5DTQA

Crystal structure of dot1l in complex with inhibitor cpd3 [(2,6-dichlorophenyl)(quinolin-6-yl)methanone]
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
328
structure length
320
Chain Sequence
b'LELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMENYVLIDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTNTRPSTGLLRHILQQVYNHSVTDPEKLNNYEPFSPEVYGETSFDLVAQMIDEIKMTDDDLFVDLGSGVGQVVLQVAAATNCKHHYGVEKADIPAKYAETMDREFRKWMKWYGKKHAEYTLERGDFLSEEWRERIANTSVIFVNNFAFGPEVDHQLKERFANMKEGGRIVSSKPFAPLNFRINSRNLSDIGTIMRVVELSPLKGSWTGKPVSYYLHTIDRTILENYFSSLKNP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone-lysine N-methyltransferase, H3 lysine-79 specific
molecule tags Transferase
source organism Homo sapiens
publication title Optimization of a Fragment-Based Screening Hit toward Potent DOT1L Inhibitors Interacting in an Induced Binding Pocket.
pubmed doi rcsb
total genus 103
structure length 320
sequence length 328
chains with identical sequence B
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2015-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08123 DOT1 Histone methylation protein DOT1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.60 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) 434 Repressor (Amino-terminal Domain) 5dtqA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5dtqA02
3OPNA 2IDKA 3QV2A 1SKMA 2ZWAA 3EPPA 1EQAA 1SVUA 2ZBQA 4X60A 3FTEA 1YB2A 2P41A 3UA3A 5DX8A 1M6EX 4K6MA 3M4XA 2EX4A 1XDZA 3DMGA 4PGGA 3C3YA 3GXOA 3TMAA 2ZCJA 2AZTA 3KQWA 3P2IA 4LECA 3PFGA 4DZRA 3C0KA 2NP6A 2Z6UA 1QAMA 1G6Q1 2ONZA 3GGDA 5EIWA 3DTNA 5KQRA 5GM1A 3DLCA 4C04A 4ER6A 3SXJA 2VP3A 5E1OA 4BLVA 4PCAA 4QPNA 5EHGA 1L3IA 2P8JA 3WSTA 2B9EA 2HWKA 3Q87B 2GA9A 2PT9A 3G5TA 4IKPA 2QE6A 5FCDA 3SSMA 1SUSA 4CTJA 3EVEA 4BLWA 3M33A 4HRAA 3R9XB 3LKDA 4GC9A 4OBWA 5ICEA 3PTAA 4XUDA 3R3HA 5EMLA 2PXCA 3UJ7A 3B3GA 3G2OA 5GWXA 1WG8A 4WVLA 1R74A 3FPJA 5B1SA 3TLJA 4Z2YA 1P1CA 4PYQA 3KR2A 3HA7A 1JG2A 5EMJA 1N7JA 4RTRA 3FPEA 4DCMA 2O57A 3KQQA 5EMMA 4RTNA 1P1BA 3KPUA 1JG4A 3BWCA 3O7WA 3FUVA 3I64A 5K03A 2F8LA 5CIYA 2OY0A 2ZSUA 2IIPA 4X1OA 2OKCA 3U81A 4M36A 2OBFA 2VZ9A 4ISCA 2QY6A 1VPTA 4MWZA 3TM5A 1G8AA 5FULA 5HIJA 4PIPA 5G02A 3P9KA 4U7TB 4CWAA 5ICCA 4RTJA 1TW3A 3UJ9A 4HTFA 2PWPA 2QRVA 3THSA 3TQSA 3E23A 2OYRA 2C7PA 2JHCA 3PLAE 5C0OE 1BHJA 3FYCA 2Y1WA 3G8AA 3SMQA 5K01A 4KDCA 2GB4A 1M0EA 2P3QA 2B3TA 2EJTA 5DSTA 5FA8A 1N7IA 2BM8A 2BR5A 3G2PA 4PCLA 3SVZA 4QVGA 1P39A 2XBMA 1EG2A 4HC4A 3BWBA 1FP1D 1Z3CA 3EVCA 4FGZA 4M7RA 4E2XA 4V0QA 1KR5A 5C1IA 2I7CA 5HIMA 1RI3A 4EKGA 4PONA 3DXYA 5T67A 1RJFA 1WS6A 3LBYA 4DMGA 1VP9A 4A6DA 4JXJA 2AR0A 4AUKA 3M70A 2XYVA 1QZZA 2B2CA 1JTEA 1P91A 2O0LA 5EIFA 3BT7A 1VP3A 5FQOA 1RJEA 1JSZA 1R6AA 5GOZA 3G5LA 3REOA 1R00A 3A27A 1YFLA 3OU2A 1RJGA 3MAGA 4XCXA 2OPBA 4ER0A 4RTKA 4R8SA 3VC1A 2IDJA 3SM3A 1XXLA 4YUWA 1L9KA 3UJCA 4HGYA 4EVIA 5EOVA 5EC8A 3SX0A 4AX8A 4KIGA 2O07A 2C7QA 1NBIA 3BWMA 2ZULA 3MCZA 4YUVA 4E30A 5BW4A 3LHDA 3CVOA 1M6YA 3A7EA 3FUXA 4RYLA 4DM3A 2HTEA 1FPQA 4PGHA 4PYNA 5K0GA 3ER9A 5FHQA 2OB1A 4HGZA 3BUSA 2ZIEA 5E9WA 2QYOA 3DLIA 2YXDA 1D2CA 2VDUE 1V39A 2FHPA 2ZW9A 3RW9A 1R18A 2Y1XA 3JWJA 1INLA 5T6BA 5DWQA 2VDVE 3HEMA 4NECA 3GIWA 3RIEA 1XCJA 3G2QA 1VIDA 2GS9A 4AZWA 1IXKA 1NKVA 4MIKA 1R8XA 1X1AA 4G56A 3EVGA 4GC5A 2G8NA 4PYJA 3E05A 3UZUA 4P58A 1SQFA 2CWWA 1G55A 3FRHA 1G60A 4EQZA 3CJQA 3LDFA 3KQSA 3UJBA 3BXOA 3KR9A 4FT2A 4FT4A 1JQDA 1L1EA 3IYLW 5KYGA 2PJDA 3HCAA 2IBSA 3HNRA 3EVDA 2WA1A 4XUCA 2JJQA 4RTLA 3BWYA 4F86A 5GIPE 2A14A 5BP7A 2FK8A 3LBFA 3NWBA 2QRVB 3HA3A 1JG1A 3ERCA 4X41A 4AZVA 1EJ0A 2H00A 1KPHA 2P35A 3A4TA 3LGAA 5GM2A 2AVNA 5CCXA 4E31A 3D2LA 2HMYB 4HH4A 5LQUA 2I62A 3BKXA 3NDIA 4MHTA 4HG2A 3AXSA 2JG3A 2PX4A 3ORHA 4YV2A 4M37A 4ER3A 1XDSA 2ONYA 1I9GA 4ER7A 4H0NA 5HILA 2PY6A 1SG9A 3BZBA 1QAOA 2YX1A 3LDUA 5EQJB 5K0LA 3TRKA 3MQ2A 4E2WA 3TM4A 4P7JA 2PGXA 3EVAA 3K6RA 5CVJA 3LCCA 5GP1A 5E9QA 3GCZA 3RODA 3V97A 2AOUA 4GEKA 3JWGA 3P97A 5ERGB 2ZZNA 2WA2A 5KVAA 3AWIA 4CTKA 2JH8A 3PFHA 2ZTHA 2AS0A 3PT9A 1NV8A 4BP3A 1NW7A 5K09A 1DCTA 5F2OA 3SGLA 5K05A 2PT6A 1IY9A 2R6ZA 2YXLA 2ZBPA 5DM4A 2NXCA 3HVKA 3PVCA 2PVCA 3Q7EA 5FADA 4HSGA 4BP1A 1DL5A 2ESRA 2JH9A 3A25A 3LX6A 5EZSA 3HA5A 2IP2A 1TW2A 2KW5A 5IH3A 3P8ZA 3KQPA 1EJ6A 4IWNA 3NVKI 4GUAA 10MHA 1JQEA 5CVUA 5FWAA 4AZTA 2BH2A 4PYKA 3FPFA 4AZSA 5ICFA 1G8SA 2AN5A 5DPMA 3MERA 4GOLD 3UJ8A 5FUBA 3UWPA 3F4KA 1H1DA 3MCTA 3I53A 5U4XA 3H2BA 1G38A 1RI4A 1VE3A 2C7RA 3DH0A 1YZHA 3X0DA 5FWDA 1RI1A 2CMHA 3I5UA 3BGIA 5EKXA 3OCJA 5D1HA 3B3FA 5EEGA 1VL5A 5DTQA 5CVVA 2OO3A 3FZGA 3E8SA 4IV8A 5CM2Z 5T64A 4BY9E 1QAQA 2ZBRA 3HCFA 3CCFA 5EPEA 3ELYA 4YV1A 3G7UA 5DTMA 1ZGAA 8MHTA 1O9HA 3P9IA 3GRVA 2N47A 3P71T 4PINA 4R6WA 5K0EA 5MHTA 3KQVA 1BKYA 4PIMA 4FP9A 3BGVA 3LCVB 4P7GA 3EVFA 3EGIA 3GO4A 3MTIA 3OFJA 1JTFA 2AOWA 3EMDA 5EKUA 4EKIA 1U2ZA 3FUUA 4RSRA 1BOOA 5H02A 1ZGJA 2V7EA 4OA5A 4KVZA 3FUTA 5DX0A 3CKKA 3ELUA 3T7SA 1RJDA 4KW7A 2P40A 2P7IA 5CVEA 2G72A 3NVMB 3KPYA 5JUWA 4KRGA 3CBGA 1NW8A 2OZVA 1KP9A 4E2ZA 3SR4A 4MQ4A 3HTXA 3JWIA 1PJZA 5EVJA 3M6VA 2HNKA 5JR3A 2P3OA 2DPMA 1Y8CA 2AOUB 3ELWA 2CL5A 1KIAA 