2XI8A

High resolution structure of native cylr2
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
66
structure length
66
Chain Sequence
MIINNLKLIREKKKISQSELAALLEVSRQTINGIEKNKYNPSLQLALKIAYYLNTPLEDIFQWQPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Integrated Analysis of the Conformation of a Protein-Linked Spin Label by Crystallography, Epr and NMR Spectroscopy.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Transcription
molecule keywords PUTATIVE TRANSCRIPTION REGULATOR
total genus 23
structure length 66
sequence length 66
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2xi8A00
2PPXA 3IVPA 2IU7A 1ZVVA 2LYLA 4X4FA 3SCGA 2AW6A 4F8DA 2XJ3A 1LMB3 1BDHA 3BS3A 2BNOA 4OB4A 4GHJA 4I8TA 4Y42A 3SCHA 3QYXA 1R69A 2MQKA 4X4CA 3O9XA 2GZUA 2O38A 3S8QA 2D5VA 2LYQA 3HZIB 3BDNA 1PRVA 1JFSA 1RPEL 4IWRA 2PUFA 3OQMA 4JCYA 1POUA 2PUAA 4J1WA 4I6RA 4Z58A 2PUDA 3GN5A 2KZ8A 3CECA 1RZSA 1ZZ8A 5A7LA 4PU4C 2AXUA 2GRLA 2IVGA 3QQ6A 2A6CA 4I6UA 2XI8A 1UTXA 1DW9A 1WH6A 2AXVA 3SCFA 4FBIA 4X4HA 3ZHIA 2LYRA 1O4XA 2LCVA 2EBYA 2B5AA 4IA8A 1IC8A 3QWGA 3FMYA 1WIZA 3JXDL 2BJCA 2BNMA 4Z5DA 4X4EA 4YBAA 4YG7B 3DNVB 1OSLA 3ZKCA 2HINA 1CJGA 3TRBA 3L1PA 1XWRA 3B7HA 4MCXA 3PXPA 2MEZA 4X4IA 2R1JL 3OQOA 1BDIA 5K98B 1JFTA 1E3OC 1UXDA 4X4GA 4IVZA 2AWIA 2KEKA 2IVBA 2PUGA 1S7EA 2LYPA 4YG1A 3CROL 2CSFA 1NEQA 2BNNA 3MLFA 3JXCL 2O4AA 4Z5CA 4X4BA 1ZZCA 2CROA 4YG4A 1OCTC 3U3WA 1RZRD 1LLIA 2IV1A 2JVLA 4NDWA 1PRAA 1QP4A 3OMTA 2AUWA 1DWKA 3OQNA 3ZHMA 2EWTA 1ZZ9A 1CQTA 3FYAA 3LISA 3QF3A 1ZS4A 2PIJA 1L1MA 1QP7A 3H5TA 2XIUA 1VPWA 3G5GA 2LYJA 1Y9QA 1ZZ7A 2OR1L 1ZAYA 4PU8A 4JQDA 3R1FA 2IVQA 3CLCA 1B0NA 2R63A 1UXCA 3LFPA 1SQ8A 4Z59A 1PNRA 3BD1A 1QPZA 3EUSA 1ZZ6A 3KJXA 1JWLA 1EFAA 2H8RA 2HSGA 4FN3A 4X4DA 1LCDA 3F51A 4JCXA 1WH8A 3JXBC 1HF0A 4I6TA 3D1NI 2XSDC 2ICTA 1X57A 1YSEA 1ZPQA 1JH9A 1QP0A 1ADRA 2XCJA 1LQCA 2OFYA 2KEIA 3FYMA 1WETA 2PUBA 1PRUA 1ZUGA 2LYSA 2ICPA 2KPJA 4GQMA 3GBFA 3KZ3A 3F6WA 1QQBA 1PERL 2PUCA 1Y7YA 2PUEA 1X2LA 2JCGA 3KXAA 1R63A 3OP9A 4J1XA 2KEJA 1AU7A 3G7DA 4PU7A 3F52A 2L8NA 1GT0C 1QQAA 3UFDA 2AXZA 1NERA 4O8BA 1RZRA 4MCTA 2IUOA 2GRMA 3VK0A 4PU3C 1RIOA 2WIUB 2EF8A 3GN5B 1ZZBA 1LCCA 2WUSR 2L49A 2O49A 2LYKA 2PE5A 4YARA 2FJRA 4Z5HA 3RZZA
