5DTQA

Crystal structure of dot1l in complex with inhibitor cpd3 [(2,6-dichlorophenyl)(quinolin-6-yl)methanone]
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
328
structure length
320
Chain Sequence
LELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMENYVLIDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTNTRPSTGLLRHILQQVYNHSVTDPEKLNNYEPFSPEVYGETSFDLVAQMIDEIKMTDDDLFVDLGSGVGQVVLQVAAATNCKHHYGVEKADIPAKYAETMDREFRKWMKWYGKKHAEYTLERGDFLSEEWRERIANTSVIFVNNFAFGPEVDHQLKERFANMKEGGRIVSSKPFAPLNFRINSRNLSDIGTIMRVVELSPLKGSWTGKPVSYYLHTIDRTILENYFSSLKNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone-lysine N-methyltransferase, H3 lysine-79 specific
publication title Optimization of a Fragment-Based Screening Hit toward Potent DOT1L Inhibitors Interacting in an Induced Binding Pocket.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 103
structure length 320
sequence length 328
chains with identical sequence B
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2015-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08123 DOT1 Histone methylation protein DOT1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.60 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) 434 Repressor (Amino-terminal Domain) 5dtqA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5dtqA02
2PT9A 3M4XA 3E8SA 3FUVA 3G8AA 3HM2A 3PX2A 4XCXA 4DM3A 2IH2A 3SR4A 1L3CA 2AOTB 4CTJA 3O7WA 2FK7A 3LBFA 3K0BA 1I4WA 2OY0A 2OKCA 3EGEA 5E9QA 5GP1A 3KQQA 1YZHA 2NXCA 3P9CA 2NP7A 4P58A 5B1SA 3TM4A 1ZG3A 2ZIFA 3G8BA 5DSXA 1JQDA 1T43A 5FCDA 1JTFA 3IEIA 4E30A 5K8VA 5KYGA 3BGDA 4CTKA 5EMLA 2EX4A 3VSEA 5FADA 1FP2A 3BKXA 4E2ZA 3H2BA 4PYOA 5LQRA 4C06A 3T0IA 2O57A 3QOXA 3KPVA 5GOZA 4PONA 5ICFA 3C6MA 9MHTA 4YUYA 3HCCA 1F3LA 4PIMA 1N7IA 1VL5A 2ERCA 3V97A 1JG4A 3KR1A 2OYRA 2XVMA 3KQVA 2R6ZA 1M6EX 1X1DA 3DUWA 2IDKA 3MAGA 1DL5A 3NWEA 4FP9A 1QAMA 3G5TA 3TQSA 4DCGA 4E2YA 4FS8A 3FTEA 2EJTA 2GA9A 3GNLA 2PJDA 5EIFA 2ZVJA 4YUVA 5CCBA 2WA2A 4PYJA 1DUSA 2GB4A 1EJ6A 5F2NA 3RW9A 3NWBA 2P40A 3TM5A 3OZRA 5HOQA 5CCXA 2HV9A 3NJRA 2HTEA 4ISCA 3BGVA 2QYOA 4AZWA 1FBNA 1KP9A 4YV0A 3K6RA 3UWPA 1WY7A 2B3TA 2P7HA 3LECA 3BXOA 1JG2A 3HCFA 4PYMA 5D1NA 3OE4A 5EEHA 3A7DA 2N47A 3I5UA 2O0LA 2YR0A 5D1HA 3UJDA 3MB5A 4XUEA 1O9GA 3R9XB 3EEOA 1RI1A 2FPOA 5IH3A 3E7PA 1SVUA 3A26A 4RTRA 2QRVB 4Y30A 1EIZA 4QVGA 4YUZA 4YUWA 2ZCJA 3KQWA 3UJBA 2UYCA 1R18A 4O29A 4C08A 1RJDA 1YB2A 3HCDA 4X63A 2FRXA 2AOUA 5E1OA 4Z2YA 4ER6A 1XCJA 2AVDA 2QE6A 3SGLA 3DLIA 3ELUA 5E9WA 4X41A 3B89A 3EVGA 5GIPE 5K05A 5KS2A 4PCLA 3EVEA 1SUIA 4U7TB 3TMAA 2AZTA 3BWMA 4P7KA 3KQPA 5LQNA 3A7EA 1L3BA 3HCBA 2AOVA 2C7RA 3G89A 3ID6C 2IFTA 1NBIA 2UYOA 5CUQA 2NXJA 4C03A 3FRIA 4GEKA 4DQ0A 1VBFA 5GWXA 1WS6A 1ZKDA 3C3YA 1WXWA 2P3LA 5KVAA 1EQAA 3CJQA 2EFJA 2LD4A 3HVHA 3NTVA 4L7VA 4A6EA 4CXMA 4GQBA 4CKBA 3I53A 2GAFA 4RTKA 2PX5A 3G2PA 4V0QA 1R8YA 3KPUA 4F86A 4X60A 5EG5A 2QY6A 4EKIA 3R6TA 1YFLA 3FYDA 3F4KA 3OCJA 4OA5A 3X0DA 1JSZA 4V0RA 1ORIA 2CL5A 2K4MA 3ORHA 1NW3A 4GBED 5K0LA 1R6AA 1ORHA 1KR5A 3GU3A 1R00A 2ZIEA 5EGSA 3FPHA 3O31A 2FCAA 2ONYA 2P3OA 3Q7EA 4K6MA 2PWPA 3KHKA 5E8RA 2NYUA 4FSDA 4RVDA 5BXYA 1RJEA 4X61A 2IP2A 3KR9A 3KU1A 1EJ0A 1UIRA 3M6XA 1UWVA 3PX3A 4RTOA 1XCLA 1H1DA 1Y8CA 1UFKA 3DMFA 4GOND 5HIJA 5EMMA 4OQEA 5FHRA 1RI5A 3FZGA 4LG1A 4OX9Y 1HNNA 1JQ3A 3HCAA 10MHA 3EVBA 3GXOA 4F85A 2PKWA 2AOUB 3BWYA 1SG9A 2ZIGA 5P8WA 1NKVA 4PYLA 4ER0A 2R3SA 1WG8A 2XYQA 2EG5A 3FUUA 3GJYA 5EZQA 2AR0A 4RYLA 4GF5A 4OBXA 1XVAA 4WXHA 2PBFA 4ER7A 3CC8A 4PYQA 5F2KA 2C7PA 1R74A 5H02A 4EMSA 3I64A 3AXTA 3PTAA 1P91A 3FUTA 5EMJA 5HFJA 4E32A 4YV1A 3LBYA 1SQFA 1X19A 2PV0A 3FPEA 4RX1A 2V74B 4IKPA 1O9HA 3UJ7A 5E2BA 1MJFA 3HP7A 1Q0TA 4BLVA 1BC5A 5FA8A 5KQSA 4R05A 2IGTA 5U4XA 2DPMA 3MQ2A 4XUDA 4M7RA 3KPWA 