1O9GA 3EMBA 2VDWA 3GNLA 1ZQ9A 4F84A 2YTZA 3GDHA 3PX2A 5EHIA 5EG5A 2P3LA 3GRYA 3KPVA 5K8VA 2UYHA 3LSTA 1WZNA 3NMUF 1X1BA 3G8BA 1YFJA 2FCAA 1MJFA 2ZWVA 1X19A 1X1CA 2XVMA 2PBFA 7MHTA 3DP7A 2IGTA 2JHAA 5CUQA 2CMGA 1HNNA 3E7PA 3T0IA 4QVKA 2ZIFA 5DT2A 1BC5A 1ORIA 1ZG3A 4P7KA 2CKDA 5E1BA 3UFBA 2YVLA 3TOSA 3C3PA 4C07A 4E70A 4YUXA 5K0JA 5D1NA 1VLMA 2FYTA 5LQCA 2ZLBA 5E9JA 5K0NA 5LR6A 2YXEA 3HM2A 3GWZA 3R6TA 4OQEA 4QQKA 1FP2A 4QQNA 5CD1A 1WXXA 1KPIA 3A7DA 5EMKA 3UJDA 4XUEA 3O4FA 1AF7A 1XCLA 3FPGA 4GBED 3GRUA 1JQ3A 4GF5A 4LG1A 2EFJA 2PX8A 1TPYA 2G1PA 3FYDA 4OQDA 3C6KA 5DTRA 3B89A 1YUBA 3OU7A 4DQ0A 4PYLA 3KPWA 3GU3A 5DXJA 4B17A 3GJYA 2BM9A 4WXHA 4YMHA 3ID6C 3IEIA 4RX1A 1DUSA 1I1NA 2ADMA 3S68A 4R8RA 2NXNA 1B42A 3CJRA 4GOOD 5LQRA 1YF3A 3HP7A 3DR5A 4UOEA 2PSSA 5E8RA 5K0BA 2E5WA 4PYOA 1FJXA 4QDKA 2AN3A 3VSEA 3LDGA 2WK1A 4C4AA 2ORED 4DKJA 2B25A 2AOTA 1JR4A 3JWHA 1QANA 1OR8A 2BR3A 3KPJA 1XTPA 4IV0A 4KWCA 4RTSA 3G89A 1IM8A 4GOND 5F2KA 1PRYA 2EJUA 1UWVA 2GAFA 2IFTA 2JHPA 5LQAA 3OU6A 4V0RA 4C06A 5LSAA 1KHHA 1ORHA 2YQZA 5BXYA 2IBTA 2Z6QA 4F85A 3HVJA 3V8VA 4CXMA 3KR0A 2AOVA 2YR0A 2NP7A 4FSXA 3ELDA 4ZTBA 1RI2A 1KPGA 2LD4A 2NXEA 2PX5A 3FUWA 5K0FA 3VC2A 4YUYA 3GRRA 4RTOA 2IH5A 2B78A 2IH4A 5LQKA 1NBHA 2PKWA 1FBNA 3ANXA 4X63A 1AQJA 1NT2A 1SUIA 2ZFUA 3HVHA 3M6XA 3KHKA 2QM3A 4ER5A 1NW5A 4KIFA 3DXXA 2OB2A 4PNEA 3THRA 3KQOA 3VYWA 5M5BA 4RVHA 3T7TA 2UZ4A 4RVDA 1KYZA 2I6GA 1SQGA 3I58A 3R0QA 3MTEA 3DXZA 2FRXA 4U7PB 3BGDA 3MGGA 3P9CA 5E2BA 5E2AA 3FTFA 2G70A 5HIIA 4E2YA 2BR4A 3OE4A 2ZVJA 2ERCA 3SSOA 3UA4A 1Q0SA 3CJTA 3I9FA 3DMFA 3KQMA 4HTFB 2H1RA 4LWOA 5DM1A 5EEHA 3A26A 3P2EA 3HCCA 3TFWA 4RVGA 2FPOA 3DMHA 4DA4A 1MHTA 3LKZA 3OZSA 4X61A 5LQNA 1X1DA 2HV9A 2NNWB 2XYQA 3KKZA 3ER8A 3KR1A 5FA5A 2VS1A 2UYQA 2OXTA 5EGSA 4RV9A 4CKBA 5DX1A 3IV6A 3FTDA 1NV9A 1XJ5A 2IPXA 3BKWA 3HVIA 3P9NA 3R24A 4R05A 3EEOA 3P2KA 4OA8A 4RTQA 4L7VA 4RTPA 3OFKA 5CCBA 3EVZA 5HFJA 4ATNA 2O06A 1Q0TA 3MHTA 5DXAA 2Z6AA 4Y30A 2PWYA 2BZGA 3AJDA 2R3SA 3UJ6A 4C08A 9MHTA 5IKMA 2DULA 4CKCA 1UFKA 1EIZA 3QOXA 2EG5A 2YUIA 2GH1A 3EGVA 3CGGA 3AY0A 3NDJA 1L3BA 2GLUA 5P8WA 1YZ3A 3G88A 2ZZMA 1RI5A 3NW9A 1T43A 2AOTB 3KQYA 4C03A 3AXTA 1VQ1A 4QTTB 3FPHA 4LWPA 1NW6A 5FHRA 5ICGA 4QPPA 2ZIGA 1D2HA 5C9ZA 1QYRA 3LL7A 3LPMA 5BW5A 3B5IA 4BLUA 1D2GA 4QDJA 4EMSA 1N2XA 1ZKDA 3LCUA 5FQNA 3DOUA 2PXAA 3KQTA 4O29A 4A6EA 2I9KA 1JSXA 3CC8A 4DF3A 1NE2A 3HCDA 2IH2A 2PV0A 3C6MA 2PX2A 4GQBA 3TPZA 2NYUA 4P7FA 1L3CA 3MB5A 3OZTA 5DRYA 3L8DA 2PXXA 4DCGA 2C7OA 5KQSA 3OE5A 1JG3A 2UYOA 4R6XA 5DM2A 3TKAA 3UJAA 1NW3A 5F2NA 5DSXA 2ZZKA 3EVBA 3O31A 4YMGA 5KS2A 3M6WA 2PLWA 3EEYA 3HCBA 3IHTA 3B7PA 1VBFA 4RVFA 1I4WA 4C05A 2Q41A 1R8YA 2AVDA 2P1DA 4OX9Y 4FS8A 2AOXA 5EZQA 3TKYA 3M6UA 4FSDA 4FZVA 4PYMA 2H11A 5LQJA 4M38A 4RWZA 1WXWA 3NWEA 2HR1A 2NXJA 3NJRA 2G71A 3NTVA 3T7RA 5K0CA 1F38A 1F3LA 3K0BA 2K4MA 4QTUB 1KXZA 1UIRA 3ME5A 3OZRA 4CKEA 4E33A 5HZMA 1KYWA 5GIOE 4EK9A 2FK7A 3FRIA 4PWYA 3DUWA 2P7HA 4KDRA 5HIKA 1EAMA 4POOA 1XVAA 5E8JA 2AN4A 2UYCA 3FTCA 2V74B 3QOWA 3PX3A 1HMYA 5DRTA 1WY7A 1ZHFA 3PB3A 4OBXA 5CVDA 4Y2HA 4FR0A 3SSNA 3DULA 5HOQA 1AV6A 3HCEA 3KU1A 4YUZA 1XDUA 4GOMD 2XYRA 4PYIA 5DLYA 3UBTA 3B3JA 4MTLA 1AQIA 3PS9A 5HEKA 5GINE 3GRZA 2XVAA 3LECA 2GPYA 5E1DA 4RTMA 3EGEA 5FTWA 3G2MA 1O54A 5E1MA 3TR6A 4E32A 2O05A 5DM0A 4YV0A
chains in the Genus database with same CATH superfamily
4B33A 4RE6A 1GQQA 1V35A 4DLVA 2ZWAA 3TYXA 1U7PA 1UAYA 3JASB 1KQPA 2OUIA 4PO8A 2XGSA 5A05A 3RC9A 3B7WA 1X8KA 4CM7A 3DMGA 1LMB3 1KIFA 3I05A 3C3YA 1GTG1 4AG5A 1ZVKA 4TROA 3U4DA 5J3JA 4H16A 2XIUA 5EKTA 1DI0A 4XWAA 3LK7A 4DLPA 1PJ4A 4EG0A 5B58C 4I8IA 5JWRA 4PLYA 4C04A 1PDVA 2R4UA 3FDIA 5IKEA 2R8YA 3DF7A 4QVIA 1MRSA 1YASA 4IIXA 3MW8A 5D3QA 2IYTA 2L69A 1QFMA 3BFJA 3Q87B 4TV8A 3UWKA 2QE6A 3IVRA 3STXA 1KJJA 1RXVA 4ZVKA 1UBEA 1G3RA 3QITA 1YVEI 2D2FA 2W8BA 5IT9A 1W87A 3JSXA 3T3EA 2VDNB 1J06A 1U0TA 2G76A 3URMA 3FTPA 4ZEOA 3F9IA 1G0OA 3GGOA 1IHXA 1OXBB 3D5TA 4IEEA 2IEAA 3HB9A 2OK7A 1WG8A 3BDAA 4D0SA 1WF6A 3LT2A 4PYQA 2IDMA 1OPRA 5ICGA 5JZBA 3RUDA 3OZDA 1JWAB 1DBRA 2XUDA 4MJLA 1N7JA 3Q7RA 4YRPA 2ST1A 2FG7C 5EHXA 4YPOA 2BBTA 4H7FA 4DCSA 4YGYA 3R44A 1PQ4A 1MIHA 2HM7A 2SKDA 3LDAA 2W93A 3BJZA 3UG6A 3H5TA 4IMPA 4ACBA 3SQDA 5M7EA 5LYJB 3BXXA 3OQ6A 1VPTA 4KQEA 3ROFA 5I3CA 2FMTA 3G8DA 2XCIA 4IOLA 4U7TB 2ZRJA 2GX6A 1XYGA 2ZREA 1HEIA 3IERA 1CEQA 3J7TA 4GHWA 4TTQA 3IL2A 1ZXLA 2B69A 3F49S 3NUQA 4WBNB 3M1AA 2B83A 2BEUA 1TJNA 1XTSA 3C1UA 5C0OE 2F3QA 2VQ3A 1H2FA 4Q19A 4RIHA 2ATCA 4LK2A 3D7KA 5DSTA 2Y1GA 4HDOB 2LCQA 4AICA 2VPXA 1ZOIA 2B8JA 3GB9A 2EIXA 1Z2PX 4PHFA 2XZLA 2V0NA 3ZYCA 1V37A 3MT7A 2FEOA 1AB6A 3KZMA 1U2EA 4UULA 2JANA 3RU3A 6NULA 1J9EA 2H3HA 1T91A 1GZHB 4A8TA 4IAOA 4B6OA 3G2IA 4BNYA 2W2KA 4B85A 3AM4A 1KH3A 2L49A 2ZYGA 3IBYA 3HCWA 5CB4F 3FD8A 1XPJA 3SHFA 3VR6A 5HPYB 3F5DA 3SF8B 1K68A 1MEOA 1KK2A 2XVYA 3WFIA 5AQ1A 1X39A 1GRCA 4KLCA 1QXSA 2OPBA 2BKVA 2D1YA 1IZ9A 3H18A 4TYQA 3ZLTA 3L01A 5IHXA 2WFLA 4AN0A 3OY7A 4NRDA 2QNRA 3FPKA 3C43A 4G5XA 4FBLA 3UOWA 1EM6A 3JVIA 2IXBA 1J5PA 3G9ZA 2XXAB 1JALA 1QVVA 3QK7A 4PPQA 1MP0A 2C5GA 1UM9B 3HG7A 4LC9A 3T38A 1YZKA 3ZK9A 2CK3A 4O25A 3DR3A 2NACA 3QSYA 2I2FA 