chains in the Genus database with same CATH superfamily
2AW6A 2XJ3A 1BDHA 2BNOA 1R69A 3PE5A 4X4CA 3TELA 2O38A 4EK9A 2D5VA 1JFSA 4EZIA 1PRVA 3BDNA 1RPEL 4JCYA 2PUAA 5DRYA 1ZZ8A 3QQ6A 3KL4A 2XI8A 1DW9A 4FBIA 3NDBB 3A9YA 2PXVA 1PRAA 1QP4A 3OQNA 3H5TA 1ZZ7A 4PU8A 4JQDA 3R1FA 3KJXA 1EFAA 4ER5A 4FN3A 4EQZA 3UWPA 1HF0A 3D1NI 2XSDC 1X57A 1JH9A 1ADRA 2LLWA 2OFYA 2V3CC 4OBMA 5GAHi 1ZUGA 3OWQA 1PERL 2PUEA 2HCSA 4PU7A 2J7WA 4Q2JA 3F52A 3OKZA 3A9XA 3GN5B 2EF8A 2WUSR 2LYKA 3RZZA 3IVPA 1ZVVA 2LYLA 3SCHA 2MQKA 3M9LA 4WVLA 2PUFA 3OQMA 4J1WA 4Z58A 2KZ8A 3CECA 1RZSA 2AXUA 2IVGA 4I6UA 1WH6A 3ZHIA 4IA8A 2B5AA 5DSXA 4ER3A 2BJCA 2BNMA 4YBAA 3DNVB 3ZKCA 3NROA 5K98B 1E3OC 1UXDA 1S7EA 1NEQA 2O4AA 1RZRD 2HFZA 1ZZ9A 3LISA 1U2ZA 2OR1L 4Z59A 3BD1A 1QPZA 2JQEA 2H8RA 3F51A 3TEPA 3TFLA 4I6TA 2LNMA 3GUUA 1LQCA 2KEIA 3FYMA 1PRUA 4EKIA 4ER6A 3ZPXA 3GBFA 1QQBA 4HRAA 1Y7YA 3KXAA 2KEJA 3G7DA 4ER7A 2J7UA 4O8BA 1RZRA 4MCTA 1ZZBA 2O49A 2PE5A 2EBYA 4Z5HA 2IU7A 3SCGA 1LMB3 4OB4A 4I8TA 2GZUA 3GZDC 3HZIB 4IWRA 4I6RA 2PXKA 2PUDA 3GN5A 3NZLA 2VEOA 5A7LA 2GRLA 2L1PA 2A6CA 1NW3A 1UTXA 4X4HA 2LYRA 2LCVA 3QWGA 2XXAA 1WIZA 3JXDL 1DULA 3B7HA 3OQOA 2MEZA 2R1JL 1BDIA 1JFTA 4X4GA 4IVZA 2PUGA 2LYPA 4YG1A 2BNNA 3MLFA 3JXCL 4X4BA 1OCTC 3U3WA 3OMTA 1DWKA 1CQTA 3QF3A 2M4HA 2XIUA 3G5GA 3A9ZA 1Y9QA 2XXQA 2IVQA 3MEJA 3LFPA 1PNRA 2PXEA 1ZZ6A 1JWLA 2HSGA 2PXLA 4JCXA 2ICTA 2PXBA 1QP0A 2HCNA 2XCJA 1WETA 1QZXA 5DTRA 2KPJA 3F6WA 1X2LA 1MFQC 2L8NA 1GT0C 2ODRD 2AXZA 3UFDA 1NERA 2IUOA 3NXHA 3VK0A 2FJRA 2PPXA 3R09A 4X4FA 4F8DA 3BS3A 4GHJA 4Y42A 3QYXA 4ER0A 3O9XA 3S8QA 2LYQA 3GZCA 1POUA 4DE9A 3G0TA 3LQXA 5DTQA 5DTMA 5GAGi 4PU4C 3QOXA 2AXVA 3SCFA 1O4XA 2YBDA 1IC8A 3FMYA 4Z5DA 4X4EA 4YG7B 1OSLA 5JUWA 2HINA 2PXPA 2PXUA 1CJGA 3TRBA 3L1PA 2XXPA 1XWRA 4MCXA 4X4IA 3PXPA 2FFHA 2AWIA 2KEKA 2IVBA 3CROL 2CSFA 4Z5CA 5DT2A 3VWSA 1ZZCA 2CROA 3DM5A 4YG4A 1LLIA 2IV1A 2JVLA 4NDWA 2MXDA 