4ER3A

Crystal structure of human dot1l in complex with inhibitor epz004777
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
328
structure length
311
Chain Sequence
KLELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMENYVLIDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTTQPMKLNTRPSTGLLRHILQQVYNHSVTDPEKLNNETSFDLVAQMIDEIKMTDDDLFVDLGSGVGQVVLQVAAATNCKHHYGVEKADIPAKYAETMDREFRKWMKWYGKKHAEYTLERGDFLSEEWRERIANTSVIFVNNFAFGPEVDHQLKERFANMKEGGRIVSSKPFAPLNFRINSRNLSDIGTIMRVVELSPLKGSVSYYLHTIDRTILENYFSSLKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Histone-lysine N-methyltransferase, H3 lysine-79 specific
publication title Catalytic site remodelling of the DOT1L methyltransferase by selective inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 93
structure length 311
sequence length 328
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2012-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08123 DOT1 Histone methylation protein DOT1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.60 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) 434 Repressor (Amino-terminal Domain) 4er3A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4er3A02
3DMGA 3LX6A 1QAOA 3TLJA 4YV2A 1EAMA 1R00A 4ER5A 3LCVB 4RTRA 3LDUA 3DH0A 3FRHA 1YFJA 3JWIA 8MHTA 2GPYA 4PGHA 3C3YA 2IBTA 4FGZA 2I6GA 3G8BA 2CMHA 3NDJA 3CJQA 5FA8A 3GCZA 4RTKA 1G8SA 1XDUA 1EQAA 1TPYA 3HVHA 4OX9Y 4GC9A 4RTNA 2PX2A 1QAQA 1JR4A 3A7DA 2ONYA 3LKZA 4PYLA 3OZTA 3A25A 3GIWA 3VYWA 1EJ0A 2ZZKA 5K0EA 4YV1A 5K0GA 1KXZA 2OB1A 2PKWA 3HCFA 4ISCA 1L3IA 2FK7A 2Y1WA 3HEMA 3A26A 2AN3A 4R8SA 1L3BA 3BKXA 3PFGA 4QPPA 1JG3A 3ANXA 1JG2A 3RODA 1O54A 3ELYA 4RTOA 4GOND 3UA3A 3I53A 1M6YA 3L8DA 3OU7A 1XDSA 3NTVA 3DTNA 4KIGA 3OU6A 3G5LA 3LDFA 5D1HA 3HA5A 4RTSA 2AZTA 3UJ7A 1F3LA 1G8AA 4C05A 1YFLA 5K05A 4HC4A 4QQKA 4CXMA 1P1CA 3DR5A 2EG5A 3T7SA 2UYQA 3IEIA 3UJBA 2EX4A 2DULA 1JTEA 3P71T 2BM8A 3KQMA 3FPEA 1X1AA 2EFJA 5K09A 1G38A 5IKMA 3C0KA 5BP7A 2JH8A 2YXEA 3BKWA 5CM2Z 2VDUE 1KPHA 5T64A 3HA3A 5C0OE 2GAFA 2IP2A 4FS8A 2BZGA 3E05A 4PONA 5DM2A 4DA4A 2C7QA 1FJXA 1QANA 1L3CA 4OA8A 2YVLA 3LCCA 4X1OA 4A6DA 1TW2A 2BR3A 1SQFA 2PT6A 2YR0A 3DXXA 5FWAA 4OBXA 4KVZA 4F86A 1HMYA 3M6VA 5E2AA 1UFKA 3THSA 5EKUA 5E9WA 2NYUA 3HA7A 1ZHFA 4QPNA 4QQNA 3BXOA 5EEHA 3RIEA 1ZGJA 1XVAA 3IV6A 4CKCA 1R8XA 5GM2A 3EVGA 4Y2HA 2ZW9A 3T0IA 5HEKA 1VBFA 3GJYA 4KWCA 2IBSA 2P41A 4RYLA 4DCMA 5FULA 3PVCA 1RI1A 3C6KA 1VE3A 3M70A 3LBYA 5EEGA 3GRZA 5BW5A 5G02A 1NKVA 2ZIEA 4F85A 4RTQA 1UIRA 5CD1A 5DT2A 1YF3A 1R18A 1KYWA 3MAGA 4C03A 3KQYA 4EQZA 2NXNA 3SR4A 3PX2A 1XTPA 1BOOA 4MQ4A 2PX8A 2P3LA 3QOXA 5FA5A 3FUUA 4P7JA 4ER6A 1NT2A 2B78A 3EGVA 3FUWA 2ZWAA 4RTLA 1WZNA 5GINE 2AVDA 5K0NA 3T7TA 1F38A 2CWWA 5HIIA 5DSXA 2G71A 2Z6AA 5DRYA 2OPBA 5GIPE 2ZBQA 4XUDA 2VS1A 5EVJA 1P1BA 3NMUF 2OBFA 2R3SA 4XUEA 5EMKA 4DQ0A 3KU1A 2ZTHA 4X63A 5FQNA 3LDGA 1JQDA 3OE4A 3HCDA 1AV6A 2GH1A 2P7IA 2CKDA 3LPMA 4BP1A 2ZBRA 3SXJA 4V0QA 2GLUA 3JWJA 3PFHA 1I1NA 4OQEA 3GRVA 1Q0SA 5DLYA 1YZHA 2I62A 5ICFA 1XDZA 4KIFA 3LGAA 1RI2A 2V74B 3R24A 4P7GA 3VC2A 3UJDA 2IDJA 3VC1A 2YUIA 3NDIA 4MWZA 3A27A 3TPZA 3MTEA 1G6Q1 3EVEA 3MCZA 3A7EA 4U7TB 2ZFUA 3EMBA 3DLCA 2FYTA 3IYLW 2AOUA 3KQQA 2IH4A 4HGZA 4RTMA 4RV9A 2GS9A 5GWXA 3G2MA 4EKIA 2K4MA 3DUWA 3KPWA 3TKAA 5F2NA 5K0CA 1KIAA 2PXCA 2HWKA 5BXYA 3OCJA 4HG2A 5LQUA 4DM3A 4BLVA 2PX5A 3K6RA 5LQCA 5CCXA 5K0BA 3RW9A 4RX1A 3X0DA 5DX8A 5EKXA 3NVKI 4E2WA 4XCXA 4PCAA 2G70A 1RJFA 1JQ3A 2P1DA 1PJZA 2ZBPA 2QY6A 5DTRA 4YMGA 4IV8A 3I9FA 2Z6UA 4HTFA 2JHCA 3FPGA 4E2ZA 1WXXA 2QRVA 2XVAA 1ZG3A 4M37A 2FPOA 4FT2A 2PVCA 4CTJA 4LWOA 5E1MA 2H1RA 4IV0A 3MQ2A 4YUXA 2LD4A 2GA9A 3I5UA 1XCJA 1KHHA 1DUSA 1ZGAA 1RJEA 3GRUA 3KQOA 3ORHA 5DXAA 4Z2YA 1X1BA 3GO4A 3KPYA 1QZZA 2AOTA 1FP1D 7MHTA 3OZSA 2ORED 5EMJA 2ESRA 3MB5A 2QE6A 2P3OA 3SSOA 3UWPA 5LQAA 5CVUA 5KQSA 5F2OA 2WA2A 1DCTA 1XJ5A 4EK9A 2Q41A 3DXZA 4M7RA 3ELDA 4UOEA 1HNNA 4E31A 3B5IA 5E1BA 3OFKA 4PINA 3FUXA 2V7EA 3TM4A 1AF7A 3M6WA 1FBNA 4OBWA 5DTQA 4P58A 3FPFA 3LHDA 3WSTA 5GOZA 1VLMA 1RJGA 3GDHA 3TM5A 3OE5A 3EVCA 4FSDA 3JWHA 1VP3A 5ICCA 4E32A 3BT7A 3FYDA 1AQIA 3KR1A 5GM1A 3O31A 5EOVA 3BUSA 3MGGA 2PSSA 4OQDA 3KR2A 3AXTA 4FZVA 1RJDA 2JH9A 4ATNA 1NE2A 1SG9A 2YXLA 5HFJA 2HV9A 2IGTA 4AZSA 4R6WA 2HTEA 3AXSA 3REOA 2C7OA 3LKDA 1Y8CA 3UZUA 3HVJA 3UJ9A 3IHTA 4P7FA 2FRXA 1RI5A 5EIWA 1FP2A 4GUAA 3R9XB 5DSTA 1X19A 3B89A 4X41A 5KQRA 1U2ZA 2FK8A 3FZGA 3G7UA 3P8ZA 5DXJA 5H02A 2G1PA 4ER0A 1NW7A 3EEYA 3KQPA 4QDJA 4HRAA 3PT9A 3LECA 4M38A 5KS2A 3R6TA 4R8RA 5EHIA 2ZSUA 1JSXA 3HCCA 2EJTA 3G2QA 5FTWA 5JUWA 5HOQA 5EG5A 2YQZA 4PYNA 3ME5A 3FYCA 2IFTA 4QVKA 2BR4A 1YB2A 3EVZA 4KRGA 2WK1A 3CC8A 3HNRA 4X61A 3P9KA 5CUQA 1FPQA 1Z3CA 3FTCA 5U4XA 3EMDA 2AR0A 2PXXA 3A4TA 2NP7A 3FPJA 3ID6C 2BR5A 3T7RA 2NXEA 3EPPA 3HCEA 3V8VA 5ICEA 5EMLA 5EMMA 5CIYA 3ER9A 1WXWA 3M6UA 1P39A 3P9CA 5DM1A 2AOVA 2NXCA 3KR0A 3GNLA 5EZSA 3VSEA 3B3FA 4ER3A 2EJUA 2PLWA 1X1DA 5FHRA 1QAMA 5LQKA 1SUSA 3BWBA 5EC8A 1O9HA 1SVUA 1RI3A 2VZ9A 4PCLA 4PYQA 5FWDA 3MCTA 3CBGA 3NJRA 2HMYB 3GGDA 3UA4A 3KR9A 5K0JA 2ZCJA 2KW5A 4CTKA 4G56A 4LG1A 1X1CA 2Z6QA 2N47A 10MHA 