5CVVA 4RTMA 3DULA 3B7PA 1JQEA 4HC4A 1F38A 5E8JA 5KQRA 2FK8A 1WZNA 4QVKA 4R8SA 1XXLA 4LWPA 3G2QA 2WA1A 4WVLA 1G8AA 4CKEA 4EVIA 2I6GA 1FPQA 3SM3A 2YXLA 3U81A 4MHTA 3KKZA 4OA8A 1ZQ9A 3OFJA 1QAOA 2PSSA 4MQ4A 5JUWA 1P1BA 1TPYA 3NW9A 1FP1D 1YZ3A 4PGGA 4PNEA 4EQZA 5M5BA 1NBHA 5LQAA 4ZTBA 4F84A 5LQJA 4POOA 4M38A 1B42A 3GCZA 2BR3A 3KPYA 5ICEA 4KIGA 3AJDA 5EOVA 3A27A 2ZZKA 2IPXA 5EKUA 2AN5A 3M6UA 4P7JA 2IH5A 4RTQA 3B3JA 4RVHA 3ER8A 4E70A 4QDKA 3SVZA 3BZBA 2PGXA 2AN4A 3T7RA 3DP7A 5BP7A 4XUCA 3BWCA 3SSMA 2OBFA 2GH1A 3P2IA 4C07A 3LCVB 1I1NA 3LDGA 2Z6AA 3GRRA 3MCZA 3EMBA 4FR0A 4RVFA 4P7FA 4M36A 2ZZMA 4FT4A 2PX2A 1YF3A 3FPFA 4B17A 3AY0A 3RIEA 3DH0A 4DMGA 3LKDA 5E1DA 4AZTA 1IY9A 4NECA 3CVOA 1M0EA 2P3QA 3FYCA 3JWGA 5DWQA 4RTJA 3FTFA 5BW5A 3S68A 4HRAA 1DCTA 4GOMD 5IKMA 5LQKA 2PX8A 1Q0SA 2O06A 3UJ6A 4G56A 1O54A 5DM4A 5HZMA 2WK1A 3MTEA 4MIKA 3THSA 3OPNA 4PCAA 3D2LA 4DCMA 4RTSA 5G02A 2OXTA 3C0KA 4RVGA 2YUIA 1KYWA 3KQMA 2CMGA 3BUSA 3BT7A 4RTLA 4MWZA 3LPMA 4LWOA 2BZGA 2BM8A 4YMGA 4PYKA 1INLA 3M6WA 3ELDA 3TPZA 5K09A 2C7QA 3MGGA 5K0FA 4KVZA 4ATNA 1HMYA 3DTNA 2OPBA 2ZFUA 1D2GA 4R8RA 2GLUA 5CVUA 4HGZA 3P9IA 2IBSA 3CCFA 4AUKA 4X1OA 3EVZA 4LECA 2V7EA 2JHPA 5K0GA 2P35A 3I58A 4IV8A 2YVLA 3TKYA 3UBTA 3SX0A 3CGGA 1YFJA 4KDRA 5HILA 3G88A 1SKMA 2BR5A 2ZW9A 3P9KA 2H00A 2JH8A 3EPPA 2O05A 3GO4A 5BW4A 3ME5A 3NDIA 1QANA 4DKJA 5FULA 1BKYA 2AOTA 5EMKA 1BHJA 2PXCA 3A4TA 2XVAA 2P41A 1RI2A 3LHDA 5E1MA 5FQOA 3BGIA 3MERA 2PXXA 1P1CA 3G7UA 2I9KA 1VE3A 1KXZA 3HNRA 2VP3A 3HA7A 4R6XA 5F2OA 5C9ZA 3GRUA 1QYRA 3R24A 2BR4A 4GC9A 2HNKA 1L1EA 4BLUA 5ICCA 3KPJA 3ERCA 1WXXA 4RTPA 1D2CA 4KWCA 3M70A 4PYIA 5T64A 1JSXA 5CVEA 5K0JA 2Z6UA 1M6YA 2ZWAA 2ZZNA 3PLAE 5DPMA 3M6VA 4DF3A 4BY9E 3TOSA 5HIIA 1JTEA 1L9KA 2EJUA 4AZSA 4C4AA 1IXKA 5K0BA 5K01A 5HIMA 4PIPA 2G70A 3ELWA 3UA3A 3DR5A 3GDHA 3EGIA 3DXYA 3FTDA 2PXAA 3P97A 1G60A 3B3GA 1VP3A 5GINE 3PFGA 5LQCA 5K03A 4UOEA 3VC2A 1G6Q1 3GGDA 5DM1A 3DLCA 1VLMA 5DXAA 2QM3A 5EHGA 1P39A 4HG2A 2C7OA 1G38A 2IH4A 4E33A 2NXEA 4FT2A 5CVDA 1U2ZA 2VZ9A 3OE5A 5DTQA 2BM9A 1OR8A 1I9GA 3MCTA 4RWZA 3NMUF 2GS9A 4PWYA 3HVIA 4RSRA 1XTPA 2Y1WA 3TKAA 4DA4A 4OQDA 2ZSUA 1PJZA 3GWZA 1FJXA 4PYNA 2O07A 3OU6A 1NW8A 1NT2A 3HA3A 3LDUA 3P8ZA 8MHTA 3P71T 2BH2A 1RI3A 1KPGA 2PVCA 1NW7A 2QRVA 3OZSA 3FUWA 3QV2A 1ZGAA 1ZHFA 2B25A 2ADMA 2FYTA 2PLWA 5E2AA 1G55A 2UYHA 3GRZA 3B3FA 3PFHA 4R6WA 5T6BA 1NE2A 1X1CA 4KW7A 2AOWA 1AV6A 4GOOD 4FZVA 2B2CA 3TFWA 5GM1A 1SQGA 4HH4A 1D2HA 3ANXA 3EVDA 3UA4A 3DXZA 2UZ4A 2Q41A 3REOA 4CKCA 3R3HA 1KIAA 5DXJA 3AXSA 3PVCA 5E9JA 4EK9A 2FHPA 4KRGA 5FUBA 2ZULA 3JWJA 3DOUA 3OU7A 5GM2A 4HTFA 2NP6A 3EGVA 3CBGA 3EVAA 1RI4A 4MTLA 4EKGA 5LQUA 5LSAA 4ER5A 2G8NA 5EQJB 4AX8A 5K0EA 5FWDA 2NNWB 3M33A 3NVMB 2ZBQA 2XYVA 4U7PB 1VQ1A 1NW5A 2YXDA 3I9FA 3PT9A 1X1BA 3LCUA 4KDCA 3SSNA 3VC1A 3CJTA 3PS9A 2P1DA 2OB2A 4QTTB 4M37A 5FA5A 4A6DA 1AQJA 3ELYA 3CJRA 1JR4A 3FPJA 4PGHA 1NV8A 5FTWA 5DSTA 3NDJA 2F8LA 3KQOA 5DTRA 4P7GA 4C05A 4QTUB 1TW3A 1IM8A 1R8XA 2PX4A 5EPEA 3TLJA 3KR0A 4QQKA 3L8DA 1XDZA 2B9EA 2H11A 2H1RA 3EMDA 4OBWA 5EHIA 5GIOE 2G72A 1RJGA 3C3PA 3C6KA 3P2KA 2IIPA 4IWNA 3GRYA 5EIWA 5EVJA 2XBMA 1VP9A 4QQNA 2PT6A 4CWAA 2ORED 4AZVA 2PWYA 2PY6A 5E1BA 5HEKA 1PRYA 4IV0A 3UJAA 2VDUE 4C04A 2VDWA 3FPGA 3LGAA 2IDJA 5FWAA 5C1IA 1XJ5A 3ER9A 4ER3A 2OZVA 4E31A 3BKWA 3FTCA 1JG3A 1N7JA 1XDUA 3T7SA 3KR2A 2CKDA 4FGZA 4GUAA 3DXXA 2ZLBA 5DT2A 3AWIA 5CM2Z 1KPHA 2VS1A 3MHTA 3T7TA 4RV9A 2E5WA 4RTNA 2OO3A 1Z3CA 2OB1A 2NXNA 5EC8A 1QZZA 1BOOA 2AVNA 2JH9A 2YQZA 1TW2A 2XYRA 3GRVA 2IBTA 5DRYA 2HMYB 3LKZA 4BP3A 5FHQA 3THRA 2DULA 3SMQA 2VDVE 4DZRA 4E2WA 5ICGA 1JG1A 5DX0A 4HTFB 5K0NA 3NVKI 5EZSA 5FQNA 4E2XA 3DMHA 5HIKA 1L3IA 7MHTA 2ZTHA 3G5LA 1YUBA 3UJ8A 4QPPA 3V8VA 3B5IA 2P7IA 3EVCA 3MTIA 1MHTA 3E23A 3G2OA 1ZGJA 2YXEA 4YUXA 1NV9A 1VIDA 