2AUWA 3ZHMA 2EWTA 3FYAA 1QP7A 1ZS4A 1L1MA 2PIJA 1VPWA 2LYJA 1ZAYA 5DRTA 4DE8A 3CLCA 2PXFA 1B0NA 2R63A 3ME5A 1UXCA 1SQ8A 1QB2A 2LLVA 3GZDA 3EUSA 4X4DA 1LCDA 3SX0A 3SR4A 1WH8A 3JXBC 2PXDA 1YSEA 1ZPQA 2PUBA 2PXTA 2LYSA 1HQ1A 2ICPA 4GQMA 3KZ3A 2PUCA 2JCGA 1R63A 3OP9A 4J1XA 1AU7A 4EKGA 1QQAA 3QFIA 2PXQA 2GRMA 4PU3C 1RIOA 2WIUB 3QOWA 1LCCA 2L49A 4YARA
chains in the Genus database with same CATH topology
2PPXA 3IVPA 2IU7A 1ZVVA 2LYLA 4X4FA 3SCGA 2AW6A 4F8DA 2XJ3A 1LMB3 1BDHA 3BS3A 2BNOA 4OB4A 4GHJA 4I8TA 4Y42A 3SCHA 3QYXA 1R69A 2MQKA 4X4CA 3O9XA 2GZUA 2O38A 3S8QA 2D5VA 2LYQA 3HZIB 3BDNA 1PRVA 1JFSA 1RPEL 4IWRA 2PUFA 3OQMA 4JCYA 1POUA 2PUAA 4J1WA 4I6RA 4Z58A 2PUDA 3GN5A 2KZ8A 3CECA 1RZSA 1ZZ8A 5A7LA 4PU4C 2AXUA 2GRLA 2IVGA 3QQ6A 2A6CA 4I6UA 2XI8A 1UTXA 1DW9A 1WH6A 2AXVA 3SCFA 4FBIA 4X4HA 3ZHIA 2LYRA 1O4XA 2LCVA 2EBYA 2B5AA 4IA8A 1IC8A 3QWGA 3FMYA 1WIZA 3JXDL 2BJCA 2BNMA 4Z5DA 4X4EA 4YBAA 4YG7B 3DNVB 1OSLA 3ZKCA 2HINA 1CJGA 3TRBA 3L1PA 1XWRA 3B7HA 4MCXA 3PXPA 2MEZA 4X4IA 2R1JL 3OQOA 1BDIA 5K98B 1JFTA 1E3OC 1UXDA 4X4GA 4IVZA 2AWIA 2KEKA 2IVBA 2PUGA 1S7EA 2LYPA 4YG1A 3CROL 2CSFA 1NEQA 2BNNA 3MLFA 3JXCL 2O4AA 4Z5CA 4X4BA 1ZZCA 2CROA 4YG4A 1OCTC 3U3WA 1RZRD 1LLIA 2IV1A 2JVLA 4NDWA 1PRAA 1QP4A 3OMTA 2AUWA 1DWKA 3OQNA 3ZHMA 2EWTA 1ZZ9A 1CQTA 3FYAA 3LISA 3QF3A 1ZS4A 2PIJA 1L1MA 1QP7A 3H5TA 2XIUA 1VPWA 3G5GA 2LYJA 1Y9QA 1ZZ7A 2OR1L 1ZAYA 4PU8A 4JQDA 3R1FA 2IVQA 3CLCA 1B0NA 2R63A 1UXCA 3LFPA 1SQ8A 4Z59A 1PNRA 3BD1A 1QPZA 3EUSA 1ZZ6A 3KJXA 1JWLA 1EFAA 2H8RA 2HSGA 4FN3A 4X4DA 1LCDA 3F51A 4JCXA 1WH8A 3JXBC 1HF0A 4I6TA 3D1NI 2XSDC 2ICTA 1X57A 1YSEA 1ZPQA 1JH9A 1QP0A 1ADRA 2XCJA 1LQCA 2OFYA 2KEIA 3FYMA 1WETA 2PUBA 1PRUA 1ZUGA 2LYSA 2ICPA 2KPJA 4GQMA 3GBFA 3KZ3A 3F6WA 1QQBA 1PERL 2PUCA 1Y7YA 2PUEA 1X2LA 2JCGA 3KXAA 1R63A 3OP9A 4J1XA 2KEJA 1AU7A 3G7DA 4PU7A 3F52A 2L8NA 1GT0C 1QQAA 3UFDA 2AXZA 1NERA 4O8BA 1RZRA 4MCTA 2IUOA 2GRMA 3VK0A 4PU3C 1RIOA 2WIUB 2EF8A 3GN5B 1ZZBA 1LCCA 2WUSR 2L49A 2O49A 2LYKA 2PE5A 4YARA 2FJRA 4Z5HA 3RZZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PPX