3CKKA 4FR0A 3SMQA 4GBED 1JSZA 1T43A 3BZBA 3M6XA 4PYJA 3E23A 1IXKA 5C9ZA 4LECA 4PNEA 3EVDA 3ERCA 5DM0A 3SVZA 2FCAA 3G8AA 1SUIA 2AS0A 5E1DA 3DMHA 5EPEA 5IH3A 4C08A 1I9GA 3BGIA 3HTXA 1M0EA 3PTAA 4FP9A 3AJDA 2C7RA 4HTFB 5T67A 4MHTA 5JR3A 2ZIFA 2QRVB 2AN5A 4QTTB 4IKPA 3JWGA 1WS6A 4ZTBA 3I64A 1EJ6A 5LR6A 2IH2A 5FADA 2CL5A 5ICGA 3B7PA 4WVLA 3BWMA 3P2KA 5CVVA 1Q0TA 3B3GA 3DP7A 3GXOA 1L9KA 3E7PA 2AOWA 5GIOE 3G2PA 4AZWA 4AZTA 4YUVA 2B25A 1KPGA 3MTIA 2I9KA 5FCDA 3FUVA 3NW9A 5BW4A 4PIMA 4K6MA 2ADMA 4POOA 2PX4A 5E9QA 3UJ6A 1NW3A 3HCAA 3M4XA 4BLUA 1N2XA 5DX1A 2BH2A 4PIPA 5GP1A 1D2HA 2YX1A 3UBTA 4C07A 4RTPA 1OR8A 3R3HA 2G72A 2O07A 4KW7A 2G8NA 4X60A 4FSXA 4F84A 5LQJA 3PB3A 1ZKDA 3FRIA 3OZRA 1JG4A 2AVNA 5CVEA 2HNKA 2ZIGA 3HP7A 4C06A 4P7KA 2B9EA 4L7VA 2PV0A 5HIKA 5K01A 5KYGA 4HSGA 5P8WA 5LSAA 1MJFA 4ER7A 2ZWVA 1VL5A 3FTFA 1N7JA 3GRRA 5DX0A 2FHPA 1NW8A 3G89A 3HM2A 4GOMD 2ZLBA 4GOOD 5FUBA 3PLAE 1KYZA 3CGGA 5ERGB 1XXLA 1KPIA 3UJCA 4OA5A 2O06A 4Y30A 3P2EA 3O7WA 2A14A 3HCBA 4RVFA 2VDVE 2ERCA 5DRTA 3G5TA 3C3PA 2O57A 3NWBA 1ZQ9A 1NV8A 4LWPA 2YXDA 5DPMA 3QOWA 3KPJA 3KQSA 3LSTA 2UYOA 4U7PB 5CCBA 2AOXA 1SKMA 2P8JA 2OXTA 1WG8A 2OB2A 2OYRA 1NW5A 4QTUB 5DWQA 5FQOA 4YUWA 4DKJA 3EGEA 5MHTA 3P9IA 4GEKA 5E1OA 2XVMA 1VPTA 2IDKA 2P35A 3O4FA 4PYKA 4QDKA 3SGLA 1BKYA 2NP6A 2NNWB 3EVFA 2BM9A 2QM3A 3SSMA 2OZVA 2PWPA 2DPMA 3MERA 3KQVA 5KVAA 1BHJA 3KPVA 4E70A 3GWZA 4EVIA 4PYIA 1M6EX 2IPXA 4YV0A 2I7CA 4QVGA 3I58A 1R8YA 3DMFA 2PBFA 3DOUA 3LL7A 3UJ8A 3TQSA 4HH4A 4A6EA 3M33A 4DF3A 3HVKA 1DL5A 1YZ3A 5EQJB 3KQWA 3R0QA 1TW3A 3ER8A 3UFBA 5LQNA 3CVOA 1N7IA 4BLWA 1G55A 2VP3A 4MIKA 1VQ1A 2ONZA 2OO3A 3ELWA 3EEOA 3QV2A 3TMAA 5E8RA 3G2OA 5CVDA 2UYHA 5EIFA 1R74A 3KHKA 3PX3A 5C1IA 4DCGA 2ZVJA 3SM3A 2PXAA 5D1NA 4C04A 2UZ4A 2C7PA 4EKGA 3K0BA 1RI4A 3HVIA 4GC5A 4KDRA 1YUBA 3TR6A 2PJDA 3AWIA 4GF5A 4YUZA 3SSNA 1PRYA 2E5WA 3FTDA 4DMGA 4E30A 2ZZMA 3TFWA 3OPNA 4WXHA 3H2BA 1JQEA 1I4WA 3BGVA 5HZMA 3GU3A 5EZQA 4CKEA 3UJAA 2VDWA 2Y1XA 1L1EA 3LBFA 4RWZA 4E2XA 3Q87B 3BWCA 1AQJA 4BY9E 2JG3A 4PYMA 1QYRA 4GQBA 1ORHA 3F4KA 3EGIA 2OKCA 3CJRA 4CWAA 4RTJA 3NWEA 1EIZA 1JG1A 4PWYA 1MHTA 2PGXA 3GRYA 4CKBA 4NECA 2XYRA 2JHPA 5FHQA 4AZVA 4IWNA 4YMHA 1EG2A 2AOUB 3OFJA 2B2CA 2PWYA 5DTMA 3E8SA 4AUKA 4RVGA 3PS9A 2R6ZA 4RSRA 2NXJA 3EVAA 1KR5A 1XCLA 3KPUA 3TRKA 5EGSA 1NBHA 3V97A 1VP9A 2XYVA 3KKZA 5M5BA 4AX8A 1B42A 1UWVA 1VIDA 1KP9A 3D2LA 3S68A 3Q7EA 2AN4A 2B3TA 2P3QA 1V39A 3EVBA 4KDCA 5HIMA 2ZZNA 1G60A 2O0LA 4C4AA 3CJTA 2CMGA 4RVHA 3P9NA 5K0LA 4R05A 2P7HA 1P91A 4PGGA 3LCUA 2GB4A 2ZULA 5E2BA 1NBIA 2YTZA 1NV9A 2H00A 1D2GA 4PYOA 5HIJA 3DXYA 3SX0A 5B1SA 1JTFA 4R6XA 2PY6A 5DM4A 3NVMB 5HILA 2IIPA 2JHAA 3B3JA 3BWYA 2P40A 3THRA 3FTEA 3ELUA 5EHGA 4YUYA 3P2IA 3FUTA 2QYOA 4O29A 4DZRA 3AY0A 4JXJA 2O05A 2UYCA 4E33A 1SQGA 2AOTB 3FPHA 5E8JA 4V0RA 4RVDA 3CCFA 2WA1A 3DULA 3KQTA 4HGYA 4BP3A 2IH5A 3MHTA 2XBMA 1IY9A 1BC5A 1R6AA 2JJQA 9MHTA 4XUCA 1D2CA 3TOSA 5CVJA 5K0FA 4H0NA 3OU2A 2H11A 1WY7A 5K03A 1INLA 1NW6A 4FT4A 4GOLD 4MTLA 2F8LA 2OY0A 5T6BA 5LQRA 3U81A 3C6MA 2HR1A 1ORIA 3BGDA 2PT9A 5K8VA 3G88A 4B17A 5F2KA 4M36A 3P97A 3TKYA 3DLIA 1O9GA 4EMSA 1IM8A 4E2YA 2XYQA 5E9JA 1H1DA
chains in the Genus database with same CATH superfamily
2YIDA 3NXKA 3FFTA 4L74A 3AF3A 1KEEA 3WI7A 2JGEA 1W0JD 1P9LA 2UXCB 4YBZA 2H0AA 4PS0A 5HTOA 3E48A 2ZR7A 3IP9A 4OG2A 4RKRA 1QR6A 4MLCA 4Q9HA 1EFLA 1ZHHA 2QN9A 1JXMA 1V1MA 4Q82A 3H4TA 3FDJA 3KWMA 4B75A 5ALVA 4LNUA 4D3DA 5IJ0A 5K4GA 3HXKA 1SEVA 1EVYA 2HRBA 3RI3A 3QUTA 2M6SA 3D54D 1T2NA 1VHLA 2WU8A 4MYHA 3WL7A 1QAQA 2PSJA 2FRDC 2FUG6 2XWBF 4C4PA 1EJ0A 4EAAA 2Z09A 5K0GA 2IU7A 4WSOA 1XTZA 5AK0A 4YPOA 4CM3A 3MJTA 5DT9A 3F9CA 1MO4A 4NE7A 3WWOA 4QHSA 4AYWA 1BVRA 1DEXA 3EQ7A 3IBYA 1J97A 2MXDA 4PSDA 3VO8A 5JVDF 2AE2A 2ECFA 4JGIA 1MJ5A 4ZO6A 1ZPQA 2WMOB 3RODA 4GP7A 2HSJA 3QQPA 4MARA 1UPFA 3OHSX 3QEJA 3W4KA 1II0A 2JF0A 1SM4A 4KMMA 4LC1A 4CV1A 1N9KA 2WYOA 2RHGB 4O2AA 1PTKA 2H1IA 4QARA 2QROA 3EX7C 1DBQA 1XCOA 5SY4A 2F9MA 5CB4F 2BFPA 2FZVA 3EQZA 2GBFA 2CVHA 4BNVA 5LOVB 1K8YB 4WW0A 3DONA 3KQMA 4DMUB 5KYYA 4KR3A 2VLBA 1T8PA 2C83A 1QCZA 4TTRA 3OOEA 2JH8A 2YOGA 1ONBA 1B8PA 1VB5A 1DB3A 2ONKA 3DTVB 4L3VA 4PANA 3IUYA 5C9ZA 1LRJA 1QRUA 2CFRA 4GPZA 1WY5A 1FRNA 1L9XA 4HRXA 4DBZA 2ZJFA 3ETLA 4YLGA 1HORA 2I7VA 2NPFA 2AL7A 5M04A 1B8NA 2FG6C 3U3KA 4CT5A 1FIUA 3PEUA 5JRJA 1DIAA 3MG9A 4NCHA 4UW9A 1WCWA 3OIYA 2A0FA 4W8HA 4OU4A 1JH9A 5K3SA 4IIYA 4JQZA 5E9WA 2FSVC 4NVRA 4OI1A 1YKGA 4QQNA 2PUCA 4PZ9A 2C9MA 3QFFA 1YUMA 1K7EB 1GA1A 1SIUA 2HRDA 2OFXA 3HDJA 4TYPA 9ATCA 1SXQA 2KZ8A 3IMKA 3K32A 3STWA 1IK4A 5KINB 2G1UA 5LYJF 2NZUG 4WBSA 3H05A 3ETGA 4IYRA 1MTZA 4JL5A 4PG5A 4RQTA 1A2KC 1T2DA 1ZRMA 2ZANA 2HA6A 2FRDA 4V03A 4JI6B 1PJ8A 1T36A 3HB4X 1OHHD 4HLDA 4I4LA 3IESA 3LZDA 4Y9RA 4C03A 1Y6FA 4RZQA 4C4YA 1W85A 1BOOA 2AD5A 1A8SA 4ZHQA 3MUFA 4Z99A 5G0WA 4IDQA 1M2FA 4ER6A 2O3TA 2XOXA 2ZT7A 4PR3A 1NT2A 2ZUFA 3CRQA 4LHSA 1SVNA 5EVCA 2O8FB 3IUJA 2HMAA 1Z6GA 4D92A 1KEKA 4YV7A 1AGRA 2JARA 1YR7A 1M2VA 2HTFA 2VBGA 1Z2DA 1SD2A 3JQPA 2MEZA 3HYSA 2CLKB 3N8GA 2RHTA 3KJGA 3OLCX 4RY0A 1AKTA 2VUUA 1ECPA 1QGDA 3THXB 2HUPA 5B3JC 1XEFA 5JY6A 2Q5LA 3QYAA 