5DTQA

Crystal structure of dot1l in complex with inhibitor cpd3 [(2,6-dichlorophenyl)(quinolin-6-yl)methanone]
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
328
structure length
320
Chain Sequence
LELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMENYVLIDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTNTRPSTGLLRHILQQVYNHSVTDPEKLNNYEPFSPEVYGETSFDLVAQMIDEIKMTDDDLFVDLGSGVGQVVLQVAAATNCKHHYGVEKADIPAKYAETMDREFRKWMKWYGKKHAEYTLERGDFLSEEWRERIANTSVIFVNNFAFGPEVDHQLKERFANMKEGGRIVSSKPFAPLNFRINSRNLSDIGTIMRVVELSPLKGSWTGKPVSYYLHTIDRTILENYFSSLKNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone-lysine N-methyltransferase, H3 lysine-79 specific
publication title Optimization of a Fragment-Based Screening Hit toward Potent DOT1L Inhibitors Interacting in an Induced Binding Pocket.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 103
structure length 320
sequence length 328
chains with identical sequence B
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2015-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08123 DOT1 Histone methylation protein DOT1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.60 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) 434 Repressor (Amino-terminal Domain) 5dtqA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5dtqA02
1QAMA 1ZQ9A 2YR0A 3EVGA 5K03A 4PCAA 1VBFA 3DR5A 4PIMA 4R8SA 5KYGA 2PBFA 1P91A 2O57A 4RVHA 3PX3A 3BGIA 3FUTA 4AZTA 3PS9A 3X0DA 5CCXA 3BWCA 2FK8A 4AZSA 1RJEA 4IV0A 5HIIA 1XVAA 2ONYA 3OZTA 4P7GA 3SSNA 4RTNA 3G88A 4FR0A 1EIZA 5DLYA 4X61A 3NDJA 2BM8A 2V7EA 3LL7A 1F3LA 1RJGA 1EJ6A 3KPUA 4JXJA 1Y8CA 2GPYA 2O05A 2P40A 2PGXA 3LCVB 4GUAA 4YMHA 2FYTA 3DXXA 3MQ2A 4RTLA 2C7RA 3UJ6A 5DM0A 3FZGA 4PYKA 5DM2A 3I58A 5E1BA 2PV0A 3TM4A 3HP7A 2CKDA 3M6VA 2ZZKA 2AN5A 4E30A 2IPXA 3MERA 5BW4A 10MHA 3DLIA 1UIRA 5EQJB 3UJBA 3UZUA 3CJQA 4YV0A 3EGEA 4XUCA 5MHTA 1KP9A 5DT2A 5JR3A 4CXMA 3FPEA 5DM4A 3DH0A 1G8AA 5DTRA 5F2KA 2PX8A 4MHTA 1BOOA 2P1DA 2QY6A 2WA1A 2IGTA 4CWAA 2GLUA 3NMUF 3OU7A 2GH1A 3FPGA 3G89A 3KQSA 1G8SA 5HEKA 5HILA 3G8BA 3LDFA 1KPHA 3A25A 4Y2HA 4RVDA 1RI1A 1X1DA 3A7EA 1RI3A 3IHTA 3P9KA 5K0BA 3G2QA 4LECA 1X1AA 2QYOA 3LKZA 1D2CA 2I62A 2FHPA 3P2EA 3GJYA 2PY6A 4MWZA 1YUBA 2ZIGA 5GP1A 4Z2YA 3RIEA 4P7JA 3UJDA 5HZMA 5GIPE 2GAFA 2VDUE 4BP3A 3CCFA 4PONA 1XJ5A 4RTRA 5EKXA 3OE4A 4KDCA 2PX4A 4E2ZA 1M0EA 3FUXA 2AOVA 4AUKA 3UJ7A 1ZHFA 2ZLBA 3B3JA 3DMGA 3TRKA 4RX1A 1DUSA 4GOND 3EVFA 5G02A 3UBTA 1R74A 2EFJA 2P7HA 2PWPA 2BR5A 3OZSA 1QZZA 1D2HA 1SUIA 5DWQA 4F86A 4YUYA 1WXXA 5FADA 1NW3A 4GOLD 4HGZA 4U7TB 3FUUA 4QVGA 3P9IA 3OU6A 4ZTBA 3EEOA 1TW3A 1IM8A 3QOWA 4HGYA 2P35A 4QVKA 1AQJA 1HNNA 1YZHA 3DOUA 5EEHA 3FPFA 1U2ZA 2PXAA 4RTJA 2Z6AA 3GWZA 4OBWA 5D1HA 4FS8A 4EQZA 3C0KA 4ER3A 2QRVB 5EGSA 3UWPA 4F84A 3KPWA 3GGDA 1XTPA 3DULA 3NVMB 3VC2A 2QM3A 5DRYA 1L3IA 2NXEA 3B89A 4V0QA 4C03A 5LQKA 5LQAA 2OY0A 4HRAA 2AOXA 1NW5A 1Q0TA 3G2MA 4CKCA 4RTSA 3HA5A 1R8YA 3LGAA 1NE2A 3EVAA 3OE5A 5EMLA 1EJ0A 3I64A 4KW7A 3TM5A 5F2NA 4GOOD 4GC9A 3HVKA 3K6RA 5K05A 5CD1A 4HG2A 4ISCA 1B42A 1RJDA 7MHTA 3CJRA 5H02A 4RTKA 3GRRA 3DUWA 4C4AA 2QE6A 3KQQA 4FSDA 4PNEA 1JQEA 2GB4A 1FJXA 3H2BA 3FTEA 3AXSA 1NV9A 3KQTA 5CM2Z 4MTLA 1JTEA 2PT9A 1XDZA 2BZGA 2YXEA 2AS0A 1VQ1A 2BM9A 3VYWA 4OA8A 3T0IA 2ZCJA 3ER8A 3QV2A 5DX8A 3TKAA 2CMHA 4FGZA 5HOQA 5GM1A 4C07A 4LG1A 3OPNA 3HCCA 4QQNA 3JWHA 4HC4A 2IDJA 5JUWA 3AJDA 5T6BA 1EAMA 3ORHA 4B17A 4RTPA 1PRYA 2AR0A 3T7RA 4RVFA 3BWBA 1JG4A 5KS2A 3MCTA 3OZRA 3E7PA 1KYZA 2ZBRA 3IV6A 1SQGA 3KR1A 3D2LA 4RTMA 1NT2A 3UJ8A 1L1EA 3LX6A 5FA8A 1XCLA 5LQJA 2IH4A 1VLMA 5T64A 3REOA 4F85A 3EVEA 4ER6A 3LCCA 4IWNA 1SUSA 4HTFB 5K0GA 5HIKA 2G1PA 3LCUA 1INLA 1AF7A 3P9CA 4H0NA 4X60A 3NVKI 2PX5A 2YQZA 4YUVA 1SG9A 1Z3CA 4K6MA 3A7DA 4GF5A 2YX1A 4CTKA 5LSAA 2HV9A 1BC5A 1JG1A 3R6TA 4BP1A 4ER5A 3WSTA 2F8LA 3EPPA 3HCBA 3KKZA 3KQWA 2PKWA 3LKDA 3MGGA 4GBED 5EEGA 3EEYA 3TPZA 4M7RA 2ZSUA 4LWPA 1P1CA 2FCAA 5K0CA 5CVEA 3C3PA 5FWAA 1JSZA 2FPOA 2IP2A 5CVDA 3KU1A 3FRHA 5K0LA 3PFHA 1BKYA 3G2PA 3KQVA 1WZNA 1YFJA 3M70A 3VSEA 3E05A 4Y30A 2I6GA 3FTCA 4X63A 3DP7A 1QAQA 5LQRA 5DTMA 2OXTA 2GS9A 5FQNA 4AX8A 3IYLW 4LWOA 1WS6A 2B78A 1D2GA 1QAOA 1VIDA 3VC1A 4CTJA 3PLAE 1XXLA 3DLCA 2YXDA 4QTTB 4DM3A 4QPNA 4DCMA 1N7JA 4IKPA 2B3TA 2ONZA 9MHTA 3RODA 1FBNA 2IH5A 3GU3A 3I5UA 4E2XA 4U7PB 3LBYA 3C6KA 4FZVA 2Z6QA 2E5WA 2HTEA 1G55A 1YZ3A 2AOUB 3ELWA 3ELUA 5EC8A 3S68A 1XCJA 5F2OA 4QDKA 1R6AA 4L7VA 5E1OA 5K8VA 4OX9Y 5EOVA 2HMYB 4E70A 3CJTA 2H11A 2NXCA 4FT2A 5EKUA 1JG2A 5CCBA 5LQCA 1KPIA 3PX2A 5E8JA 2CWWA 4E32A 2N47A 4AZWA 1G38A 4ER0A 3TKYA 5BW5A 3FYCA 2DULA 1L9KA 3HCFA 1JQ3A 1MJFA 2HNKA 5P8WA 2OB1A 1FP1D 3A27A 4OQDA 1FPQA 5ICGA 4HH4A 1JTFA 1KIAA 3BKWA 2ERCA 3M33A 3BWMA 2O07A 2IIPA 3E23A 5D1NA 5FHQA 2UYQA 4XCXA 2CL5A 5HIJA 5E8RA 1NV8A 3HVIA 3MHTA 3G7UA 2LD4A 4PYMA 5DXAA 3UJAA 2PXCA 1G60A 2O0LA 1M6YA 3SMQA 1O54A 1NKVA 4M36A 3TOSA 3UJCA 3E8SA 5GM2A 2H1RA 2VS1A 2NXJA 3UA3A 2BR4A 5K0JA 2IBSA 3O4FA 2ZBPA 4EK9A 1UFKA 4RVGA 2AOTB 5T67A 4WVLA 4C04A 2XYVA 2I9KA 3BGVA 3L8DA 2C7PA 5LR6A 3LBFA 3UJ9A 3GCZA 4YV2A 2UYOA 3UFBA 4BLWA 1O9GA 2ZTHA 3GDHA 3KQPA 1ORHA 