A;  3IVP A;  2IU7 A;  1ZVV A;  2LYL A;  4X4F A;  3SCG A;  2AW6 A;  4F8D A;  2XJ3 A;  1LMB 3;  1BDH A;  3BS3 A;  2BNO A;  4OB4 A;  4GHJ A;  4I8T A;  4Y42 A;  3SCH A;  3QYX A;  1R69 A;  2MQK A;  4X4C A;  3O9X A;  2GZU A;  2O38 A;  3S8Q A;  2D5V A;  2LYQ A;  3HZI B;  3BDN A;  1PRV A;  1JFS A;  1RPE L;  4IWR A;  2PUF A;  3OQM A;  4JCY A;  1POU A;  2PUA A;  4J1W A;  4I6R A;  4Z58 A;  2PUD A;  3GN5 A;  2KZ8 A;  3CEC A;  1RZS A;  1ZZ8 A;  5A7L A;  4PU4 C;  2AXU A;  2GRL A;  2IVG A;  3QQ6 A;  2A6C A;  4I6U A;  2XI8 A;  1UTX A;  1DW9 A;  1WH6 A;  2AXV A;  3SCF A;  4FBI A;  4X4H A;  3ZHI A;  2LYR A;  1O4X A;  2LCV A;  2EBY A;  2B5A A;  4IA8 A;  1IC8 A;  3QWG A;  3FMY A;  1WIZ A;  3JXD L;  2BJC A;  2BNM A;  4Z5D A;  4X4E A;  4YBA A;  4YG7 B;  3DNV B;  1OSL A;  3ZKC A;  2HIN A;  1CJG A;  3TRB A;  3L1P A;  1XWR A;  3B7H A;  4MCX A;  3PXP A;  2MEZ A;  4X4I A;  2R1J L;  3OQO A;  1BDI A;  5K98 B;  1JFT A;  1E3O C;  1UXD A;  4X4G A;  4IVZ A;  2AWI A;  2KEK A;  2IVB A;  2PUG A;  1S7E A;  2LYP A;  4YG1 A;  3CRO L;  2CSF A;  1NEQ A;  2BNN A;  3MLF A;  3JXC L;  2O4A A;  4Z5C A;  4X4B A;  1ZZC A;  2CRO A;  4YG4 A;  1OCT C;  3U3W A;  1RZR D;  1LLI A;  2IV1 A;  2JVL A;  4NDW A;  1PRA A;  1QP4 A;  3OMT A;  2AUW A;  1DWK A;  3OQN A;  3ZHM A;  2EWT A;  1ZZ9 A;  1CQT A;  3FYA A;  3LIS A;  3QF3 A;  1ZS4 A;  2PIJ A;  1L1M A;  1QP7 A;  3H5T A;  2XIU A;  1VPW A;  3G5G A;  2LYJ A;  1Y9Q A;  1ZZ7 A;  2OR1 L;  1ZAY A;  4PU8 A;  4JQD A;  3R1F A;  2IVQ A;  3CLC A;  1B0N A;  2R63 A;  1UXC A;  3LFP A;  1SQ8 A;  4Z59 A;  1PNR A;  3BD1 A;  1QPZ A;  3EUS A;  1ZZ6 A;  3KJX A;  1JWL A;  1EFA A;  2H8R A;  2HSG A;  4FN3 A;  4X4D A;  1LCD A;  3F51 A;  4JCX A;  1WH8 A;  3JXB C;  1HF0 A;  4I6T A;  3D1N I;  2XSD C;  2ICT A;  1X57 A;  1YSE A;  1ZPQ A;  1JH9 A;  1QP0 A;  1ADR A;  2XCJ A;  1LQC A;  2OFY A;  2KEI A;  3FYM A;  1WET A;  2PUB A;  1PRU A;  1ZUG A;  2LYS A;  2ICP A;  2KPJ A;  4GQM A;  3GBF A;  3KZ3 A;  3F6W A;  1QQB A;  1PER L;  2PUC A;  1Y7Y A;  2PUE A;  1X2L A;  2JCG A;  3KXA A;  1R63 A;  