3KUDA 2HA0A 4MGHA 4AY5A 1ORTA 3LPMA 3IHWA 1H94A 1RYBA 4CG2A 2H59A 4I5FA 2PS9A 1W75A 1JLMA 4C29A 1M1ZA 3IKTA 2QX7A 5ARBA 4D7AA 4DR5B 4YRZA 4MR9A 4KAAA 2WJIA 4E14A 4LA4A 2IXGA 3TBKA 1IQRA 2NM0A 3DL7A 3OKAA 4G67A 1COWD 4WLUA 3X1ZA 1J0CA 4L7QA 3MMZA 1TAQA 1B16A 2FGKA 3RTEA 1L4GA 1YB7A 3EF1A 3NDIA 4QDZA 1TJ3A 3QLTA 4U7TB 3KV3O 3C8HA 3STHA 5J2UB 5SYAA 2JD1A 2IW3A 1SGWA 1Z7YA 2AOUA 2XTAA 2ZE7A 1EFPB 1K6MA 2R25B 2J0UB 2FSVA 1S9HA 3HKEB 2QLBA 4INPA 4EKIA 2K4MA 1CWUA 2QDKA 4GGMX 1A9ZA 1VI5A 4GO1A 1D4AA 2O7NA 3RFFA 2O7SA 4CI9A 1G8PA 3DQQA 1LW6E 4CBVA 1X7YA 1HT3A 2AXZA 3RUIA 3NJ4A 5EKXA 3NLLA 3W8NA 4WV3A 3L8MA 8AT1A 1PYOA 5KYWA 3TQCA 2XB8A 4FLEA 2P1DA 4KPYA 1C3OB 4OKNA 2M1XA 1DKUA 1Z5OA 1Q0QA 2C2YA 4X95A 1L5KA 4E2ZA 2XVAA 4QNNA 1SN7A 5EKSA 3U3OA 4G36A 2V9PA 2YRWA 4V1CI 1MJNA 3TD2A 3DV9A 4W7IA 4KQGA 4ZO4A 4CJXA 1EE2A 3RSFA 5BMVA 4UVDA 5CXSA 4Z9FA 5KVQA 3Q8MA 3TUJC 4TWAA 1XR3A 4DCSA 1K88A 1DFHA 1WW2A 1ZGAA 2REQB 5EWLA 3DLBA 1DV1A 2ZTVA 3MMXA 3C85A 4TKVA 1I0LA 2OQIA 3Q8LA 3P4XA 2Q9AA 3AVTA 1E69A 3BRWA 1NTOA 2ZQYA 5JSFA 1FQKA 5B30A 5JNRA 1NEQA 3VNBA 4QAJA 3KKOA 1Z17A 2J08A 4CUZA 3OZ7A 1V16B 4M7RA 5DBHX 5B3JA 3U60B 2IZOA 5GTDA 3OZUA 2Q5FA 1U3GA 1CQJB 1UOPA 4G4SP 2QJFA 4PINA 1K08A 3PJFA 3LOPA 2VOEA 1IVYA 1D9XA 2XUHA 4TLMB 2WKRA 1XGKA 2V3VA 3BMNB 2X5OA 1A9PA 2GD0A 4B3MB 4I55F 1QUEA 1JJ7A 1ACJA 3UCXA 1QG6A 3BT7A 5IJWA 5K4HA 5A71A 4ZOLB 1WX1A 3JQQA 5J23A 1MTOA 3FMPB 2CFCA 4GYKA 3UK2A 2QWXA 4ATNA 5JAHA 5FBRB 1SG9A 4Z9XA 4FUQA 1B1CA 3VR2A 5HS4A 1O5OA 2FPRA 1E7RA 2VJBA 4B85A 2CNOA 3DMTC 1UKZA 3BIOA 2ANCA 2XT6A 3DBVO 1BFUA 3EMKA 2JVIA 2YBEA 4GVXA 3AQ4A 5G0UA 2BRUC 2JEYA 5DSTA 3H1BA 2O0MA 4Y0NA 3RM3A 3EXAA 1PX2A 1T0BA 2KPOA 3M1LA 4I5DA 4UUPA 1AKWA 3KT6A 5H02A 2X7JA 4G5GA 4XB6B 1C9YA 2FR0A 1IZ7A 4QQ8A 3A1UA 5GVRA 5TSDA 1UXDA 1VJ1A 4LHZA 4BPRA 2BJWA 5BSWA 2EC5A 3QLVA 4B3CA 2CF5A 5JO9A 4AXXA 4R40A 1I6WA 5EHIA 7MDHA 2HBRA 3H5OA 3FB4A 2YQZA 3EVNA 5K8CA 3G7SA 4LY6A 4ZAWA 2IFTA 3IHKA 1GSAA 3TAXA 1EM8B 2I2FA 4DE8A 3MCAA 1EUCB 1MEJA 3IBCA 4AIIA 1LI4A 3CLUD 3GLRA 1ECGA 5GJCA 1E1MA 3REQB 1JKJB 4U02A 2CYAA 2PU7A 3JZAA 2WD8A 2OLEA 3GEEA 4D8VA 3QEOA 3RABA 2DPLA 2X9NA 2VXYA 4GI1A 4L5YA 5KYNA 4GZLA 3V8VA 5EMLA 1RABA 1XMIA 3QFCA 1U2DC 1GTL1 4ZDWA 2TSYB 3T7AA 2NACA 4UHFA 4XX0B 5JPDA 5JNLA 2ZIAA 1LBEA 1F60A 2FWJA 2XGJA 3QY9A 1P39A 2Z56A 3ZWBA 4DV6B 4EUFA 2YWDA 3DL2A 1TIBA 1E7WA 1USGA 2RGXA 3FSGA 3HXLA 3K05A 4JQSA 4BVBA 5A02A 2O0HA 2EJWA 2G0TA 2RJ3A 3AOEC 4WLNA 4RZXA 2OM2A 2VKTA 1BXGB 4PYQA 1MFQC 1R0YA 2G08A 1YS1X 4WZBA 5E7MA 4E5KA 4TYWA 5K0JA 4LI3X 4G56A 3UT0A 3K53A 3BL6A 2N47A 1JEOA 4LX8A 2VF4X 4G2NA 4QG3A 3ZVRA 2BFFA 1LK5A 5L51A 4LK2A 1J6UA 2PMWB 2XGGA 2D1TA 2WFLA 4D96A 1P8JA 4FZ5A 1GZ4A 2AS0A 4L5IA 3BGIA 3DVAA 4IFTA 1H3EA 2PSEA 3DMTA 3KJFA 1ND5A 3QKSA 3JAWB 1GCGA 3UXEA 5K8IA 4B3RB 2AQIA 2WUSR 1US8B 2BRUA 4ZMBA 5LR6A 2C4WA 2IH2A 1FNMA 2BSXA 4ZAGA 1TU4A 2VRBA 4EVQA 1EK1A 3DP7A 3MRSA 4JEHA 1GPNA 3MJVA 2QTCA 1G2PA 1N0UA 4O4HB 1Z12A 1GZ3A 4F3RA 2EBFX 5BW4A 4Y2TA 4D02A 1GL9B 3CNQS 5I7HA 5DBEX 2JI7A 4Y9SA 2VWQA 4MDEA 4HADA 4BLUA 1O87A 1G6KA 5C4MA 5TRTA 2I7DA 2V5UA 1A7UA 1D6MA 2CFTA 2JI4A 2JAXA 3GEBA 4PIPA 3UTCA 5JOQA 5FV7A 1RQNA 5MGNA 1PVDA 2BMJA 1TIPA 1QLHA 1XZEA 2IV1A 2BV3A 2HX1A 2O07A 3ZQUA 1DFGA 5JZSA 4ZMSA 4I9UA 4ESOA 1XMPA 2DFTA 2G9QA 1SB9A 2DFKB 3PB3A 4YBRA 4DE5A 1J09A 2ZIGA 5ALGA 1VJTA 1XTSA 3FJOA 4P7KA 3RZZA 3BTOA 2F8MA 4BNNA 5P8WA 3C7CB 3LX8A 1PGOA 1U2DA 2MTBA 5A5EA 3N5KA 5EP4A 3AETA 5IK2D 3K1ZA 4WK6A 4AKEA 2ZLBA 2Y71A 1I2DA 1IEVA 1TT5B 1V6AA 2IP1A 2OENG 2N42A 1YHNA 4I36A 1SJ9A 4MUFA 4N41A 2GYWA 2WKPA 1ZUGA 1C7EA 1GUZA 1E61A 3OC6A 4ZI7B 3AOEA 3HUFA 3NIBA 4MRRA 4WT7A 4Y30A 2IYVA 4F6RA 3D6VA 1S6YA 2PTGA 2OCBA 4KPGA 3V8NA 2IUOA 1ISSA 3EZXA 3ET4A 1J2TA 4Y6QA 4ZU3A 2WF9A 1YI8A 1QTQA 5CLGA 4PCUA 4BMNA 4JN6B 4UHJA 4WY8A 1MAWA 5F9FA 2OCYC 2KMLA 4EHKA 5MHTA 2GO1A 1FNBA 3JQRA 2XVMA 3P9IA 2P35A 1FQWA 2IKQA 5JZVA 3RS3A 2GKSA 3PNYA 1QPBA 2JAPA 1GRCA 1MB2A 3HDTA 2QENA 1YK0A 1B0UA 5JV5A 3LPCA 4QYTA 2J3IA 3ZWVA 1UF9A 5FFMA 3K6SB 1FC0A 4BLQA 1ZVJA 2HH9A 2ZSEA 1I13A 3AU8A 4RL6A 3EWNA 1JPUA 3JZMA 3SU8A 4ERNA 3NDRA 2QUAA 1QSGA 1EXMA 3U1VA 3ZI0A 1YACA 4Q1AA 4W6ZA 1E92A 4DOMA 2D7DA 1GEEA 3UJ8A 1GNQA 2KEIA 2C8KA 1VL1A 1CDDA 2YCLA 3ZCQA 1EINA 1T3LA 4XYGA 3L02A 3UFBA 1J99A 3L49A 1L7VC 2RGWA 4TXMA 1H3NA 1VLJA 2CNDA 2QSJA 4M49A 4H3HB 4F8YA 1YE5A 1XNQB 1CUIA 2ZSHA 2GZMA 2YXPX 3G2OA 4FMCF 1LZKA 1Q91A 4B81A 1P62B 3N07A 3OTWA 4C04A 1RI4A 2B2NA 1DQZA 4ARSA 5C8YA 1E99A 2NPIA 4TVOA 1JHYA 2XQVA 2C0PA 3SFZA 5AW2A 1WMSA 3OPNA 4DDVA 3U49A 1LSUA 3FF1A 3DUFB 4G1MB 3USES 3GLFA 1BE0A 1MFPA 5BVHA 2VH1A 3IB6A 3R3JA 2FLVA 4WCDA 2CHEA 1FLDA 3C7AA 4TTPA 1JVBA 1QYRA 1SU4A 2I8LA 3GCDA 5ECGC 4X64B 4DYDA 2PE5A 3E1GA 4U00A 1OREA 1WH8A 1Z5UA 4P35A 4A26A 5TEWA 1NBOA 4OLFA 2G36A 3E03A 3ER6A 5JG7A 1OI7A 3QHAA 3UK7A 3JD3A 4Y2PA 3A3NA 3RFXA 5TF4A 3SX4A 3ZLTA 1V8ZA 2BEJA 3OUUA 3NR2A 4LYFA 5C35A 2XXBA 4AUKA 4TT3A 3DCJA 4GIBA 1H5UA 2A33A 4OSOA 3QUCA 1E5LA 1ECCA 1VP9A 5T3UA 1VSUA 3ED5A 2JCSA 4MW1A 4Q1CA 1UWVA 3VV3A 5B64A 5LP6F 1Y3DE 3QU9A 4K9LA 1MH1A 2WLTA 3GJSA 4PO1A 4C9BA 3G85A 4KLZA 4TV9B 4UHEA 5CX1A 