4OA5A 5DX0A 4PYQA 2B25A 5EZSA 5E1MA 3SGLA 4YUZA 3GNLA 1RI4A 3ERCA 1RI2A 3G8AA 3HTXA 3I9FA 4FP9A 4KIFA 5DX1A 2Q41A 5EMMA 3HA3A 3BWYA 3KR2A 2AN3A 4KVZA 5EMKA 2ZWVA 3P8ZA 5EIWA 3TR6A 2O06A 3LHDA 5CIYA 3HM2A 2Y1XA 2JH8A 5K09A 1N7IA 3P2IA 1NW8A 3LSTA 4OBXA 4R05A 4RSRA 2EJTA 2NP6A 3EMBA 4YUXA 3CBGA 2AOUA 3CVOA 4HSGA 4P7KA 4P58A 4DA4A 4OQEA 3QOXA 1R18A 4R6WA 5CVUA 2AN4A 3G2OA 4KWCA 4PGGA 5E2AA 4E33A 3EVZA 1R8XA 3EGIA 4NECA 5GOZA 4C06A 3EVBA 5CUQA 2AZTA 3FPJA 3P9NA 3BXOA 3KPYA 5DXJA 3NTVA 2PXXA 4PGHA 3RW9A 5HFJA 3SSMA 4PYNA 1AQIA 1M6EX 1RI5A 5IKMA 2P3OA 3I53A 2ZZNA 5E9QA 5FCDA 5DSTA 1I9GA 3SR4A 3PTAA 3M4XA 2JHCA 2P41A 2OO3A 2PLWA 1DL5A 2GA9A 3GRZA 2HWKA 2PVCA 3M6UA 4V0RA 5GWXA 4DKJA 3KHKA 3KPVA 4PYIA 4WXHA 4R8RA 2P8JA 2XYRA 3TLJA 4YMGA 4RWZA 2CMGA 5C1IA 4QDJA 1JQDA 5U4XA 4EKGA 2G70A 3UA4A 2ZZMA 3EVCA 1XDSA 1OR8A 2R3SA 3PT9A 1NBIA 5FULA 5B1SA 4CKEA 1Q0SA 4RV9A 3CKKA 5EZQA 1G6Q1 3JWJA 3GXOA 3R3HA 2QRVA 3HCAA 3P71T 2C7OA 2AOTA 3KQOA 4DMGA 5ICEA 1TPYA 3AY0A 4BLVA 3EMDA 3FUVA 3MAGA 3CGGA 2NP7A 1UWVA 2OB2A 5EIFA 5ERGB 3T7SA 5GINE 2YUIA 1VPTA 1QANA 4DQ0A 2JG3A 3O7WA 1FP2A 2XVAA 1ZKDA 2VDVE 3HA7A 4KIGA 4PYJA 5HIMA 3R0QA 3ELDA 5M5BA 2DPMA 2P3LA 3B5IA 4XUEA 5GIOE 2A14A 4E2YA 1KYWA 1DCTA 2ORED 3DMHA 3KQMA 3NJRA 1YF3A 4O29A 1XDUA 3M6WA 2XVMA 3OU2A 1VP3A 3LDUA 3FTFA 2PJDA 4C08A 5C9ZA 5FUBA 2WK1A 3ID6C 4C05A 3DXYA 5IH3A 3IEIA 4GEKA 4YV1A 3A4TA 3BUSA 1WY7A 4YUWA 3MTEA 1HMYA 3O31A 5K01A 2G71A 1NW7A 3FTDA 5LQUA 2BH2A 4KRGA 2Y1WA 3ELYA 2AOWA 4PINA 2ZW9A 1JR4A 3HCDA 2EX4A 1YB2A 1I1NA 1I4WA 3FRIA 3FPHA 4EVIA 4PWYA 5KQRA 3FUWA 3DXZA 3TMAA 4CKBA 1P39A 2K4MA 1H1DA 5FA5A 4PIPA 5ICCA 3GIWA 1EG2A 5CVJA 2YVLA 1X1CA 2FK7A 1X19A 4IV8A 3M6XA 4A6DA 3PFGA 1NBHA 3MB5A 3LPMA 3R9XB 3MCZA 4HTFA 4PCLA 5EMJA 1AV6A 4E2WA 2G8NA 1ZG3A 1VP9A 5EG5A 4R6XA 1SKMA 1X1BA 2OBFA 5FQOA 3P2KA 5ICFA 4DCGA 2XBMA 5C0OE 1IXKA 2IH2A 3THRA 1EQAA 1KPGA 3JWGA 3BGDA 3LDGA 8MHTA 4GOMD 1JG3A 2C7QA 1TW2A 2BR3A 3BZBA 2ZBQA 1T43A 3TQSA 1KXZA 4RTQA 2I7CA 3NW9A 1P1BA 2VZ9A 2ZULA 2ZIEA 4RYLA 3KR9A 3B3FA 2OZVA 1N2XA 3HCEA 2IBTA 3MTIA 2IFTA 3GRUA 4M37A 5KVAA 2PX2A 2JHAA 2OKCA 5FTWA 4MQ4A 3AWIA 3SM3A 3EVDA 2HR1A 2AVNA 1WXWA 3KPJA 3LECA 3OFJA 2Z6UA 5DRTA 1L3CA 2EG5A 3SX0A 4E31A 1F38A 3HEMA 4RTOA 2NNWB 1VE3A 2ZVJA 3HVJA 3P97A 3PB3A 1SVUA 2EJUA 4MIKA 4PYOA 2YXLA 4QQKA 2IDKA 3ME5A 1ORIA 5EHGA 5FHRA 2FRXA 5K0NA 4A6EA 4GC5A 3SXJA 4ATNA 1IY9A 2P7IA 2ZFUA 5FWDA 3B3GA 3G5TA 2H00A 3ANXA 1SQFA 3GO4A 3GRYA 2YTZA 3GRVA 5DM1A 4BLUA 1MHTA 2B2CA 4UOEA 3OFKA 3V97A 1BHJA 2ZIFA 3SVZA 5EVJA 5KQSA 5DTQA 4QTUB 1KHHA 3KQYA 3V8VA 2XYQA 3G5LA 4FT4A 1V39A 5K0EA 2PSSA 3KR0A 2JH9A 3BKXA 4X1OA 2ADMA 4ER7A 3NDIA 3OCJA 1ZGAA 3HVHA 3B7PA 2OPBA 3CC8A 5E9WA 4QPPA 2UZ4A 3ER9A 3EGVA 1ZGJA 3U81A 2VDWA 3JWIA 4POOA 2VP3A 5BP7A 2JJQA 2AVDA 2NXNA 3A26A 3HNRA 2KW5A 4X41A 4G56A 5E9JA 1O9HA 2NYUA 1PJZA 5CVVA 3TFWA 3C6MA 2G72A 2PT6A 3F4KA 3DTNA 3Q7EA 5BXYA 3T7TA 3SSOA 3AXTA 5E1DA 1VL5A 1WG8A 1L3BA 2OYRA 2JHPA 3Q87B 5DSXA 4EMSA 4M38A 2V74B 1KR5A 3DMFA 5E2BA 1NW6A 4PYLA 2UYCA 5LQNA 4XUDA 5DPMA 3BT7A 3K0BA 5EPEA 4DZRA 4GQBA 3C3YA 1R00A 2ESRA 3R24A 3FYDA 5K0FA 2P3QA 1YFLA 3NWBA 4KDRA 2WA2A 3THSA 2B9EA 3NWEA 5EHIA 1RJFA 4DF3A 4BY9E 1JSXA 4EKIA 2R6ZA 3PVCA 2UYHA 2ZWAA 4FSXA 4AZVA 1QYRA 4P7FA 2PWYA
chains in the Genus database with same CATH superfamily
4IG4A 3CO5A 4BZPA 4LF6B 5G1PA 3DE3X 4AZ3A 3E35A 1TF2A 4B3HA 3D6TB 4LDZA 1W0CA 1Z4QA 3RFFA 2QOEA 3ZWAA 4AZTA 3FOAA 5HBGA 3C1OA 3OCYA 1RJEA 3PE5A 2XGMA 6REQB 1E3MA 2ZPUA 2V55B 5AKHA 3PWKA 1Z6QA 3I1JA 3WLOA 1D2RA 2NYVA 2JLBA 3T7DA 2FOLA 1NNSA 1ADBA 1FQJA 1J99A 1WOYA 1ZUNA 2ECKA 3C3EA 2R8EA 3T1VA 3WX0A 4CLOB 1PGNA 4EB8A 2D7JA 1YZFA 2ZT8A 2JGKA 2PGXA 4ZI7A 3OCWA 3W3AA 2V7XA 3A06A 3GA0A 3QA9A 3F5SA 1ABFA 3AUTA 4M7OA 5CK4A 2RAVA 1AMOA 4AQDA 5DM0A 2XUAA 4MUHA 4Q7MB 4QYXA 1LI5A 1HOTA 2FMUA 2BF4A 2V0GA 2WKWA 4QGBA 5AVRA 5J1SB 4LWQA 2IXEA 4A23A 2PUCA 1E9CA 3DDOA 5HKLA 1DBWA 2KZ8A 2G40A 2XXQA 1MMFB 3PUJA 4I36A 1NVVR 5JR3A 2C42A 4MWCA 1F5NA 1SC6A 3ILVA 1TVKB 2OMKA 1ZSYA 3H05A 1DCKA 4M8NE 2G9NA 4LYGA 5FWYB 3W79A 4ZQGA 3WNCA 3G8BA 5NLLA 4D8UA 1MV5A 1RI1A 1UBFA 2AG8A 5K0BA 3IPRA 4HT3B 1AQYA 3FZNA 4LECA 3P26A 2IU0A 1E3EA 3MJRA 3P2EA 5DTEA 5A04A 4DUGA 3LXRA 1LLFA 2WUEA 4L2IB 3UJDA 1GGVA 5JD5A 1NYQA 3WKAA 5BQXA 3GH3A 4ENQA 1W2GA 4P3KA 4OMCA 3VDMA 1YRQA 1TM3E 4R1SA 3QITA 4Y9UA 2DGDA 4RANA 2YRFA 3TRKA 2P2YA 4BDTA 1IMJA 4TWJA 2EFJA 5A71A 3MM4A 3T3MB 2P67A 4F86A 1K88A 1JPUA 4HB2A 1B3BA 1G5FA 1PT8A 2C61A 4R7ZA 3P9IA 4JKIA 5ETJA 1FLAA 2C03A 1JDBC 2H57A 5BNTA 1J0CA 2Q1TA 1HNNA 1V3TA 3GZTB 3G2NA 1MB0A 1R6BX 2POQX 1XZHA 5HG0A 3LP5A 3O0DA 2F48A 1H3FA 5M34A 4O4IA 1CUGA 3DULA 3RR2A 1U81A 4D9EA 5I8ZA 1Y1KE 3CCBA 3BDVA 2EFHB 2HKIA 4HRAA 2ZS7A 4LF4B 4U7WA 2QT1A 2R63A 3JZFA 5FNVF 4AECA 2WJ4A 4X54A 1I4LD 5DHPA 4E5DA 1X57A 1S4MA 5JO9A 1XZKA 4MCAA 4AYXA 1WXFA 2RD2A 5B4TA 4L5CA 3T41A 4WKCA 3DMDA 4YRZA 1UZAA 2DB3A 5KZMB 5ESRA 4KV7A 1H2ZA 2DCUA 4GO1A 4KXNA 2EKZA 3V34A 5M29A 2NIPA 2P78A 3ESCA 3LUDA 2H1HA 2IEGA 1IM5A 1YZGA 3TBFA 1KZ1A 3FTEA 4F1KA 1NIJA 3WK6A 4BDSA 1JTEA 1SB8A 3I6YA 1FDOA 5ER9A 3UHPA 1JBKA 3G6KA 4CODB 1GRRA 5COBA 3RVBA 3LP6A 