3OX3A 1TL7C 1V39A 2ES4A 2ZR0A 4E09A 1SXJA 5CPBA 1A8PA 4RWEA 1U31A 4JMLA 2QAGC 3TZLA 4G81A 4R8MA 1F4VA 1SCUB 2QUIA 3T06B 1KI2A 5EIXA 4UD2A 3G2QA 1C9JA 3DC2A 4AZWA 2YHSA 4RA9B 3SZ3A 3SIXA 3BD9A 1P3DA 4FU0A 4K87A 3U61B 4P58A 5JWOA 1UAGA 3WMRA 3W2TA 3RVRA 3U5TA 3PGXA 4R5HA 4DV5B 3ZWQA 2C0CA 5B12A 1MC4A 3JS5A 2Q3BA 3H9JA 4FN3A 3NNSA 1NZFA 1E64A 4PO3X 3RHFA 3AVYA 2A57A 1OTXA 5DT9A 1MAWA 5AD1A 1OKKA 3DMNA 1LV8A 1GUBA 3EIUA 2DHDA 4AX4A 3H3JA 2QV0A 1Q14A 3W05A 3NTRA 3R20A 1B4DA 4N41A 3H2ZA 1JG1A 3DOOA 3IRVA 2H00A 4AULA 3PLNA 4KQCA 2XHZA 3HE3A 4E31A 3HDQA 2DJ5A 1G0NA 1RWPA 2UUOA 4TLLB 1TEHA 2H5EA 2ZCVA 1NDQA 2FW9A 3LYUA 1LC0A 5FOSA 3TTSA 3AW9A 1F5SA 4X45A 4FIDA 4GSKA 2PY6A 2O0KA 2ZI7A 4XX0A 4A3SA 3ZWAA 1OLUB 3BH6A 4QXPA 3CXRA 3N8IA 5TEVA 3QF3A 2O3JA 3PUZA 1CC1S 4FC6A 1VCIA 4XIFA 5IT5A 3QOYA 2A86A 1UPUA 5EE9A 1P0IA 4RMIA 4R1NA 1BCRA 3HUDA 3JWGA 5CB4A 1SVSA 2V5VA 2NTEA 4Z5CA 3N0XA 4YBZA 3RJZA 3AWIA 4OXXA 4ZV4A 3EG9A 1E7QA 1HURA 1P2TA 3EW7A 1SU8A 1YVUA 2XB4A 3FZNA 4IDDA 4XGQA 2VYVD 5A7HA 3V2UA 3KHUA 1XU4A 4G84A 3ZWMA 2G7ZA 4J1NA 4DLSA 3M83A 2OZPA 1RIFA 3P9PA 2P0EA 4NIMA 3PXGA 2LVBA 1DKMA 2BFAA 1VOTA 2X7XA 3AF0A 3Q40A 5G3ZA 1VE9A 5IZCA 4JI8B 3BMQA 3IPLA 2JFWA 1G9SA 3H4TA 4F60A 3IQWA 1DXQA 2VK1A 4GUAA 4Q3LA 3QFIA 5CB8A 2X1VA 1QH8B 1FUIA 2B6NA 4J0QA 3PQ4A 1W35A 4L6IA 5FWAA 4F8JA 3ZCUA 2B99A 5ICFA 2FFRA 4JL5A 5CEJA 3DQZA 4QRDA 2M4HA 1SM4A 3ANNA 3VKFA 4AG3A 2YFHA 4BMDA 1NHGA 3QSGA 4KO1S 5FUBA 1UC9A 1PLJA 2IZZA 2V6IA 3KS9A 3QLUC 1WKBA 4FFPA 4OQPA 1FY2A 3I53A 3QG1A 5TJ9A 1E89A 4UTPA 5BRAA 1J0AA 3Q9NA 3H7AA 1D2EA 1XRQA 4BNXA 4LIPD 1X1QA 3GYBA 1FFBA 3V4OA 4EYOA 1E7MA 4GI1A 1CDEA 4ZYYA 4X8HA 1L4YA 2J7PA 1NVDA 3EGOA 2YXNA 3VDRA 1ZK4A 1ZMOA 5IM4A 1QQAA 1Z36A 1PFQA 2X0DA 3DBLB 2BJWA 3T0FA 1QAQA 2ZBRA 1X9IA 5AOVA 1U4SA 1GG8A 1GADO 1V71A 5DTMA 4HRXA 2YS7A 2CJFA 5JNVA 2R48A 1QG4A 3GCDA 2CDCA 3FMVA 5BYJA 4ENTA 1E3WA 4YJGA 1GZDA 2O1EA 2QTZA 4HUQB 2I65A 4KAXA 4YQZA 3QXHA 3EFEA 2QWXA 3R3XA 4IH4A 4KO3S 5HXAA 1RFGE 4GRDA 5ER6A 4TV8F 3RS0A 3OPXA 4MKIA 2TS1A 3ZZ0A 1SCNE 4KVZA 1IG0A 1ZOLA 4NARA 3QXGA 3NHYA 3K92A 1N1EA 1Y7PA 3M2PA 4ND6A 4J0DA 3V4RA 1TQ4A 5E3JA 2MYTA 4Z8YA 4MYHA 1N2JA 1XUOA 3HWSA 4EUHA 2BFFB 5TVGA 3I6ZA 1BXGA 4XARA 3N86A 1ZIOA 2XCUA 1ZVMA 4P4LA 4R81A 1H2YA 1A4XA 1JYFA 2Q9CA 2FETA 1KTIA 1CR2A 1PV4A 4JB8A 4NK5A 2RAUA 5KSPA 1E5VA 4AMYA 4DJTA 1VL1A 2A2ZA 1SBYA 5E4YA 1DV1A 2PXPA 1VHJA 5HKLA 5HS6A 5AUOB 1AK1A 2UYHA 2JCGA 1T3GA 1KYVA 3RTCA 3S2SA 1G98A 5ALWA 3OZCA 1P2VA 4RGVA 3ZS8A 1MNQA 2VA8A 4GOJA 4M8NE 4ILEA 4LFBB 1D8TA 1QG2A 1V16A 5CUQA 4EQ6B 1OZ0A 2I2WA 2YY7A 3BHNA 3R5XA 5CTJA 2ZAYA 3SI7A 4YRKA 3EG9B 1H9CA 1QB2A 1JIVA 4JLPA 4JT8A 3DWIA 4LMBA 5LC1A 3U26A 5A04A 2H7YA 4UMFA 4D9HA 2PZJA 2D13A 3GBPA 5LB4A 5DOZA 3W7BA 1EUDA 2CF6A 3R6TA 3X1JA 1GGNA 1TO6A 3I9V1 1WXXA 3QFFA 4Z51A 1B6GA 4CM8A 2WFMA 3CN9A 4IRXA 3X1MA 1CRPA 2J0UA 4C0QC 1RQGA 3EQ7A 2F43A 2QSUA 1FP6A 3BAZA 2QVCA 3G3EA 3ICWA 1ESCA 2QLJA 2GHQA 4UNSA 5DVZA 4K2HA 1V4VA 1TLFA 5D6OA 4BGUA 4D4KA 3GLGA 3LPDA 5EKSA 1D8AA 3FA2A 3AQIA 3FY4A 4LQDA 2FE1A 3WLIA 4KC0A 1QV6A 4BAGA 2XNKA 1A9TA 1I1NA 3PFBA 4Y9TA 3OWQA 1ZZ7A 1YZLA 2H1CA 4CEJB 3DR5A 3H1AA 2WTBA 5EIHA 1PWYE 4RNCA 4JVNA 2AE2A 4FQ5A 3CIOA 5K6AC 2HT1A 3GMTA 4IIBA 3LDGA 1Z0UA 1JV2B 4G4IA 4C4AA 1Y8ZA 1HDGO 1MA3A 4JBXA 2BN4A 4W5HA 1AJEA 2FQQA 2CNOA 2EWWA 2ZJYA 4CGYA 1WVMA 1ZGGA 4DEXA 4BE9A 2WOJA 4NABA 5CURA 1ZIYA 2BW0A 2XUKA 4KQWA 4XD7D 5IUJC 1Y6JA 4I3HA 1LPPA 4L5IA 1TM1E 4YRGA 3MJTA 1XN4A 3VJRA 2AOVA 1JH8A 3PXDA 3CIFA 1UMCA 5MDHA 4D4LA 4X7PA 1I01A 3N6XA 2NX2A 3CLHA 4ESHA 5TSDA 1L5GB 1VMAA 4YAUA 4QXOA 2RC6A 1MJ5A 1SB8A 4Q4DA 2MEZA 5AKKA 5KPDA 4I8TA 4B73A 4GKKB 4LXTA 2ODPA 5CPFA 1DOZA 3ANXA 3IDZA 3G5UA 3L0DA 1C8LA 3A3YA 2WJIA 1FNBA 4OH7A 2RHBA 3DXXA 3HUUA 5C53B 3O1IC 3PSAA 3WGQA 4I08A 4S1WA 1A7UA 3KT3A 1ZH2A 2JGNA 2BFWA 3CQ9A 3O91A 1Z0DA 2Y1CA 2B3DA 2EV9A 1AS0A 1ZBQA 4OM7A 3DQQA 4YMUA 3UA4A 3RBVA 3REQA 2V9ZA 4CHTA 2OHGA 4EUNA 3HCCA 2HXSA 3DMHA 5FPQA 3GJSA 3E4DA 1LWOA 1XD2A 3DZBA 3NUZA 1ZGBA 1NAHA 3PEUA 4J94A 4Q66C 3NKFA 1DKRA 2I7XA 3LT5A 3A3NA 2PZKA 5KYWB 3R3YA 1UK9A 3L8GA 4EYQA 3TLEA 3D31A 3D4PA 4OL9A 4V03A 2CJPA 5EGSA 4D56A 1VHLA 1RM4A 2FMHA 3F74A 1GAEO 1DJQA 4M9UA 5D6NA 4D8UA 3LLMA 2Q29A 4UXIA 3JRWA 3D6UA 3UHOA 1SO8A 1YZTA 2KMLA 3H5VA 2ODEA 2YXBA 3D6AA 4H15A 4J9VA 4NDZA 4A0GA 5TARA 1ATZA 1UMDA 3UHPA 3RBZA 4F45A 4WZBA 4DJ5X 4L02A 1R1DA 1UP6A 5BR1A 4L5BA 1MJGM 5LQSA 3SJAA 4G41A 3UJ6A 4QGSA 1Q7RA 5M5BA 3KELA 4Y2TA 1W2HA 3HXLA 3FR7A 1WDKA 2QT0A 1K8XB 3TRFA 3AY7A 2K2QB 4KQXA 3GLGB 3QOXA 1E62A 1TFUA 3Q2OA 3NR2A 3EISA 1QP7A 4XX1A 1NJ8A 1ZJJA 3I5AA 1EWTA 1CDZA 4CKCB 3K9GA 4G97A 3NW9A 5DEOA 2GCOA 5A3RA 1XRMA 3W8NA 2QTCA 1F2UA 4DG9A 4BEWA 3JATA 3TCNA 4L8LA 3QKTA 3V1TC 2O50A 2GEFA 3M6FA 3LCUA 1GR1A 4F9EA 5G40A 5EXXA 1YMUA 2RGWA 3E1KA 1YJCA 4DF3A 2YHBA 5GY7A 2PWAA 2H06A 1WX1A 2WSSA 3BMXA 1D7OA 1F14A 3HFGA 3KJEA 5I9SA 3JQ6A 1CT9A 4RZ3A 2LLWA 4DXHA 2BGRA 1TUBA 1JHVA 5AUPB 4R1LA 4G0WA 1BA3A 1U98A 1A88A 1P9RA 5KNBA 4PNHA 4AQ7A 3FW1A 1YA6A 1YR3A 3KEGA 5HCIA 4LY9A 1ODTC 1PSDA 1S3GA 1YD7A 1HH4A 1ZA1A 2D1QA 1G5PA 3FXAA 3DCIA 4FHZA 4JR2A 4Q9JA 2O1XA 1JDNA 3HU2A 3ZE7A 5I7VA 