4AKIA 1BMFA 2QT0A 1Z5VA 5D2CA 1D2MA 1JWAB 5ITVA 2Y0EA 3LCUA 2ZULA 1QVAA 1T5DX 3N59A 4PO3X 3SE7A 2W58A 1VBMA 1C30A 2B4RO 2OCLA 2CZGA 2X2OA 3GARA 3HJNA 4DCVA 1DC7A 1ACLA 2WHXA 5JS1A 2JIZD 4DLLA 1IIBA 2E4ZA 2ZI9A 5FIUA 5JNTA 1EDDA 3EY4A 3L1IA 3R9KA 3VR0A 1ZGGA 4UEWA 4HEA1 4KR7A 3N75A 4X1KB 4WZ6A 2BD0A 3G02A 1V48A 2Q5CA 3Q3EA 5DI3A 4CCYA 2PHZA 1YDHA 4BNDA 4M2LA 2P9FA 2AYYA 3UMYA 3A4YA 3BCHA 2C0CA 3ZKAA 3JVUA 4KPEC 4JCYA 1D8TA 4PN7A 3V9AA 4KB5A 1MC1A 3AJAA 4PXSA 2A4MA 4BQIA 1PDWA 4TM8A 3DBHB 4M8SA 2H2FA 3INTA 3FPKA 4CU5A 4Q9KA 4EMSA 1M76A 1JIIA 2BFEB 3V4SA 3T7RA 4E2YA 5FPHA 1IMOA 4MKXA 3LTNC 2POQX 3C74A 5KKAA 5IBQA 3L7AA 1IZYA 2R7KA 2AQHA 2QMZA 4ER5A 3MCWA 5D6OA 1E3QA 4DLSA 4HVCA 1DLIA 2XADA 3E9YA 3QVOA 3T3GA 5I51A 2WE7A 1U5BA 3KKMA 3CT4A 1C14A 2VWGA 4YIKA 2II6A 4NJMB 3HPQA 2QE7A 4L9SA 5JECA 4QUJA 4HRYA 2GBCA 5TJ9A 2UZ3A 2DT8A 2LYSA 5EKDA 1LY1A 2PK3A 1XDUA 4QAQA 1TPYA 4UBKA 4OJNA 1RKVA 4WECA 5F3RA 2PSDA 5K3DA 4EJMA 3VH4A 3R9WA 1N2IA 2HLDD 3BULA 3EUSA 4D3SA 5JJLA 1AKEA 3BTUA 1RZRD 1VB3A 4NMMA 1QQ5A 3O2QB 3RG8A 1NXPA 5ALIA 3KVYA 4A36A 1HE3A 3A9RA 1NQOA 4ZWNA 1XWWA 2YWCA 1DAIA 4BQRA 1GLVA 3V2HA 4QBTA 1DG3A 1QHGA 4BX9A 1CJSA 3I53A 1M6YA 1F8GA 3FA2A 1MB4A 3ABRB 1XPJA 4HB4A 3EQ8A 2IZ7A 1RIOA 1KQPA 1SOAA 4JP3A 1B2RA 3FXAA 3HU3A 5AYVA 2FV8A 4FQ7A 3UCEA 3VDNB 3ZTWA 1ZP6A 1HYGA 2GNPA 4C7BA 1JFSA 4FEYA 4XAQA 4RULA 4UHHA 2IY8A 3QM1A 4RABA 4BNKA 4K0KB 1RWNA 1EXWA 4H0CA 2BM8A 3OLVA 1FPMA 2HWWA 3FR7A 4YWHA 2B4KA 3N2KA 1E1NA 1UJ4A 1M1XB 3C0KA 4Z1MA 1HKHA 4AZWA 1GN8A 4N8SA 2WUDA 4UHCA 2EJBA 2YNMD 5C0OE 4XWYA 4P54A 4PO9A 4A03A 1QZUA 4GU5A 4XRRA 3KQHA 1L3CA 5CITA 2DUNA 2EKQA 2BC9A 1Q0PA 2GCPA 2W6JD 1SU7A 4IILA 4Q7JB 5G4LA 2NU8A 1EI9A 5G1PA 1RC8A 3SHWA 2YR0A 2HGZA 5FWAA 2ZBFA 4MNTA 4UCXA 4CT0A 1N2HA 3C3WA 4B6QA 2GRUA 2LW7A 1Y7PA 1WA5A 3WRYC 3QX3A 4BWVA 1ZHFA 4GM1A 1T15A 1OI2A 3RIEA 1E3OC 1N2OA 1UDBA 3ZHCA 4CHGA 3CF6R 3UAOA 3VOTA 3MINB 1JHMA 2VT2A 4XWTA 2V7GA 3CVUA 4MVYA 3BH7A 3KRTA 5IVPA 2O50A 4EHBA 3IE0A 3M70A 3HHEA 2NU9B 5KJCA 1SY7A 3DE1X 3HP1A 1KVSA 4Q00A 1FTGA 5GZ3A 1GZVA 2X9QA 3PNSA 5G41A 1FRZA 1NKVA 1R88A 2DH5A 2QUIA 1ZESA 5EQFA 1UIRA 1Z15A 4NHOA 4BFTA 3OT4A 4HP8A 1M7GA 3LQYA 3MD9A 4HOYA 4IO1A 1K89A 4G0WA 2GM9A 4ZA2A 5AD1A 1EU1A 1MPXA 4R7ZA 3K9CA 4UZEA 3ZHZA 4CNQA 2A9RA 1BAPA 1DUVG 4EB0A 1UJNA 2Q9BA 4ZQHA 3QVSA 1C9DB 5SY9A 3LC0A 1KEUA 4HNGA 3WZLA 3HLTA 5IABA 2EEPA 1WZNA 5BV2P 4L8VA 4ME6A 1P60A 2DLNA 3DEZA 3EGWA 3N86A 1AMUA 1WXIA 4CN9A 5CNMA 4ZI2A 4DG5A 5AW8A 2QBYB 3DAYA 4N12A 1YZVA 1PR9A 2Q6VA 2SNIE 3IRVA 4K7JA 2GD6A 5JANA 1PNQA 5DOVA 4UNSA 2VQEB 5LWHA 2X9VA 2ZI4A 3D8BA 4J1WA 1ISFA 4NATA 3GLFE 2ZS8A 3LQRA 4TZKA 1HG1A 3ZWCA 3UAXA 3QVGA 1AB6A 1O77A 1EDOA 4ZQFA 5KJ1A 5BWMA 3O8DA 1N0IA 1YZHA 5CA1B 3D4LA 5G1NA 1D2RA 2WHYA 4MW9A 1BN7A 2ADOA 2JCYA 3PR2B 4Z4EA 1RPZA 2I1WA 1RI2A 1YR9A 2PYIA 1Z5GA 4FOPA 1JZSA 3H19A 5TVGA 2PR7A 4Q0MA 3ZV6A 3DEHA 2JVLA 1VJDA 3VKWA 2HFZA 5NLLA 5L6LB 1PR3A 1W4CA 3TI7A 4PX2A 1NVMB 1DDGA 4IIJF 1XRQA 3CHYA 2MDTA 3NALA 5H70A 1L5MA 2FG7C 1QCCA 1ZJ4A 5K2MA 1TD9A 3KB2A 4RV9A 1XJQA 2QJOA 3WRYA 3DUWA 4JJZA 3W90A 4R8VA 2W90A 5CDFA 1FLNA 2R44A 3WNVA 1AQYA 1XHEA 5EZ5A 1IBCA 3SC3A 4EB3A 1RE1A 2XZTA 4CODB 3B2QA 4YT8A 2G5GX 2VA8A 2R84A 1EB8A 3TELA 1H4SA 4X1YB 3ZIAD 1JKMA 3BXXA 3WK4A 5DTRA 4A2CA 4HYYA 5BWLA 4UMDA 3LLSA 4W5QA 2Q3BA 1YQ9A 4J4TA 4Q4JA 3PPXA 4ZYYA 1ZG3A 1JJIA 1RM3A 4UNIA 2G7MC 1JQKA 2XUGA 5ADHA 2BTEA 2FPOA 3ROFA 4Y0AA 2AF3C 3KXLA 5KC9A 1B0AA 2BN4A 1L8XA 4QRIA 2LD4A 2WQZA 5D51S 2BBTA 2ZSFA 3I5UA 1NXXA 4IHJB 4OHPA 4QPCA 4ZYTA 1QB7A 4Z4FA 1UWLA 1QU2A 3V42A 4HPWA 4GZ6A 1GVHA 2GASA 3ONNA 1T3GA 2W83A 5EIBC 3SY8A 4AP9A 5J1SB 1G3IA 3QFHA 5CA0B 1TJYA 4IR7A 1HXHA 2QQ5A 5IUJC 2CDRA 2FQXA 1LPNA 3NG1A 4JEIA 1FYDA 3OJEA 4J0KA 1MR3F 5TARA 3X1XA 5K8TA 1PVOA 1G8MA 1TYBE 5K0TA 2ZREA 3DHNA 3RBAA 2C0QA 5I7FA 2OCKA 4LF6B 4A8PA 4JENA 3T12A 3DWFA 2JGFA 3X2SA 3PE6A 3CB4A 4KFUA 4BCCA 1N77A 1GGNA 4W7HA 5THKA 4MR8A 2XQGA 3QE2A 2FP4A 3BXGA 4OAQA 3N76A 2QI9F 4IIEA 1RXIA 2OHHA 4BGUA 1UH5A 1N2JA 3RTGA 3CVXA 2VFAA 3VH2A 3FKJA 3LW8A 3R9IA 3PWSA 5HXAA 4R9VA 3UWKA 1KDYA 1E4EB 4JCCA 1XUOA 3TTYA 4MW6A 3ZNQA 4BE9A 3VYRB 1IB6A 2NSYA 1USVA 1VLQA 2IGTA 1TA9A 2HTEA 3DZHA 3PUYA 5ALFA 2BGUA 3IL2A 1L1QA 4NZNA 1SUAA 2C9CA 3UOWA 1GGKA 3BRCA 3OQIB 4KE7A 2HA3A 4CF6A 1BW9B 4W5WA 4IDPA 4TMKA 4EH1A 3O73A 4QXOA 4LXQA 5IMBA 3KZVA 1EA7A 2MYUA 3P8ZA 3DWGA 4MYRA 4EY5A 1B8VA 3BE6A 2O2XA 3JR7A 5JE8A 3A0UA 1DX6A 3TZCA 2D2EA 3D8SA 5L4SA 1RBYA 1XD2A 2IPAB 3OEYA 1N6NA 4K28A 5ALSA 3HCCA 3AI7A 1LZLA 2EJTA 2WU1A 2QRLA 4M0UA 5AI0A 5ALMA 1F2UA 5EG5A 5JD5A 2VTKA 4W9RA 3ME5A 3Q2OA 5A3VA 1RJ9B 3VJMA 2E5LB 4BX0A 1AURA 4KRGA 1BNCA 3SNHA 3HNRA 3IBSA 5DNAA 4NP6A 4LKRA 3FTCA 3VSAA 4V0OA 1A7JA 2A92A 3FKQA 4MS4A 3RSOA 5AVWA 3EGCA 3Q8WA 3VDMA 5HJEA 1FFEA 1UBLS 5JNSA 2J7UA 3I0MA 1S8OA 3PRHA 4M8KA 2WSYB 2NXEA 4ND4A 4EATA 2HIMA 1JE1A 1WJGA 1L7BA 3TLCA 1T5SA 4G1FA 1WXFA 1GQQA 4S1NA 1RPAA 4OXXA 4RAQA 3I2IA 4ZVQA 3TNLA 4WBNF 5BRAA 4F91B 4HS9A 3M6UA 3O92A 3P9CA 2B35A 5JQWA 5DM1A 2AOVA 4MUNA 3TOZA 4EO4A 4J0GA 1BS9A 3RRFA 3P19A 4G41A 2GZAA 2R751 4XPZA 1NUSA 4B32A 5JU6A 1YDWA 4HDSA 4NG5A 4I8DA 