3FOWA 1GAXA 5AVJA 2CMHA 4PLHA 5GM1A 4AMGA 4BU0A 1G7TA 3KAQA 1KI6A 1L5HB 2J0VA 1G5QA 3PFNA 4TV9A 3VPGA 4A82A 2OAGA 5KKNB 3CIOA 4GLJA 1L5KA 1BAPA 1CS4C 1R8QA 3GLHB 3BXHA 1NUQA 3KOYA 5JZOA 4YRRA 2WUSR 3EPKA 4LY3A 5CURA 3RIGA 1N0UA 4KOAA 3SJUA 3CH6A 4X4CA 5KYUA 1UM9B 4QAQA 4WESB 3WLRA 3E7WA 2AZDA 2LBPA 3OEYA 1ZM9A 2Y1FA 1LLIA 1XCLA 4OLBA 1T6ZA 1JT9A 3OD5A 3FMVA 4UVHA 2O50A 1XLTA 4Y7CA 1LSJA 5T5QA 4ETNA 5B6IA 2G1PA 3CR7A 1AHPA 2ZJ6A 1E2NA 3D3KA 2BFFB 3QWBA 3HY6A 1PFWA 4YECA 3CEAA 1FNNA 1IONA 1JG1A 2FXIA 1IN8A 3BQ9A 2F8LA 3EPPA 1OBCA 3AEKB 3L6BA 1M5RA 2V9PA 3EEYA 5I9TA 4XM1A 1E6MA 2PUEA 4DS3A 1RLTA 1ZD4A 3AP3A 3BULA 1GKYA 4KXVA 1UK7A 1TUEA 2FPOA 1XYGA 5FP0A 1DAFA 4AMBA 2PANA 5TT1A 3L0YA 4Y9TA 1DBQA 2FTKE 3ZDEA 1KVQA 2XI8A 3ZGXA 2NU8A 6ADHA 1TZCA 2HGSA 2KQUA 2QN8A 3VSEA 1CEEA 1OGIA 3W9BA 4X63A 1CULC 3DP7A 3RRBA 3N7UA 4AJ2A 3SWWA 1PEKE 2XBLA 3A6ZA 2X0DA 1JUDA 1E7YA 4QBHA 3C85A 1JB1A 1BGWA 1T34A 3I8OA 1P6XA 3D3WB 1O87A 5ILOA 1S02A 1UBGA 1QLHA 4JJEA 4RIGA 4AWBA 3H7IA 5FOTA 1QYDA 2NO9A 2B3TA 4QHTA 2I5PO 4INZA 1ZNYA 4WN9A 4X6YA 4O1MA 1Z2PX 3IDZA 4J0KA 2NO7A 1PGPA 4WADA 4MVJM 2QRHA 1QOZA 2GCGA 3O1JC 1KVSA 1YK0A 2IHNA 2D2EA 2H1LA 1YZ3A 4I5FA 3JWPA 1QIIA 2CXHA 1M1NA 3L79A 4ZGGA 1DAMA 3K5WA 2ZBEA 4BIIA 4MKIA 2HMYB 3BGOS 1NSTA 5F4BA 2BJCA 4PEVA 5JD3A 4FT2A 1GQYA 1QORA 1JG2A 3GVHA 5GAGi 4XWOA 1DKQA 5EZ6B 1VJ5A 2C88A 2HN9A 5E8JA 2O8BA 5DTJA 3IXLA 4QGAA 1G38A 1U6JA 2H3EA 3CPEA 2X0EA 1PYDA 3L8MA 4EGSA 4DQDA 5BW5A 1OB5A 4D42A 3H0KA 3MMZA 4KXFB 1ZU5A 2P9TA 4F3CA 1E6WA 3B1XA 4ICIA 3A27A 1HUQA 4D0RA 5HKBA 1Z2AA 2IIPA 3E7FA 2CE7A 4JLBA 4M87A 5U4QA 4EL0A 1OROA 1FRVA 1Q14A 3LBNA 4F21A 3ZJTA 3G0GA 3ZNOA 3UWOA 1O95C 4QUAA 3IOEA 3UJAA 5E38A 2CMDA 1WVMA 1T0UA 2D5LA 2MSKA 3OIYA 4DT1B 1KJJA 1M6YA 3F6YA 1JNXX 1A9ZA 1Q7BA 4DOMA 4CUKA 4XD2A 4RDHA 4D44A 2YVAA 3DMYA 3HO6A 4K9NA 4TSKA 2D5IA 2JI9A 2W83A 1GG5A 3ZNQA 3CUUA 4L4YA 4M3NA 1SVWA 4QUHA 1G7RA 4U2BA 4X85A 4DDKA 5KQGA 3CX6A 1HMPA 5KWVA 4GS5A 1K7YA 1TUBB 4TSFD 3FUCA 3OG9A 3R9KA 4E6EA 1SKQA 2G4VA 1FTWA 4KQKA 4IFEA 2AQ8A 5CG1A 2KEKA 1HC7A 4QPDA 5AQ1A 3R3JA 3TLGA 1A5SB 2QE7A 1PG5A 3BWYA 1YCHA 4XYEA 3C4VA 4B1FA 5JH7A 1K1EA 2ZU0C 4MQUA 3PQ5A 3U31A 3V7YA 1KI1A 2ODPA 3A6GA 4G01B 5BSWA 2PIAA 4ZP1A 3TQCA 4EFMA 2WYHA 1I8TA 3MLBA 1IOWA 3NBKA 4ZCMA 1B76A 2WHQA 3F7NA 5TEWA 1J8VA 3EC7A 2EZ8A 3CVYA 3K1YA 1K68A 3LQ1A 5J2UA 4DA4A 1SUFA 2QVLA 1GPKA 1FW6A 4DJEC 2AQKA 5H4HA 1U2DC 2JEOA 2V6JA 3EVZA 3EFOA 3M4JA 4K3UA 2PRJA 3I1FA 2GEVA 4WINA 1VLJA 1UPFA 4ZZ1A 3ZJYA 3DNVB 4EUEA 1QGED 4L02A 2RK3A 2DBZA 3I01M 2X8AA 2J31A 5KYNA 2D1SA 2WP0A 1UBEA 5E9QA 2H85A 2EF8A 1CEQA 4M9ZA 3KYIB 1X38A 9LDBA 4QFDA 2PLNA 4JBLA 4Q1DA 4MZXA 1L5MA 2C07A 1HL3A 1EXDA 3UJNA 2O20A 4M49A 4M0FA 5KTYA 3FMOB 4RWZA 4ZU6X 5C1IA 5FTLA 1XZIA 4FN5A 4HDRB 4P36A 3SFVA 5EUBA 2YCBA 2IY8A 4Y2RA 1D03A 4JU9A 3SIWA 1X2LA 2NVOA 1WZ2A 1XEAA 3EXHC 3CKKA 3TQIA 3JX9A 1ZNWA 1E0SA 5BQOA 1FMJA 4D02A 5AVUA 4NFLA 1R4MA 3ADBA 2VTVA 2XQVA 2M2IA 3MMXA 4S0XA 3I2GA 3S81A 4ZJYA 5IBPA 5AUPB 2AN1A 5LZ2A 4YCAA 3D0RA 4L76A 4DV0B 3MAGA 1C7RA 4PAWA 3CLVA 4JDUA 2CYAA 3IKVA 2YUIA 2P6PA 4JBXA 4NICA 5TY0A 1KU6A 3HDYA 3IE2A 5K51A 3W2IA 4P6VF 5IULC 2HRDA 4KPEC 3ELDA 4AY4A 4DMLA 4XUEA 5ALZA 3UAGA 1DBSA 3RS9A 3DMHA 3ILXA 2N9UA 4D9JA 2BMFA 3IO5A 3SLRA 2A7QA 2E48A 3UAYA 4ZIRB 1YF3A 2PTGA 1VJ1A 1VP3A 3NASA 5IPFA 1U8AA 1OH7A 4U00A 3HLTA 4I1YA 3TQRA 4LOKA 2F9FA 3VYRB 1TCVA 2A9PA 2RGNA 4YV1A 4JCOA 5EESA 3ZHMA 1V5FA 2OP1A 3A4TA 1E7RA 3DEHA 4UXIA 2H4HA 1AKYA 4F8JA 2G71A 1NW7A 3JTMA 3FTDA 3D31A 3Q8LA 2IQIA 4UVDA 2JJ2A 1NPTO 3UNXA 1FJ2A 3W3AH 2V3VA 2PZGA 3N8DA 4JGGA 4YMIA 1YQEA 3HCDA 1C14A 1NMZA 3NTUA 5F1KA 2RHRA 4KLNA 3S1SA 2FR1A 4LE0A 2EP7A 3FRIA 3JAKA 4ENWA 3UB3A 3B53X 4G25A 1EDDA 3BH0A 2E4UA 4H6XA 1PS9A 3NRBA 5DGDA 1YJCA 3OLVA 4FKMA 4IIYA 3TO5A 3E5MA 1HKUA 5IANA 1TJ4A 1YA4A 1XLUA 4QUEA 4JQOA 4IV8A 4WFKA 4Y9RA 1O2DA 5G1NA 1LPNA 2X7XA 3R9XB 4U7DA 2Y0DA 3S29A 3SICE 5IW8A 1P0IA 3DWGA 3I83A 2BNNA 5KKCA 1DQSA 4LWZA 1N34B 1Z75A 2XBMA 3QE9Y 3DHNA 3HDTA 2BEVB 5BSRA 4CL8A 3EE6A 1DV1A 1QUEA 2HRZA 3ADOA 4K0RA 1MKYA 3HMQA 4KKVA 3FIJA 3SK0A 1GPJA 3ZI7A 5JVDA 1KNXA 1P9RA 4O2AF 3S2FA 5KIAA 4RULA 1GHTA 1XMXA 3IKJA 1GVNB 1X8LA 1YA8A 4QTYA 1OSLA 1KXZA 2XF8A 4JP5A 4CYMA 2UVPA 1SCQA 2HT6A 5C7YA 2B7BA 5IJWA 4IIGA 5YASA 3DO6A 4ARBA 3CUYA 1KSFX 1OGJA 1YL5A 5T7BA 4L74A 1HEIA 3R7BA 4CIAA 2AI3A 5GONB 1BA2A 3AFNA 2AXQA 2VWHA 2M1XA 3JVDA 5DRTA 2E87A 4HR7A 1UK6A 3CRW1 3LZDA 1XZPA 1E2IA 1DHRA 4JS0A 4U63A 4WNCA 3PYMA 3ZXSA 1L4MA 1REQB 3ZIDA 2HA5A 5BRNA 1A1SA 3IUPA 3QELA 4C4TA 4G65A 5E4JA 5K0NA 5TPZD 1ZISA 3GJXC 4XWKA 4Z99A 3K0KA 2FG6C 5CBPA 1SVLA 2E55A 4ZCPA 1R27A 2C5FA 4YROA 1EX1A 1IHDA 1Q2XA 2D5CA 5GZ1A 1HDIA 1VKOA 3AVUA 3IT1A 3UT5A 1K06A 3H5VA 1O4XA 1U9IC 3KYCB 4FLEA 4IHJF 3AIKA 4LRYA 2NW6A 1NVMB 4NENB 2G77B 5FAKA 3E7XA 3WKEA 1XIVA 1JFFA 2ZE5A 3M6AA 4PR0A 4ER7A 3ZDDA 1GQOA 3DTVB 1ZGAA 2ZB8A 2GASA 4KO1S 4DR6B 4FB4A 4LVCA 1TUIA 3EGVA 2WTMA 5LP6F 1KO1A 2I76A 4Z9XA 5BP7A 1P3JA 4HGRA 4RJLA 4ZKDA 2PJZA 5G0VA 2FXVA 2AWNA 1W49A 1PJZA 1SR8A 4DLTA 5AJTA 3IELA 4IW3B 4A1OA 1W19A 5JWRA 4K7JA 3DVAB 1HFEL 1HEUA 1PUXA 1K5PA 3LLUA 3MCAA 4J1TA 