1TZMA 4GZ6A 2VQSA 4RKYA 3IHLA 5KU7A 3EEYA 2QAJA 3TPCA 3G5GA 1RXIA 1ZJYA 2Q41A 1RC8A 2YDXA 3DEIA 1EVZA 4G4JA 2ICPA 1PT5A 1DRJA 1QWOA 3A14A 2KJQA 3CT6A 2H1LA 4DSNA 5EZQA 1J5EB 4BMCA 2ABWA 2B0JA 3DS8A 3ZJTA 3OZUA 1UQUA 3QVVA 2OFPA 2CGEA 5AK0A 5FR1A 3I9OA 3T61A 2IKQA 2I7DA 2RHDA 3PGJA 4H6VA 3WL7A 3GP8A 5KNBD 2C0QA 4MW4A 5K0CA 1KXZA 1TA4A 1F6WA 1C1HA 1UIRA 3E9CA 5J2UB 4OQFA 3WAGA 3Q3GE 1RWXA 1RSZA 2MTBA 4CFYA 1WHTA 1W0JA 1YL6A 2R79A 1EFPA 1G2QA 4R0VA 5DF1A 4EEZA 3REQB 2UZ0A 4N0DA 1Y8AA 3P2OA 4ZAVA 2PT5A 3FYUB 1P1KA 3HZRA 3O4JA 3QA3E 3SSNA 4YAIA 2JIRA 2Q5HA 1KDVA 4P4SA 1X8JA 2Q6VA 4C0KA 2HXGA 5SICE 5CA0A 1XDUA 4UCQA 3CZQA 4U8HA 5DLYA 5F51A 3TVYA 4MTLA 1L4MA 3CZ4A 3PS9A 3ONWA 5ALLA 4BTLA 3VKUA 4YRJA 2A9VA 3L4KA 1ZNXA 2Q1TA 3CVUA 4TRMA 3TQCA 3L6OO 2A0FA 4Z5HA 4CF3A 3EZ7A 4O4LA 2X9VA 2ON6A 3ENWA 4NZOA 4J8PA 2I9KA 1X7XA 5HCUA 5INTA 2X0KA 2ZBQA 2RIRA 2I80A 1C29B 1Q0ZA 1ZS9A 5IYZB 5A1JA 4RSHA 4R1MA 4CQLB 1G9TA 1K89A 2V8BA 2PRKA 3EG5A 4MR8B 3HKCB 4F3RA 1IN5A 1QYDA 3AFMA 2DFLA 2QN2A 4FEAA 2QQEA 4PZEA 4S2UA 3PD1A 4C6SA 2I6SA 3O8OB 4W8HA 2PR2A 1EE2A 4Q9IA 2EBYA 2AWIA 1L3IA 2BSXA 1BE6A 4CIVA 2YVUA 5M3BA 5L53A 3FNBA 4GMFA 5ESWA 2PLNA 3V8NA 2A33A 4MB0A 2OWDA 2QRJA 3ETDA 3PQ7A 1O4XA 4BGVA 2DXIA 1ZVJA 5JXGA 1M6WA 1NQAO 5IASA 2DQ4A 2XA1A 3IUJA 1T6XA 3F7TA 2FOLA 3OLQA 3LKDA 1FMLA 5JCZA 1YQ9A 1P29A 2ZROA 3A4YA 4COKA 4W5JA 4Q9NA 3VPXA 3OT1B 1ZN9A 5I8ZA 3WQBA 1XEXB 4BU0A 2P6RA 4BV8A 4WNAB 1I13A 1USUA 1G7CA 7REQB 5GAJA 1Z38A 1RYYA 2XRYA 1HYEA 2DWUA 1PTKA 2XTNA 3Q3CA 4L95C 5LUBA 2RE8A 1Y63A 3CNOA 4ZT6A 5DYYA 1PNRA 1K4YA 1R5BA 1VXOA 1CIPA 1DKQA 3DMTC 3L7KA 3O7WA 3SE7A 3I64A 2H54A 2OGWA 4HFRA 2XMCA 3KJXA 5D3KA 1ZUNB 4UHHA 4AD8A 4EECA 4ZCSA 1CQXA 1NBAA 2HADA 3EGWA 4X1OA 4R7TA 1LY1A 1Q3HA 3WWDA 1U0EA 2OXIA 2WM9B 1IXRC 1XJ0A 4E5VA 2R60A 1TW3A 4GD3Q 4BC1A 3KVYA 5KJ6A 3THSA 3VJKA 5C46F 1A76A 4UTOA 2XWPA 5DP1A 1T8TA 3GEGA 3D7RA 1ZM3A 4DNFA 3L8ZA 1UXGA 2AN9A 4JLMA 1VKRA 2HQ1A 4XSHA 1AE1A 1SGWA 2NZUG 3GLSA 2GA8A 4MQMA 4GM1A 3TXAA 4DBZA 1THGA 2WYOA 4YH1A 3RUCA 3S27A 1VPWA 3IALA 3D8BA 1HE8B 1YH3A 3D3EA 5A0FA 5CH5A 4A2WA 5H3HA 2WSSD 5DMHA 2OCGA 4QGHA 1XL1A 4LPSA 4PS1A 1IQUA 4NYMQ 1BH6A 1L1RA 1D5CA 2YZMA 3LO8A 2DCUA 4DCVA 5TMPA 1UDXA 3RT9A 2BGIA 4BDSA 4FFWA 2FPIA 4C0AC 2XWJI 5FQOA 5GOZA 5EJFA 1DMSA 1Z6GA 2DUNA 3R3ZA 2A0WA 3SHWA 3HR8A 2XRZA 3ZX5A 3Q8LA 1X7XB 1OH8A 4JU9A 2VSQA 1H8HD 3DJYA 3GAFA 4TM8A 5AHRA 1O8BA 2AQHA 2Q07A 4N0PA 4TTJA 3ZDYB 3KT0A 1K6MA 1SHLA 1GZUA 4HNVA 1PJ8A 1U28C 3NROA 1YBHA 2HTEA 3TBHA 1U5BB 1YRQA 1E77A 1T24A 1VSTA 4WFQA 2O8CB 3H2GA 1SH7A 3MTJA 3WOVA 4GZLA 2PZLA 1J9ZA 3I30X 1H0KA 5T6BA 3G2JA 3EZ6A 1EFRD 4B79A 2G07A 1LW6E 1NULA 2C9DA 3WGMA 5I7FA 2QNIA 2GF2A 1FLAA 5BV0A 2AFHE 5A5DA 2Y71A 4M88A 5AW0A 4UFPA 1NLZA 1F8XA 3O90A 2WE8A 1S2DA 4MVYA 3KE9A 5CH8A 4YYEA 3QMVA 4MA5A 4ZI2A 3EZYA 4HATA 5AK5A 2EJCA 2Y2VA 2FSFA 4DR7B 1UMKA 2Q6TA 3VZBA 1ZKMA 1JJAA 1D6SA 3B6MA 4M2LA 5B6IA 2HIMA 4RS3A 4LOJA 1M2OA 2O2JA 3MELA 3E3NA 3KETA 4K8RB 2WA1A 3IURA 1N2GA 1XF1A 1MBZA 2XAAA 3OC0A 3IE1A 2C0PA 1UPAA 2FJUA 4MGEA 4BCBA 5BP7A 1N5OX 4B6RA 3R7DA 3W5JA 2ZB3A 3WQSB 4BXOB 3ZNNA 2O8DB 1OSLA 1A8UA 2HLDA 3SKVA 4JBNA 3WB0A 4BKUA 3D4OA 4YMHA 1XZCA 3W3AD 3NDIA 4N6GA 2BPOA 2JG3A 3K6KA 4TQ9A 2HCNA 1KEEA 5BSWA 3C97A 3AUKA 3IODA 5CXXA 2OV1A 2PS0A 3VSAA 1I3MA 3WA6A 4WLUA 1R4NB 3TVDA 1Q19A 1Z35A 2O8FB 2AXEA 3PUKA 4W9NC 1EWQA 4P7JA 2PGXA 3Q9UA 2GTHA 3NHMA 4Q9LA 3ZQ4A 3T94A 2IIVA 4MQBA 3Q85A 2AFVA 2IOQA 5ERGB 4EA6A 3THXB 4RA6A 2OFYA 2QN9A 5ALYA 5ITVA 1QGOA 5CFLA 3RYCA 4RK1A 3G9UA 2W2OA 3IPAA 5TNXA 1KEZA 3DWFA 4GH5A 5I4IA 3AOEA 3QNWA 4Q4AA 2YN2A 3ZEIA 1WPGA 3O8DA 3KQLA 2H4FA 1EBBA 3NDPA 3DVQX 5GAGi 3OF2A 4OKNA 4PICA 2VO1A 4V02A 3G0HA 1LCDA 3SEQA 3LKBA 5AM5A 4ZYTA 5CVTA 2AT1A 4DWJA 5FUXA 1G3QA 1H0RA 1WRBA 4BCDA 3IKVA 4HYTA 3PRJA 4L4UA 2ZYHA 2MSEB 4HDQB 1BCSA 1IXZA 1QYVA 1US8B 3DT9A 3P8ZA 2CXPA 4K40A 3WSWA 2WAMA 3EAFA 4B3GA 2WT4A 1OIXA 10MHA 3PKZA 5DI9A 4P3XA 2IZOA 1FPMA 2C3PA 3T5AA 1G8SA 4LDJA 2GRLA 4ZDIA 5EE3A 1TM5E 5AR1A 4CMIA 2B8NA 5HKOA 3E9RA 1BEUB 5U4XA 2D0PB 5JHHB 1M5UA 1RI4A 1VE3A 3DEJA 1GSAA 1U0RA 2A5FA 3GJ4A 4D25A 1D04A 1XROA 4ENVA 1RI1A 2ZS7A 3B38A 4YPVA 3OCJA 2QTHA 1L7BA 2Z8XA 2E3JA 1DQNA 5ITZA 2ZAMA 5KNCA 5HTOA 3TN7A 1GG9A 3PZBA 2V97A 5EPEA 2X8LA 1N1GA 2WIFA 2Q7OE 2HL6A 4C0WA 1TNDA 1CYDA 3SDBA 4ARVA 5A03A 4WXPA 1J2UA 2PUBA 1PW5A 3KQVA 5K2MA 5KOHA 1WE2A 3A0UA 1XPRA 3NCHA 1E2JA 5DHQA 3FSGD 3OFJA 3H11A 3FCSB 3GRKA 5EKUA 4EKIA 2QRUA 1F2TB 1SCQA 2WSBA 3U3DA 1BOOA 3K20A 3V8EA 2V7EA 5KWSA 1FMJA 1G3UA 4BQPA 4PY2A 4U7JA 3DLPX 1W9MA 3QWIA 3VTKA 1RVV1 3PUHA 4JYCA 3CKKA 4MKGA 4NI5A 2W00A 3LC2O 1RJDA 1ZGHA 2G4LA 1IBLB 2C31A 5JUWA 1FA9A 2WWFA 3F97A 1EVKA 1RLTA 5EVJA 3AP3A 2GN6A 5I9TA 4EPYA 1IQ0A 1HSOA 3UAYA 4QLOA 4G1FA 4HDNB 1ZZBA 3KP1A 3HJUA 2QXUA 1LTKA 3C3XA 1F9AA 2CXOA 3L2OB 1GCAA 1QNLA 2Q5OA 2OAGA 3NMUF 1J8MF 1RIOA 1YB5A 5IVKA 1D0IA 2ZVPX 4JOCA 4EP1A 3ZNPA 4DCJA 4RDIA 5EXTA 1ZEMA 3IR6A 2ZWVA 3EARA 4KLAA 5FD8A 1YFJA 3GGPA 1GV0A 4BNGA 4XR9A 1LK0A 3P0JA 2C2YA 1OZAA 1MOZA 4OQQA 5A7LA 1GGHA 1TGVA 1OX6A 3IHKA 4QXRA 1YQXA 2XEXA 2G0TA 1CDOA 4Q4AB 1ULSA 3ESAA 2E21A 4PQEA 5D1NA 2OGUA 2WTNA 3OPVA 