3OP9 A;  4J1X A;  2KEJ A;  1AU7 A;  3G7D A;  4PU7 A;  3F52 A;  2L8N A;  1GT0 C;  1QQA A;  3UFD A;  2AXZ A;  1NER A;  4O8B A;  1RZR A;  4MCT A;  2IUO A;  2GRM A;  3VK0 A;  4PU3 C;  1RIO A;  2WIU B;  2EF8 A;  3GN5 B;  1ZZB A;  1LCC A;  2WUS R;  2L49 A;  2O49 A;  2LYK A;  2PE5 A;  4YAR A;  2FJR A;  4Z5H A;  3RZZ A; 
#chains in the Genus database with same CATH topology
 2AW6 A;  2XJ3 A;  1BDH A;  2BNO A;  1R69 A;  3PE5 A;  4X4C A;  3TEL A;  2O38 A;  4EK9 A;  2D5V A;  1JFS A;  4EZI A;  1PRV A;  3BDN A;  1RPE L;  4JCY A;  2PUA A;  5DRY A;  1ZZ8 A;  3QQ6 A;  3KL4 A;  2XI8 A;  1DW9 A;  4FBI A;  3NDB B;  3A9Y A;  2PXV A;  1PRA A;  1QP4 A;  3OQN A;  3H5T A;  1ZZ7 A;  4PU8 A;  4JQD A;  3R1F A;  3KJX A;  1EFA A;  4ER5 A;  4FN3 A;  4EQZ A;  3UWP A;  1HF0 A;  3D1N I;  2XSD C;  1X57 A;  1JH9 A;  1ADR A;  2LLW A;  2OFY A;  2V3C C;  4OBM A;  5GAH i;  1ZUG A;  3OWQ A;  1PER L;  2PUE A;  2HCS A;  4PU7 A;  2J7W A;  4Q2J A;  3F52 A;  3OKZ A;  3A9X A;  3GN5 B;  2EF8 A;  2WUS R;  2LYK A;  3RZZ A;  3IVP A;  1ZVV A;  2LYL A;  3SCH A;  2MQK A;  3M9L A;  4WVL A;  2PUF A;  3OQM A;  4J1W A;  4Z58 A;  2KZ8 A;  3CEC A;  1RZS A;  2AXU A;  2IVG A;  4I6U A;  1WH6 A;  3ZHI A;  4IA8 A;  2B5A A;  5DSX A;  4ER3 A;  2BJC A;  2BNM A;  4YBA A;  3DNV B;  3ZKC A;  3NRO A;  5K98 B;  1E3O C;  1UXD A;  1S7E A;  1NEQ A;  2O4A A;  1RZR D;  2HFZ A;  1ZZ9 A;  3LIS A;  1U2Z A;  2OR1 L;  4Z59 A;  3BD1 A;  1QPZ A;  2JQE A;  2H8R A;  3F51 A;  3TEP A;  3TFL A;  4I6T A;  2LNM A;  3GUU A;  1LQC A;  2KEI A;  3FYM A;  1PRU A;  4EKI A;  4ER6 A;  3ZPX A;  3GBF A;  1QQB A;  4HRA A;  1Y7Y A;  3KXA A;  2KEJ A;  3G7D A;  4ER7 A;  2J7U A;  4O8B A;  1RZR A;  4MCT A;  1ZZB A;  2O49 A;  2PE5 A;  2EBY A;  4Z5H A;  2IU7 A;  3SCG A;  1LMB 3;  4OB4 A;  4I8T A;  2GZU A;  3GZD C;  3HZI B;  4IWR A;  4I6R A;  2PXK A;  2PUD A;  3GN5 A;  3NZL A;  2VEO A;  5A7L A;  2GRL A;  2L1P A;  2A6C A;  1NW3 A;  1UTX A;  4X4H A;  2LYR A;  2LCV A;  3QWG A;  2XXA A;  1WIZ A;  3JXD L;  1DUL A;  3B7H A;  3OQO A;  2MEZ A;  2R1J L;  1BDI A;  1JFT