3BWBA 3OFKA 5MHTA 3UFBA 2JJQA 2AN3A 2I7CA 3EVFA 4GOLD 2AOXA 2ZWVA 4YMHA 1SUSA 1VPTA 3UJ9A 1KPIA 4BP1A 4BLWA 3IV6A 5DX8A 3OU2A 5CD1A 2A14A 1NW6A 2G1PA 3FUXA 2ONZA 3LX6A 3UJCA 4Y2HA 3JWHA 3GIWA 3LSTA 4PINA 3UZUA 1AF7A 2UYQA 3PB3A 2HWKA 4KIFA 2Z6QA 2KW5A 2YTZA 1KYZA 3DMGA 2P8JA 3VYWA 3WSTA 3JWIA 3KQSA 4HSGA 1EG2A 5T67A 2JG3A 1RJFA 1V39A 2JHCA 5EEGA 2Y1XA 2GPYA 3RODA 2G71A 4H0NA 4QDJA 4HGYA 5DTMA 1X1AA 3A25A 3R0QA 3CKKA 3HEMA 5ERGB 3TRKA 3LL7A 4GC5A 5DRTA 3Q87B 2JHAA 3OZTA 5C0OE 3SSOA 3SXJA 2ZBRA 2B78A 2I62A 3HA5A 3IYLW 5DM0A 5CVJA 1QAQA 2CMHA 5DLYA 5K0CA 3HTXA 3HCEA 3FRHA 3IHTA 2CWWA 5EKXA 2ZBPA 4QPNA 2HR1A 1N2XA 3HVJA 3HVKA 3KQYA 3O4FA 1G8SA 4FSXA 5CIYA 1XDSA 2YX1A 4YV2A 5JR3A 3LDFA 1KHHA 5DM2A 3QOWA 4JXJA 3EEYA 2ESRA 2AS0A 5LR6A 3TR6A 3P9NA 3G2MA 5DX1A 3KQTA 3LCCA 1EAMA 3E05A 1AQIA 3P2EA
chains in the Genus database with same CATH superfamily
2PT9A 3ZI7A 1DARA 2EYUA 3BXFA 2DUNA 3WYGA 4DRZA 9LDTA 3AL0C 4HAIA 1ESNA 3D54D 3BMCB 1MX1A 4UJ5A 2Y8EA 4UVHA 2B5OA 3IEVA 1E2NA 2Q8PA 4IDOA 3VC3A 3OZWA 5JVDB 5JSZA 3QXJA 4P3OA 2R9VA 4MEAA 4HL6A 2X1HA 4P58A 5KOJB 2D0PB 1UT8A 4CMHA 5AM3A 2JHFA 2JFOA 4TTSA 1P3DA 4CTKA 4B6JA 3TELA 2D06A 3LFPA 3ABIA 4JL6A 5EMLA 4JGBA 2I2WA 1UBOS 1QO0D 3PC8C 4I66A 5A5FA 1CS0A 2FSIA 3J81k 4Y1GA 3V4LA 3CWQA 4LSGA 4YJFA 4Y6PA 2O4CA 3WO1A 4DC0A 5IFKA 1QU2A 5G53C 4K7JA 1UJBA 4LK3A 5I8PA 3IUYA 3TZBA 1XJ0A 2F6RA 3PQCA 3IEMA 4DXAA 2PBRA 5BYKA 5AH0A 3A6JA 5FFFA 3IFSA 1U8ZA 1A88A 4FOOA 1QAMA 1FQOA 5I9IA 2V4ZA 5MDHA 3FCOA 4FS8A 3L0YA 3IJRA 2GA9A 2AE2A 3QVGA 4UMVA 3WBJA 2FZVA 4JLPA 3ROGA 5BR4A 2Z5LA 3A4YA 2XTNA 3BHMA 5BSWA 1Z18A 1G6HA 1IN7A 3G0BA 1GLGA 2I54A 1UJ2A 2BVNA 4W4TA 5T4EA 3W79A 2VDJA 4L0CA 4G4GA 5BSUA 3ZN2A 4C2AA 4EVSA 3GPIA 2PLFA 3FCAA 2P7HA 1ISSA 2UZIR 4QRDA 5HMLA 5KVVA 1WUHS 3DNVB 2F55A 1FBTA 3EWIA 4F8EA 2XRMA 1G6OA 1KZ9A 1G7RA 2IHYA 2WJHA 3URKA 3ZIUA 1XVUA 3B2EA 3JQAB 3TOVA 4BVJA 4BWYA 2AFHB 1KRXA 2HSJA 4N0MA 4QUDA 1SQ0A 2VPYA 2PZEA 4BGUA 5C8XA 3D6UA 1IUPA 2C4KA 4UZFA 2PMKA 1PEAA 1QP7A 2PXQA 2BFNA 4RMNA 2M6LA 3SOZA 2VBIA 3SOPA 1TLTA 4H7DA 5A5DA 5LJLA 4WXPA 3BDVA 4OBBA 4C0QC 1PR1A 1VL2A 1TU3A 2AOUA 2ZRDA 3D0QA 4ARZB 4ZJPA 2AVDA 3A6KA 4UBIA 3N0TA 1N2JA 1PT7A 3LLVA 5IKXA 4JI5B 2PUJA 2VDPB 3SYNA 3T7KA 1QNLA 3F6CA 1BH2A 3N2KB 1WCIA 3VOAA 1ZHHA 1ETHA 1VSVA 2J0UB 4G1UC 2O1SA 4D02A 4JVLA 4C7OB 1MJGA 1MJHA 1Z5OA 3CW2A 2EKDA 3L6OO 4LVOA 4P80A 5ALTA 5HTOA 4W99A 1X7YB 4U3JA 4WACA 3OH8A 3SS7X 5GAHi 4B85A 2JAPA 3NEPX 4CLRB 5CDHA 3VJLA 3A1WA 1VE1A 4OHFA 5EQTA 1WS6A 3C8DA 1U9IC 2XA9A 1HMPA 1Y0BA 3NTVA 4B31A 1DSSG 3C8UA 3G9XA 4US0R 4P86A 1YDMA 3WLIA 3WWDA 4F9TA 4GZ5A 2PXUA 4FFBB 4YA6A 2I87A 2Q0SA 3AFMA 1OYVA 4J2OA 3EPHA 1ISHA 3FYDA 2AUMA 2XB9A 3QU4A 1JSZA 3PYMA 4DBLC 4DV1B 1BFDA 3IAFA 4QPZA 2QLBA 3TECE 1ORHA 3G5MA 2VYVA 3QWIA 2HDWA 1E2JA 3QI7A 3GN2A 3TW8B 1QH1A 1A9XB 2XT0A 1K7SN 2FPIA 2HZ7A 2ZPTX 3KR9A 4L4RA 4QUAA 4WE3A 1Z0AA 3E2IA 4G1FA 3KCQA 3KLNA 4GOND 1C14A 2UVPB 4OL0A 7MDHA 1LLCA 3COJA 5J59A 3DE5X 3KLPX 2HDNB 3WHPA 4E5SA 4JLOA 2VHVA 5HDQA 3EXFB 4KR9A 2O23A 3PQ4A 1KSFX 1SVMA 3QVKA 1G20E 1XZMA 5DGTA 4F85A 4LJRA 3AETA 5L4NA 2VT2A 4C76A 1C0PA 3EOBI 4DMRA 4PX9A 1RJWA 1U7TA 2QYTA 3WLKX 3ADDA 1WF3A 2EWWA 3VDNB 4CV2A 1ELOA 4WXYB 3UWDA 2GPBA 2GM5A 1RADA 4TQAA 2NADA 5ENDA 4TS4A 3MPOA 4QPJC 1GU7A 2MINB 5CNMA 1DBSA 1ZCJA 3CE6A 1AK2A 4GM0A 4IKPA 1T5DX 5LWQA 3CF2A 1HDXA 3PGLA 1Q0TA 3STWA 1M2JA 4R05A 2ODQA 3RJTA 4PU8A 1ZM3A 1JALA 1LBSA 3IQIX 3LY9A 4GPD1 2ZI5A 5ICSA 1ZU5A 3N8NA 5ITVA 4ZVTA 3VA7A 2R5FA 1JDUA 1E3QA 5CFQA 5K9ZA 4IXMA 2GXSA 2WD8A 3OMXA 4ZCIA 1C7EA 1U2TA 4A0FA 4KV9A 2H1OA 2DQ4A 3MWDA 2V8BA 5EJAA 3UK7A 1TX4B 1EI9A 4FYPA 4IMRA 3EODA 2AGVA 3QMMA 2W9XA 4JODA 221PA 3SFVA 5CXQA 1VCIA 5FBKA 1P72A 2WHPB 2ARKA 1BO6A 2ZS7A 3P9PA 2NZJA 4MP6A 5CT5A 4AJIA 5G2OA 