2ZJ7A 4YFYA 4JV5B 2YDYA 4XVUA 3NJRA 2UUAB 3KAPA 1J5EB 1K97A 3B7WA 5CFZA 4BJHB 1YBVA 2QY9A 2FZCA 3B6JA 4HDRB 3Q40A 4BO9A 2EW1A 1TCBA 1EXDA 3IA2A 4V1CB 4LECA 4HRVA 1ZN9A 3ERCA 5DM0A 3GAMA 4WCFC 1GL6A 2BE7A 1UBMS 2IVGA 1UC9A 2JC3A 2PZLA 5HTKA 721PA 2IU0A 4IUCS 3GELA 5BYKA 1G8JA 3H9QA 2ZIFA 4MHTA 4ETMA 4LFAB 4NNPA 3VR5H 4GWGA 1BX3A 3W4JA 4NQRA 1X92A 3DZJA 3MD0A 1J5PA 2ZDGA 4IX9A 4L3OA 2J5QA 3DEKA 5BN5A 2P4HX 4EW2A 1Y63A 2YFYA 4DQLA 2A9FA 1K2VN 1XG5A 4ZD6A 1G21B 2O8VA 2QQEA 3ZWAA 3VR6H 4OXNA 2OCDA 3JQAA 5BRNA 2Q1TA 3I05A 4GUDA 4M76B 5JD3A 1KEPA 4O2RA 2FXIA 1T24A 2DM6A 5EFOA 4YXWA 1P2GA 5C8DA 3KB8A 2CL7X 3EGDA 3A6HA 4LI0A 3TINA 1K9SA 1L7PA 3R3VA 3D4OA 1IAVA 4KHZA 2AXPA 3IDOA 3PR1A 1JECA 3IPYA 1FFBA 2JZOA 4PC3A 5LSAA 1NWHA 3DEYX 1Q0UA 1T91A 1ZLXA 4BECA 2PVSA 4U4AA 3RB8A 1N7JA 3GRRA 4IOKA 4LYDA 3WGTA 2EL9A 2A1TR 2EZ4A 1CUZA 4GOOD 3ZE2B 1W0KA 1JQ5A 3W8RA 2C59A 1X74A 1FU7A 1EJ2A 1RAAA 4YMLA 2FOLA 1LWNA 3EIQA 3VGJA 1B0ZA 2FXVA 1SK8A 2GBGA 2UZ0A 2NO6A 5KSZA 4RVFA 3WK6A 4EIWA 1CRZA 1HI9A 1N3LA 2P30A 4CCSA 4HN4B 1VHTA 4U3JB 5CDFE 1C8KA 1TM2A 3VYVA 4LVNA 1CULC 1DKNA 2J46A 2E0IA 4QTUB 1LK7A 3T7DA 4YUWA 4EG5A 5B7NA 1U0TA 5K1ZA 2G1JA 2X13A 4WCFA 2GVZC 4IVRA 2X6QA 2FPUA 2UUOA 1BKYA 2HDHA 4X0EA 3GFFA 2CLMB 2DECA 3UOAB 2DU8A 3OPYB 1ZSNA 3L0IB 1LDGA 1S4MA 1CLEA 2JGKA 2YH2A 4KJZA 2JDID 4CKYA 2BH2A 1FRVA 4LHWA 1M66A 1QE0A 2HF9A 3GJ8A 4DL9A 5BWNA 1ODJA 4OREX 4RU1A 5A0VA 3ZLBA 4QOFA 3ZHQA 5L45A 1THZA 2IXEA 5LBIA 2CSXA 2ZS9A 4HPXB 4HVTA 5AOCA 3HVKA 3SN6A 4DNOA 1C41A 5JSZA 3ER8A 1SZJG 1TW3A 4BNTA 1XZIA 2V7TA 1DKRA 2WD7B 3FGOA 3AM4A 1XHLA 2EHJA 4JB3A 4G4GA 2I76A 2UVDA 2VEOA 1LLQA 3LC1O 2XW6A 3JXBC 3M5DA 3KHKA 3WBKA 3TXXA 1PV4A 2OHIA 3TRBA 2GYVA 1XVTA 5BSRA 3NHYA 4V0SA 2VP5A 2A59A 3NH6A 4Z5CA 3EYWA 3W2EA 2ZRPA 2NSHA 2QTVA 1E0KA 3LXUX 1TAGA 1ETHA 1E7YA 3R20A 4LDQA 5CXXA 3W8FA 3WFZA 3ZS8A 4E30A 5THXA 1E2NA 3DD5A 3LPNA 4UVIA 4L72A 3EAFA 1GTVA 4UFOA 4YNBA 2WZQA 4AUEA 4B7AA 3X1DA 3R5JA 4IH4A 5A6VA 5J59A 3I5AA 4BXOA 1Y3HA 1PR6A 3PDJA 3QG1A 5BXQC 5JEEA 5JWRA 4HWSA 4I08A 4H6XA 2RK4A 4J3FA 1EIZA 3S1AA 2J9FA 2ZRGA 1U9ZA 3LUBA 4E13A 5CYOA 4ZOEA 4HQFA 3VU9B 4LC0A 3SP1A 4R9RA 1SELA 2AFVA 2JHPA 3IVPA 1VIMA 4HGOA 1U8EA 4CQMA 4EB6B 1NR1A 2IY9A 3DPSA 4I2VA 1YQUA 4WPGA 2QLFA 2PZEA 2ZUVA 3PFBA 1PR0A 2GK7A 1J33A 2FKNA 4RSRA 3IE1A 3QYJA 1Y4AE 3ZHBA 4BO2A 4B4VA 3IT2A 3KQKA 3HLKA 3OJWA 1ISMA 3L9WA 1WUYA 1ZH2A 2Y2UA 1EEXB 2YS7A 2Z5LA 4WKPA 2JKZA 3QPAA 2EAUA 3MA0A 4JLDA 4CLEA 3TSYA 1HDRA 1O5TA 4C89A 3GG2A 5K6TA 3BFJA 4M53A 4WNYA 5ECYA 4GP6A 4J6FA 3L0SA 2CHVA 1J07A 2B83A 3E82A 2ZSDA 4LV6A 4M9ZA 3WV5A 4PCVA 2OBYA 2HEIA 4B6RA 1JHVA 2X1VA 2F1HA 5B1SA 3ROXA 2AXEA 2EF0A 1OWNA 4JI2B 3BWYA 2J3LA 2P40A 3WGQA 3H9BA 1GTJ1 5EHGA 3E9DA 2ZI7A 3R7DA 3S4YA 4LE0A 3TXYA 3AY0A 2P0YA 2PXDA 1XEAA 2Z2IA 4OK5A 1QG0A 2J0EA 4A15A 4A23A 1SQGA 3BMXA 4UZFA 1J00A 4EJ0A 4KO8A 4QICA 9GPBA 1JFVA 4AY2A 5BNWA 4RDIA 4UXIA 1YR8A 2R1TB 1MIHA 4M99A 4KFCA 2AEJA 4UHKA 4FUTA 3GN5A 2CLIB 4JQDA 4F21A 5IZCC 4WN9B 1K6EA 3SXUA 5K03A 4MTLA 1FP4B 3CZ5A 2OY0A 2O9JA 4DRXA 4G0UA 1P2UA 4NPAA 2V7XA 4M0EA 3BJMA 5AVOA 1QTIA 4Q7KA 2H8GA 1W5SA 5BYJA 1Y9JA 1EE1A 13PKA 3DMYA 5FEUA 1MVOA 1LNQA 1W35A 1SC4A 3PXDA 1KSJA 4TKUB 4FMBB 2HSEA 1EDZA 2NU6B 3LMKA 3FW1A 2R66A 1U0OC 4RHXA 3FMVA 3B6EA 1Q1ZA 3NDPA 1DWKA 4YAIA 2AW5A 1UJ6A 3B9BA 1YHZA 3SBEA 3PUJA 1I3NA 3KQNA 4NR0A 4B6FA 2UU9B 4QDXA 3AHJA 3WQQA 4AP6A 3BPSA 5CCBA 1PDOA 2CMHA 2C4HA 5FA8A 3PIRA 3OIFA 4RTKA 2PT7A 5FB3A 1WHSB 3AJ8A 1XIVA 2CLCX 4GLOA 1OWMA 3X1KA 3UXHA 3L6DA 4RY8A 1P33A 4CM8B 4P53A 1FU8A 1Q1EA 3U7EB 2YJ3A 2IE0A 4MJ3A 3U3MA 1NF8A 3ZLUA 3UM9A 4D99A 1W19A 1L3IA 1OX6A 2ID4A 2Y1WA 4KO4S 1XE3A 3A26A 1SKYB 4EYQA 1LTHR 3QF3A 3L93A 5C1OA 5K8UA 1WUTA 4EA6A 1UEXC 3EXIB 1U0JA 1VJ0A 3LV8A 3O5AA 1J1UA 4XASA 2A1IA 1OKKD 2ZBDA 1DO2A 4WA7A 1MCZA 4PU3C 2HLNA 3FNEA 3PV0A 4YJ3B 1KQFA 4DS3A 3UHFA 4QM6A 2RGNC 4IEIA 3VNSA 1I9CA 1H2FA 1GILA 1SCIA 2X0EA 3MF4A 2VEDA 3NEJA 3M3DA 3KEQA 2OZLA 1D6NA 4BMXA 3UJBA 3IVMA 3IEIA 1ZXLA 2O2DA 1XT6A 3O9MA 4XPIA 2I4LA 4UEOA 1BZYA 2HSGA 2O8CA 3V5NA 5JAIA 5K09A 3O38A 1WNTA 5BP7A 3RK4A 1SR8A 1VCHA 4INJA 3DVLA 4OU5A 3NYQA 5IZCA 3CEMA 3UICA 3R2JA 4R81A 4TMYA 5C18A 2JGRA 3GBFA 5C5DA 5JAMA 4MB2A 3PXEA 1SCUA 3FLEA 2YVLA 5EHNA 3UT5A 5L7TA 1WF6A 2D62A 5EXSA 3SQNA 2ZBUA 2HI0A 2A4KA 4NF2A 2FOIA 1S3FA 5E2AA 4BZXA 1F4VA 1N7GA 1JFFA 2AC4A 4YG4A 3ENKA 3D7RA 5FR2A 2QVYX 3TK1A 4CN8A 5IVHA 1N4AA 1OI3A 3LYLA 4CPDA 1VKNA 5EEHA 2WOOA 4IJVA 1ZZGA 2QZJA 4H27A 1XVAA 1Z8HA 2FEKA 3E9EA 1VXRA 1PT9A 1YR2A 4PE5B 5BNFA 3KALA 4YMUA 2LCFA 1YDGA 1YCGA 1SXHA 2B9VA 4G09A 3RH0A 3RT1A 3ZHXA 2IBSA 4P0QB 1YE3A 5BNZA 5ECWA 2Q8QA 4GMDA 1IBMB 3GRZA 2P6MA 3FVRA 1SUBA 4GX5A 5I9TA 4QKQA 4B8YA 1AHHA 2RE8A 1SULA 1YBFA 4XVCA 4MO2A 5JYDA 4FB4A 3T5TA 1Z4KA 2CD7A 2OOKA 8LDHA 2NXNA 2PKRA 3NHWA 1RCFA 1VJ5A 3T5AA 3KV1A 4HNRA 2V54A 5LMUB 2PX8A 2P3LA 4DPLA 2PUBA 3LPLA 1R2QA 2R8RA 3OHMA 4GEGA 1RZ3A 1O57A 2CE2X 3O95A 3PP8A 4XQ0A 4ZOBA 5LZ9A 2ZWAA 4DM7A 4JVNA 4PNPA 1Y98A 4HDOB 2PMBA 3QF4A 4OFWA 1YJXA 3FCYA 5AK4A 3JXCL 4ECAA 5HQ3B 2V4ZA 4O63O 2P2SA 2I87A 4CQJA 2CWWA 2IK8A 4Z53A 1YS9A 4RFSB 1BDIA 2YFHA 4PBSA 