A;  4X4G A;  4IVZ A;  2PUG A;  2LYP A;  4YG1 A;  2BNN A;  3MLF A;  3JXC L;  4X4B A;  1OCT C;  3U3W A;  3OMT A;  1DWK A;  1CQT A;  3QF3 A;  2M4H A;  2XIU A;  3G5G A;  3A9Z A;  1Y9Q A;  2XXQ A;  2IVQ A;  3MEJ A;  3LFP A;  1PNR A;  2PXE A;  1ZZ6 A;  1JWL A;  2HSG A;  2PXL A;  4JCX A;  2ICT A;  2PXB A;  1QP0 A;  2HCN A;  2XCJ A;  1WET A;  1QZX A;  5DTR A;  2KPJ A;  3F6W A;  1X2L A;  1MFQ C;  2L8N A;  1GT0 C;  2ODR D;  2AXZ A;  3UFD A;  1NER A;  2IUO A;  3NXH A;  3VK0 A;  2FJR A;  2PPX A;  3R09 A;  4X4F A;  4F8D A;  3BS3 A;  4GHJ A;  4Y42 A;  3QYX A;  4ER0 A;  3O9X A;  3S8Q A;  2LYQ A;  3GZC A;  1POU A;  4DE9 A;  3G0T A;  3LQX A;  5DTQ A;  5DTM A;  5GAG i;  4PU4 C;  3QOX A;  2AXV A;  3SCF A;  1O4X A;  2YBD A;  1IC8 A;  3FMY A;  4Z5D A;  4X4E A;  4YG7 B;  1OSL A;  5JUW A;  2HIN A;  2PXP A;  2PXU A;  1CJG A;  3TRB A;  3L1P A;  2XXP A;  1XWR A;  4MCX A;  4X4I A;  3PXP A;  2FFH A;  2AWI A;  2KEK A;  2IVB A;  3CRO L;  2CSF A;  4Z5C A;  5DT2 A;  3VWS A;  1ZZC A;  2CRO A;  3DM5 A;  4YG4 A;  1LLI A;  2IV1 A;  2JVL A;  4NDW A;  2MXD A;  2AUW A;  3ZHM A;  2EWT A;  3FYA A;  1QP7 A;  1ZS4 A;  1L1M A;  2PIJ A;  1VPW A;  2LYJ A;  1ZAY A;  5DRT A;  4DE8 A;  3CLC A;  2PXF A;  1B0N A;  2R63 A;  3ME5 A;  1UXC A;  1SQ8 A;  1QB2 A;  2LLV A;  3GZD A;  3EUS A;  4X4D A;  1LCD A;  3SX0 A;  3SR4 A;  1WH8 A;  3JXB C;  2PXD A;  1YSE A;  1ZPQ A;  2PUB A;  2PXT A;  2LYS A;  1HQ1 A;  2ICP A;  4GQM A;  3KZ3 A;  2PUC A;  2JCG A;  1R63 A;  3OP9 A;  4J1X A;  1AU7 A;  4EKG A;  1QQA A;  3QFI A;  2PXQ A;  2GRM A;  4PU3 C;  1RIO A;  2WIU B;  3QOW A;  1LCC A;  2L49 A;  4YAR A; 
#chains in the Genus database with same CATH homology
 2PPX A;  3IVP A;  2IU7 A;  1ZVV A;  2LYL A;  4X4F A;  3SCG A;  2AW6 A;  4F8D A;  2XJ3 A;  1LMB 3;  1BDH A;  3BS3 A;  2BNO A;  4OB4 A;  4GHJ A;  4I8T A;  4Y42 A;  3SCH A;  3QYX A;  1R69 A;  2MQK A;  4X4C A;  3O9X A;  2GZU A;  2O38 A;  3S8Q A;  2D5V A;  2LYQ A;  3HZI B;  3BDN A;  1PRV A;  1JFS A;  1RPE L;  4IWR A;  2PUF A;  3OQM A;  4JCY A;  1POU A;  2PUA A;  4J1W A;  