2D59A 3I9KA 4AP6A 1N78A 2XWBF 2VHTA 3FYAA 4HBGA 2QVBA 1EVYA 1H2XA 1ADCA 1MJ5A 3EFOA 1FPMA 1KEEB 2HHAA 2VP9A 2YJ6A 2TMDA 4L8VA 4N3AA 5K3DA 1DI0A 4JC5A 1NIPA 3OMTA 1BVUA 1H2WA 2BFOA 3NEAA 1YT5A 4I1RA 2PZBA 2ID8A 4LK2A 2CEAA 2X4LA 2ZRMA 5EP1A 4ZTBA 5AVSA 3KHSA 5FLEX 3BULA 1Y3DE 3DOEA 1BQ3A 2OO5A 3KG2A 3QKIA 2BEVA 5LXTF 3WMGA 3GFRA 2O8VA 1OXSC 3ESAA 3LPDA 4WUTA 4CU2A 5JWOA 1P29A 3T5MA 3ESBA 2ZJ5A 3L9XA 5HMMA 5CJ2A 1FFEA 4RKRA 4EFLA 3E7XA 4DUYB 3RADC 2QVCA 3HY3A 2XBUA 1V25A 1W5AA 4OM7A 5JDIA 5BOSB 2QAGC 4YMIA 2K6GA 3PQEA 2ZCVA 4GBJA 5D5QA 4F56A 4UD6A 5AKLA 4HFMA 5CYOA 4R1OA 1Z4QA 4QX6A 3CLKA 4C7BA 4HQNA 4U7JA 5BNZA 2P9ZA 1E1YA 5EZ6B 3PI6A 4ZAYA 3CUEF 4GFDA 3QPUA 5FBWB 4ZVVA 4I36A 3FB4A 5CLQA 1T9BA 4LHVA 1WBBA 3QXSA 2O6LA 3FYCA 4ZCLA 3OPMA 3EIOA 2X6RA 4A8JC 2HU7A 4O1HA 5G0WA 5A3SA 1IEWA 3GRKA 1THGA 4U63A 3GRCA 1C2YA 4BLSA 3MOIA 3OPNA 4PCAA 4QQ8A 1ZESA 2HSWA 2ZE8A 1MFPA 1YHNA 2AWNA 4MW7A 1NSYA 2I6XA 4BNDB 5AVUA 4REQA 2QM8A 2ON6A 3DE1X 1AKWA 2HRCA 3WLEA 1T13A 4R3WA 3KQMA 1AS3A 2W2NA 3I8SA 3KKPA 1F0NA 3BUSA 2RGAA 4GMFA 5ALZA 1OYYA 3DVSX 5KU1A 3DLTA 1O95A 2WSSA 1FUIA 1XEAA 3KZCA 2VJPA 4ZK2A 1Q0RA 1UR5A 4KTVE 4MQFB 4MWCA 5E6SA 2AR7A 5HM6A 3P9IA 1BKDR 1NR1A 1IN5A 3EVZA 3NM6B 3HKDA 1T0PA 2V7EA 2VJCA 3HJNA 1V6CA 3RYFA 3SLGA 5K0GA 5K99A 3GUUA 1ZLYA 3M4JA 5AI0A 3TKYA 3TAHA 2FSGA 2VQ6A 3KSMA 3C3BA 5F5NA 2XWPA 2KBFA 3D8HA 2OAP1 5TJ9A 4GPZA 1YVRA 3B20A 3QJ5A 3TIGA 1LPNA 2NQTA 1UWCA 3KD2A 1NXPA 4YACA 2B8EA 4WKPA 4XRGA 4CHTA 1RJ9B 3WLRA 5I4IA 3H7AA 2JLBA 3Q72A 1LV8A 2CV0A 2J3QA 4D98A 5JMWA 2LTAA 3MYYA 1W4BA 1WXXA 4RTPA 3KTAB 4HDMA 1QHHA 1XTZA 4C6TB 3BFXA 4C29A 3C6BA 3UW3A 1PV4A 4A0HA 5JEEA 5GQSA 4JU9A 4BY9E 3E18A 1DHRA 4UUPA 3CEJA 3L4BA 4XM2A 1MFZA 1RZSA 1AGXA 1IZ9A 2EW8A 3OPYA 4ZAFA 2D1YA 5K0BA 1HE4A 3VPGA 2FPGB 1W8IA 4PIPA 5REQA 1L2TA 2R4QA 3ROFA 2PUGA 2DJIA 2V0NA 2X15A 3V4SA 1OFHA 4ZZ2A 2NLOA 3R3YA 3TUJC 4HXEB 5A9RA 1EA5A 2WTMA 3H2JA 4K9QA 2O3UA 1DUVG 3AT1A 3CIFA 2DSTA 3TLAA 2BLNA 3KFLA 3SMVA 3D3QA 3ZKWA 1IULA 4NDNE 4J0DA 5L45A 1GUZA 2EZ8A 1U2ZA 1JF8A 3EISA 4PBTA 3AR6A 2WJGA 2BSQA 3CNBA 2D2FA 2E2WA 3MA0A 3OE5A 3MCTA 1YA4A 3HBJA 5CHYA 1O94D 1V8OA 4P4LA 3OJXA 3R9XA 1N0WA 1M34E 2XX3A 2E87A 2UVQA 2XKBA 1YBFA 3H5AA 2BFFB 2IV3A 1RIIA 2ANBA 4TLMB 5HKKD 4XTRA 4BMXA 3H75A 1IN6A 2J30A 2P79A 5J2UB 5E2AA 5BNFA 5K7SA 1SC1A 4GX0A 1QYIA 2F3TA 2VL7A 4IW3B 5K20A 4UEQA 1FFYA 1VJRA 2R8PA 2JK1A 4GOOD 3S28A 3R9XB 3U7HB 1D2HA 1HNWB 2OXIA 3ANXA 1EFVB 3BEDA 4QNRA 3WICA 3FOBA 1OLSB 1A7JA 2XMZA 1KIAA 1LSOA 4Q6BA 5A9TA 1NMEA 2PA0A 4U8HA 2F8TA 3RB8A 2OHHA 3K9GA 1QVAA 2E37A 3OU7A 3RBXA 1B41A 1O0BA 3SJBA 4QFBA 2QLTA 2YY5A 2QQFA 1L5NA 1J97A 3O2QB 4YTEA 3X2FA 3UF0A 5CH8A 1MABB 2F3PA 2JAQA 2NNWB 1G0OA 1L7QA 2IPLA 1U0OC 3L7IA 3ZEIA 2VF5X 121PA 3ENVA 3PS9A 4GEGA 1W52X 3VJMA 3TWOA 3J81A 3CJRA 4OLFA 1TL7C 1G20A 1MB0A 3I42A 1RACA 2ZS9A 1FK8A 2YC4C 3KD3A 2F8LA 3PU6A 4J3FA 5ULLA 3SS9X 1E0AA 1UMCA 3ILVA 5H82A 4QTUB 3MMNA 2Q6VA 5DP1A 2E4XA 1VL8A 3K6SA 4GL2A 4AMUA 2B8TA 1XDZA 3WIOA 5GIOE 5KYXA 4Y6OA 3CH5A 5AOAA 4ND2A 4MO2A 4R31A 3C3PA 4QXRA 4WAUA 1A82A 4KO1S 4WK0B 3EQZA 1KE2A 1S4QA 3IESA 4CUKA 1BJKA 2WJ6A 3BE8A 3OWHA 1G3QA 1O1YA 3DEZA 3L5OA 3U7EB 1M8PA 2IDJA 1T3GA 1L8AA 1ZGGA 5LB2A 2WWYA 4TZ0A 4BJ6A 4F3RA 1K5GA 2QL7A 3H11A 3GQVA 5B36A 3FOFC 5CM2Z 3QVMA 3PTLA 1KJYA 5CW2A 4NMHA 5TQJA 1TM5E 4EZBA 3ZK7A 2Q2WA 4A16A 2AVNA 4YYEA 1G2IA 3G2KA 3HDTA 1TW2A 1UOQA 2GPAA 2V6JA 5BSFA 1LPOA 2IBTA 1MXFA 2QP9X 4DR7B 1AM4D 1VRWA 3M1IA 4KXFB 3LRTA 3LP5A 1M2NA 5FTNA 2VT6A 3UAXA 2C3YA 1Q1EA 1R0RE 3KL4A 2WABA 5AW3A 1ZH4A 3G5GA 1P2GA 2ZIAA 4MNTA 1IJBA 3HUUA 2ZJ2A 1G2PA 4QM7A 4EX7A 1AD2A 4K9OA 4RACA 5I4CA 2GTIA 2WUWE 2JJ2D 5AJXA 4MYDA 2J7WA 5KX5B 4OHYA 2AN3A 1FLDA 4G5SA 1T6BY 2JAUA 2CDNA 5KKCA 2O8EA 1HPLA 2C54A 3IAM1 1G8KA 1SKYE 4XIGS 