4M9RA 4MWEA 4UDYX 4YI3A 3H9QA 3M83A 6PFKA 4G0WA 1XROA 2Z3VA 3KCQA 1PW5A 3LY5A 2YWXA 4NQZA 3C8HA 2WFLA 5EPEA 1SBIA 1U7XA 3CU5A 4F3NA 1KI4A 4DIMA 3IRUA 2OFYA 1J2UA 1ABEA 2YWRA 1OZAA 2HF7A 3EEFA 3L3BA 3ACBA 1L5WA 1CR0A 3PVCA 1LBSA 2RBGA 4HEJA 1Y48E 1THZA 1KAGA 1UPAA 2XZPA 3GLKA 3HYRA 4FGUA 4JITA 5EIBC 3WL8A 4PCAA 2VIIA 5CVTA 1US8A 2PGOA 4NCAA 4AI6A 3U3OA 1QV9A 1FS4A 3MT9A 2WU3A 3CINA 4YUAA 1NKSA 1QH1B 5DHTA 4BGDA 1JH9A 1OWNA 1BVHA 3K8QA 1F51E 2BFEA 3I3OA 4IV0A 4OSEA 2HUPA 3PDHA 1YFKA 1MTOA 1BVYF 1SXHA 2XNSA 4QJ4A 5A9SA 1PJAA 4P7GA 2OHJA 5ECDA 1M1UA 1ID8A 3G88A 3HJCA 3LK7A 3R5KA 4FR0A 1VL2A 1TMKA 1TLFA 2MEZA 4MV1A 3CURA 1EJ6A 2DPHA 3HA2A 5L9AA 1J25A 4CHGA 1LK0A 1W6RA 3PUWA 4OU5A 3OZXA 1V9SA 1D0VA 3L8EA 2ZM5A 3AKEA 3BK7A 1DEKA 3MTDA 3RVDA 4XB2A 3ITEA 4BO6A 2DQSA 3LE8A 3M1AA 4ZYTA 1NXWA 3W1VA 1IH8A 2YQ5A 1TM2A 3E5NA 1VSVA 3URKA 2DH5A 1VE5A 1YIAA 1NFQA 1T4MA 4N54A 4PU8A 4WZBB 5LA6F 5C1OA 4TTSA 4C4ZA 4M8IA 5I7EA 2RGGA 5CDSA 2HQRA 2R2AA 2XE7A 1GTSA 4NYIQ 4LF7B 2H52A 2FF7A 2PKQO 1EA7A 3AKDA 3FPEA 3L8HA 3PFBA 3VZCA 4CXMA 3N6VA 5SZHB 1XOIA 1RLOA 1O9BA 4R0VA 3L0DA 1QB7A 1OF1A 2P1DA 4EW1A 2IGTA 2JRLA 1TYCA 3V1MA 3GFQA 3SMVA 2XVZA 3KKMA 4MV4A 4U2GA 2ZRQA 4GSYA 2HV8A 3DF7A 3HP1A 4Z0NA 2MHCA 1QC5A 4F5EA 5L4LA 4YRQA 5AKGA 1J23A 3MK31 1W1UA 1E3DA 3G2QA 4NJMA 4PAOA 2QYOA 3ZN2A 2I62A 5ED4A 4P83A 2ZIGA 3RIEA 1GRNA 1DTWA 4KJZA 3S1LA 3UC9A 4B79A 1CUZA 4BP3A 4JI7B 1NP3A 1KFKB 5FWXA 5T41A 3TUIC 2V7QA 1P2TA 4DIEA 3B3JA 4G5GA 5IP5A 4HV4A 1TQ2A 3UBTA 2VYFA 4Y6OA 2PXKA 3QNMA 4ZQBA 2XCJA 4EGQA 4XPIA 3I9LA 4HADA 3U3MA 4PRYA 3W4IA 2IRWA 2KPOA 4L16A 4RGQA 4YP5A 5AVZA 3U44B 4LKOA 3NGMA 3H9JA 1CY0A 4LK3A 1T1EA 1J9EA 3RC9A 3M89A 1VJ0A 5THKA 1RT9A 4LC9A 5AW1A 2EW2A 3PVZA 2XITA 1WH6A 1OX5A 4ER3A 2VAVA 3FGOA 5C8YA 5FOQA 2Y4OA 5G0WA 4P08A 4FN4A 1P62B 2NGRA 3GJSA 1O58A 3VC3A 2C7PA 3BEOA 3G2MA 3IIMA 5TSDA 3UXYA 3HA5A 1AK1A 3O38A 3VPCA 4DBLC 3ZE9A 2OK7A 5CAEA 2B4YA 2GRAA 1EJ0A 2IA5A 1GR0A 4BO8A 1ZXXA 1PO7A 4CIXA 2DWQA 2EBWA 4QRHA 3JQBA 4LEIA 1ZZ9A 5CD1A 3PGJA 4PQGA 4TMZA 3DGEC 3T3DA 3VPXA 4DJDC 3GRRA 1AH2A 1GL9B 3JQCA 1XCOA 1XA4A 3TLKA 1G8JA 3TL3A 3H9UA 3QXGA 2QXTA 4FFOA 1G21B 1GO2A 2YXEA 4BQNA 1U1GA 1QPBA 3SHQA 5ITZA 3T0IA 4OBEA 1I3MA 2FWNA 4TZKA 5DX8A 3RVLA 2XKBA 4D7AA 4ZHQB 1HE3A 2QGNA 4QPCA 2FOXA 2C5AA 2G0AA 1YI8A 5LLTA 2BONA 5FBRB 4EECA 2OO7A 1N2GA 1M7HA 2ZATA 2I1WA 2QL9A 4N5LA 1NMEA 2CXNA 2GEUA 5KOHB 1WSBA 4BX0A 1PGJA 3O7MA 4O4LA 2PH3A 3BZWA 4CF5A 4UVEA 1N32B 4RCVA 2RH9B 3E7PA 1HE5A 2ISCA 3GGJA 4EHJA 3D2LA 1EM6A 1OH5A 1ZWKA 1CUUA 3FZEA 3JQ6A 3OIFA 4PFKA 1UAAA 5F1YA 3REOA 3DV9A 3J7AC 1ODIA 1P7PA 3G5MA 4RNDB 2FZWA 2Y3IA 2AW5A 3F7MA 4RY0A 1DG1G 1DTSA 4LYFA 5A3SA 4D4JA 3SX4A 2BHRA 2QTCA 2V6IA 3BH7A 3KXKA 4GF5A 4MQMA 1SK8A 4RAOA 4F2DA 2V6FA 1VA5A 4YO8A 5IK2A 3WDLA 3MGGA 5JDCC 2CL7X 3VDQA 4AJIA 4GDMA 4QJ5A 4WZAB 4ZMSA 3RJ9A 4LWPA 1JAIA 4E08A 4HAWA 4Y1RA 5EZYF 2ZQ5A 4IDBA 4OYRA 2O2SA 2Q2OA 3KOMA 4BRWA 1JQAA 3IVCA 1DWQA 2ANBA 1TECE 4KH0A 4MW9A 1IWPB 1JAZA 1VXRA 1G7SA 1QYVA 3I4FA 2IWRA 5C51B 2YJTD 1GIAA 4D46A 5HNKA 1R4ZA 1W0KA 4CQMB 4B9EA 5EFOA 3UQZA 5LQRA 1ADCA 3C5VA 2NSYA 5B3AA 3W5DA 1NRIA 2BJHA 1TL7C 2NVBA 2WOOA 4KZPA 1JJIA 2VHUA 3BOSA 4O4HA 4J0JA 4XIYA 1BCRB 3BCUA 3DE7X 5JV5A 4ECAA 4KVAA 1L1QA 4DREA 5JAQA 1GLGA 1V48A 2JGDA 2R0QC 2B69A 3OT1A 1QZ3A 2XB9A 3CNQS 2I8CA 2Z8XA 3D8HA 3LGSA 2X4IA 3N2NA 4IQ0A 5LVAA 3S28A 2JARA 3C6KA 4QBFA 5I7OA 2Z0MA 3EMKA 1RR6A 4LXXA 4MX8A 2FPGB 4TXMA 1ZFNA 2WT8A 2ALJA 3TIVA 4DIUA 1G55A 3ETCA 1GLVA 3O91A 3T1OA 4EG0A 3R3WA 3S68A 4BP9A 1WKVA 1FYFA 1KO5A 1WCWA 4LCEA 4D98A 2BFDB 1TM1E 3Q8KA 4B2PA 1HURA 4N9WA 2HRCA 1KPIA 2FPPA 1KDRA 4FFBB 3S2UA 2QN6A 2XMSA 3EA4A 2HDHA 2JNWA 4PHFA 4ARZA 4IWRA 4NZZA 4QYIA 2PR7A 1W36B 3RVNA 3NDBB 3HH8A 1KEEA 5F9MA 4LZJA 1B8OA 1D7OA 2OB1A 4JUAA 3LT0A 4LE1A 4OQDA 4OJMX 5JG7A 3WYAA 4X00A 1IBSA 3OQ6A 3QFRA 2ERCA 4PSVA 3CLSC 3ZD7A 2GYWA 1RYMA 3LXMA 2ZRKA 2UYQA 4A8HA 4DNFA 5CEJA 2HIHA 4GSKA 2FLVA 1I5EA 5CR9A 4D3ZA 1E3QA 3A1NA 1YIDA 3LP8A 4RACA 2P2SA 4DUPA 1R37A 3K4HA 2AI2A 4X3PA 4L08A 4DR3B 4OFBA 1IN5A 5F2EA 3VSBA 4LFAB 3KSZO 1PP4A 1GKLA 1X94A 1ZOPA 3T9EA 4H7JA 2JBAB 3DBRB 2GD6A 2HWXA 3AQIA 2QSUA 3S2IA 4EOGA 4TV8F 1I32A 2KI5A 3NXKA 4US1R 3MN1A 4K6OA 3VJRA 4YV2A 3V8NA 4PLPA 3NHWA 1M0SA 4ZVOA 1C2TA 1A8SA 2FJPA 2GO7A 5CHEA 4D57A 4BHTA 2GM5A 3C4QA 4IDNA 1U8UA 3R5FA 5L53A 3L7MA 2QN7A 4RD0A 1U7DA 3GMIA 1T1RA 4ZV4A 821PA 2Z2KA 2X9NA 1L4FA 3SR3A 1E9DA 2VAXA 3DUFA 4MYDA 1T2FA 3WYEA 2Q21A 1EMDA 3K0AA 2DKFA 1E60A 3KIPA 3Q88A 1Z16A 4WOBA 1LCCA 3IAS6 3HVRA 2QNRA 3Q3HA 1NMYA 1JDZA 2XEDA 2YNMC 2ZSIA 4E46A 4PX3A 1T3HA 1XXHA 5IT0A 5JS1A 2AOUA 3MJ4A 2XDQB 4P58A 4IP0A 3P5SA 3T1TA 3WIUA 5K9ZA 5FOWA 3X1ZA 3G2OA 4V0OA 1PV2A 2B5OA 1NP7A 4UEWA 4Z86A 5KMGA 2Z30A 4OM8A 4RW0A 4C6RA 5I9SA 4F5ZA 3ESRA 4WJZA 1LC3A 2VXBA 3QF4B 1C9YA 1IB6A 1S6YA 2RGAA 3M5DA 4II3A 4US0R 5A5VA 5L7TA 2PEZA 1KOGA 3FYHA 2Q1WA 4PNHA 5K6RA 3LUCA 4IVRA 1I4EB 1Y5MA 2OFOA 3PC3A 5DEOA 4CKBB 1O94D 1ACLA 1WUJS 3KZXA 4FEAA 5LDGA 2ZDQA 5IKMA 3ZGVA 3ZHRA 3K31A 2CWDA 3EJ6A 3LA8A 5CMLA 3PTAA 1G2PA 1HYBA 1M67A 1KSJA 5BRAA 5BMVB 5JC1A 1V1RB 2HWKA 1A76A 1ZMXA 1A8PA 2ETVA 2PVCA 1OI7A 