3Q72A 1R37A 3I01A 4BQIA 1R50A 3UJNA 4D82A 2GZ2A 5K3FA 3MYYA 4QQKA 2JIPA 1ILEA 4ND7A 3GGSA 1GN9A 3BM5A 1E9DA 3O8QB 1J56A 4BN4A 4O2BA 1YL5A 4PBRA 1BS2A 1LFAA 5FWXB 1FQJA 4ENSA 3RM3A 2IYVA 5KEIA 5BNTA 1AKNA 1TU0A 5EE0A 2G1PA 5K3CA 3B89A 5C31A 5EMHA 2NVOA 4Q16A 4IFEA 4EB0A 3S2YA 3PKJA 2J08A 1K2WA 1U1GA 4JITA 3B3QA 4WXHA 3KJQA 3GFTA 5DGIA 3WG9A 4LWZA 5C4IA 1F4PA 4K2AA 5HZKA 5JNSA 3NHWA 3OD1A 4CHGA 1G20A 4KI7A 5EZ5A 3EHEA 4FYXA 621PA 4PTLA 2VP9A 1R8JA 4R9NA 3Q3EA 3CF4G 3WE7A 4YXWD 2CD9A 2XZDA 2WK1A 5EP2A 1IAVA 4H1HA 2B25A 2PX6A 5ENZA 4NESA 1OR8A 4MRAA 4DCNA 1MOQA 3UKDA 3PC7A 4WN9A 1T9DA 3PFKA 3IEPA 4HXYA 3BS3A 2EJUA 4ARCA 1E1CA 3T3OA 1KDTA 4AROA 2F17A 1G63A 2P6UA 4DUPA 4YO8A 1JA0A 3NBMA 1NKSA 4RORA 5ALQA 3WL3A 4F85A 2R84A 1WB4A 4WAUA 5GAHi 3KDAA 4H0FA 4H3SA 3GLIE 2HBQA 1J8DA 3A1DA 1RACA 1JFRA 2F67A 4ZALA 3IUSA 3T9CA 4JP2A 3ZGZA 3DV0A 3BFXA 3SJBA 3KJNA 1X74A 1SIWA 1T9KA 4OBEA 4LTNA 2C98A 2XB8A 5JO9A 4PZDA 3UMFA 1A9RA 2A5JA 4W1QA 4DJDC 1W59A 3EK2A 2JLYA 4NVRA 3K1YA 3SLRA 1E7RA 2E4AA 4INAA 4RXTA 5M29A 1SNYA 2ZJ7A 3DFIA 3O8LA 1M7HA 4PG5A 5AM0A 3AL2A 3GZDA 4IUDS 2YMPA 2XD4A 4J4BA 4YR9A 4L0MA 1QR2A 2QE7D 3C5VA 1B2LA 3AUUA 1CW2B 3IKTA 1J97A 3TD9A 5B53A 4PHGA 1GAWA 4JCOA 1GTZA 2ZVQX 5EEHA 1SUDA 3GQBB 3QVJA 5KYKA 4L27A 1PGQA 3A26A 2W70A 4RVGA 2FPOA 2OBLA 1DEAA 5KI6A 3TTTA 2VXBA 3IPRA 1ADCA 1V2GA 2VLIA 4X3OA 4X44A 2XOEA 4IXTA 4EHHA 4ZU6X 1R5NA 5ADHA 1K7SN 3ER8A 2R1ZA 2B92A 3SLGA 5JTTA 3RYHA 2NQ2C 4GMHA 4N5MA 1G17A 2XMRA 4ARUA 4M1QA 2G7MC 3STTA 4GWGA 4RV9A 4K9LA 1E4VA 3DNVB 1ZH4A 2GESA 2ISSD 1NN0A 1UJCA 2MDTA 2WUEA 1N7GA 3OQ1A 1NUUA 4KG7A 5LLTA 1N3LA 5FWXA 1PIWA 2QN3A 3EVZA 3N07A 5F77A 5HGJA 1Q0TA 1LPAB 5DXAA 2WTEA 1SXIA 1YTUA 2BZGA 3AJDA 3UUWA 3PJFA 5EMNA 4WBXC 4ASUA 1R0XA 1GPLA 1U8UA 2NUPA 3B85A 4IXWA 4BRSA 3N7UA 5F98A 1UFKA 1ECGA 1EJ2A 2WR8A 1WQ1R 3OOYA 4CDGA 1U8EA 4O5AA 3GCGA 4X6LA 1IZ7A 2R8OA 3DBLA 3JU3A 3JYPA 4DWOA 3FNRA 3G88A 3QQ6A 1D5WA 3PI7A 1DQSA 4C03A 3THWA 2PMKA 4JVLA 3UWSA 4BNFA 4PO1A 1AUPA 1PZHA 4LGMA 1DKOA 1UCFA 1BMQA 1N9GB 1TU4A 1D2GA 1QK5A 1PZFA 5CLLA 4B3DA 3MD0A 2E6UX 3S8EA 3I2FA 1T5BA 1U9IA 1C3VA 5F1KA 2F8TA 2HO4A 3IP8A 4IHJB 1FNCA 4AUMA 3QF4A 4CETA 5KOIA 1Y98A 2UAGA 2ZG6A 4X20B 1CQPA 3I8XA 3I92A 4RULA 2XNCA 3UHJA 2C84A 4IIGA 5DRYA 1KOFA 1YMQA 2AF4C 2XUPA 4I3FA 4H7EA 1NVKA 3OZWA 4ZQEA 1RRKA 3VTAA 1JG3A 4E6EA 4LRUA 3CYFA 3UUEA 4PM4A 3RO7A 4XM1A 2E9SA 3F6RA 2HHHB 2IEIA 3M6WA 4BYGA 3SBOA 2GETA 3TMYA 4Q1FA 1XEWX 4N7MA 1OA1A 2G0NA 3L8HA 1SR8A 3KKOA 3UATA 4BRZA 5EJMA 4HMOA 5ISMA 1T5HX 2AOXA 3Q6NA 3AY3A 4GMXA 3A1UA 4JB2A 2XTJA 1TKAA 4OQYA 2VP4A 3FYMA 2OBXA 3CV3A 3K1ZA 2AXVA 3NWEA 3OQHA 2VT6A 3MCWA 4RWZA 4TS1A 1KMHA 2G71A 5AOCA 5H68A 4MGZR 4Q82A 3K0BA 3QLTA 3ROEA 1ZR2A 2QMZA 2X77A 3DDCA 3R4CA 3RANA 5JEDA 1LDEA 1V48A 3ANTA 4A0QA 1RRMA 2H9YA 3BH7A 3FNIA 2O8BA 5IKPA 2AC2A 3ULKA 4REQB 4EHBA 5D5HA 1MG5A 5AW6A 4LOHA 4Z7JA 3HFJA 4U2BA 3L7NA 3ELBA 1LGYA 1SURA 2JF0A 3F9RA 3LHSA 3OIVA 3RU7A 1ZUIA 1UZNA 2L18A 1B26A 1OGIA 1Y3AA 4HAXA 2H1WA 4BLSA 5C7YA 1E6KA 4QASA 4HPWA 3UAWA 5LIPA 2ZRDA 4FGKA 3NUGA 4AKGA 2CFOA 3O2JA 4J2TA 3OICA 3T1HB 5K99A 2YKGA 5AKYA 2F43B 4R2MA 3II6X 3ONFA 2HCJB 4Q3NA 3A58B 4X94A 3G2MA 5AH0A 3E2PA 3IT3A 4J0HA 5EAIA 1VSBA 4AF6A 4F6RA 1XMPA 1Y8RB 2DEUA 1TUEA 2GFIA 5CHEA 4Q21A 1NI4B 4N3NA 2WDZA 4K26A 1LJLA 2P4QA 1ZH6A 3AU8A 2DQZA 3IQZA 4RKQA 1A1SA 1VM6A 3ND8A 5JJBA 1QX3A 2OV8A 5HJEA 1TUIA 1SUPA 1ISHA 1N6RA 4XGKA 3BE4A 4N47A 2OA0A 1M54A 4MQEB 4S0XA 3STVA 4HF7A 5DBIA 3DTNA 3CE9A 3TLMA 2ZB8A 3SZRA 2XB2A 1OREA 1NDUA 3NP9A 1YJ8A 5JDIC 1JI3A 3DM5A 5E6RA 2HB6A 1OT3A 3AUSA 3X1YA 1UWCA 3ONEA 1O5OA 1C8KA 4OMUA 1PNOA 2JW5A 4EO9A 1G20E 2WMDA 3IIKA 4X7BA 3UJ3X 3D8RA 3UO8B 1K8QA 3EHDA 2VF8A 4DQKA 1F0YA 2NW6A 2QVZX 3TZ6A 2PMFA 4L3OA 4UJ3A 3ENVA 2FDRA 2WMOB 3FPJA 1VZ3A 3PIDA 4I1YA 4TRJA 4LSZA 3WYNA 2FR8A 5IH7A 4KUGA 2VDJA 4NCJA 4BN5A 4K6HA 1JG2A 3DE6X 5EMJA 2IW3A 2WTMA 4MLDA 3S2FA 2G8LA 2GKSA 2O2XA 2ZRCA 3KQQA 1DG3A 1GOTA 2VDWB 2IHBA 3D4LA 1PR9A 1ZPDA 3HBMA 2FEAA 3H17A 4BIIA 2JAQA 4J1TA 2B2XA 3U4HA 4JJ7A 2DBQA 1IPHA 4LDAA 5KVQA 5L3QA 2W7TA 1DOHA 1FS5A 3HI6A 2YYAA 1HDRA 3QHPA 2QVYX 5F3DA 5IZ4A 4IFBA 2PO7A 3PL1A 3WL6A 4X1YA 3UJ9A 2XY4A 4BKQA 2Z58A 4IEIA 3O2NA 1IQPA 3QE0A 2PWPA 1XSEA 4XIYA 4FFBB 2QYHA 3NYQA 1BHJA 4DWVA 3SMQA 1JIKA 3G79A 3CVXA 1ZS4A 4PG7A 1A9OA 2B3TA 2EWVA 4TWZA 1C9EA 3LMKA 4GS5A 3EFOB 3JQEA 1JLMA 1Y8QA 4MVJF 3TIXB 4ZHQF 3R7SA 1GGVA 1L4EA 1Z2CA 2XXPA 2YL2A 4RKEA 1MT3A 3OCCA 3O8NA 3Q6IA 4QPDA 3GLFA 1GSIA 1W36B 2B5OA 2G04A 3I45A 4L5JA 1VLHA 1ZBDA 4WK4B 1J70A 4R9RA 2GZAA 2CLIB 5T67A 1N5MA 3VR0A 4JHXA 3S6JA 2W2NA 4E1BA 1BFKA 4JX9A 3VH3A 5JBIA 2O0LA 3AR7A 5FUYA 2BHTA 3FDZB 4C2AA 1AMUA 4QPZA 2KEIA 5C1DA 3JALA 4F92B 4MUYA 3T9BA 3KB2A 1NQWA 2GHTA 2JBAB 4JLNA 4D57A 4L08A 4N01A 3KXLA 1EDEA 2P78A 1NI4A 3UXEA 3ECSA 2WJVA 3DB2A 5BMOA 1JFTA 1B76A 3D6MA 2GZ1A 3ZZNA 3I5XA 3KLMX 3T9EA 5FFMA 1VLZA 2FSPA 1A95A 1GG2A 1OWNA 1P74A 4IJKA 1AU9A 3DE0X 5ALUA 5J63A 5FHQA 5JLAA 3P4XA 4Q4LA 1UOEA 1L5SA 2PA3A 3T12A 1UXKA 3WQRA 3I2JA 1YQEA 4KRYA 4WOCA 3HBLA 4KUEA 3HYRA 1Y5NA 1E66A 4MMZB 5SZJA 2Y1XA 3IXMA 4CQMA 8GPBA 3U4CA 2VHXA 2RAVA 4TT8A 3GLHE 4NWIA 