4I6R A;  4Z58 A;  2PUD A;  3GN5 A;  2KZ8 A;  3CEC A;  1RZS A;  1ZZ8 A;  5A7L A;  4PU4 C;  2AXU A;  2GRL A;  2IVG A;  3QQ6 A;  2A6C A;  4I6U A;  2XI8 A;  1UTX A;  1DW9 A;  1WH6 A;  2AXV A;  3SCF A;  4FBI A;  4X4H A;  3ZHI A;  2LYR A;  1O4X A;  2LCV A;  2EBY A;  2B5A A;  4IA8 A;  1IC8 A;  3QWG A;  3FMY A;  1WIZ A;  3JXD L;  2BJC A;  2BNM A;  4Z5D A;  4X4E A;  4YBA A;  4YG7 B;  3DNV B;  1OSL A;  3ZKC A;  2HIN A;  1CJG A;  3TRB A;  3L1P A;  1XWR A;  3B7H A;  4MCX A;  3PXP A;  2MEZ A;  4X4I A;  2R1J L;  3OQO A;  1BDI A;  5K98 B;  1JFT A;  1E3O C;  1UXD A;  4X4G A;  4IVZ A;  2AWI A;  2KEK A;  2IVB A;  2PUG A;  1S7E A;  2LYP A;  4YG1 A;  3CRO L;  2CSF A;  1NEQ A;  2BNN A;  3MLF A;  3JXC L;  2O4A A;  4Z5C A;  4X4B A;  1ZZC A;  2CRO A;  4YG4 A;  1OCT C;  3U3W A;  1RZR D;  1LLI A;  2IV1 A;  2JVL A;  4NDW A;  1PRA A;  1QP4 A;  3OMT A;  2AUW A;  1DWK A;  3OQN A;  3ZHM A;  2EWT A;  1ZZ9 A;  1CQT A;  3FYA A;  3LIS A;  3QF3 A;  1ZS4 A;  2PIJ A;  1L1M A;  1QP7 A;  3H5T A;  2XIU A;  1VPW A;  3G5G A;  2LYJ A;  1Y9Q A;  1ZZ7 A;  2OR1 L;  1ZAY A;  4PU8 A;  4JQD A;  3R1F A;  2IVQ A;  3CLC A;  1B0N A;  2R63 A;  1UXC A;  3LFP A;  1SQ8 A;  4Z59 A;  1PNR A;  3BD1 A;  1QPZ A;  3EUS A;  1ZZ6 A;  3KJX A;  1JWL A;  1EFA A;  2H8R A;  2HSG A;  4FN3 A;  4X4D A;  1LCD A;  3F51 A;  4JCX A;  1WH8 A;  3JXB C;  1HF0 A;  4I6T A;  3D1N I;  2XSD C;  2ICT A;  1X57 A;  1YSE A;  1ZPQ A;  1JH9 A;  1QP0 A;  1ADR A;  2XCJ A;  1LQC A;  2OFY A;  2KEI A;  3FYM A;  1WET A;  2PUB A;  1PRU A;  1ZUG A;  2LYS A;  2ICP A;  2KPJ A;  4GQM A;  3GBF A;  3KZ3 A;  3F6W A;  1QQB A;  1PER L;  2PUC A;  1Y7Y A;  2PUE A;  1X2L A;  2JCG A;  3KXA A;  1R63 A;  3OP9 A;  4J1X A;  2KEJ A;  1AU7 A;  3G7D A;  4PU7 A;  3F52 A;  2L8N A;  1GT0 C;  1QQA A;  3UFD A;  2AXZ A;  1NER A;  4O8B A;  1RZR A;  4MCT A;  2IUO A;  2GRM A;  3VK0 A;  4PU3 C;  1RIO A;  2WIU B;  2EF8 A;  3GN5 B;  1ZZB A;  1LCC A;  2WUS R;  2L49 A;  2O49 A;  2LYK A;  2PE5 A;  4YAR A;  2FJR A;  4Z5H A;  3RZZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...