2QQ0A 3I5AA 4HYQA 4WCFC 4JA0A 4WXHA 1RMYA 1K2WA 3KXLA 1E20A 4B7CA 1DC5A 5DNAA 3WNBA 4YP7A 3WHIA 1XP8A 1WHSA 4EKGA 4Y6QA 1ISGA 2Q9AA 3HDHA 1TYZA 3JQQA 3CLUC 1RVV1 3ZLVA 5DBEX 1Q0SA 5EZQA 3V8RA 4BL5A 1N9GB 2GUGA 3M6LA 4JLUA 3W78A 1TKAA 3PDIA 5LL6P 1GITA 3CF4G 2ES4A 3U26A 2FEWB 3OEED 3GCXA 3V00A 2R44A 5LB4A 3CPSA 1Z2OX 1KSGA 1KI8A 3QVGA 1B4DA 1LJLA 3NH9A 2WPDD 2OQRA 4I0WB 3SCZA 1T9CA 5SY9A 2YHUA 2OHXA 4G86A 4QT0A 2VEOA 3GEGA 5DF1A 1FRNA 3MVEA 4FLFA 5EIFA 5KVVA 2CD9A 2JAXA 3R0ZA 3MELA 3PC7A 2XVAA 1QLJA 2OGZA 5GJBA 5HIMA 1UWCA 2LR0A 4A8JC 2OYCA 4I2NA 4F2HA 5C5EA 3AUAA 3QVXA 4ND2A 1XAJA 4G4JA 3VR4A 2J5XA 3H5WA 1JALA 2JLQA 2R68A 2CNNA 2LYSA 4FXOA 4JLWA 1D6JA 1DKNA 2R85A 3KSMA 3RCBA 1AKTA 1YO6A 3HSSA 3FVRA 1X7XB 3QQ5A 1E8NA 1HMYA 3H8SA 3OFVA 2AQIA 2ODQA 1KYQA 1Z6PA 2BH2A 2ST1A 2BGNA 3DM5A 3V4ZA 3DSRA 4FMCF 3TJMA 4DJAA 1KI7A 4P4GA 2GN8A 1MQSA 5AKKA 4XEUA 2KYRA 3EA5A 4AS1A 1QH8A 4JVLA 2JLCA 4JP8A 2B30A 1AB6A 1JIJA 1HORA 2PSEA 2JA2A 4ZYZA 2LNMA 3JQAD 3ANMA 3AYXB 1XRPA 3C3DA 3IT2A 4LSZA 4Q34A 4BQPA 3HWRA 3FTQA 4X95A 1RXIA 1X1CA 2Z09A 1KDOA 2E89A 1RWXA 4P32A 1TVEA 2AUNA 4EY7A 3OLQA 2X40A 1GQSA 1ODJA 5JMTA 4AQYB 5A5EA 3IR7A 1NYRA 1Z37A 1Z4NA 1P33A 5FQOA 3TVDA 3CN9A 4LTNA 4GPAA 2OPHA 4B3XA 3K7EA 1AUPA 1NR5A 5KOYA 4JL8A 2AMJA 1MO4A 4Z54A 3LH5A 1IOVA 5TQJA 4EB0A 5IWCA 2ZYRA 2PG3A 2VJPA 4AYTA 1JMVA 2ORYA 1FUYB 4EF6A 5BXQC 2QXYA 3ETGA 3L1KA 2J3DA 4YJGB 2QJOA 3FPAA 4BFLA 3ISTA 3JV7A 4NH0A 5ED0A 4B34A 3L7AA 3QKRB 3UKOA 4Q00A 3T1NA 1G291 3LPDA 4RYLA 2IYTA 4LJAA 4V0LA 3PD7A 1DG9A 1RPTA 4QYMA 4N48A 3N2KB 1ZI8A 2G83A 2EYUA 3DB2A 4QULA 5LN1A 2VQFB 1L1RA 1LSUA 5EXXA 3GGOA 5JAPA 5SZIA 4YP6A 4YRBA 5BNZA 4DUYB 1JMYA 4AZ3B 3AEYA 1JR3D 1WP4A 2OORC 4ZODA 3JD2A 4XWAA 3K16A 4LE2A 1X1SA 1DC8A 4R31A 1QFYA 2XGSA 3MBIA 4E31A 1W8IA 2NNWB 3OZUA 4K05A 4XDHA 1H69A 1H0SA 2GRJA 3CVJA 3SCFA 2XMGA 2OHFA 2FRXA 4QT4A 5IJXA 4HLDA 4IDHA 5HKOA 1UCFA 4MHOA 1BE1A 3LY9A 1T6NA 4NHOA 2HA3A 3EBLA 3CRZA 2A0KA 3UF0A 4TT3D 1BXGB 3TDNA 1RLMA 3ZNNA 5E3JA 1L7DA 3G82C 1P3Y1 2G9RA 3K2QA 3QFSA 5CFOA 2B98A 3HYTA 2GZDA 1LS6A 3U17A 1SQ8A 3TH5A 1KHHA 1P1IA 4Q05A 1K3UB 1KAEA 2HRBA 4QGGA 1CT9A 4IY1A 2FPSA 3LK6A 2JH9A 4X1OA 2EATA 3I9V1 2FUKA 3W0LB 3LFPA 1YD7A 2CNWA 2GZAA 3AOEA 1GGFA 1NE7A 4EGCB 2A8YA 1EZZA 1WM1A 1HFJA 1ZJYA 1CPYA 3DKIA 2X0IA 1JEYB 4ZYXA 5A62A 1AVTA 1YBVA 3HJBA 4UZFA 2QM0A 1EFRD 1EWKA 3M81A 4JENA 1GPNA 1YDMA 1I13A 3C6MA 1L5RA 1OQAA 5KNBD 3WGJA 2OHVA 3AUFA 1BD3A 3NUGA 2HIGA 4UULA 1KMMA 1VL5A 1Q7RA 2ZSEA 4HGPA 3EC2A 4RPJA 2JHPA 5DIZA 3ET4A 2JLUA 2FUNB 2CXXA 3PGLA 4KB5A 1A9RA 4R4JA 4OU4A 1KR5A 1ICEA 1RSZA 3MLEA 1GU1A 1JWBB 2O8CB 3K0BA 2BP7A 1JLKA 3IIJA 4BE7B 1NXSA 1RHUA 1YU9A 3NWBA 3GBPA 5KC9A 1I30A 2XUKA 5EHIA 3VKHA 1UBHS 3IUMA 1I7QB 1CR1A 1U3GA 1MA0A 3N2EA 4PC1A 4XUGB 3GRAA 3VNAA 3BTVA 2K7FA 4J16A 2NSJA 2MSEB 2PT7A 3ZUGA 3WGVA 3HU2A 5J4LA 3TGPA 2PBFA 4HDOB 4NOKA 3A1SA 3PX3A 2PSHA 2EX1A 5CCXA 3EAQA 4AD8A 1WBBA 1YONA 3HGMA 4XQ9A 1KJIA 2YIDA 3DZBA 3NOXA 4M22A 3DL0A 4HGOA 1CUXA 2HO5A 4PQRA 3BMQA 3FY4A 2ONYA 3OZTA 1EUDA 1NXQA 4X3CA 5CPFA 3TMYA 1XRRA 4HNVA 2GHIA 4H0CA 3PQ8A 3B51X 1A2BA 1N5DA 3OM9A 4MS3B 1OYYA 2O05A 4JJGA 4O4IB 5IYZA 4EVSA 3L6OO 1DFHA 3C39A 5H59A 2XUDA 4KBGA 4P0TA 4PM4A 4QUKA 2I3BA 2VXCA 4FWBA 5FPHA 4CMIA 1YKFA 5B1DA 2MT9A 4P4TA 1L4EA 4BN4A 4HRXA 4V0ME 1GGJA 3SKXA 3AY6A 1NNEA 1GPYA 4F97A 4B6RA 1U0LA 3GYBA 1TU3A 3NDRA 4FLMA 2GXUA 1X1EA 4NNOA 4I1PA 4QUBA 3O4IA 1X9HA 1XAIA 2C3PA 1AUVA 4KK4A 3SY8A 3ICOA 1ADGA 4LQCA 2L82A 1T5IA 1L7OA 2GK7A 3HZOA 4LJSA 4FIZA 3U60B 1E96A 1RQGA 1UP6A 4IDEA 2XWPA 3VU0A 3EHEA 2CHQA 3ZU6A 3SBDA 1O0CA 4IYRA 2HA2A 5GZ6A 2QY6A 1A9PA 5TMEA 4AY2A 3MG9A 4RLFA 1FJHA 3IEUA 1GCOA 4NMMA 5F3DA 1L1FA 5A9TA 1XDBA 5PNTA 2UU9B 4AUNA 4QJ3A 2EARA 3EZ9A 3LDFA 3L1VA 3NTOA 4LN1A 2HWUA 4L5IA 3LD9A 4RETA 2X8JB 4N39A 1NR1A 3WA6A 2GX6A 2X1HA 4WK2B 3VRHA 2D2VA 2CHEA 2ATEA 4NPHA 4CKCA 5BUQA 3AF3A 3Q0TA 3QEBZ 3I0ZA 4YPVA 5AXBA 4CF6A 1NUHA 4UNIA 5KYUB 2IUFA 1IIBA 1F9AA 1DBIA 2BSAA 3B1KA 4DV7B 1H8HA 2GPJA 2IGBA 1SOAA 3ENVA 3IP9A 4JEHA 3EVFA 3LIIA 1NBOA 1UBOS 3OZCA 3RS4A 5JSZA 3AKYA 4W5OA 2EW8A 1FFDA 3LQYA 2HJSA 4CG2A 4PU7A 1WXXA 1NBMA 2XE8A 2O2ZA 3H75A 5FADA 5IBQA 5TF4A 3G2LA 2O59A 1MA3A 1V71A 1KMCA 4MVWA 3UMCA 1U8FO 2TMKA 2VP4A 1XTRA 1X42A 4IJUA 1JZQA 2JFVA 3D6AA 4K9QA 1E4VA 1WZUA 1H8EA 1QO0D 4XCQA 5E6UB 2OKGA 5J5AA 3RU7A 4AWXA 2QYSA 2ZTLA 1WDMA 4Y6GB 4E2FA 2QM3A 4QLOA 5ALWA 4NJOA 4EFNA 4GE0A 1U9CA 2AOXA 1MB9A 4G5SA 1GQ2A 5AOVA 3BRWD 4JN6B 3DBLA 3DLHA 2NU8B 1E58A 3BTSA 4HP8A 4NCJA 4DCOA 4D45A 2NAPA 1TD1A 1AHIA 1PSZA 1AHNA 2YXPX 2AG1A 4H3KB 4ISCA 1BDJA 4BKPA 3IAM1 4DDHA 4HS4A 4RTKA 4LRTB 1BQEA 2HMSA 4V02A 2H1WA 3U13A 2JS7A 3ZWWA 1NY5A 3C6ZA 5AD1A 4N7RA 1ZIPA 4M76B 1NJGA 5EJ2A 3V4VB 3F5QA 3GX1A 5DBGA 3RAJA 3CX3A 2DWUA 5CM2Z 1HWYA 3HCNA 4FUTA 4WN9B 2OGWA 1E2QA 5BSMA 2XSZA 1SVIA 4OA8A 2EJWA 2A58A 2CXRA 1UKZA 1ZGGA 3HHPA 4UFOA 1W34A 2BYTA 2FWRA 2J4FA 3PHBE 1H4SA 2OV6A 2M9MA 3Q7SA 1JXQA 1DKRA 1FFWA 1H6DA 1LKZA 1P45A 4WLVA 5H1YA 5HJ7A 1KDZA 1SPBS 2R48A 2X9QA 3AJDA 3IB3A 4KKXB 4RTPA 2AFIA 1XTSA 2UVDA 5A2GA 1WUTA 1K63A 1SG0A 3ZBQA 3S8YA 2O8BB 2Y9MB 2A9RA 1J20A 1MJNA 1UMDB 3QPWA 