2Z6AA 2RGNA 1HDCA 3IUEA 3TDKA 2X8AA 1RTKA 3QPBA 1U7OA 3KT0A 2F1IA 3KUKA 5DNCA 4IA8A 1G8GA 2J6HA 1GFWA 2OBFA 4FPXA 4ZQGA 3KU1A 3KG2A 4GECA 2HINA 4XLZA 4S0ZA 1BN6A 3OE4A 1AKQA 4MI1A 5DB4A 1QF9A 4DKXA 1AVTA 3OP4A 2B5WA 4F5ZA 1FUYB 4IXDA 2WAYA 3SXJA 2GLUA 3JWJA 1VA4A 4Q9DA 5T4BA 1G64A 3COPA 2BFDB 4TTTS 1NU8A 4LFBB 1XMVA 3I3SR 4Y8VA 1V8OA 2V74B 3A6EA 3R24A 4CG1A 3CBQA 4EG0A 1VPDA 2IS6A 5ADWA 1Y7YA 5KSPA 4I99A 2D3WA 2QZSA 1ZM3A 2LE0A 1IY0A 2CNNA 2GN8A 2NXWA 2BY4A 1HF0A 3C7TA 1TLFA 1DC3A 1VKZA 3PXPA 1P4SA 3C5EA 5F35A 4DSUA 4LY3A 1E8NA 1VMIA 2DWUA 4YDQA 1ZD9A 1PR2A 4B87A 3WGUA 2I65A 4DIEA 1IBSA 2C2GA 5H8WA 5D3QA 3S2ZA 1JW9B 3LE8A 4JI8B 3CLSD 3H2KA 4HT3B 3KM0A 1X9HA 1M1YA 1NXVA 2V7PA 3MFQA 5MGBA 1GSOA 2P65A 1DRVA 1U0FA 1LXCA 3HUEA 3KKLA 3N0TA 4NJEA 1YMVA 4MUYA 4EELA 4XW2A 5G3YA 5JAUA 3RIXA 1V0JA 2C95A 4DMMA 1E62A 4PCAA 4MQMA 1PGNA 2PRYA 3D6HA 4HTAA 3I32A 4URWR 3UB4A 1UDXA 2QY6A 4IEFB 4RCZA 3JYHA 4NEHB 2PPLA 2QEQA 4D4MA 4BJ1A 4R1NA 5KSYA 1XAHA 1KI8A 1W9HA 4UBNA 1GD1O 4Q9IA 2E5FA 2B0CA 3STYA 1JWLA 3VJLA 5C80A 4Q3BA 4DSZA 1K8QA 2ZJBA 3BD8A 1JLLA 1XCBA 4O3FA 3F7MA 2LIVA 2WWVD 3CWZA 1N2SA 1F7UA 1YJBA 1TFUA 1NI4A 5AJYA 1I80A 3QBJA 2ETVA 5CVUA 3G23A 5DWVA 3L5OA 3S6JA 2YJ6A 5LUAA 2XI4A 1Z62A 3LY8A 1VL8A 3ELDA 4RIIA 4FC7A 4IH9A 4CDGA 4BIMA 1L5RA 1H23A 1XCPA 4TYMA 5G4KA 1CR2A 3LUAA 4C2AA 4B3BA 1E20A 1DAGA 4L22A 5EZYA 3TM4A 6GPBA 4YJ3A 3V7YA 2D2FA 1QMGA 3V80A 2EQAA 2P8SA 3P45A 1CZUA 1EWYA 4LWZA 3NNNA 4U5XA 3D43A 3GDHA 4BWGA 3HU2A 3WLHA 5C5EA 1O0CA 1MC5A 3JYOA 5JASA 4Q19A 3CO0S 4ZCRA 1H8HA 1WBDA 4NSNA 1HFJA 1RQGA 2PX6A 4FKMA 3KIPA 2OPHA 3DE7X 4OQDA 3Q7RA 4EG6A 4XCQA 3UC5A 3MCUA 2XCSB 1XJCA 5HFJA 1DOZA 2MYPA 1A9XA 3BN3A 3E7FA 3LKDA 4G5HA 3HE3A 3CW8X 1AKRA 2ZTMA 1C1DB 3D6AA 1I7LA 1ECLA 1XTVA 3TB6A 1YNSA 5EIWA 3I2GA 5KHAA 1WUJS 3UMGA 1EFVA 2JFFA 1X2LA 3OZIA 3R23A 4FWIB 4NYMR 3G7UA 4RACA 4U2DA 5DXJA 3KYIB 3WO0A 3SJZA 1NVKA 2NTVA 3M9LA 1NW7A 3NBAA 1ZXBA 4OH7A 3AHCA 1U0GA 4UBJA 5BRJA 5BV8A 1HC7A 3PT9A 3DT8A 2O2HA 4PG8A 3K0CC 3T7KA 4MAFA 4B34A 1HMPA 4RCVA 1Z4JA 3ZIUA 4JUDX 3QBTA 4NCKA 1MZVA 1YAJA 1JLKA 1UP4A 1WCXA 2OESA 2ZAOA 1AN9A 3QIVA 4AZ0B 5I7OA 3AUYA 4FHCA 2BR4A 1HNXB 2A5JA 4NULA 2H54A 4WY2A 3E15A 3ELBA 1GRQA 4MVJF 4N3AA 2QIPA 3BMQB 3SQXA 1O97D 2PYDA 1FPQA 3H2GA 2DCUA 1P1RA 3GZNA 4OOEA 1AMNA 2FUKA 3KKEA 4RJIA 1AT1A 4JXXA 1IEWA 1PZHA 5KNCA 1U9YA 5IT4A 5AHWA 5BUCA 1ML4A 3TYXA 5DYWA 5CBPB 3CUTA 3LHKA 1FFHA 1LNSA 1W59A 1CJGA 5JATA 5ERYA 5AH0A 1CJBA 1RU3A 2G25A 2KEKA 2Q2QA 3IOYA 2GAAA 1VXOA 2XX3A 3OT1A 4AK9A 4Q5IA 3EQ9A 3LXXA 1V7ZA 4WGFA 5CT5A 1RZVA 1NRXA 3WLLA 4DLXA 4OBBA 3T3EA 4RUKA 3TUIC 3K4HA 1K7XB 4YEDA 3TSOA 5AJTA 3T0GA 1F7VA 1PJQA 1AF4A 1SXIA 2XUAA 1SMKA 3D31A 2KW5A 3R5SA 5CT9A 2NUTA 3N6VA 4MV9A 1WXDA 1GFSA 1AO0A 3A0RB 3BHMA 3E5RA 3GRPA 4L8GA 2AG0A 1UKVY 1NMZA 1JXOA 3MRXA 2PIJA 2EF1A 4GXQA 1U9IC 4PNEA 5KX5F 1RPEL 3UEOA 4UCQA 4M88A 5EPEA 2M2IA 4D9GA 2WZCA 4JOQA 4ZQIA 2B4TO 3OE1A 1U2SA 2R5NA 4HTFB 4II7A 1TGYA 1X3LA 4R68A 5DHFA 3G6KA 3NGLA 3TW8B 4CCWA 4CG3A 5JR3A 1OIVA 1QUFA 3OJCA 5FOSA 3I64A 4C6RA 2UVPA 5EN4A 2C29D 4XWOA 1W88A 2NZVG 1WQ3A 3C5HA 4BNGA 1IK6A 5BR4A 4GL4A 1A7KA 4IVZA 2Z5VA 3OM8A 4Q3OA 2HDNB 2NQ8A 5DLDA 1UM9B 3W5SA 4BFYA 3FMGA 4HQOA 1R4NB 1C8BA 1H8EA 1TYZA 3K0CA 2X76A 2HSWA 3NFRA 1JIJA 1SIWA 1CUWA 4GKAA 3U7IA 2C2MA 4WK4B 4YCNA 4FDMA 3CB2A 2XWJI 1E79D 1CR4A 5BN1A 1V3VA 3IO5A 3C4VA 1BDHA 4JAVC 4K6GA 4L76A 2PKQP 4PZZA 2IODA 1RKUA 1K5HA 4LZOA 4WXPA 3FKSA 3CQ9A 2XQIA 1Y5RA 2G72A 3KDSE 4MP6A 3BERA 3H65A 4BO3A 2Y1OA 2ZDQA 4K26A 1AXEA 1MIOA 1V2HE 3D1JA 1IZ8A 2TMKA 5A0FA 4AS3A 3OJOA 4RVSA 2QD1A 3G0IA 3PNKA 2OG1A 4OQNA 3FTFA 5AVQA 3G89A 1R4AA 3LP8A 3WYBA 3MGAA 2Y27A 3QPDA 4G5RA 4DNFA 3QU7A 5AKKA 1LC3A 2W2KA 1DUIA 4S1PA 1Y8RA 1JX6A 1JT9A 4RW0A 3MT8A 2WJPA 2P11A 2Z6VA 3G2IA 3ZEAA 5AVVA 5JVDA 4E94A 1NW4A 3TNYA 2FDXA 1ZQ9A 1KAOA 2IZ6A 4WD3A 3ZE7A 2CUZA 5FI1B 4Q1DA 1M1YE 3KKKA 2OXTA 1WG8A 2OB2A 1BEZA 2OWEA 3I6QA 3LQFA 4QGBA 1CVLA 1NMEA 1U9IA 4CMGA 3T3NA 4G3XA 2PKYX 1XB2A 3EZ7A 4N6GA 4O4JF 3KUCA 4FYKA 5DKFA 3V00A 4C4ZA 1C2YA 4RZUA 1E9SA 4UDOA 5A2GA 1GY8A 1IPEA 3EDMA 4WXYB 4KMRA 5HDBB 4TMZA 3FZNA 5HUHA 4B8WA 3ENQA 4IKOA 3ULKA 1U0NA 2FWBA 3I73A 1NLUA 4N49A 4ARVA 4E70A 2B98A 3NHAA 5HQJA 4Z7JA 3PTLA 1JAHA 1CVIA 2XMBA 3NQ41 4U7DA 2FE1A 2NVUA 3DOUA 4RO0A 3ZBTA 1UMCA 2Y9PB 2JGAA 4OB6A 2G9UA 3RK1A 2ZQZA 1KBOA 3MEQA 2V96A 1G59A 3MRTA 1G55A 1R5OA 2VP3A 5J40A 2C5SA 3UN1A 4CL3A 4DR7B 3N2LA 4A2PA 4W5HA 2ODWA 4P6VF 5SY6A 4JI1B 4RIGA 1M2VB 2EBWA 5I7RA 2PGNA 1OC4A 2I4RA 2H8RA 4FYIA 4JNCA 4NFLA 1R6UA 3SM3A 3DDNA 4G0VA 3HSKA 2C5EA 3LCRA 1CU1A 4LAFA 5LXTF 1JHDA 1KJQA 1PRYA 3RRZA 4D8UA 4EA8A 5J2TB 2WAXA 1AV7A 1ZYUA 3K73O 1ZJYA 4UU7A 3OWHA 1DZ3A 3BGVA 3R6DA 5HBGA 1CUAA 2BE9A 4WOPA 5JDCA 4E2XA 3KB6A 3Q87B 1YO6A 1BH2A 4MR9B 5B3LA 4L8FA 5CYGA 3TVDA 1ORHA 4ESEA 4K6FA 1U8FO 1LBQA 1IHPA 5ILGA 1ILWA 1TYDE 3WK5A 4YT4A 1L5FA 1PD1A 3Q3JB 3PA8A 1F1BA 3JALA 3ONEA 4TOIA 1W1UA 3ZHSA 5F5LA 1IJFA 3AEQB 1Y7IA 1I7NA 2AOUB 4AT1A 5ARCA 3T1NA 1OXTA 3ZOZA 2CVPA 1UT5A 3IIEA 2O8DA 3C97A 5I8ZA 5IJ9A 1TVCA 2IYXA 1JHZA 4X4DA 1ORDA 3C1AA 3D2LA 4LJ8A 4LEIA 4YJKA 5JZ9A 1GAXA 