2GPWA 2ZYWX 3WKCA 4EEXA 3PUWA 4NDZA 3RGWS 4XDZA 1F20A 1SC9A 5AW5A 4G25A 1V7CA 2R44A 4JCYA 3LX6A 1GLVA 3NATA 5B1DA 1DQSA 4OHPA 1TNDA 4P4NA 1VIYA 5LP6A 1XMOB 3THXA 3D6VA 4LGCA 5HNKA 1XNJA 1D4ZA 3LG2A 4YREA 1NQAO 1LDNA 1XVVA 3G2IA 1EG2A 4G4SP 1M6VB 3TBFA 4FNOA 5PGMA 1Z8FA 3L07A 2JVJA 2GPYA 5JE8A 4AJHA 4Z5DA 3E5MA 3KUKA 3R0QA 3ZJ4A 2IX3A 4EJFA 4HAWA 4GS5A 5TGZA 4JYZA 5HQ3B 4I55A 5HK8A 1U6JA 2GASA 3AKEA 4LDQA 4FOSA 1XPOA 2EWMA 2W6IA 5CAEB 1VSBA 4G5QA 4DXDA 1ZI6A 2NYRA 3MN1A 3JQGB 4G37A 1U8UA 1IXZA 2FVYA 4PRZA 5CVJA 2CMHA 2VTEA 4JH0A 3JVIA 4RA6A 1SJ9A 3IHTA 2GD1O 4NNOA 5ALFA 5EKTA 1O6GA 1TFUA 1TC2A 4ZT3A 3OWQA 2PBLA 1ZRNA 3NAQA 4OJTA 1NEQA 4Q9IA 2O3RA 2GVNA 3HVJA 4AZ0A 1SD2A 4EARA 4UEOA 1L5GB 1W9MA 4Q7QA 2FEPA 5TT0A 2HQRA 4YV2A 5JARA 3MRSA 1F6BA 5KSYA 1Q5PA 2PZMA 4G8CA 3E9MA 1V35A 2R48A 1NQVA 1B6SA 3JSAA 3TR6A 2ZIXA 2EFYA 3DKRA 1UP7A 3GOHA 1PT9A 3OZCA 3KDPA 1KJQA 3JVUA 3K20A 5FYDA 1AQIA 2FN7A 1VSTA 3DWFA 3SP1A 2XTJA 1AGYA 1E8MA 2I3GA 4E11A 4WK4B 4JJGA 4NEGA 4MAFA 2XQVA 4B7CA 2DR2A 3HCPA 4DABA 4EG4A 3N7TA 3RNLA 4FOPA 3D6FA 4LVNA 3BXXA 3EGEA 1USUA 3KYDB 4G36A 5E9QA 5M34A 3CZAA 1A7KA 1OTHA 1ZMBA 2FP4A 1R15A 3UATA 5EZ5A 4C6RA 1JQDA 2PEZA 3H65A 4KHZA 1ISMA 2WBLC 3V42A 5BXQC 1EP1B 2J3KA 5DHAA 3WK7A 4Q1VA 5LA6A 3VSEA 3ZE1B 3ZWDA 4C89A 3N6RA 4YDSA 2DFDA 3RRXA 2O57A 3QOXA 4BX0A 1OXUA 1ZGCA 3VVCA 2Z3WA 4BXOB 4JS0A 4CTNA 2C9MA 3Q12A 2GESA 1ISRA 2PNFA 2W6QA 1TIBA 4ZVMA 1T6ZA 5AXAA 2W2TA 4CIWA 1A04A 2I66A 3ZKAA 3KU4A 2BNMA 3NONA 3O91A 4B34A 2WHRA 1NN3A 3S7ZA 4HH3C 1C3OA 1OFUX 3NWBA 3Q1KA 4BASA 5B7GA 3BTOA 4JWKA 4DJEC 2HV9A 2ZYTX 1AG9A 2HTEA 1U0RA 3B2QA 4AY5A 4DCVA 1KORA 2GRAA 4RELA 4NBWA 4UAUA 1C3EA 2FWNA 3TLEA 4HWSA 4JA0A 2VJOA 3OZEA 1DCMA 4S1PA 4M99A 1E1RD 4RH3A 3EEIA 5AJVB 1SD1A 5CM9C 4D3FA 3A7DA 1H0SA 2VK8A 3IQGX 1E96A 1O9GA 3JQFA 3G2HA 1RI1A 4DGQA 4B6RA 1H2HA 3FSGD 4WLOA 4N8DA 4OSOA 2BF4A 3L7DA 3DT8A 3I6IA 4RTRA 3ZDBA 1GRRA 1S2IA 1LKZA 2EZ9A 2NUAA 3LNTA 3O2SB 4LXYA 1TGYA 3R1FA 1Z7GA 5T5QA 5A9SA 1RJDA 3KTOA 3K5HA 2E9SA 4PWZA 4Z2YA 1LQCA 2OQVA 1TJ5A 2BUBA 4KOEC 3SGLA 4NFHA 1DG1G 2D1QA 3ZBTA 4UNRA 1GM5A 3NXKA 3IUSA 4K0KB 3W2HA 4II3A 3F5DA 3OPXA 3C8MA 4TKMA 1A8SA 5ILOA 1EK1A 2EFGA 1MD9A 1WZUA 3S99A 4YT8A 5DV9A 2JFWA 2I71A 2IE8A 1V5GA 2RHBA 4Y9DA 5LP6F 2CSUA 2FRDA 3VR0A 2FLVA 1YQUA 4J16A 1Z5GA 3SN6A 3M8KA 5TX7A 3KQKA 3ZV4A 1Q1NA 4MKFA 3KVVA 1OH5A 4O4LA 4OXKA 1SBQA 1UDCA 2GZ2A 1JEJA 1UWLA 3VXKA 3NWJA 5BSKA 4Y2TA 4O4HA 4H16A 5B7QA 4TSRA 2VK4A 4PQGA 4V0LA 5TSDA 4YRSA 3JD4A 3EGCA 5TIIA 1GHTA 2JI4A 4BMNA 2AWOA 2M32A 1DJLA 1II8B 2ZAOA 1XXHE 1YS9A 1ENPA 1NAHA 1Z5PA 2W0MA 4QULA 2QTBA 5EL0A 3PITA 3R8CA 4MR9A 1CJSA 1T2CA 1P9WA 2HHLA 3JW8A 2GJ8A 4TMZA 3KYIB 5E8RA 3KHKA 4D9NA 3F90A 3L8EA 2C7GA 3D0KA 3H7IA 3BSSA 4OJKA 3AB3A 2NU8A 1AUXA 3AL2A 1SUBA 1E3SA 4EMUA 3SIWA 1H1DA 1RRVA 3PR1A 4DYVA 4RSHA 4G23A 1Y8ZA 1OFGA 1N92A 4GI7A 3PL1A 3JQ8A 1E2HA 2ORVA 2JAWA 4PZCA 1JQ3A 3RSHA 3UC9A 4CMGA 4WCVA 4TQ9A 4UHCA 4CV0A 3KT6A 3VR6A 1ZIPA 4F3KA 2CFSA 1JAZA 3SLRA 1GFIA 3PCXA 4BAZA 2IUEA 1TT7A 5U9CA 3QXXA 2MDTA 4TXHA 5JZSA 1D07A 1KZ4A 2ZYIA 3ESYA 4ARAA 1ADBA 1QC5B 3QW4B 3HN7A 1RHRA 2BFDB 2F3RA 1Z16A 3E3LA 3S3TA 5KSZA 1KQOA 4EMSA 5LA6F 3PTAA 2EZ4A 4BV3A 3TLXA 2Z9CA 3EXHC 1FTYA 4LHYA 3VZCA 1T2DA 1TK3A 1BH6A 5AOVA 3B6ZA 1QO9A 1POWA 4J75A 1X38A 1Z33A 3E82A 3LFHA 4U9IS 4JOQA 4UQOA 4Z99A 3I0ZA 5THXA 3VDRA 4CM1A 4EO7A 3FW1A 2P27A 4J43A 1IZ7A 2BRUA 4L74A 4AF6A 4H17A 3GRFA 2GCEA 2VPQA 3DAPA 1LLIA 4FQ5A 4O1MA 4OVKA 1KFKB 1WSWA 3PRJA 4HYQA 1N6NA 4I50A 2ZYRA 3OJCA 4CIAA 1C1DA 1FX0A 1MUUA 1WZNA 2BFCB 4OI1A 1YB7A 1F8XA 1HGXA 2VAXA 3A3OA 4HNAB 4UMDA 2XUOA 1FPQA 2CYCA 4OAQA 4PFSA 1NLUA 1HXHA 2I6FA 2OV6A 1JHOA 1L7PA 3ZE0B 1U3VA 4E5UA 1WABA 3KKZA 4WDRA 1FJHA 1I01A 3CCCA 4DDUA 3HFGA 4ANFA 4E1VA 4FBGA 3MJRA 3WA6A 4M38A 