4R2XA 5B3JC 1QK5A 1ZOIA 1QGYA 4QEKA 1DXYA 4OYLA 3Q5DA 1J2YA 4C1BA 3PGVA 1DRUA 4DKXA 2ZUVA 5CCEA 3DB1A 1L5LA 4UQPA 3VNSA 5K1ZA 3N5CA 1RWWA 3WNDA 4V38A 1NVKA 3ZU3A 2LGJA 5DYYA 2Q5OA 2ZUDA 4P2GA 4PBRA 4MI3A 4OHWA 4ZU3A 3ICVA 2JLZA 1IPHA 3AVQA 4GBED 1DO2A 4HQNA 4MHSA 4ID3A 1ZK1A 1ISFA 1BRTA 5F7XA 1PJLA 2J3IA 3HZZA 2ZJ1A 2PS9A 3Q11A 5EE5B 3H5NA 3ZDYB 4B4DA 3KU1A 2QW8A 3E3LA 5IMBA 1C30A 2IVZA 1TFUA 2P91A 5MF6A 2O9JA 4GMKA 3HV2A 2R8PA 3RV4A 4B44A 4BS9A 3WDKA 1Y3DE 4PZ0A 1N57A 2CSXA 1Y34E 2DJIA 3EWAA 3KOOA 3R7DA 4LOIA 1LNZA 4FMPA 3R44A 5BURA 5U9CA 4TRMA 1FZTA 2Q6LA 1U3FA 2YZGA 1EFPB 1I7PA 1YS7A 2R66A 2YXDA 3G59A 4HUQA 3TLGB 4NCHA 4AKIA 1L7RA 3FLAA 5B3LA 5BW6B 2JI6A 3VOAA 4R16A 2WV9A 9MHTA 4W6ZA 3NIWA 5T4HA 3VR4H 3QMPA 2OESA 1SUAA 4YAFA 5LIPA 3LF1A 4KN9S 8ATCA 5TIIA 3BS4A 3EIUA 3JQ7A 2BSQA 4M8LA 1C5KA 1IYZA 2ZRJA 4O2LA 4WLEA 5ALDA 3GCDA 1HDZA 1YZLA 3ELWA 5DCYA 2BBOA 5J2UB 3JQGA 2IITA 4EGJA 4JR0A 5TB5A 2H11A 3OEHA 4RE6A 1L5VA 4WVFA 2BNOA 4I1SA 3OOSA 1RJ9B 3LWBA 3KLOA 4HTAA 5ERXA 5LLSA 4NKRA 1XJQA 3HKBB 5I3CA 1QX3A 1CVIA 2XF2A 1QHEA 4XGNA 5CX4A 1JQ3A 1GUZA 3UHOA 3WRYC 4X4IA 5P8WA 2WLTA 4AP5A 2FSUA 4ZO9A 4ED9A 2BISA 1DCMA 3Q9SA 1FPQA 1I2BA 2CFRA 2XADA 3ZNPA 1S1MA 1S96A 3D1NI 2GM4A 2GKGA 4YJ2A 1IZ0A 1M1YA 2DWCA 1PR4A 3ZZ1A 3KDPA 4WMLA 1DULA 5HZHA 2H4FA 4WZBE 5GJVC 4J43A 4RDXA 5CX1B 2PUBA 1K8QA 2GK6A 4QKQA 3Q85A 2PRYA 1WXHA 4JBIA 4UARA 3KZCA 3JARA 3I01A 1MJGM 3JRXA 5CA0A 3S0JA 3CWCA 3OZDA 5AJXA 2OWDA 3NWOA 1XYYA 2X5NA 2MQKA 4AUMA 1SK9A 1AOXA 2G67A 1UBJS 2HAEA 2RGXA 4J9UE 1JI0A 5EEHA 5FV4A 3SZGA 3JATB 1WDWB 4XB6B 3OWOA 2UZ1A 3TPFA 3UJ9A 1RJWA 1CWUA 4KPFC 3WGZA 4YAIA 4BLWA 3A4LA 3VR0A 3GDHA 1JJVA 3U7FB 3SHFA 2PBZA 4BY9E 2B25A 3D8BA 2OCXA 2VWQA 1IRXA 3H9EO 4PSDA 4Q03A 4CF7A 3U5ZB 2NG1A 1VLLA 4BJ5A 4HDMA 3STTA 4M99A 2AN3A 4L5BA 2ZWVA 1QIMA 4LNUB 1N7IA 1ZUD1 3QVOA 1AK2A 1NW8A 1Z17A 2J9RA 2QMHA 3E3NA 3G0OA 3DDCA 2EJTA 4TROA 3A3KA 5TJHA 3AF1A 1Q6YA 3EMBA 4IDDA 1AD2A 1E9RA 4UTRA 2H51A 1EVJA 2QQGA 1GT6A 3Q8WA 1F14A 2XMZA 4G0ZA 4GVLA 4U2EA 1MABB 1NUUA 2OAEA 4OVKA 5C5DA 4BMPB 2ZSFA 3MXOA 5DGXA 3VH1A 3RS8A 1CB7A 4R9NA 4J91A 4C7MA 3FB1A 1MEEA 2J6HA 2EP8A 1ORDA 3NZEA 2JPDA 4I6GA 4D3DA 4DYVA 4YBAA 2ZI4A 3IIKA 3JAKB 5HFJA 4MYSA 5DU2A 1ND6A 3HN6A 2XOXA 4RHUA 2Q27A 3NS7A 2BBSA 4G0NA 1OMOA 5DI3A 4X90A 1Y1SA 2PLRA 3PNKA 1AZWA 3SEQA 3UAOA 2OV8A 4UBMA 3K2IA 5HE9A 1UT6A 5B58T 4FFLA 3TD6A 3UJ3X 1NSFA 2R60A 2CVOA 4R8RA 1SELA 2YJ6A 1L7BA 5FNVB 4CCWA 1IK6A 1C9EA 3OP1A 2FFRA 1JQDA 2NU7A 4PW0A 3ETJA 4QDJA 4RXTA 4XLZA 4B2IA 1I36A 2G70A 3E3MA 3OEWA 4GX1A 2HX1A 2K5UA 3HL0A 2R87A 3PT9A 4A0SA 1OCTC 2FP3A 3SQOA 4GI1A 1AURA 1JSRA 1U65A 1BE6A 1NOJA 1M2VA 4HMOA 2V9ZA 4YJ3A 4EUFA 1G21E 1D8TA 5C1BA 2X0KA 4W5NA 3DA8A 5K2OA 1BDHA 3FUVA 4JB2A 2EVWX 5IN4A 5MFPA 3ED5A 2D8MA 1TJ3A 4FIDA 3EAGA 2ONJA 1IBKB 1GG9A 1I2MA 2WHPB 4G81A 4OFZA 4XIJA 1RCUA 4MKFA 2W2LD 2FVYA 2YFHA 1QK4A 1XHFA 1YS1X 2IIBA 4UUMA 4YBRA 1YFZA 1DOHA 1NN0A 1LJUA 3K1JA 4BNDB 3NBZC 4FU0A 4HQ6A 5HWSA 3OKFA 4QYWA 1ZCAA 4FHGA 4X93A 3QELB 3BAZA 5ARCA 2BKVA 4RA9A 1SBZA 4EUHA 2C95A 4CLXA 4I6EA 4ZRDA 4N6OA 5H5JA 3THYB 3X1WA 2C4TA 4KQ2A 3L7LA 5DCLA 2GWHA 3RADC 4KL8S 3W7VA 2EZTA 1DU4A 3PXAA 1H4QA 1S89A 4LRSB 5DHSA 4CTMA 3FVTA 5H70A 2HK8A 1N36B 1NI5A 2ZT7A 3QYAA 2GF9A 1YCFA 4ZT3A 4WZAE 3REQB 3TVTA 1O95A 1WW2A 1CHDA 3G8CA 2VAPA 5TGDA 1L8OA 1MUUA 2XQIA 1DJQA 1OC4A 1XMJA 2AV6A 1SU4A 2FK7A 2YVLA 2BW0A 1ULUA 3NJ8A 1NBHA 1JN0A 1AKVA 1Q1ZA 1BH2A 1Q1GA 1QH0A 4YRAA 6YASA 4E2WA 2RHHA 2I6TA 4QXAA 4I3GA 1FNCA 4F06A 3NXHA 1SN7A 3PKZA 4F93B 2BGWA 5A02A 1HNZB 5EE1A 5ICFA 2FX5A 2IYQA 3HSKA 3U62A 2HL6A 5H82A 3H42B 1QTIA 4EPRA 3AK4A 3W9YA 5GVRA 2P9FA 3GDFA 1EFHA 4LJ5A 4Q3KA 3FD8A 1QRDA 1CQJA 3I09A 1T6BY 3GYGA 4JUFA 3WIVA 4BX8A 2CZCA 2NO4A 3F6WA 1E79D 1TW2A 2QLJA 2WFLB 4ZRNA 3V8QA 2IPLA 5AXDA 3OE7A 2WT9A 5LWQA 2WIAA 1YVPA 3F6PA 3KEOA 1B41A 2EEZA 2JVKA 3NW9A 4YJFB 1OPRA 3GGGA 3L4EA 4P3XA 3NP9A 3GY0A 4D9IA 1X9GA 2I2XB 2OZVA 3D6FA 3R6DA 1UZMA 4JI2B 1JEJA 1B26A 3TUJC 1JG6A 1FDRA 2DT5A 3NOQA 3TZCA 3ZXUB 2F7SA 4BLSA 2VJAA 4UHJA 1NHGA 1VB5A 3AWIA 2R5WA 1NBAA 1ZN9A 2ODTX 3A0RB 1HYEA 3AW8A 2NNLD 1M2HA 1NUPA 2WF6A 3QF3A 1BKSB 1LBIA 1U2DA 1WF6A 4IJ6A 4B8ZA 4IDOA 4JHXA 1V0JA 1MN6A 3AESA 4C2AA 2YXLA 2BFEB 1BXRA 4GC5A 3SXJA 5DM70 2G9QA 3NYWA 5A9SB 2DLNA 4B48A 1LB1B 4PQEA 4ND7A 3RUEA 4DBVO 2WSSD 4YGYA 3VJMA 2EKLA 4Z4EA 3HU1A 2ERYA 3GRVA 4ZKEA 2AJBA 5GQSA 2BSXA 4LZWA 2YMQA 3K9WA 4B5LA 3DDUA 3F7OA 2EXXA 2RG7A 4KLRA 2BLNA 1WVGA 3KQYA 3ADDA 3ENZA 5EWMA 3COVA 2CC2A 2DQZA 1B73A 3GGPA 4MQLA 1V2GA 3TIXB 4FDMA 2VSQA 1Z7WA 4CQLA 2O6HA 3EXHA 2BGRA 3I32A 4JEMA 2ZXEA 4Q66C 4AIRA 5CFMA 1W7AA 1E1RA 3TLBA 5BWOA 3ER9A 2C4UA 4X24A 5DTIA 3ZY4A 2R00C 3T3NA 2C0QA 4MVJE 4X41A 3T4XA 4FFMA 4HUTA 3PEWA 4PRZA 2PXVA 2WG0A 3CF4A 1G6OA 3K6SB 2DQYA 4BJ3A 1BO6A 2P4HX 3DKVA 4AT1A 2RGDA 3RLFA 2C5GA 3CZQA 3MD9A 1EBBA 2Y2UA 3X43A 4OG2A 1XTVA 3OCVA 1Q1QA 2CDAA 5EGNA 1WUHS 3UAXA 1F0KA 5DISB 2YWEA 1B74A 3L7CA 4F6RB 3R20A 2DXIA 2XWSA 3SZLA 2SKDA 4IDAA 4NJMB 1NKTA 1K86A 1SCUA 4U9IS 4TVSA 4D9KA 4N0EA 4OLFA 1T3GA 3FYDA 1YFLA 4HWPA 1SKBA 2WA2A 3U7JA 1MH9A 3AIOA 2B9EA 4DF3A 4GKVA 1U90A 5E4YA 3IALA 