3EFOB 2G1KA 2P3QA 1YQDA 4FLMA 1F20A 4PR0A 1N75A 4Z5XA 5HKBA 3TECE 3SCZA 4UC0A 4JROA 3PE5A 2YVUA 2QZPA 4QATA 4UTVA 3LWZA 1M2JA 4J29A 1E2MA 1GZHB 2FUCA 3AIKA 4QWMA 3GGOA 2V9ZA 1FFXA 4J43A 2RB5A 4JB0A 3ASYA 5B1EA 1FJHA 2WKSA 2IU6A 4IS2A 2BMFA 1V5GA 1D3AA 3KJNA 4YYEA 4CVNA 1K9VF 3OEWA 1XPOA 4ZEXA 1PZXA 3MAJA 1C0PA 3EZGA 3RR2A 3GLIB 4LRXA 1XZFA 3AGQA 5HIAA 4Y2QA 1RR6A 2QTZA 3E4DA 4N7JA 2JNWA 3QUBA 3YASA 2PNFA 2E37A 3FETA 4FXOA 1GU1A 3CNBA 4TTQA 5F1PA 3F73A 5G3ZA 4W6QA 3SBDA 2IH5A 3CKLA 2P79A 3DQPA 3C3CA 2YN0A 3H1GA 5A4JA 2JJQA 3QVJA 3VHXA 5M7EA 3A04A 2QG6A 2A9VA 3IC5A 1GYRA 2I7XA 2R7MA 2YWEA 3PRJA 3TTWA 1CYDA 2DQYA 1EVKA 3T52A 1PKXA 2HR1A 3RSZA 4ALMA 5JHHB 3RF7A 1KYQA 4JT2A 1KI6B 1GPH1 5F2KA 5GV8A 3UHJA 2DERA 3HXTA 4H6WA 3SC4A 4QOGA 3VZQA 1N8TA 4K6OA 1ZGHA 3K8OE 4U0JA 5MDHA 5L8VA 1PEKE 1L5SA 3CPHA 3OZBA 4ILKA 4RKQA 2ZATA 1PZNA 2R60A 3IJRA 1ZGZA 1RLOA 2G7ZA 2IYQA 1TUBB 2OQRA 3ANMA 2W4QA 4P5PA 3O4VA 1RWOA 1RNLA 2Q50A 3PCRB 4OHZA 2QU7A 2BNOA 3JWIA 1PZFA 3E1SA 3BL5A 4V0KA 2VPXA 2ZYWX 4S0XA 4WNAB 1X70A 5F5XA 4B6EA 2CLEB 1L4NA 4YC7A 2WSIA 2J30A 3I1YA 1XK6A 2LYQA 3DBIA 5IYZA 3TG8A 2UAGA 3HVHA 4KP7A 2XJ9A 3O03A 2COUA 4TYYA 1P9NA 1SUWA 3GBVA 4KWHA 5IM5A 1ZHOA 3LKZA 4NMHA 3DCNA 3TLGA 5KTSA 4TWZA 2MIIA 4LQ4A 1J8QA 1AMOA 3LF1A 3ICOA 4YRNA 4E09A 4IZ6A 1T6XA 2VIIA 3HCFA 3HDGA 4A5OA 3C39A 4O8ZA 1EK5A 4YA6A 4UFPA 5G0SA 3H97A 4KRYA 4P5EA 1L3BA 5LUBA 3KVOA 4G26A 1USIA 2C2BA 4NBLA 5EINA 1NYLA 4JKOA 3R7BA 2NYVA 3H8WA 2WJYA 1SUEA 1NFFA 2PH3A 4NOJA 4JITA 2X1MA 3IOEA 4YROA 4YQFA 1T1GA 3W5HA 4EO7A 1Z6ZA 2DETA 4R3NA 3S29A 1AIPA 1B93A 3TEMA 1U8AA 3AVQA 4G5QA 1Y4SA 2LR0A 4IYJA 1HFEL 1ONOA 1UWCA 1MABA 1WWKA 1X86B 4EI2A 4F92B 3ANYB 4FONA 3ZJVA 5DM60 1ZU5A 1Q77A 5DIZA 2PO7A 3WGHA 4AF8A 1SPBS 3L04A 5LA6A 2QMUA 3QP9A 3VUFA 1MORA 4FS8A 5GONA 4AU1A 4DC1A 1AHIA 1FJXA 1VSVA 2MJLA 2RAFA 5EQTA 5JVDB 4B9AA 3I01M 4DGSA 5B55A 4F5DA 2FMKA 4WZBB 2ONCA 1ANKA 1Z4OA 3E0XA 5B6IA 5I5EA 1QKKA 2F1RA 3M5CA 3QX8A 4O0LA 2XE6A 4YLEA 2AKEA 3T3MB 1UCFA 3R5HA 4G01B 4P0PB 1LF5A 3QXXA 3IEMA 2WIUB 2GZ2A 2LV8A 5BSTA 1N33B 1DWQA 4HWTA 4UDXX 1A7AA 5CB4B 4QM7A 4AN1A 3IV6A 5TMPA 1Z0SA 3DVAB 3RU2A 4I50F 2C2XA 2EZ8A 2X2EA 2IYOA 2PD6A 4KWCA 1P75A 5DASA 4NONA 4ZCLA 3FPBA 2IX3A 3HI4A 3LWNA 4EECA 4W5NA 2XNSA 3QLUC 1HT0A 5EJ5A 3RYIA 3EHEA 1UIMA 3F7TA 3OURA 4L08A 1NOIA 2OTCA 3R6WA 3LTEA 4KO2S 4J0QA 3U9LA 4Q01A 3CZMA 3GZJA 3KSUA 4A2WA 3GH3A 1HQDA 3GLUA 4ZCTA 2B34A 2YICA 3A9XA 3KQYA 3R6GA 3U44A 3ZDAA 1JPJA 3GUUA 4BTEA 4GGOA 2QGZA 1UXJA 4RMNA 2QW1A 2ZJ6A 1XJ0A 3OZVA 3ZQ4A 5LMNB 4D9JA 4OHBA 4J2OA 4W1RA 5ALXA 3VV2A 3EGVA 1I3LA 1W2HA 2VBIA 1CQWA 5K0NA 4ARAA 3U4IA 2C5FA 4F8JA 3UMBA 2IL1A 4KXLA 3ZWPA 2Z2XA 4P92A 3IQEA 1QHEA 2G71A 4GMXA 1Z39A 4W63A 1ESNA 3ZY5A 3VC7A 4YYZA 4AURA 4PGMA 3TQFA 4E5PA 3VBCA 5A9SA 4Z9AA 4G5OA 2ZTHA 3WP0A 2XV1A 1EDEA 1TEVA 2ABWA 2OHVA 3HACA 3K6KA 3MQFA 3K1YA 5LYJB 1L7QA 1AZWA 2PXTA 1L5WA 2POCA 1NP3A 1RC1A 4XE5A 1WQ1R 2OGSA 1ZITA 3OLYA 3CRVA 3RC1A 3RRYA 3GRVA 1Q0SA 1SVOA 3DE2X 3ZOKA 3KTAB 1XDZA 2ZRMA 5C31A 1CETA 2FFAA 2FN7A 1NAIA 2IEZA 1ZZ7A 1D1TA 2GFQA 3BBPA 4J03A 3W2IA 1XOIA 2JFBA 2XXJA 4GSKA 2FFBA 2QLTA 4LHEA 1Z0FA 3GAZA 2Q6LA 4HQLA 3WIEA 3OCYA 2KS6A 4M7OA 4ZVKA 2H4WA 3AF2A 1O6ZA 4ICIA 4YJFA 3ZWOA 1IEXA 3GOQA 5EWJA 5EJ8A 3H3JA 4UARA 5HK8A 3TTSA 1K98A 4RTMA 1BDMA 1LRLA 2Z58A 1TM7E 5ALHA 5K51A 4DC0A 3PFCA 5JY1A 4CMIA 1OXXK 4G89A 4FBLA 3RAPR 4I1PA 4HNTA 2ONJA 2RJOA 1WCYA 1IXSB 3O0TA 1C1XB 2KYRA 3IBFA 3VR4A 4MCAA 3QLUA 2GLXA 4D6XA 1KZHA 1DULA 3OIUA 4F56A 4P3PA 1X7WA 5CURA 5IHXA 3B9PA 1W49A 2Z9CA 4RHFA 4Q16A 1GVNB 1ZIOA 1XF1A 1VOTA 2SCUB 3WA6A 4HHEA 3C4QA 3J7AC 2NZYA 1P4RA 4KYUA 1GZ7A 2QVCA 2P2ZA 1PFKA 3TJMA 3JQBC 4C6HA 4D80A 3GOHA 2ID9A 4FE3A 1A5BB 1T6BY 3IUSA 3KQOA 2QB5A 4FEEA 4N9WA 3ZLVA 3PD1A 3TSWA 4MMYB 1ACMA 3NNSA 5KQGA 2WQ7A 5EMJA 4YK7A 3Q8KA 1ZUNA 2GBLC 3ZD7A 3QVKA 4V38A 4UXJA 5FTNA 3P5BA 2X6TA 1W5EA 3LQ2A 3O47A 3D3EA 3MT7A 1Z74A 4TVBA 5LJIA 1L5OA 1FE8A 3GLIE 2YWBA 3HYRA 4H7KA 3SS7X 1RIFA 3FPFA 4WDRA 1NC3A 1VLMA 5D6NA 2Z9BA 4Y67A 2R4QA 3PDHA 4O6VA 3KDAA 3EVCA 3JWHA 1PERL 1VBKA 3EPJA 5CK4A 4MCJA 2DX7A 3MJRA 1QO9A 4LHVA 1EM6A 2FQ1A 4WFQA 3N6XA 3J81k 4I1YA 1SQ8A 4MYSA 3CT6A 4A0QA 2JGMA 2XAUA 3I9JA 4NZ9A 3REOA 2BZSA 4LBZA 1UBSB 5LB2A 4AB1A 1YQQA 1RLMA 1U0SY 3FYSA 4DMLA 4YT5A 1ADBA 1RP1A 3H9UA 1DTEA 2EZUA 2O3RA 2OHJA 2DG2A 3JZIA 4X41A 3LLUA 4GI7A 4FILA 4BMPB 5JQGA 3GLTA 1U63A 4D9MA 3P9QA 1KTIA 5HKOA 1E6LA 3EW9A 2BUCA 4NK5A 1JEDA 1IU9A 4BRUA 2WUFA 1AUVA 1HF3A 2GCNA 4MJXA 4U6QA 2Q5IA 4I55B 4E6EA 4YPVA 1PT8A 4IXMA 4XTRA 2NW6A 2C4UA 3G2QA 3M6LA 2IYAA 1XZNA 4NABA 1KBQA 2V6FA 4MMXB 3F67A 2LCQA 4C4AA 1NRWA 4BMDA 2GD2A 1Z9BA 5DSZA 4CE6A 2YQ4A 1EP3B 3GFTA 4M9SA 1T6NA 3BJRA 3PUHA 4EQ6A 3UAWA 1EXVA 3LUDA 5K0SA 3RVKA 1XLUA 3NBUA 3ORFA 1ZM7A 2OV4A 3EFEA 1E3WA 1XMXA 2WTXA 3JQBA 3OAAA 5ADVA 5AW5A 4LRWA 5J3JA 2NP7A 4XYLA 4ZI7F 3EZLA 3QG5A 1OGIA 1O89A 2NOAA 1ST2A 4TV8A 1DX9A 2GBLA 2WT4A 3U7HB 3U26A 2XA2A 3LC7O 1S2LA 3WNBA 1OD6A 1OFGA 1RMYA 3LQXA 1VE1A 3VZBA 4F3NA 1PVVA 1IC6A 1QKIA 1JILA 2V7VA 3HDHA 2ZAGA 4UM5A 3SDBA 2IXTA 1ECFA 3N8DA 3PXUA 3FBWA 2PXUA 5HF5A 1GO2A 1K5GA 3DXFA 4HUJA 