3PI7A 1MORA 2BR3A 3KPYA 3M5CA 3PCTA 1Q57A 2ZS8A 3DCNA 4H1VA 4ZK6A 4MI3A 1JPVA 2QDXA 3KJHA 2XUDA 3OESA 1IZ8A 4DPLA 2R87A 2L19A 3L7LA 2X3FA 4ZANA 4F45A 1ZH0A 2HADA 5J23A 3D3EA 3P94A 5KU7A 3SZ3A 3JQPA 2VXBA 3F7MA 2OVFA 5A6SA 5ADUS 5BP7A 2O52A 3ZCSA 5A1JA 2JFUA 2PUVA 3GDGA 3TNDA 2RH8A 5AM4A 1THZA 3PC4A 4K3UA 3SNHA 2IXDA 2JI9A 2YN4A 4YAWA 1RC0A 3TRDA 1NUQA 2IZ1A 4FHFA 4LZLA 4CI0B 3EW9A 1OB2A 3RSOA 3WB0A 3UMSA 3AEUB 3GGCA 2YZ7A 3ZWBA 1RP7A 4BVFA 4DV7B 4X4CA 1E3LA 1ZMXA 2CLOB 1YZUA 1FTNA 3BK2A 5G0VA 1VG0B 2JATA 4QXPA 3QKSA 4O4HF 4HDOB 5CTAA 1SIBE 3MFQA 4N9QA 2O06A 4YRMA 4AY2A 2VDKB 2ZJZA 2VNHA 1PLJA 1XRSB 3IUBA 4J7UA 1RWVA 4FYXA 3GT4A 5FEUA 1C0KA 4N6NA 4BX3A 1CRZA 2XOXA 4O4JB 3VR4D 5JNTA 2X2PA 2OXTA 1U8EA 1M1NA 3CNNA 4TXLA 4C78A 2B30A 4HNTA 1AHHA 4LYYA 5EXPA 3EDCA 2YHIA 2OCLA 3B82A 4K9MA 4MIOA 1ZIYA 3X2SA 4LWOA 4X6YA 2RHLA 5A4IS 1OI2A 3VGJA 1LEHA 1C9MA 1E6WA 2NO9A 3EIWA 3FYUC 1L4FA 3RVDA 1G9XA 4LHEA 2H7XA 3TLKA 1YS1X 5K09A 1PNRA 3KSZO 3FGOA 3MGGA 5AR1A 2OPBA 2I7TA 1VLHA 1XALA 4YMWA 2XMCA 2JVKA 3UCEA 1KQGA 1E3WA 2E89A 2F9FA 2W2KB 3PJGA 4COKA 1U81A 3MWFA 3H9CA 3NLLA 4YGXB 3QBEA 3M5DA 3CLRD 3W04A 4X4GA 5FOVA 4YAFA 1OJ7A 1ZOOA 3CGGA 3L8HA 4QU8A 5HILA 3RT1A 4A82A 1ABFA 2FFHA 1MOZA 2BR5A 2BGNA 3LAWA 4JGIA 4JQZA 5EUCA 4UW9A 4DKJA 4G0UA 1ZM4A 1GR1A 3ZTTA 3JQRA 1BE8A 1VRVA 1COWA 1U9YA 3QKWA 3T06B 2QN8A 2V7QA 1SA0B 1UANA 3C8HA 4HDNB 4C22A 4CLDA 5D51S 1D6NA 3DZDA 5DW3A 1Q12A 1X9IA 3AF2A 3HA7A 3IERA 4MP3A 3TB6A 3ZDZB 2ZJFA 3T8YA 1M7HA 3GFTA 3Q98A 4AIIA 4C01A 1WKCA 4PG6A 3RF7A 4Y2UA 1UPTA 3H5OA 5IUNC 2H16A 3VAAA 3KV1A 5CVEA 4XWWA 3DKPA 1KAMA 1M6YA 3A1TA 3WKDA 2ZZNA 2GTHA 1UJ6A 2XITA 4Z86A 1BDBA 2ZIZA 2Q49A 3WK5A 5HZGA 4C4AA 1QOQB 3AC0A 3OZVA 1IHOA 1UPCA 2FE1A 1JT2A 3DR5A 1SUPA 2YFKA 3U4MA 1JEQB 2A9PA 3IP9A 4U0KA 2AC4A 2C04A 2IODA 5LUBA 1ZXLA 5D6NA 1SHKA 4LBYA 3GGDA 1DRJA 4GNKA 2QM3A 4UOQA 2J0SA 1PZNA 4MAMA 4QOJA 2C78A 1IM2A 2XB6A 3RLFA 1CY2A 1DG3A 3A9SA 4Q00A 4ZHQB 3S8EA 3UT5B 3WHIA 4ENSA 3QIVA 3DBHB 3Q2IA 3R1IA 3TKAA 3FAZA 4MJXA 2F3SA 3GBPA 1JHVA 2J5XA 4CLEA 3RFTA 1RI3A 3TRFA 4RQAA 3QV2A 2EBYA 2Z1DA 1RXIA 3HB4X 1ZUWA 1RM3A 4LIPD 1UBSB 1JSCA 3FMFA 1Q7CA 2X5XA 4KYTA 4R6WA 4NPCA 5DHQA 1UKEA 1XXHA 1QPBA 3UB4A 1K4KA 5GGYA 3K8ZA 3N7AA 3Q8LA 4WRRA 5F3RA 1CBUA 4N12A 3SIPA 3WI7A 4XLZA 3R3HA 3ZWYA 3R8FA 1TYDE 4ZDIA 1Z0IA 3EXIA 3EXEA 4M2LA 3B2NA 1UFVA 1TE2A 4GI3A 4Q1FA 2HK7A 1PEKE 1R6VA 2F43A 5DIFA 3U4CA 1C7ZA 4XGNA 3D6JA 3GJ5A 1ST3A 3AYZB 2IYAA 3TZHA 3X1MA 4Q4LA 5IMSA 5KEIA 2WWVD 3BRQA 1XZJA 3OE1A 1D0VA 4Q66C 1JAIA 2Q5LA 4BO9A 2QKYA 2DJ5A 1GUFA 2H3EA 3LCUA 2Q4RA 1NG1A 3ELBA 4AO8A 4FYVA 3VSCA 2KLHA 5LP1A 1UKCA 2CJWB 4Y0NA 3ASZA 2X2OA 4PLGA 2LYPA 1S96A 3QUSA 2R47A 4K9DA 2YWDA 4QUJA 4M0EA 4O2AA 3WYFA 3BAFA 5EXDA 2FJRA 1NQ5A 4P7GA 1XRQA 2E85A 2JEOA 1KBQA 1BW9A 2XCLA 4S1TA 5D86A 1J56A 1IK6A 3T1QA 1IZZA 4CM9D 2H31A 3OSUA 1BGWA 5B2FA 3L7NA 2VPXA 4ESEA 2PG3A 1LLQA 3JASB 1ICIA 2RHMA 4FDLA 2A0KA 1FNBA 2FJUA 5KCZA 3IIJA 4D99A 2XSDC 3VR5A 2IPOA 4BUZA 3FNEA 4V24A 4DFDA 4C1BA 2O8FB 1EWTA 2PIAA 1Z5UA 1KP3A 3BILA 5TQ2B 3S7TA 1IZ0A 3GC6A 2QAGA 4DMMA 2YVUA 4BDSA 1GPH1 2D5LA 2ATXA 3QZUA 5G41A 1A2QA 3KAKA 5JWRA 3AM1A 1PDWA 1OW3B 2FJ0A 1VG9B 2WIUB 2ZJ1A 1ZM9A 3T7SA 1J70A 1KIFA 3N0RA 4ZGGA 4HQOA 5F73A 2IA5A 4BVHA 1ZJ5A 2C2YA 1PFYA 2HLDA 2ISSD 3AWIA 4OGGA 3RJZA 5B55A 1BU5A 1QLWA 1XELA 3CH7A 3AERA 2KSQA 2OB1A 2RK4A 3IE2A 5F77A 4DNXA 2FW1A 1BOOA 2H1LA 5JJCA 1PUXA 2JH9A 1VYTA 3MJSA 2XYRA 1QH8A 2R7MA 4OY3A 3SEFA 3D4NA 1SULA 1YR1A 3Q8WA 4A8JA 4YPVA 2QZ9A 4NMMA 3VHRA 2B92A 3O03A 5INTA 3HXQA 3H16A 4B3MB 4MV0A 1RVDA 4LYGA 4BVGA 1YXMA 1G8HA 4U2KA 2XEXA 2QX7A 2DFPA 3EAFA 4ZCTA 1GGVA 3A6GA 3QHAA 1I3MA 2XADA 3EZLA 4PW0A 1RQRA 1NV9A 3ANTA 1VCMA 2JJQA 3DOOA 2RI0A 3DV9A 1MZPA 2FZGA 5C35A 2G4LA 4GOLD 1T0IA 2PWBA 3WAKA 