1JSXA 4EKIA 3EF0A 4JBHA 4BQRA 4CLRA 1ZPQA 5TT0A 3P94A 3L5KA 4MB2A 2PGJA 2JQEA 2D1QA 2YR0A 3KSBC 1WIWA 3T35A 1SU6A 3RWMB 1WQ4A 4F1JA 2Q4EA 2WUWE 5IDWA 3IKLA 4RVHA 1P7YA 3OQHA 1CUCA 1Y98A 4V2UA 3DDNA 3X0DA 1UDWA 4DY6A 2H92A 2PTHA 5BVHB 2N75A 2DU8A 2GARA 2FK8A 2YOGA 3ND5A 1U3DA 3P9SA 4X20A 5HIIA 1QB8A 5CIQA 1YZVA 1P2VA 1JV2B 1T24A 1LK7A 4UFPA 3FWYA 1NMQA 3NEYA 2BM8A 2ZSBA 4LXYA 4XFDA 4TRNA 3UAWA 2R7NA 1CUEA 1P0CA 3IR6A 3IHLA 3PIIA 5AW2A 4OHYA 1NIPA 1JKFA 5IF9A 4K86A 1DKPA 1NN5A 1NPDA 1RIFA 3LIPA 5CAEB 4C5CA 4CN8A 4DA8A 2GRLA 4Z5XA 4G09A 4Y6RA 3ZV3A 2ZVPX 2OO5C 1WR8A 3AB3A 3CM0A 3OY2A 3HQ4O 4K6GA 2A5JA 2X9VA 4K6KA 3BJEA 2CK3D 4R5MA 4XQCA 5CNMA 4MUYA 4PX9A 2XTAA 1RMTA 3IVAA 3L93A 4LW8A 2J30A 3L8FA 3UJBA 4OL9A 4KO2S 4V1CI 5E0KB 5L3QA 1Z39A 3ISVA 3PTZA 2F8SA 1EGVB 4C3ZA 5DTRA 3BK1A 3EEOA 4AG5A 1IC6A 1BOOA 3L0BA 3A9CA 4L4RA 4HQLA 2WG1A 4M9SA 3VHXB 3ZV5A 2ZXFA 1HLPA 2ZUUA 3WLQA 1KWKA 5L51A 2Z2IA 1C0LA 4J9VA 2DFNA 3TW8A 4QDOA 4EVRA 2G3YA 4D4KA 1QB2A 3H1PA 1U7HA 3VYTB 3PT5A 5ABPA 1T1GA 4YPOA 3RYFA 1RKQA 3IQDB 1JPJA 4WA8A 3WTCA 5KYKA 5LYJF 3ICQB 4EGFA 4Z2YA 1NR7A 3W5IA 1UM8A 2GAFA 2VDUE 1L7EA 5JO0A 4W5TA 4BZQA 4H60A 3HB5X 3U4IA 1I80A 3OE4A 4GP9A 1UBNA 4JEIA 1OTHA 5EP4A 4AAYA 1G5IA 8ADHA 2B5WA 3WGTA 1YWGO 2ZRNA 2QP3A 1JPVA 1F5SA 2C78A 1E59A 4RX1A 1SNYA 4DHEA 1A9XB 2ZRGA 1DOAA 4I1OA 3HY4A 1O4VA 2J08A 3COZA 3DFFA 5BWNA 1YRBA 2KX7A 1OBVA 3CB4A 2KLHA 4A0RA 1U9IA 5JNTA 4EG6A 3OU6A 1PX2A 4MQ6A 5DNEA 4H1UA 3AF2A 1IM8A 3QOWA 3HCWA 1I14A 2V8BA 4K40A 4IGAA 2HA0A 1NQTA 4NZOA 1EXNA 3AI2A 1ZN2A 2PV7A 3IDQA 3P2YA 2C7GA 1ZOSA 4QEZA 4BVKA 4CW7A 2XDWA 3K4PA 4KE8A 3BWVA 3AL0C 2TMYA 4MSUA 4Y1RB 4GVPA 3WJ1A 1L3IA 5F9FA 2IXAA 2Y2VA 2QAIA 2OY0A 3IQWA 4CEJA 2LNDA 2F4NA 3BE4A 2JJ8A 2HHCA 2SICE 1TCAA 1TKCA 3F2VA 1VOTA 4BJ6A 2ILTA 4ZJZA 1XNQB 1OA0A 3TTXA 4B45A 2FMHA 3MQ4A 4GOOD 2I2FA 2ISSD 4RGYA 1W30A 2I29A 5T3UA 4BUJA 4CMGA 5CFNA 3D4PA 3NANA 4O4HB 1C8LA 1G0NA 2FE1A 3EA0A 4MQEB 3RIHA 1B16A 4Q1EA 4G1VA 3HZIB 2BEUA 3DUWA 2QE6A 2L69A 3C16C 3LLCA 3NHYA 3WWPA 4WXMA 5KB3A 1EUZA 3OT1B 1A88A 1IQRA 1L4LA 2WPNA 4OATA 3NROA 3QVMA 1QOQB 5DMXA 1I24A 3KB2A 3LRTA 4HBGA 3SF0A 3IQZA 1H65A 1OFIA 3W7BA 1KK1A 1M7BA 1VQ1A 3E9ZA 2A5GA 4CDNA 4AG6A 4DYHA 2NO0A 3LU1A 4L50A 5M04A 3FGNA 3AVVA 1NN3A 3NDPA 1J7JA 2AX3A 1EX6A 2R62A 4QU8A 4S1TA 4AVYA 2WD7A 1YV9A 2ZI9A 1ZZEA 3HXQA 5LD2B 2W4MA 1QYWA 4A5SA 2A67A 2ZRIA 4DLNA 1U28C 2CUTA 2YC4C 4C78A 2PLFA 1IULA 5BVGB 4A2CA 4KK3A 3DQPA 3ESZA 4TTIA 2DLDA 1DEHA 3C2QA 1LV8A 1SXIA 2ZBRA 3KYJB 5EWJA 2A0WA 3ZV4A 4ARZB 1SCDA 5C37A 4S2EA 4MEAA 4MUMA 1DRKA 1Z06A 5LQJA 3PXXA 3EQ7A 3FMGA 1O94C 4ER6A 5ENVA 4EB6A 4RGVA 3HKCB 3M4YA 1I5OA 2W93A 3FDZB 3OZGA 3KB8A 3O3MB 4I9FA 1INLA 4MWOA 1FBTA 3BE6A 3KWLA 4Q82A 4D0SA 3KXAA 1G5PA 2VQDA 1RWKA 3I6ZA 4FILA 4FONA 4UE6A 1S4QA 2X13A 3BJMA 3AR5A 4V24A 3DTTA 1XMOB 1PWXA 3UUEA 3RJTA 3W9SA 2QPLA 3A6HA 4UUBA 4F8DA 1YHNA 2ZSKA 4PLGA 1GL7A 1VG9B 2QZ9A 4WOPA 3S27A 4NFSA 3G1TA 2X4LA 1PR1A 4HDQB 4XWTA 3HJRA 4IJMA 4JB0A 5LP6B 1HTWA 4ZZIA 3SN6A 5FOXA 1YS9A 3I05A 3N8GA 1E99A 1BKYA 1AS0A 1EM8B 5TC4A 4DLKA 1FYXA 2VP2A 2GQ0A 1T2DA 5CDYA 4Q16A 2QNBA 3R9WA 2IHTA 4V1CB 1M5UA 2PUAA 1TTHA 3E22A 2BOVA 3C5EA 2OXTA 2WSBA 4REOA 3I2JA 4A16A 2RGYA 4BTEA 1EU1A 1QAOA 3UYKA 1P9NA 3LNTA 3SIRA 2ZB2A 4YARA 4B3JA 4CTJA 3BAFA 5TARA 2IL1A 3ZYZA 3F3MA 4EHNA 2Z4TA 3EOZA 4J94A 1OCEA 2DRIA 2B2XA 2RBEA 5FR2A 4Z7JA 4XTRA 1RBYA 3DUFB 1PWHA 2WDPA 3K9FC 1HKHA 3ZCUA 4OBMA 3NH6A 1CDEA 3ZVRA 4PZLA 4HDNA 4I5GA 4NCNA 5EE0A 2CZGA 3Q1KA 1UDCA 2WVAA 1XLWA 2X22A 4Y1GA 3FIUA 1KBOA 2V5UA 1XXHB 4JJKA 1UPUA 3L77A 4DNQA 2AOUB 1KAQA 1SC4A 1KXJA 1LBEA 1WHTB 4R9VA 3KB6A 3Q15C 4ZU1X 2P65A 5HKKA 1FFCA 3F3KA 4K6FA 4YMWA 4BLOA 1LPMA 3WK4A 1KJ8A 1P1JA 3CJTA 4OB6A 2HPZA 3FFAA 3PCXA 4YCDA 2GBPA 5KX5A 1F6DA 4JFRA 1OLSA 3PU6A 2O5VA 1B7GO 1J8FA 1RFLA 2VF7A 4MH0R 4N5IX 1DBRA 2DQ4A 5LXTF 2N1MA 3QFIA 1TYBE 1ESCA 4JR2A 2I6XA 3UMFA 2CN1A 3OLXA 4BB9A 5LLDA 1BS2A 1M8GA 5ICGA 4BO1A 2Z1DA 5KU1A 1Z5UA 1HYGA 3QNWA 1NPYA 4ND1A 4QASA 1T9DA 1RXCA 2F3RA 2PKCA 4KZKA 4Y2UA 1E0JA 1LSOA 2Q3CA 2LD4A 2WJHA 1U7WA 1WHSB 3U4QB 1NEQA 3A6KA 2ZCUA 3VDNB 2B99A 1G60A 3SMQA 4C4YA 2AKAB 5BQ5A 1N6LA 2QRNA 1Y4SA 5LA6B 1R0YA 2H1RA 4KV9A 3WK8A 1VHLA 4CI0B 4IPTA 1CZKA 2PUJA 2XGGA 5LPNA 3ACCA 1RAIA 4MIEA 2C4HA 3NTRA 3O94A 4C04A 1EVIA 2C54A 1JVSA 2W5UA 2V59A 3PIDA 1WU8A 2R6R1 1DRVA 4ZVPA 3GCZA 2GTHA 4E1AA 2V6BA 4BTVA 3I72A 3N6RA 4H7EA 2OZLB 4OXYA 1PZEA 4IAOA 4RENA 4HNAB 1G66A 1Z0ZA 3HXMA 4D5GA 1NW4A 1P4AA 3PUXA 1E5DA 1VG0B 1XKLA 2IYUA 3JR3A 4ZI3A 2AHRA 2GCEA 4NPCA 2PXLA 3HTXA 2Q41A 4Z9BA 2PSJA 1MQ8B 3B9QA 3E1SA 4OI0A 1RFGE 1H2AS 3ZQ6A 4RVOA 2VUUA 1ZMTA 1I1OA 4XD7A 1SKAA 1IJBA 4EHFA 3T5PA 5JCPA 3ES9A 1CS0B 3P2IA 4BMYA 2FETA 2OECA 3LSTA 2QHXA 2XWJI 1WEKA 2J9GA 4ZAGA 1RXEA 1VPLA 2IY7A 2Y66A 4ZMBA 1Z34A 5KJCA 3CS3A 3O2SB 5TVKA 1WLYA 4R6WA 3DD5A 3INYA 4GDFA 3EGIA 4FS3A 3E6AA 2O49A 4UQLA 4DJJA 3B6EA 3H11A 2HSWA 3D5EA 3T0FA 3ZQKA 3DO5A 5G3YA 1UMBB 4C5AA 3X1XA 1QH8B 4PPYA 2Y0CA 4DIOA 2F1RA 2VJMA 3ABOB 3ONWA 4EDFA 1QK3A 5JDCA 4NFYA 3E9YA 3EXG1 3I53A 2PGIA 2JHCA 3N07A 2G08A 1SUEA 4LZOA 1NWCA 4I4NA 1WU7A 2QWXA 4B3SB 3PRKE 4I14A 1EWTA 