JVDB 1V5IA 1Z17A 1GVHA 5EP2A 2MT9A 4BNFA 4C7JA 2X5OA 3WKDA 4OHVA 2VP3A 1NF2A 3VR2A 1ZD9A 3HB5X 5DYIA 5CXUA 1V4NA 3K6SB 2ZREA 1XDGA 2NZJA 1Z36A 3IPCA 4ND7A 4E32A 4IXNA 2QRNA 3CVVA 1PJ2A 3D8SA 3PEEA 2O7RA 3GL9A 4LVCA 1QMGA 1SA0A 2NT4A 4TZ6A 1XMSA 1YUBA 4C3ZA 1G9TA 3L8YA 5DF1A 5TT0A 4ZGGA 1SEPA 1SUBA 3DB1A 3HACA 1ULHA 4X3PA 5JAPA 3N2LA 1QYWA 2WUFA 2J3QA 2Q6LA 3EISA 3Q40A 1TYZA 3A4MA 1IIRA 3NYRA 1OX4A 4ZT4A 3MN1A 4B2YA 2AN1A 3AP3A 2LR0A 3EZ2A 5A5GA 1ZOOA 3O9VA 2EW1A 3A6FA 1ZIOA 3PTZA 2C7GA 2Z5FA 4I4TA 3RSCA 1PIWA 1Q1AA 3CX7A 4DB4A 5EXPA 1EA7A 1Q0SA 3DNMA 4EJ2A 5ICSA 3R0JA 2ZAIA 1YCDA 3UJCA 1E3SA 1G21E 4EPXA 5K3OA 4OGLA 1JG6A 2OB2A 3BKXA 2I6QA 4QEZA 3A9TA 2DFLA 1P5RA 2A7QA 1PBTA 2CDBA 1LTHR 3D54D 5DZSA 4EYOA 4JX8A 1BA2A 2BEVB 3JYLA 3LNCA 2PRJA 5BN3B 2COEA 1A77A 1HSOA 1KSJA 2V7TA 2XLBA 3FF1A 5CITA 2L82A 5AVUA 4BQOA 2R6DA 2ANCA 4TUYB 2DX7A 1CJUC 2EAUA 4KN8A 4M8IA 4PGHA 1SU8A 2B8EA 5JLAA 5LXTF 4PHGA 3RU7A 1FPQA 2IU4A 5JD6A 2PZLA 4YRNA 3Q11A 3DOEA 3B2EA 3OA0A 2MSKA 2B4YA 4CLRB 2E3JA 1U3GA 2HUPA 3W5SA 4YROA 3P9KA 4JR0A 3P2KA 1OZGA 3WX0A 3MTEA 4U2CA 3CONA 4AJ4A 2ZTHA 2NWQA 4J6EA 4BNNA 1E3MA 2MU1A 3QI7A 3L7CA 4Z9FA 1JSCA 4PX3A 2VYCA 3QF7A 4DRYA 4MCXA 5C53B 2GEUA 1VGVA 1C1XA 1VP3A 1VE5A 3I2JA 4C07A 1OJLA 2XTAA 1MO3A 1A9PA 1GQFA 4OHFA