4AJJA 5CW2A 4W9NC 5EYPA 4IDHA 3I9MA 5JCJA 4RYDA 2GZ1A 2CXUA 4FR0A 4IF4A 1B1AA 4EJFA 4HEHA 4Q12A 1G9XA 4Y2YA 1HURA 1U5BB 3EVDA 4M60A 2GZ3A 3BE8A 3GF4A 1ZVQA 3RROA 1YZYA 4X4CA 4QDUA 5K7SA 4JR0A 1VHJA 3MTAA 4FP9A 3ND6A 5GGYA 4NV3A 5A7HA 4JJAA 3CVWA 1V71A 2PD3A 3ZKWA 1L8AA 4Z3OA 1DAKA 3W9UA 2IOYA 1LBHA 1XXHB 1P0PA 1KK2A 4U63A 5H3LA 2QQ0A 4R9NA 2PQ0A 2BCGY 2BTQB 2PX0A 4AMZA 2BNMA 3ILSA 4BO4A 1IUPA 3GQVA 4GX0A 3WMFA 1D1PA 3B48A 2MYNA 1V1RB 1QGAA 2ADMA 1ZIDA 2JEZA 3E2PA 4LGCA 2ZIWB 3OPQA 3W2GA 1IOWA 4I1OA 1NW3A 4RJKA 1Y3AA 3H9CA 1GHTA 3ZUGA 2VT3A 3W1WA 2IOHA 2H4FA 2PWAA 3A1WA 1UC8A 2EZTA 1YGPA 2ZGVA 3OFSA 3QTTA 1VMEA 1K6IA 3CLKA 3F8SA 5HP4A 1R66A 4DV0B 1ZD1A 1WXGA 4YO8A 1NYRA 2Q1XA 4BEBA 2JLAA 1VIVA 2YZGA 2JCBA 5AMXA 1U7WA 1J25A 4XEHA 5EJ4A 4PQRA 2ZWVA 3V48A 4MUEA 4KVGA 4JWKA 3C98A 2MHCA 2OK8A 1Z4PX 3PJEA 4Z0PA 5FUBA 4OHRA 4R83A 3MSXA 5T4EA 1QCDA 5HMMA 1OE0A 1DQPA 3B13B 3BM5A 1CLUA 3ZXUB 4G85A 2HNBA 4BTLA 4GZ3A 1CB7A 1VYTA 1ZEMA 4G65A 2WV9A 1F6WA 4BCDA 3WOHA 1LBIA 4W9NA 5SYMA 2DQ4A 3I72A 3KPJA 4DMFA 2HRQA 2AW3A 2G06A 1FMJA 2GN2A 1DC8A 4H16A 4C0SA 4I9GA 4MVJD 2OYRA 3KE8A 3BD1A 1MLDA 3BJEA 1F0KA 1NVFA 1ZD2P 1D8AA 1N8NA 3LHFA 3F8WA 3MS7A 1Z5NA 1T26A 4YJHA 3UYLA 3OZGA 3O4FA 1NQVA 5JBIA 1W0CA 4P32A 3TFLA 6LDHA 2D5VA 1E2DA 1R7RA 5EPOA 2EG9A 4E5UA 4EEKA 2XCUA 5ALKA 4CEHA 1E5DA 4PZDA 3KQVA 1WQ4A 3DKRA 2YV4A 3IVRA 1H2YA 5FXMA 1ADGA 1DQYA 3OMTA 1PX0A 2R6GA 1KQNA 3ILHA 4D4JA 4YV0A 5AXCA 4QVGA 3PQ7A 4FN4A 4Q3NA 4TXJA 3UGTA 4E5VA 5MN4A 3KZ3A 2JLQA 2JI9A 4N65A 5TR9A 3D4IA 4D26A 2VSFA 3CX6A 1KRXA 2WIJA 1EDBA 1NDUA 8ADHA 4UTOA 3CYFA 1N1MA 3NXHA 5CVDA 4D0NA 2W11A 3AVPA 3TSZA 1G2QA 3A9UA 3HP4A 1JHRA 2R1VA 3BA6A 1SURA 4KDRA 4EHJA 4HLCA 3BS3A 4WZAE 2ZRBA 3VVMA 1TMKA 1CE8A 4DR4B 2PZBA 3LH5A 1KXJA 3CEHA 1E5XA 3SG0A 4I2NA 1VKHA 1AQJA 3HR7A 1YKSA 3PC3A 1E32A 4V24A 3VC3A 4NENA 3D8TA 2NGRA 4EF5A 1HL7A 4AAYA 4RTJA 1KEZA 4GM4A 4FXPA 1AU9A 3LNTA 5B37A 3WK8A 4D6YA 2EL7A 2V6JA 4G0ZA 3G8DA 4RKFA 5AI4A 1UBKS 3IS3A 1OGJA 2YMMA 2FUNB 5KHLB 2YW2A 1XMQB 5LP1A 2FVYA 4FMCB 3AL3A 4Q9AA 3LRPA 2CEKA 2BGWA 1VRWA 1RWXA 4YG7B 2PXFA 4GKVA 3TRKA 2DC1A 2PH5A 3NAZA 2XNDD 5JROA 1NXTA 3ETEA 3H8VA 2CC2A 4F4HA 1B26A 5HIMA 1H05A 4J75A 1G60A 1XZMA 4KL8S 421PA 3UAVA 3Q98A 4HFNA 3CSSA 3TZQA 4FFLA 2JRCA 4J7XA 2OGWA 3CZRA 3CINA 3LLMA 2G09A 5JYEA 5EPUA 3F49S 3V6LA 1XZPA 1QGED 2HU2A 4Q4JB 1G9TA 5FNZA 1SUPA 3H75A 2QM0A 4II3A 3MYRA 2AG6A 3BILA 5SZIA 2KM1A 1M34A 3F98A 4FTWA 3RJ9A 1WV0A 1QLWA 3NVMB 5BURA 1I7SB 4MQUA 3ROKA 1RXVA 4X94A 4MTCA 4MW2A 1SRQA 3I42A 1OWLA 1RM0A 4GI2A 5CT6A 2VHJA 3COZA 3L1HA 2XUPA 4RH1A 3PEVA 1E0DA 2FFHA 5IDYA 4TSFA 1DHRA 1MOZA 3E7XA 3H0KA 1RM5A 4DILA 1G20B 4HGYA 3WBJA 2H2HA 4FOTA 4ZO9A 1Q7CA 2WAAA 4FNOA 1EPUA 4UCWA 5LP6B 1IONA 4JYBA 2HQBA 4A8JC 4H0NA 2NT3A 2XUOA 2IZ1A 3ZWNA 1SWVA 3C6MA 2ODBA 4GOXA 4KWIA 5K8VA 4HNVA 2ZI6A 4M0LA 4BX8A 4DRYA 2ZTLA 4MI3A 1QV9A 3EWAA 3FSRA 1M6NA 4PLYA 3GFRA 1ZVMA 2FJUA 3RE1A 2VNSA 4JB2A 3A2MA 4LC9A 1WKVA 2AK3A 4QXQA 3F90A 1PG2A 2BFCA 2FZLA 3K6JA 1NDHA 1WP9A 2W0SA 5FF9A 4BQSA 4LQDA 2C2HA 3A9CA 3ESZA 1C1HA 4HBZA 3LDUA 4QNMA 2OFYA 1UAAA 2AI1A 1IHXA 3PXCX 1NBWB 1R6XA 4MUKA 5JXHA 3HXQA 3DOOA 1Y6ZA 5JCPA 2GM3A 3R0VA 3SJCA 3K30A 2BF7A 3CCCA 1A8QA 3GVHA 4MS1A 4F4CA 1IZ0A 2UZ4A 1WPGA 1G8SA 2BP7A 3PD7A 3WB1A 3WWYA 3QFSA 3H99A 3U4MA 4GHJA 1JR4A 1Z06A 2PDAA 1E2GA 1LLFA 1OXBB 1JALA 2ONYA 3AINA 1ID1A 3OZTA 4XSHA 1IQUA 3A06A 4ZOLF 1GG2A 3PUVA 5D3KA 3RS8A 3RYHB 4ZHSA 5KYTA 3ONDA 3H9JA 1W4ZA 3PF8A 4HDKB 2EYQA 2PKWA 1XD2B 2H2DA 2AZ4A 4MVJG 1LB1B 4EYGA 3DLHA 2FEXA 3MHPA 4S3MA 4D3FA 1Q6ZA 4JIMA 1F2UB 1U8XX 1X2EA 3AR3A 4NCNA 5I9LA 2V0GA 1EFDN 1PF7E 4LTDA 3QX9A 3Q3CA 2AG5A 4G25A 4R7GA 2W6ID 3RKSA 2GJ8A 2F2TA 3CIFA 4GI5A 4KPUB 1ZZ6A 1XXHE 4X97A 3UH1A 3CF0A 4KXQA 3L84A 3HDQA 3K1AA 4I81A 5FOTA 4HPJB 2QDXA 1IXRC 4RA9B 3ZQJA 3HL4A 1FYEA 1J7KA 2HK6A 2W8BB 1JTEA 3A6LA 3HCWA 5FBKA 5FP0A 1GIAA 3TLYA 4KK4A 4X85A 2O48X 4MKZA 4MP8A 2A6PA 5CM2Z 1FZQA 4H7IA 4UOQA 1XL0A 2OZEA 2ZOSA 3SYTA 4A8JA 1IBKB 3Q5DA 1J8FA 5T64A 2JLUA 2OG2A 1F1JA 2E4VA 2ZBGA 2HJGA 4YMTA 5HE8A 1PKEA 2YCBA 2C1ZA 1C7IA 5HGJA 2XWPA 3RVLA 5JH7A 1XYYA 2VJNA 3RT9A 1TCAA 2AH5A 1TRHA 1UMDB 2QJRA 4F86A 1U6KA 3CEAA 1CIPA 2HA2A 5DXFA 2CD9A 2P9EA 1Y37A 3IEVA 3ZWDA 5C7YA 4QDTA 2JBAB 1A71A 3BXOA 2ATCA 5A4FS 1DFIA 4ZJUA 3A1SA 1KA9H 1TLLA 2O59A 4KXNA 1UEIA 3WXMA 3GBPA 3T0IA 3VZSA 2AE1A 3QWBA 1BJTA 1UZAA 4X90A 1FXSA 2XUZA 4L6CA 4BAGA 5FULA 4ESHA 4TWIA 4XQEA 2JD0A 4BFCA 5TPZD 4PQEA 1HO3A 1YS7A 3NKLA 1E7MA 1L8OA 3VHRA 2WWFA 3THYB 5F21A 4WZZA 4RTQA 5KTYA 4PFSA 3PUIA 5BN5B 3SEAA 4LYEA 4MWOA 3EFBA 1KI9A 2OORC 5TPWA 2AN1A 1YRAA 3R9XA 1H69A 4WOCA 4CG0A 1W36D 4UE2A 3BE4A 2P75A 1Y7HA 7ABPA 1CJUC 2I6FA 4W99A 4ZVTA 4E46A 3JQAB 3FDZA 4L0CA 1JLRA 3W9YA 3ESAA 5CLIA 5A3RA 2OECA 4HFJA 2FVXA 1H66A 1WLYA 1YSCA 1XN1A 3IODA 4OQ4A 3N0XA 2BJVA 4MJLA 1QH8B 2B61A 1ZNXA 1D0SA 1UBNA 3EGDB 2IOFA 2PFGA 4HEQA 2CW5A 3IQHX 3PUXA 3V1YA 2GUGA 1FK8A 5EXDA 2XKBA 4BIIA 3NMUF 3MEJA 4AY4A 3KAKA 1LV7A 3IXMA 5IANA 5JALA 5BOVA 5HWSA 1ZWLA 1ULSA 3HCDA 2IYUA 4MLZA 2Q3FA 3MXOA 1WIZA 1RAHA 1W73A 2FZ5A 3JVDA 4QTZA 3V4ZA 5FNVF 1K86A 4OQEA 4QUGA 3KU4A