5JBQA 3OX1A 4ZEXA 4IEFB 2NLOA 2GM3A 1PFWA 3R41A 1ZCJA 1Z6AA 3MPOA 1LLDA 1N2ZA 3U3RA 4EZEA 1Z33A 3VM6A 2PRJA 4HMQA 2VN8A 1CETA 4ODIA 1B15A 4EQZA 3HFRA 4ZOQI 5ICMA 2PXKA 1G6OA 3KR9A 3PNPA 1L1EA 4IY1A 4NCHA 2RG1A 3EF1A 4JVOA 1SQ6A 4JYAB 1QWSA 2I6FA 4ZYUA 4R2LA 1TJ5A 3QUBA 5ALRA 4NMWA 4OAQA 1QP8A 1UXOA 2R66A 3CLSC 3LUAA 2FP4A 5FR2A 1J0DA 4IYRA 1P1JA 3AB7A 2FUNB 4JQCA 4BO7A 2I5PO 2P35A 3P9RA 3Q5GA 3RJMA 4JJAA 3KOZA 1CY0A 2WIKA 3B1XA 2GCNA 3QUCA 5CDSA 4DLRA 1YUMA 3BKXA 2R4TA 3CB4A 3ET4A 2J3QA 3FMGA 2QBYB 1TJYA 2Z09A 4Q3KA 1Q1NA 2J3IA 4Y0AA 1ECLA 2Z4RA 4X3CA 3PE5A 3PYLA 2ZITA 3QLVC 1RRCA 1CFZA 1EX7A 1U7OA 3P9SA 4OGFA 1BQ4A 1CE8B 1XDGA 3DPSA 1QRUA 2GZHA 3HKDB 1LQUA 2VBGA 5EINA 1AM4D 5BN3B 2IE8A 2FWJA 2WBLC 3G9QA 4FDTA 1KFKB 1NI5A 1NR1A 1A71A 1P6QA 1R15A 4QAJA 5CTAA 1YCFA 3VR3D 2ZYVX 1VFPA 1W34A 2ZAGA 4HK4A 3PFHA 5LYJA 1DCKA 4G0XA 2DQKA 3DVRX 2VKTA 4O4LB 2EGHA 2ACEA 3A6ZA 4MDEA 1FXWF 4ALIA 4H7DA 2LIVA 3MIIA 3UUFA 4HVTA 1E2DA 4IRUB 2IOYA 5K51A 3HVKA 4X5OA 1M72A 4LV8B 5CLJA 2WTUA 1KK1A 1TM2A 2CUZA 3EXHB 1Q44A 2Q4DA 4GYKA 3GZJA 4MUKA 5EZSA 1Q3KA 4G1VA 3MK31 2OOSA 2YWJA 3P94A 5CM9C 4DCCA 3KQPA 4IWNA 3X1ZA 3A28A 3RS2A 4RY2A 1W47A 4QE3A 1VCOA 3F73A 4A1FA 1C4XA 2QA5A 4L9RA 4K46A 3VYUB 4CQJA 1X7ZA 3GPDG 3ZLVA 4ND5A 5GONB 4G5YA 5LOVB 1Z0JA 3QU9A 4L16A 4CN8A 4Z7QB 2I1WA 2ZWMA 4BGDA 5LUAA 1T8WA 3AM3A 4YJHA 2DG2A 1TB4A 2AFHA 1B00A 1QONA 3O4GA 2VSOA 2Z5GA 3DDNA 4PX3A 5EEGA 5B3KA 3K0CA 2UUCB 2XI8A 1XWWA 2VF7A 2XZOA 3KLOA 2V4ZA 4II2A 1U2QA 2HK6A 2Q4TA 3OCXA 3PNBA 4Q03A 1SUAA 1I2AA 4UU7A 4XH9B 1EAYA 2AW3A 2NT4A 2GBGA 2Z56A 5MHTA 5LYYA 4GXRA 2JIDA 4KXQA 3NWOA 5K0EA 1EVIA 1ZH8A 1U2DC 1T4CB 3DDHA 4JQDA 3DL2A 3IR7A 2POQX 3EGIA 2O0MA 1Q0PA 3UMJA 1DCFA 3CF4A 4XOIA 2QMUA 5TPWA 3LQKA 2J0QA 3RFVA 3AEXA 4OKIA 2F8SA 4W1SA 3ITEA 4FDUA 4D8TA 4F2WA 3AF2A 3RAJA 2RH5A 3BULA 4KW7A 4ZWNA 1JDTA 1YAJA 2AEEA 4NPCA 4CMKA 3KCNA 2ASVA 2VNAA 2HRCA 2I78A 3AR9A 3KPYA 3H0CA 3TWOA 3RWMB 4N5DA 3V8MA 3FHTA 1CR0A 5KUTA 3CRRA 1KVUA 1K2VN 3SQOA 1YVRA 3RR2A 1Z2OX 5B2ZA 2COUA 3K32A 4FGWA 4RF5A 1T5SA 3W5UA 5K4HA 3CPEA 2QKYA 5DOVA 5G4LA 2NYRA 1LLIA 1E9CA 1OTHA 3FKSA 3CG0A 4J2OA 3GDHA 3GVCA 1MQ9A 2CJYA 4KTVE 4HUTA 2BUCA 3IKLA 2BKUA 5IM4F 3BQNB 3GRYA 3QI7A 4MGKR 4ZAWA 3WK7A 2KX7A 4DB4A 3UKOA 4ND8B 1SCKA 4TX1A 3PJRA 1QPZA 2LDBA 4H3KB 4ZT2A 1P7PA 3HRKA 4RIIA 3RVOA 3T0IA 4ETIA 2ZAOA 4CEIB 2OBNA 1ORIA 4KTTE 4OHOA 4B31A 5BURA 2CKDA 1GT91 5SY6A 1UJNA 2ZUTA 1LJUA 2QB5A 2QD3A 3C3PA 4AN4A 4D8YA 4CGZA 4TN1A 3RVBA 1EXDA 1HSZA 2VHWA 3E6AA 2N9UA 1JIIA 3ENQA 3S1LA 3Q0EA 3QH4A 4EELA 2N75A 3HV2A 4OQEA 2G36A 4XTRA 3WRXC 5CDFE 1I6KA 4MYSA 5K6TA 2AX4A 1HZZC 1QGZA 4EY5A 2QW0X 1SXJB 3MTAA 2P9ZA 4MUMA 1LSJA 1K3TA 4RH0A 3OJLA 3SN6A 5LDGA 3ZYZA 5CB4B 5IJ0A 1RD4A 3P5BA 4PEVA 2DT8A 4P93A 4PZUA 4RLQA 2D8MA 2EFJA 4HB3A 4XA8A 3W6UA 3L5OA 4L4RA 4MV1A 3G02A 3E58A 4RF4A 1LCIA 4RA9A 4ZCLA 1JEEA 1TZJA 3T41A 4JSYA 2D0DA 2R68A 3EFBA 1HLPA 2VAMA 3E70C 5L3VA 2H2GA 3MMPA 3P9QA 5AVSA 1GLGA 3A6KA 4ZOCA 1U1FA 1UPBA 2XA2A 3ACDA 4IS2A 3ZWBA 4RHUA 4ZN6A 1P81A 4L72A 9LDTA 3TOZA 3LHIA 3O9MA 5AHKA 2J33A 4JLAA 4NZPA 3ECCA 3L9WA 4YCMA 1L8OA 4OX9B 5JJ5A 4WBNF 1LSUA 3EOZA 5AVOA 3KYCA 4HAYA 3L6DA 4XGIA 1NX9A 1IXYA 3JWHA 1QANA 3PA8A 5TR9A 2VAWA 5K3EA 5DYWA 5FB3A 2G0AA 4BXOA 1D2AA 3ABZA 3MAJA 1C41A 2J5RA 4OFZA 2WUGA 3JSAA 4R69A 3RUEA 3OZXA 4CJXA 5JD6A 1H23A 4CXMA 1RKUA 2G80A 3TJRA 4FMBB 4I1IA 3CA8A 1EQUA 3BERA 3FX2A 3LGSA 2C2MA 2PEYA 5C32A 1SBZA 4ZREA 4N82A 3BRWD 4DDWA 4EJMA 3VC2A 1EGVB 1IB6A 3JQAB 4WTOA 2IH4A 3EWIA 4L5AA 5HW0A 2X0NA 2O14A 3AESB 1RQ2A 4WRRA 3QFSA 4YPFA 1KHTA 3EBLA 4F8DA 4ER5A 1JHAA 1PG0A 3W7AA 4CZ2A 3KQOA 2PH3A 4KPUA 2IXTA 4RVHA 2FPGB 4XLLA 3RYCB 1E2KA 3OEWA 4I7EA 1VJ1A 5LVAA 5LZ9A 4OYLA 4ZXPA 1NFRA 1Z0AA 3DZFA 1AX9A 1E3JA 3FTFA 5E2BA 4DDVA 1GSHA 1OE0A 1SRQA 1UC4B 1XP8A 2LPMA 2O0JA 2NO1A 4PRLA 2ZIVB 1Z74A 2Q2VA 3OE4A 4DLNA 1H2WA 5FBRB 2EL7A 3L7DA 3CLVA 3TFWA 3GBFA 2GYYA 4NHEA 3ENKA 4QBFA 5DO9A 5JMTA 5U9CA 3FZYA 3L1PA 3LX8A 4X61A 3JXDL 3DZJA 3VHLB 4C3ZA 3NP7A 2XTMA 5JH7A 1LK7A 4JENA 4PLVA 1L7NA 2O19A 2UZ3A 5EIBD 1ZISA 1VLLA 1VL2A 3DYBA 3K7EA 3O4HA 1B0ZA 4M1YA 4BWYA 4CKBA 4ZO7A 5DJ5A 4PGAA 1R64A 1SCAA 3VYTB 2VZEA 4I4NA 2XOXA 1EGAA 2R6JA 1SBTA 3AW8A 3CTPA 3HDYA 4NJOA 4Q1BA 3PV0A 4ZEVA 2A7QA 2I7VA 4GL2A 4QYMA 4B3BA 1OFTA 4F21A 5HFJA 4MWEA 1TT7A 5EJ5A 3HJAA 1S7GA 3D3NA 1RHRA 4G9EA 1RBQA 1V96A 1W88A 4NU0A 3DHYA 2F1IA 4Z1MD 1T2UA 4Z6KA 3OTHA 5KQMA 2B30A 5FOQA 3E9ZA 4TTVA 5F7JA 2P9QA 2GLUA 4B3XA 1YZ3A 3G85A 3T34A 1XFAA 3KQYA 3K6SB 2XECA 5ILOA 1EBUA 3S2UA 3QFCA 2DBVO 3QKSB 1ECPA 1A1VA 4FYPA 4MI1A 2WINI 5A6SA 2HBZA 4ZVLA 3CEHA 1P7YA 3WXMA 3RTAA 3WFJA 3CLKA 2HEGA 2JGDA 2VHJA 1KBZA 2J0UB 4BZWA 2GN1A 4F6CA 1C1XB 1PJCA 4JH0A 1SN7A 4M1KA 3GVPA 3ZY4A 3PRKE 2PX0A 4B7UA 2I2DA 1VMIA 4HXGA 2W2LD 1UBNA 2YJTD 1XGKA 2C7BA 3KEFA 3WWCA 5JS8A 4UM7A 2ZB7A 5CDGA 5DCYA 1UKVY 2WWGA 3GVXA 3L8DA 3L7CA 2BFFA 4OFXA 4KWTA 2VSFA 3AB3A 4Q00A 4UUOA 2PUAA 4IM7A 4ZQHA 5F2NA 1N7HA 3DBRB 4FKBA 3ZH9B 1L4BA 4URVR 3VU9A 5CB6A 1NYRA 3DOFA 4OHWA 4WZBE 3UW3A 1W5BA 2HLNA 4RADA 4CI9A 2JLVA 4MR9B 1D6JA 1SQ5A 3FMPB 1JQKA 4P80A 1M3SA 2Q2QA 2J9RA 3KRTA 1N6KA 1DJPA 2F1HA 5ALNA 