4BB0A 2CLKB 4PYIA 3TSZA 2JZOA 4EYKA 4TTPA 5HF8A 3WADA 4I4TF 2QI9C 3TD2A 1CRWG 4AU1A 2E2WA 3Q0IA 3M1LA 2IYRA 5FFMA 2NVUA 2VSOA 3MWFA 3EUAA 4AK9A 1G6Q1 4LMAA 4N6GA 1DJNA 4QL3A 3O4GA 3WOVA 1FDVA 4JBYA 1M2FA 4R2IA 4S1WA 1EUQA 3NT2A 1ZJZA 3QE0A 1PE0A 3M2TA 2ZS9A 4J76A 3GZDC 1LW6E 2BE7A 2Q99A 1E2FA 4R0MA 2IEDA 3GFSA 4HNHA 5DOZA 4X6XA 3UQYS 2F8TA 1AE1A 4OJNA 2DEUA 3K0CA 1I0ZA 3O8OA 3S2SA 1Q22A 4E51A 4ZYLA 5KNLA 1CTQA 5AJHA 5AM5A 2H7XA 3AJ8A 4NDWA 4II2A 4BYGA 1J0DA 1J8QA 1O6ZA 2PYDA 1E7SA 5ECWA 5EYPA 3FSRA 3OJWA 5IBRA 4AO6A 1TTTA 2IELA 2J5QA 4KXUA 3RGGA 3FTFA 1R69A 3KXPA 1LF5A 4N7MA 5G0UA 4C08A 3IJPA 4L73A 3DWIA 4QOJA 5ALKA 1C3EA 4NL4H 4GW3A 4DQVA 4Q48A 1KK2A 1N5KA 4K9SA 2I87A 3JASA 4YUWA 2MYPA 2R4TA 3WR5A 2D6FA 4DC0A 4C0WA 1UFRA 1GZVA 4W7IA 1Q7TA 5T4EA 1MHTA 521PA 4YJHA 4OPMA 3L4BA 3QVUA 4MV5A 1Y9QA 4WFJA 1H4VB 4QFCA 4AMUA 5MGNA 1I4WA 4BN0A 1BW9A 5JU6A 3C8ZA 2GBLA 3DXZA 3H99A 3VKUA 3RVJA 3OSUA 3OTWA 4GP7A 2C8VA 5EP1A 4DQUA 3PDCA 4MPTA 2ILVA 5GV7A 4RH3A 3GIWA 2GCOB 4JLMA 4MWBA 5H9WA 5K3AA 3R3SA 1ENYA 1NXVA 5IJ0A 5EMJA 3HP4A 3B36A 4Q9HA 4AKGA 4M98A 1XDWA 4Q3OA 1PL7A 3WQBA 2I80A 2VDLB 4DLZA 3TELA 4BPRA 2B1RA 2Q45A 3FH0A 1N0VC 4ALMA 4OYHA 3FCSB 4QVIA 3O4VA 4J2HA 5IUNC 4M60A 3TNLA 4FGJA 4LDRA 3W8FA 1Q20A 3GMSA 1KPGA 2QLLA 1IQPA 3D64A 2R86A 5HGJA 2VH1A 1OFHA 3O9XA 1JIQA 3HB7A 4JMPA 2OT3B 4EJMA 1XMVA 5A6VA 1GEGA 2W11A 4KR7A 3FYTA 2WVJA 3ML1A 3O2QB 2F90A 2H5JA 4KGDA 4RLSA 5ADUS 4OUKX 1SCAA 1CLUA 1M0WA 2YNMA 3O4RA 4NMXB 1SQ0A 1M8JA 1U11A 4M37A 4PO8A 4PYRA 1JEOA 1GNPA 2FZVA 2QLFA 2R6CA 3WLHA 1ZESA 3BSYA 3UK6A 4NU5A 3FCUB 4KQEA 2OUIA 1HL7A 2OXCA 2F43A 4WH0A 3PDWA 3T0GA 2XDYA 3BZUA 4O8CA 1KVUA 4RFVA 5BYJA 2JFZA 1NUSA 3SPXA 4OIFA 4RTOA 3HVJA 1XEXA 3PB3A 2X14A 3V2IA 4KAAA 5HE8A 3FLMA 4XDYA 2PPLA 4IRUB 2VOEA 3EF3A 2VTDA 2XRZA 5CXSA 4YMLA 2V3WA 3PNYA 3BMQB 2H08A 3JQ8A 4B6JA 2XCSB 1XJCA 4H7PA 1CQZA 5B55A 3ANXA 2QAGC 3ZDBA 2YTZA 1A5AB 1HFWA 1K8ZB 2CB0A 4UM9B 3VSAA 4KNYA 2QN1A 1TI7A 2RHWA 3OCZA 4EKEA 1WL8A 4DLSA 5IYZB 5A3JA 4XR9A 5JBIA 5DTQA 1XBTA 1ORWA 4WCFA 4CL2A 3AHJA 5IX8A 5IT9A 1CUAA 1ZUWA 3FVQA 3MCVA 4JOQA 3SXPA 3C1UA 2VQEB 3A4VA 4JJ4A 1XD8A 5JQGF 3IAUA 3N1UA 4BMXA 1C9MA 1JU9A 3S99A 3CC8A 3WLAA 1OAOC 3B70A 2PFGA 5M7EA 4JI0B 1FVOA 1UUFA 2E4YA 3S8MA 3KD3A 2RHLA 2PRZA 5EPOA 4TLCA 1IUKA 1ZUIA 2FFAA 1IIRA 4LGCA 4TV8B 3KL4A 5H68A 1A96A 4FCVA 1V3VA 3WWYA 1NLZA 1WG8A 4WBNA 3DAYA 3H1FA 2MINB 1XE3A 2LYRA 2MDTA 2WU1A 2YY5A 3C8MA 5DHRA 2V74B 1FU7A 4RS3A 3TQFA 3WKDA 1Q15A 4QU0A 1ZZ8A 3DEAA 4CE6A 1JX6A 3C43A 3MS2A 4A8JA 3GUUA 3VVCA 5AFSA 1M74A 2ESRA 1P4JA 4S3MA 2E1RA 4IILA 3T7KA 2AK3A 3E82A 4YRGA 2BI7A 4ZALA 5TX7A 4DM7A 4MPDA 2I03A 4OJKA 4BE4A 4DNPA 1QHXA 3JQ9C 1ZNXA 1Y4DE 1UJ5A 1MFZA 4HZUB 3ORRA 4LXIA 4QTZA 3FRJA 3JYQA 1N0IA 4URFA 3GLIA 4EYQA 4ASUD 1G64A 2WIFA 5C7IO 1BD4A 4AJOA 4US2R 2HW8A 3BWCA 3BVPA 4CVNA 1J21A 1N1EA 4NESA 3CV3A 2I71A 1FP4A 4O4JF 3VQTA 4AF8A 3KJEA 1GG8A 1RYZA 1K75A 2GAIA 3BE8A 3P96A 4MUNA 1RP1A 1T2NA 3IP8A 3PDUA 2AKEA 3WE7A 4DADA 4MP3A 4RK7A 5FO0A 3H17A 4YRPA 1JTVA 1R5OA 2IUUA 5KCZA 1SBTA 2BV3A 1M2KA 4QXOA 2I3ZA 3DBLB 4G1CA 4GZ3A 4J07A 3UVEA 4MR8A 1KO7A 3ZC3A 3L46A 1G6HA 1M2WA 2DFKB 2V7UA 2WJ3A 4FBLA 2B7CA 4DR4B 2QW0X 3RYCA 1GXSB 4XLLA 4AJEA 4WSOA 3U7EB 1OU0A 1U8YA 3PNMA 3ROKA 2Z57A 1ODSA 1PKXA 1Y4AE 2JGLA 2IZ5A 4RGBA 5HBRA 4XUCA 3ZIAD 3VH2A 3VTZA 2PGNA 1NW9B 2HCSA 1CW2B 2A5FA 4J49A 1KJQA 4TMVA 5E2IA 1DZ3A 1Z74A 5FUQA 1C2YA 4UAVA 2GLUA 4RWEA 2D1TA 3G89A 1VCNA 1YJBA 2X6TA 3A1CA 4YAJA 4QLBA 5KYTA 5J9FA 3MJFA 1FTGA 4OQ4A 1YCGA 2O2CA 4PLWA 2B36A 3ZZNA 1DQYA 5KHOC 5EJ7A 1JIVA 3EPRA 4L6CA 1G7CA 1OLXB 2AFIB 4PO1A 5TRTA 3AHHA 4HAXA 1HYHA 1JQLB 1D04A 3F8WA 1S2MA 1UAGA 4E2ZA 4EG4A 3IHKA 3QEMB 3ZE8A 1IN7A 2GXAA 1R74A 1CUWA 1RAHA 4D3YA 4GM4A 3B2QA 1XMPA 1FPMA 3PPXA 1KMHB 1WUYA 1ZS9A 3AM3A 3B1WA 3NVDA 4NI5A 5TPWA 4D3FA 2CLIB 1EX9A 4DDUA 4PPQA 4A0HA 4G5YA 3OZIA 1DINA 3JXCL 2KBEA 3PGMA 1MOPA 2F3PA 3H4VA 1TGYA 1LU9A 5EJ6A 4ESVA 1T3TA 2XNJA 3H0EA 4RTJA 2Z6AA 1II9A 1ZGCA 1JEAA 2AZMA 3G9UA 3F51A 5CDGA 1RBMA 3ZJ5A 1J70A 4OQLA 1X8XA 1NC3A 4QOHA 3OZVA 2OR1L 4BZWA 4EG3A 1TJNA 5LZ5A 1RWBA 2GLTA 1OKKD 2X3UA 4D3XA 2IYYA 4E11A 1Y0BA 2KPJA 4L07A 1SKUA 3FPLA 4HAYA 5THXA 3CX4A 4F9FA 2PZFA 5ALUA 3DC7A 3IV7A 2QN9A 1PN3A 2CFTA 3BL8A 3P9ZA 5REQA 2HA4A 2JAOA 2VNSA 4J3NA 3O8NA 4CMKA 4KX3A 5KEIA 3DEKA 2Y67A 4HI0E 3W7AA 1QM5A 4OOFA 2QMEA 2X4GA 1JBQA 2R1TA 2CLFB 1DJMA 4NIMA 5L3SB 2J4DA 5D6OA 5F5XA 4ALKA 2FWIA 3KQQA 4FSDA 1C41A 4MJXA 1HI9A 4DCCA 3MJTA 5AUNB 3ZOKA 2C8JA 4URXR 1LQ2A 1ISMA 1ZS4A 3VYVA 3NB0A 3NNSA 4MCJA 4DW8A 4EHDA 1OASA 3NAMA 4W8OA 3OHSX 1YMUA 3JQ7B 5G41A 5ECYA 4OI1A 1WD5A 1GJRA 1GTL1 2CJWB 2QUZA 1RHKA 3LC1O 5I9NA 3L2OB 2XZTA 2HDOA 5EPUA 1U80A 1BJRE 2GFIA 3OLYA 3OPNA 1PWEA 4M88A 3WFIA 2CSUA 4WY8A 1FL9A 2NAFA 1FLNA 1GZ3A 5T6BA 3U3ZA 3LVRE 1L7NA 1SBCA 1OXXK 1AQNA 1RYYA 2B4RO 3DZDA 3RG8A 5BN3A 1FFGA 4C7VA 3LYLA 1RQRA 2HK6A 2XE6A 3QU5A 2G5PA 4JC8A 3GEDA 4UTXA 3KR1A 1MGOA 3DLTA 1ST2A 2XI4A 2XW6A 2BGMA 4WERA 5EIEA 1G17A 3CKLA 2UXBB 3ZU2A 1CRPA 1II8A 2B9VA 3CISA 3QPCA 2JLXA 4KBYA 1L7XA 3PPVA 4JQSA 1XQVA 3WZ2A 3LCCA 4IWNA 3C7TA 4B85A 1X77A 1AKMA 1P29A 2WSIA 4G1EB