1W7AA 3ZD6A 2GN2A 2HF2A 5IM4A 1FTQA 4UUAA 4HYTA 3TDKA 2OHVA 3FUXA 5HE9A 2FHSA 2RHOA 5EWLA 3DZ8A 5F7JA 4F60A 1SKBA 2O9JA 2B4KA 3NTLA 4KIFA 4AMVA 1E5QA 1NVEA 3L8FA 4XX1A 3E9YA 2HWYA 1M9NA 1O5TA 3CS3A 2XJ3A 4G1CA 3T4EA 4C6SA 4M21A 4E94A 3MCVA 4M9ZA 5L3SA 2FX3A 1T5BA 5EZYB 4RZ2A 3UXYA 5BMOA 3UFDA 2GI4A 3DL2A 4YMTA 4NYMR 1TM3E 2FZKA 4XEUA 5J1SB 2C0CA 3R7DA 3FNRA 1NI4B 1NJ5A 4MPTA 4G0VA 4Z4GA 1MA0A 5AP9A 3EFEA 4JBIA 4REOA 1FQWA 4WT7A 3OZTA 1CVLA 3MS2A 5CGZA 5FOXA 3LDHA 2DY0A 5ERYA 1W47A 3F47A 1C9DB 4D25A 2GN9A 3RVMA 5K0CA 4UVDA 1W96A 1M8FA 1OY1A 1KDOA 2Y6VA 2R96A 3OFSA 5K3SA 2P6PA 1IIBA 3J80A 2C00A 1DPGA 1H8ED 1N2CE 2ATCA 4HUQA 2PRJA 4PLFA 3F71A 3LDFA 5EE0A 1KJZA 4BEBA 2OV1A 1KYIA 4FD2A 5IF9A 3ZGZA 3EIFA 4JUFA 3KZ1E 3AVWA 1Y1PA 5I7HA 3HO6A 1R4MB 5FL7A 4BBZA 2PE5A 2R6CA 4M1QA 4B3BA 4DIUA 1ZYUA 2NSYA 1XTSA 2AHRA 3KQTA 4KAXA 1KZHA 4EW2A 3GJ4A 1CRWG 2QAJA 3GK3A 1DKOA 2D8MA 2RBKA 5LBTA 4PZAA 3DMTA 5JMOA 2I65A 3OTGA 3ZWXA 1S4MA 4ACAA 5JQWA 1CUVA 1QGZA 1S02A 3B48A 1T4BA 3CUSA 2JIMA 1AKUA 2Q3LA 3WMEA 1RM5A 1TZCA 2GDJA 1EB9A 3BS3A 1E5LA 3TPCA 1HZZA 4P4UA 5AHXA 2ZAMA 2HLNA 5FCDA 4O2AF 4MAAA 4B6OA 3N8HA 2PU7A 4EENA 1DDGA 1NF2A 1ZZ6A 5I01A 3BRWA 2KX7A 4IDPA 4UOZA 3O2JA 5HWSA 1A4RA 4IIYA 4WN9B 1Y9AA 4X0EA 2BYTA 3EMKA 1E8DA 2BJCA 5EP2A 4FJ2A 1NVKA 1RBQA 2AD5A 1X7ZA 4Y9RA 5GAJA 4E6PA 1D4AA 2ZYGA 4P3YA 4FFRA 4P4SB 3FWPA 1F3LA 5IT5A 2ZT5A 3AVXA 3ASVA 4G26A 3LXMA 3TW6A 5I8WA 3T3DA 5A04A 2I8CA 4C4ZA 2PSHA 4G5YA 2DERA 2YWCA 2G1KA 4M98A 3WS7A 2A3NA 4CT0A 1H66A 1M72A 2AQ8A 2UZ3A 3L0SA 3A6LA 4DSTA 1QFZA 1TD1A 2P40A 2FW9A 3I3OA 3K9QO 3OZRA 3FMIA 1DRWA 3TS1A 4TTPA 6ABPA 4LPSA 1A9SA 1MX3A 4QUHA 2D7CA 1NNEA 1GFZA 1FTGA 2FF7A 3OMWA 2QLLA 2XNKA 1NX9A 2BGGA 2B8WA 3NT4A 3ZYCA 2W6MA 2E18A 1EWVA 1L4KA 4TROA 3E9EA 4Y2YA 3SJZA 3GLFB 2MEZA 2I4MA 1NOJA 1WIWA 3M3HA 2QVGA 3K0AB 3OOEA 1K68A 5C7IO 3AL3A 4LOJA 3E4DA 1FDVA 4WERA 3ED5A 5IUKC 4MQEB 2GYVA 4US2R 3UIEA 5D6OA 2Q6LA 1U4NA 1GGEA 3BIFA 3N3BC 1JDBB 4QA9A 3S70A 4CQMA 1KMQA 1DC6A 2DMRA 1AX9A 1PGQA 1PJ4A 4UXHA 5KJ1A 2PRIA 1U1CA 4MV1A 3ZCQA 3MCUA 3ELUA 1N2SA 2YHSA 7REQB 2CHEA 3DOJA 4OKNA 5IM4F 2GHTA 4RORA 2IUYA 3EVEA 3Q7PA 2M1ZA 4QATA 3SXPA 4ITVA 2PX0A 2V3VA 1YJAA 1ZOPA 1NN1A 1XDDA 4MS4A 2N1BA 1ZNYA 3HCBA 2EGGA 2XA1A 1DO2A 1JQJC 1D8AA 3EDQA 1NXSA 1NRXA 2QUJA 4JT9A 5ES4B 2FLKA 4MGKR 1G4HA 3BSYA 2IYPA 2YFQA 3KSUA 2EKPA 4UHFA 5AVRA 3IIIA 3PQ8A 4M54A 3O4RA 4ZAGA 2BMAA 4EKDA 4DTCA 3ZLJA 3M4NA 4EEKA 3KYCB 1SZDA 1MV5A 2BKUA 2IOQA 1XU7A 3A1EA 3G2PA 1GYRA 3LXUX 5CT6A 4CM7A 2NU6B 5DDIP 4C0KA 5K1ZA 4FJ0A 4KXWA 1CUIA 1PLKA 2YNMC 1SUDA 3EYAA 3PEEA 4M8LA 2PXPA 5FBZA 2KLBA 2GNAA 3OTWA 3N2LA 2EQ5A 3ETNA 4H7PA 4WCDA 2LZ0A 4L9WA 2UAGA 3TMYA 4CQNA 3O31A 4XDGA 3Q7EA 3W9BA 2HMTA 1NFFA 4MHOA 1XC7A 1PZGA 5IC5A 5BXYA 5AKJA 1OV4A 3QLVC 3FTNA 4X1YB 2OA0A 2P1RA 3KL2A 3RRZA 3R40A 4INJA 4P22A 5KC8A 4RTOA 3BH0A 5FDFA 2F90A 3MZ0A 4IGKA 3TMKA 3DA8A 3EZNA 1NE7A 3BOSA 4L5JA 2AFRA 1DTWB 1WEKA 2BNOA 3T9FA 2D2EA 1SHZA 4RZXA 5AKIA 5EXEA 5KNBH 3HR8A 3MLFA 1IY0A 1VIMA 3FDFA 3HU5A 3NQ41 5I9TA 4HUJA 1IE3A 2C4TA 3AVPA 1PYOA 5A06A 1V8FA 2AC2A 1LWOA 1NUPA 2AMVA 2BZSA 3IAAA 1OCEA 1YNOA 1Y42X 3AUTA 2R3SA 3HN2A 2OP0A 4IUDS 1PT5A 2JFVA 2ZT6A 4BB5A 1IUOA 4BNMA 4MKIA 4GSLA 5A02A 5EIBC 1I7DA 1N6OA 2CF6A 1SBCA 2ZRKA 1FA9A 1W581 1WUKS 1AA6A 4EZIA 3F49S 2QJRA 3KUUA 1KVTA 3GAMA 1CEYA 3NRCA 3SBOA 4QGHA 4R5HA 3SEZA 2RHTA 3OLYA 3QX7A 1Q7EA 1OBVA 3FPEA 4FU0A 4XPZA 1JA9A 2WUVA 2GXQA 4LOHA 1A2BA 1O9HA 1SU7A 3UJ7A 2OG2A 4FFMA 1Q21A 1UPAA 4PAWA 4Q4JA 2IEYA 5J2TF 3KOXA 2Y2VA 2VH5R 3I9MA 4D5EA 4E1AA 3GLIE 2WC1A 2PXBA 3IDAA 1N25A 4CCAA 2EARA 2JRLA 4PU0A 4Y1FA 1WKBA 1UKVY 3GLRA 2G76A 1OI7A 1Q44A 3KKKA 2VHJA 4LRUA 4R51A 4DBZA 2GZAA 2PS0A 1M8JA 2MMGA 5JS8A 3NKFA 2KEIA 4QJ5A 1JPJA 1FMJA 1EGAA 3NHLA 5CR9A 4AMYA 2BMEA 