3HN6A 5E0OA 3FR8A 3BJIC 4Z54A 3HU3A 2PQ0A 2QD1A 2VRCD 4A36A 4YV7A 3BQ9A 1OH6A 4I6GA 2NU6B 4QUHA 3GNQA 3PTZA 1G18A 1JW9B 3F3KA 3PR3A 4N1AA 2AQ8A 2QX9A 2GD0A 2VHCA 3O26A 4PFKA 4PWYA 3TINA 4XPIA 3IE0A 4WXMA 2V5UA 2JKYA 3KOWA 3LUGA 5CYGA 1Z7GA 2QI9F 2QMQA 3BSYA 3PHJA 1WPQA 1U65A 3HBAA 4B81A 4CM8B 3FJOA 5J4KA 4DQUA 2R62A 3QMPA 3HWRA 4Y2HA 3VR6H 1XALA 1I32A 3X43A 4KZKA 2PWBA 1PJ2A 1SEVA 1PR6A 4EX7A 4F93B 5FBVB 3DB1A 2X3FA 3BXEA 1EDZA 1WUIS 4IICA 3QLJA 3C1TA 1Y1QA 4RK6A 1T5OA 5KYXA 1GAXA 1ZAYA 3ROPA 1J8VA 4TTRA 1XI2A 4WIAA 4C76A 2HCSA 3R5HA 5TQ2A 4YYZA 1R6VA 1WSBA 4WGGA 2CE7A 2IDKA 3OPNA 1MJNA 2HRRA 1LDYA 3K1AB 1N2IA 3VO2A 2ECPA 3WP1B 4REMA 3RHSA 4PW0A 4AF7A 4US2R 3ZKWA 2FJRA 2ENUA 1MFPA 1SPXA 1M6EX 1W5TA 3JZFA 4NS1A 3SM9A 3PPIA 1GKKA 2HU7A 4GR5A 4C2BA 3S55A 4LECA 4Q3BA 4C2UA 3BYZA 4WXYB 1ZH0A 3LSYA 1JHZA 1ODIA 1ATIA 2R6FA 1RP7A 5LBTA 4BO4A 4EO4A 3UGJA 1Y3FE 3NAMA 2YN4A 1RHQA 2VYCA 2ZRNA 3BGOS 1MCZA 1II8B 2RHHA 1T9CA 2VDPB 2YC4C 4HQ0A 4M7PA 1LS6A 2NZVG 4ZOBA 3EA4A 2BUAA 4C7MA 3LWNA 4ID9A 2ZIZA 5L6LB 3FNQA 1OF1A 2FUG1 2HHAA 1UBCA 3P2YA 4FVTA 4NFHA 1Y5IA 3ZHMA 2GASA 1JDJA 1ZRSA 1OX5A 2Z8YM 4GRAA 1T3TA 1XNRB 2AV6A 2VUIB 1EK6A 5FLKA 4WE3A 4O3MA 3KR2A 4W4TA 1SIBE 1R9NA 1N6OA 4ZOLA 5KAMA 4BMXA 2FQYA 4P8RA 5COQA 2YICA 2C29D 3AQ4A 1U7HA 3FPEA 3PNVA 3U62A 3EDRA 3X2FA 1K6JA 5CLFA 2O8EB 3EIEA 1A5TA 2RI6A 1H66A 2EW2A 3IVCA 3JQCA 1IBCA 1FDOA 1MDBA 3FUVA 3QQPA 1IEXA 2F8LA 4JC0A 3C3MA 3GUVA 4K9NA 1BJRE 2BRUA 3F0TA 1TQ2A 2E1RA 2JRLA 4ROSA 4WW0A 1NP6A 3G2NA 3I76A 2WVGA 3P9YA 2ODQA 1SD5A 1XRJA 1XQVA 2Q2WA 4TRNA 5ICCA 3KKPA 3GQBA 2J3EA 1YC2A 2LNMA 2R7NA 3QUSA 1PT9A 3O47A 2AA3A 3OUZA 1JDBC 4QICA 3UWDA 3PLAE 3ESZA 2FW8A 1CJKC 2GPNA 3GX1A 2RHWA 2P3QA 2QMYA 2EJTA 3AR5A 3DW1X 3V34A 5EQFA 4WCVA 1M5TA 2JGEA 3H6HA 4JI4B 4NZYA 4LVNA 4HC4A 5DZSA 4OBBA 3KEMA 3ZCPA 3VPBA 2R2GA 1KJQA 1U4OA 4FGZA 4LI0A 4OJKA 2JLSA 3OIWA 4U7FA 2EERA 4UXHA 5BPFA 1DX9A 3TW0A 2PUFA 4P4GA 3V46A 1Z4MA 2R2AA 4JUIA 3UK6A 4QLAA 5LZ2A 3VR4D 5AKIA 1KMIY 3IS3A 2NPIA 2VDMB 3G68A 4PLPA 1QZZA 2B2CA 1T25A 3KYDA 2M1ZA 2IV3A 3AEZA 4W6ZA 3L41A 5JFOA 3URKA 2OO7A 5L45A 1NJ6A 4S24A 4UQLA 3A27A 1GGJA 2DPGA 2ZYIA 4DPLA 1LK5A 1QC5A 2IX9A 4MAMA 2OOKA 3MAGA 3GA7A 2O2CA 3LNCA 3O3CA 4DG5A 5DEIA 1EFPB 3FOEC 4HLUA 3SM3A 1IRIA 1XAGA 2OC4A 2OL4A 3K1AA 5DIFA 4QUDA 1L5MA 1YR9A 3TLBA 1XKXA 5EOVA 4B09A 3ETEA 2K87A 4FHDA 5FUQA 2F1OA 1K5DA 2V3VA 3A7EA 3FUXA 4AYTA 1LBIA 1I4OA 1NVWQ 1WD5A 2CUNA 3ZY3A 1LSSA 3H2KA 4ZRMA 4NBTA 3FI9A 5L6MB 1V3UA 4HX9A 3SFVA 4KR7A 1XZBA 4YJ3F 3QVKA 4ZCPA 1YZVA 1MC5A 4NPAA 2G6TA 1BWSA 2BONA 3IMKA 4X20A 1Z4QA 3MFQA 2BLLA 2BZ1A 1MB3A 2VDVE 3LUCA 4O4HF 3GIWA 4WLNA 1U0SY 3BDVA 2IDZA 4TMWA 1T0BA 2C99A 2GS9A 1HORA 2O3RA 4B45A 2YHUA 2FB9A 3IB3A 1SXQA 5B7PA 3KXPA 1W6RA 3UM9A 1Q7EA 3COJA 4U7GA 3ICCA 2ZE7A 1J09A 1I4LD 4K9MA 3CJQA 3R3JA 3TRJA 1JQDA 4YRAA 4MCTA 4L2IA 3T4UA 1NN1A 3ZNOA 2DT5A 4CLOB 3TW4A 3L0SA 2FQ1A 4G24A 4KR0A 3U0VA 1EGQA 4UASA 3CUEF 2AW6A 1NC1A 1QLHA 4E51A 4C7OA 1PKXA 1ZJ6A 2KBEA 1BEZA 1KZ9A 3M4ZA 2ZSIA 3V4LA 5C8ZA 1I7QB 3KKKA 3P0IA 1HOTA 2X58A 4B87A 1DWOA 4J07A 3TOCA 2CXRA 4JB3A 2Q4EA 3ZU2A 1WXIA 2VHZA 4QYIB 5BRNA 1M2WA 3VXKA 1FUUA 5I7SA 2VKQA 3IOBA 2A1IA 2TMGA 1C4WA 3W8RA 4EVRA 1XEXA 1YL7A 2PRYA 1SG9A 5HILA 3FOCA 3T7DA 2C00A 2H1OA 2H63A 2B4YA 1TVCA 2WU0A 4HO1X 5TS3A 1L5NA 4PC6A 1P0PA 5AW9A 5D3MA 4M76B 3TM4A 3KOOA 2D1RA 3I2GA 1QCDA 1WH8A 1VFNA 2EKLA 4KWIA 4KO2S 3TUJC 3OFVA 1GPJA 3PT5A 3MIZA 3VR3A 3USZA 3ZE6A 2CL7X 5E9QA 1RQPA 1FQWA 2OXEA 1S3IA 4JEMA 3ITNA 3P97A 4WGFA 5TMDA 1DC5A 2FN3A 4EHFA 3PE4A 5KX5F 1K7FB 4OHCA 3VR2A 1XZMA 2J3JA 4BO0A 4R01A 1ZZ9A 4RPLA 3M9WA 3OOSA 4HLCA 2HUPA 4CKEB 3RS7A 4EYSA 3H99A 3PYXA 4YTEA 3RDPA 3VAYA 2EKZA 3HEBA 4ZIRB 1EWYA 3G2HA 1VPVA 2OPHA 4CQLA 5EWLA 2I3AA 4MR8A 3WLNA 4CMEA 1UT5A 1AV7A 3FFXA 4QEDA 3BGSA 1DL5A 5KJEA 3ZTWA 4OLBA 3E3MA 1N75A 1TW2A 2I1LA 2YIDA 5HKAA 2JEZA 3PUVA 3O8OA 4E5DA 4NBVA 2D00A 4AJ9A 1IE3A 4G0VA 1O95A 1QO0D 4K3VA 5F64A 3ZD9A 4DYVA 2APJA 2XVZA 3JYOA 1UBUS 4OXIA 3ETLA 4Z49A 4C3UA 1M8FA 4U00A 8AT1A 5HS4A 1MUUA 2W4QA 5E6RB 4B9AA 4P5DA 3UJ8A 4B74A 3B1ZA 1GL3A 4F5WA 3EVTA 3FETA 4YIKA 2I8LA 2WZQA 2HHJA 1BHQ1 3EC7A 3F52A 1GY8A 3I04M 2IY7A 1Y5LA 4D5GA 2GZRA 1KJZA 4OY3A 1IJBA 3TO5A 3ZCVA 1UEXC 4IDEA 2FVYA 2PE5A 1HG0A 4FNOA 2IW1A 4R1QA 3BE5A 4WACA 1MFZA 5BSUA 4IV8A 5T64A 4K0RA 1XT6A 4M98A 2QUJA 2V7WA 1PGNA 3A6GA 3FN4A 1YU9A 2EARA 4A82A 4F3YA 3FLMA 5JDIA 3EMKA 5AJHA 2BH9A 2O6HA 3HHEA 3GRVA 4OP3A 4O2AA 4KWEA 4Q05A 2PXBA 3T1OA 3EXG2 3TZQA 2CJXA 2VF4X 1HI9A 2XTZA 5ECGC 3MTIA 5HWSA 4H1VA 1JTFA 3IX7A 4TN5A 4LV5B 4H3VA 4KRXA 1R9JA 4TUYA 1KI3A 1NFFA 1PBTA 4TSRA 4EJSC 3KWLA 2JIZA 3HEAA 2BKLA 1PS8A 1Z4PX 4QGFA 1R27A 1OIWA 1NP3A 4P84A 1MT0A 4AMGA 4A8JA 1G21B 1P8AA 4JLWA 1XMOB 1ODLA 3NHAA 4QYIA 1LBQA 4ZJZA 3WGNA 1PRAA 5AI8A 1KRXA 3SXUB 3AVTA 2PFGA 1Z28A 2G28A 2VZ0A 4PC1A 4WQMA 3WLFA 5LU9A 4FKZA 1YVDA 1JAYA 3H6KA 3DGFC 2MYPA 2VXYA 2JLXA 2G25A 2DR2A 3VNBA 3BIOA 1XNHA 3PQ2A 1PZXA 3DAPA 2WG0A 3GLTA 3Q3HA 1UF9A 1KEWA 1L7DA 3UT5A 2B1IA 2F9FA 2Q5IA 5CGQB 3UFXB 4E5MA 1I94B 4OLHA 4L8VA 1UPFA 3R1FA 1C9YA 3QI2A 2IRWA 3R6LA 3EASA 3HSSA 4YNBA 5E1BA 5U1PA 3VVCA 4E4YA 4EUFA 3FOAA 2JB9A 4GKAA 2O2YA 4ITVA 3U80A 3DAFA 3QFRA 1Y4ZA 1ULZA 4ZIRA 5KNCD 5EUCA 5K0NA 2W42A 2VHTA 1C2TA 1MAHA 2XUFA 3ZDAA 5LP1A 2EQAA 3NLLA 1FLDA 4IDNA 3DHEA 2VHQA 1H9AA 1H6DA 2BGJA 3EA0A 4Q1DA 4UNRA 1L9XA 4MAFA 4KQGA 5H16A 3NWJA 1H22A 4GF5A 1DEHA 2PH5A 2HF9A 3THXA 4XXHA 2IPNA 5A4IS 3KAPA 2RG7A 4LQCA 4LS3A 3QPBA 1SB9A 2CDNA 2W2VA 3C6KA 3CB2A 1VDZA 4N8EA 4PX2A 5G0TA 1VE1A 1OWOA 4YS6A 5CT9A 4QDXA 3GJYA 4MWBA 1NSTA 4N18A 1OVGA 1GPBA 2DSNA 1B74A 2NXNA 3C3EA 5DIZA 1Z29A 2EATA 1X0XA 5IU6A 5LQRA 4UOEA 3DAGA 3ESDA 4K6GA 4KU4A 4UQPA 4ZKDA 1UC5B 1VECA 3L9XA 3OQVA 3OJ0A 1FJXA 2DQYA 2JGFA 5D00A 3HDVA 3GJZA 2ORED 3FF4A 4X4EA 2YCLA 4K9PA 5L95A 3TDMA 4J90A 4R1TA 4DSAA 2CKMA 4O4IF 1GUAA 4P0QB 1O95C 1KORA 5MFPA 4F04A 3WGVA 3NO4A 3BA1A 3DNMA 4IDHA 1JG6A 3AU9A 3CLCA 1E1MA 1EP3B 3GIDA 3R0XA 5JS2A 3VI3B 4N49A 4ESEA 4BMPB 2BF4A 2MWMA 3OLWA 3W1WA 4B6EA 3HVJA 3QYFA 1HEUA 2JHFA 1DBWA 3KOYA 5AQEA 2YNMA 3MJRA 1KJWA 1NEQA 1WULS 3G1TA 3HJHA 1SZCA 3QKIA 4B0OA 1T1EA 4F9TA 5JAZA 1T2NA 1KERA 1XZGA 1Z2NX 3DCNA 1RM3A 3BQMB 4YUYA 3PPVA 1EFLA 4QQFA 1FZTA 5E2IA 4RTOA 1M6HA 9GPBA 4Y7CA 4GBMA 3PC6A 1FBNA 3ZE0B 1ULBA 2P9GA 1UPTA 4P3YA 1T1GA 1VYHA 1GDHA 3KV1A 1YMVA 4EYKA 1NIPA 2WZBA 3KLBA 3U1TA 1NQOA 4BMOB 1FFXB 3S99A 1KKMA 2L8NA 3G49A 3MGGA 1KNQA 2G70A 4J16C 4Q9DA 3V1UA 2BR4A 2FWMX 4MI3A 5JW6A 1Q6ZA 1VSQA 3SZMA 1FRNA 4QYXA 2X8JB 4Y8VA 3QLVA 2C3YA 2OZLB 1QV9A 1US8A 3ILSA 4FHEA 3T3PB 1X87A 2ACVA 4DA4A 1I0IA 2ETXA 4IYJA 4I8XA 3GGJA 1YZYA 2H0RA 2MSLA 3I9KA 3VKHA 5KZMB 2A5LA 1SVNA 4NFSA 4HOYA 4NBLA 1A0OA 1O08A 1U1CA 4DA9A 3DE5X 4PCUA 3SFTA 4NYIR 3L1KA 4CR6A 1HDXA 2CCKA 1MJHA 1QM5A 3L1VA 1Z68A 2CUKA 2ZB4A 4I66A 3ZZUA 4O33A 1DAIA 2FWIA 2UKDA 2VH5R 3E27A 4RVOA 4Z3DA 3S0JA 1R0LA 5LOVA 4PPYA 3VGPA 5JAOA 4OL0A 2J0SA 5FOTA 1DXYA 4JUBA 3ZR4B 3C4JA 2I0FA 5IC4A 3A9WA 3MS4A 1V1MB 3WDLA 5ALJA 4TMVA 1Q83A 2BEKA 4UPDA 3BRWA 3UG7A 2FP3A 2E6KA 5J2TA 4O4JF 2ZJ4A 3OZIA 3JAMA 1MTOA 2X5JO 2YWBA 4UTXA 3CZAA 2GAJA 4B43A 5I47A 2AXPA 4KYUA 3UAXA 4ZGGA 1GZ3A 2X9NA 2HJWA 3N8NA 5DGCA 3EAGA 2BUBA 1Z5UA 4IIUA 5FNVA 5EJ4A 1M6NA 2GT1A 4I99A 1NE7A 3B6ZA 4LBYA 1U8ZA 4RHCA 1NE2A 2VYND 3GJ8A 1FX1A 1OD6A 1P2DA 1ZZCA 4GZMA 3VNUA 1P7CA 5KINB 1V9CA 2IU4A 4BO5A 1J1IA 2XTAA 2M6KA 1AGXA 4Q48A 3FROA 1VLJA 5ARCA 1T9BA 1BDHA 1ZUWA 3L18A 2XMSA 3RC8A 4UNPA 2IU3A 4EMUA 1NW3A 1JGTA 2OV6A 3PD0A 5D84A 4ZC1A 4C7KA 4RK5A 3BBPA 3JR3A 4CM1A 3GEIA 3B60A 3BWVA 1T9ZA 3HCBA 1ZJZA 3MTBA 4UHCA 3VMMA 3REFA 3SKXA 3OM8A 2ZK7A 4XYMA 3M82A 3C7KA 2WNSA 2R63A 4NKRA 4ANFA 1RPEL 4C4XA 4IIJF 3OJXA 2H1FA 2AMVA 3O3NB 4EHDA 4WSOA 1XD9A 3WNQA 5FL7A 2WQ6A 3W6PA 3HKEB 1SOVA 1E2QA 4WLEA 3MRSA 3QXXA 1Q95A 4Q4JB 1HE5A 2G1AA 2RBKA 1Y6ZA 4MEBA 2ZJ6A 2PUEA 2IPMA 3GVIA 4OJQA 4ZYVA 4XIGS 4HZUA 5JS1A 2I4MA 2Q5CA 4HXEB 2D2VA 1ZK0A 1Z7EA 4X4BA 1EE1A 2FVXA 3KZNA 2O8VA 2QV7A 3OKAA 3KKEA 5E8JA 3O8BA 4M1TA 4OB4A 2X8JA 4REOA 1WU7A 2A1UA 1QYXA 3IQDB 1DBIA 2I99A 4I36A 1XAHA 4LRQA 4LVOA 2QTBA 3AEKA 3AKEA 4IS3A 2ZTLA 1Z82A 1J49A 4FR0A 4OBXA 2QGNA 3E15A 3PGVA 4DJJA 1ZD8A 5ES3A 4F8EA 1DLIA 2JNWA 1KO4A 1U90A 3HYSA 4V24A 3C5EA 3WGOA 3L7MA 5CCDA 2VDOB 3GRZA 3VBEA 5ES4B 3FWYA 2GUWA 4M49A 4RMNA 4QHYA 1SKUA 3OKPA 4XWWA 2OT3B 3VH2A 3CUYA 1KOLA 4J4TA 5IVDA 2OO5C 1IEQA 4GRIA 3ONVA 3YASA 3F8SA 2C2GA 4B3JA 1G20B 3MA0A 3VYVA 1SVUA 2AI3A 2IOFA 4S2EA 3QPDA 3PQ3A 1HRKA 4R9SA 3ZGXA 3M4XA 1F0KA 2EX4A 1ZNZA 3RLFA 2AZTA 5AXAA 2LCIA 5B3LA 2PKQO 7ADHA 1T9GR 4GVXA 1UPXA 4ZDWA 3RYHB 3DVAB 4Q7QA 4QNNA 2C2OA 5EP4A 4D0GA 4CMCA 2R7LA 1H3NA 2CE2X 4KYVA 1CCWA 1J07A 5EHGA 1MX1A 1H5QA 1HM5A 3EPHA 1N32B 3P32A 1LS1A 2EX1A 1EDDA 5EIOA 4OGGA 2FQXA 2PXHA 3JQFA 3NCTA 2FZVA 3D5EA 1WPXA 3IAEA 4NR0A 4QYSA 5AIBA 4MRRA 1GR0A 2DOKA 1AKTA 4IPTA 4R1PA 4GC9A 4YCDA 3CCCA 4BVEA 2ONKA 2VWPA 1QRAA 4JIGA 1MX9A 3KUDA 3TSYA 5G53C 3KSBC 1OI4A 2QN1A 1QZUA 2YJGA 3ZEAA 1C7EA 2ZUWA 4NY1A 1P1CA 2QW1A 4L9AA 1M1XB 4QODA 2C9MA 4ZVMA 1Z8HA 1CJTC 3OX4A 4KMOA 2QRMA 2R86A 1FUKA 2WYVA 1K3FA 3DE3X 1B6TA 5HF9A 2Y4NA 5C7IO 4YJKA 2CNWA 4HN2A 2NSHA 1JPNA 1ZCAA 4M6WA 3WRVA 2R44A 3UVEA 5B7GA 4PZ0A 2EG9A 5IC5A 4LJ9A 4C0BA 2Q5JA 2P0YA 1FJ2A 2QY6A 1VCMA 3EDMA 4I5FA 4JJ6A 4L4YA 4HMPA 5FXMA 3P9KA 3QVUA 1U1IA 4WUTA 5IVIA 3ZX4A 4DR4B 2TECE 2WABA 3NQ41 4LSMA 2ZYSA 2Z30A 3E23A 1A9ZA 2I6QA 2JLUA 2H16A 3PPWA 4B3CA 4BZQA 4I1SA 2ORYA 3I52A 3U60B 3WHLA 3KG2A 1P2UA 2BV3A 2BGWA 2HGZA 2XPCA 2ZJAA 3GI1A 2FRDA 4I1UA 4UAGA 2WD8A 2VK8A 3WP0A 2L19A 2BFCB 3N39C 4RZIA 4L4ZA 2EGGA 1XDWA 3DVLA 2YWFA 4OGKA 4QO8A 3QWHA 4ZO8A 3AG5A 4PONA 3HO1A 3IBTA 4GLLA 4BNJA 2AG5A 3CECA 1QLJA 3V8PA 1COWA 3AB8A 5DCWA 5IWCA 1BCRB 2XYVA 5K0SA 1P91A 5ILQA 4I5EA 5E7QA 2Y6VA 3KZKA 2PFSA 3IILA 1C4KA 3KV3O 1A04A 2SHKA 2JFFA 4HNAA 1CQIA 3OUTA 3TNJA 2IITA 3EGXA 3OZBA 4JDPA 2CNWD 1Y9JA 2QRGA 1L9KA 3TSOA 2AI2A 4GECA 4G0UA 1EFTA 2W6ID 5F5LA 5TS2A 1HE3A 1DVRA 1ZNWA 4JVMA 1N5KA 3EIHA 4Y6SA 2JFYA 1PJSA 4H6WA 3BMQB 2OVBA 4RYLA 1BQEA 3V8RA 4Y9UA 3ZW9A 3RFXA 4ROTA 1MIOB 3R6DA 1SOWA 3G0IA 3ORFA 1W4CA 1A9XB 3H0KA 4L4SA 4CLXA 3I12A 3PENA 1C1XA 4KXFB 4QA9A 3WADA 3WISA 2YXDA 1YJBA 5LM3A 1JMVA 2REOA 2FHPA 3WLJA 1CVIA 2CC2A 3N2KA 5BWMA 5IXJA 2XQIA 2PGOA 2VAVA 3DG9A 4E0BA 2OBMA 4OSPA 3HEMA 3IT2A 1XTZA