1J2UA 1OKKA 4FFLA 4U6QA 3RWMB 3JPYA 3LRXA 2ECQA 2AQKA 3CF6R 3I6MA 4G63A 4I4NA 4MQ4A 4P6VF 1GIAA 4Q19A 4U00A 3SU8A 3WZLA 1XZBA 1KGDA 4FGJA 5M5BA 1IHXA 1KZYC 2MYPA 4RC9A 4F84A 3OLZA 3BMQB 1SHTX 5THQA 2FMXA 2I3BA 1RR6A 1UQTA 3BMOB 1DX4A 3C14C 1K98A 4HDSA 2A5JA 4IY1A 4DNQA 2BGKA 1K89A 4BO6A 4RH1A 4EJSC 3HFRA 4MI9A 5JJIA 2IX9A 2C77A 4RLQA 4P7JA 5CD9A 3THWB 3IUPA 3VNVA 1KS2A 3GCWA 1P2SA 4Y8VA 3ROPA 4KXVA 3TIFA 3D02A 1BYIA 1L9XA 1T4CA 2PL9A 4KPUA 2GJKA 2J3IA 1N2BA 4LVCA 4OK6A 4XUCA 2X8LA 1YA6A 3UUEA 3ITDA 4WECA 4C07A 3KSRA 2JFQA 1I1NA 3L6DA 4IIJA 3BD7A 2WAXA 2JZNA 3IGFA 5AVYA 3FPFA 1QFSA 3NBUA 4IHKA 3VKHA 5BSRA 3TL6A 2GSWA 5EWMB 3EMVA 4XQEA 4Y6QA 1ZPQA 4CR6A 2JGDA 1ML4A 1EWYA 2JK0A 3FVVA 1PI3A 4ECAA 5EJ4A 4GKJB 3JZFA 4ZPXA 5FLKA 2LYQA 3WYCA 2W37A 4E3ZA 4TN1A 4GQMA 1EUZA 2ZSKA 2VTBA 4FC6A 4L8GA 3LFTA 4D3YA 5FPSA 1WQ3A 4RA9B 3E0QA 4FNGA 1HNZB 3G1TA 4FD3A 1LPAB 1TZBA 2PSFA 2ZTLA 4DT1B 2YH2A 3KBBA 1DU4A 3KM0A 3S29A 4MW1A 5KYYA 2OHXA 3QVWA 1KU0A 3KXDA 4RGVA 2HRZA 1N3BA 2JJ8A 4PNPA 2BZGA 3I09A 3LUKA 4KMRA 4UARA 5A4JA 1HFEL 2IEAA 5K4AA 2HDOA 5H9VA 3TPZA 1I6MA 3LKVA 2QD5A 3PGMA 3QKRA 2XKAA 2FMFA 4LEIA 1J99A 3DTNA 4PSVA 4XXHA 1HQCA 1SHLA 4AY4A 3IAM6 2GLUA 4DR3B 1YDFA 2BJWA 4O25A 2CB0A 2CNWA 4HQFA 1L4GA 1ZCZA 2FPLA 4M1YA 4YNBA 4ZVSA 1DOAA 3VBCA 3F51A 1GPDG 5L95A 3CT6A 1AZLA 1GKLA 1UBJS 4TKUB 4NXMB 1UF9A 3R3WA 5JALA 3B3AA 2Q2QA 4RAQA 5LMCA 2XXPA 4KDRA 3ISTA 3M5PA 2AW6A 4MRMA 1H6AA 1KC1A 1TT5A 2ZBVA 2YWRA 1L4UA 1BKYA 3KZOA 1FYVA 3UAWA 3ZGOA 2AOTA 3Q41A 1KVQA 1GGKA 5KVCA 3P2OA 3LHDA 3NT2A 3MT0A 4FYKA 3BMNB 3WRYA 3PC6A 2PCJA 3G7UA 2KM1A 1UBKS 3O83A 1E2LA 3GLGE 2WLSA 3ZZMA 5KKNB 3HNRA 3GHYA 1RTTA 2EFDB 3HCRA 1K3FA 3GRUA 1QYRA 2IC5A 1F7UA 4M6WA 5ICCA 3AIKA 1PL8A 2R7NA 2EVWX 1PS0A 2G83A 2VEOA 3D59A 1WUJS 3GJ6A 3FN4A 3UO8B 5CBPA 2GWHA 2YYSA 4I1SA 4XW2A 2Z6UA 1UPFA 5IASA 2YJ3A 2HBQA 4G0QA 5T41A 5A4DA 3WJ7A 1EAYA 1FYXA 2YJ4A 5JANA 3DUFA 2NTVA 2Q9AA 1C9JA 2WPDA 1IXKA 3P0JA 4AZSA 4X64B 4LDPA 2DKOA 3C3WA 1C29B 1W9HA 2XIJA 3K9NA 3M9XA 2VZEA 3MHPA 4MUFA 5DIZA 5KAMA 3UA3A 4IGIA 2ZCUA 3DXYA 1TJ3A 3BICA 4MEBA 5DZSA 4RIEA 4AROA 5LFAA 2PQMA 1LDBA 1TI7A 2X2FA 1NR7A 3AQ4A 3L77A 3PD1A 1Z29A 2Q5JA 2QQ5A 3QNWA 4AG6A 4K8OA 1VLMA 5C51B 3ZLVA 3RAPR 3COSA 4L08A 3TIXB 2ZUDA 5K98B 2ZUTA 3RRNA 2CCJA 1LRKA 3ZWWA 3E7FA 1E2BA 2W2XA 4I1UA 5BW6B 5DTQA 4O2LA 2XECA 4NS4A 4HAYA 4KX3A 2W2VA 1FFBA 1WPXA 2Y1WA 3SC2B 4DA4A 3VKFA 5KTPA 3I62A 2I2DA 3GWZA 1B8NA 5IWAB 1TVEA 2A7XA 4LTMA 4N6GA 2ZSHA 1Q3HA 1RLOA 2VJYA 1R5NA 1KPGA 4LJ5A 4CJXA 7ADHA 2BH2A 2AF3C 2Q1TA 3EXHA 2CKMA 2OLJA 4QYIA 1G55A 2P78A 4RK0A 4AJLA 3FKSA 4WI1A 5CDFE 2VNAA 5TMPA 1TAHA 5JAQA 4QRIA 1NC1A 3MF4A 1GDTA 1ANKA 5H3HA 4IIJF 3ZVMA 5EHQA 1ADYA 3C1UA 3EQ9A 5LYJA 3IQFA 4YRPA 2NTEA 1Z15A 3K73O 1QM5A 2OK7A 3D0RA 1G16A 2QX9A 3GT3A 3L7CA 5EPUA 1ZMTA 3X1XA 1AQLA 4D3ZA 5TPWB 5KOYA 3SF8B 2BI4A 1E99A 3MWKA 4KXUA 2RGEA 2WRZA 4JGGA 1T5HX 2O2YA 2G1UA 5EQJB 4AO6A 2WJAA 2L49A 5EMNA 5C4MA 1Z6TA 1CERA 3S8QA 1JXQA 1T1EA 3EQ2A 2ZYDA 3SSNA 2B1JA 4UQLA 3MD0A 5E7MA 4URXR 5FA5A 1CUEA 1ZZCA 3ELYA 5GPBA 4Q7KA 4QUKA 1Y7YA 4UMEA 1U3WA 5K3FB 1VPVA 3WGNA 1XZDA 3HXKA 5C32A 1Q77A 2ZU6A 3KQOA 4G0NA 4HLCA 1IH8A 4C05A 5EPEA 1QR6A 2BH9A 3KR0A 2ZYHA 1T6NA 1T9AA 5A2GA 3OKAA 1N57A 4Q16A 3ZGLA 4WTOA 4EKNB 2VYVD 3GPDG 2CWDA 4IWYA 1E18A 3FXAA 3P2KA 4IWNA 3GRYA 3MYRA 1T5TA 4QASA 1VP9A 3PHGA 2X1LA 5AW8A 2JLXA 1SUFA 1WPQA 4NTZA 1D09A 1E7YA 2RGNA 5KCMA 1JLMA 3DMDA 4M1OA 2J7UA 5HQJA 4NYIQ 5B1EA 1JU4A 2VDUE 3LGAA 1XA3A 1II0A 1GA6A 1E60A 3DHYA 5E3IA 4K9RA 4U5XA 4W9RA 3WYEA 2DU8A 3GLIA 2CL6X 1O87A 1K5HA 1NVVQ 1K66A 2KB0A 5L7TA 2R1ZA 2AN1A 1KGSA 4H18A 4YEDA 2Z5GA 3KT8A 4CDRA 1MOSA 4IZHA 1SBYA 1NJ6A 2NZXA 3V1YA 2XNHA 4RM3A 3WIEA 1U90A 3E7DA 1ZLXA 4M60A 4E5DA 1A8QA 4F46A 4D9GA 5BNIA 4U2BA 3F73A 3R5FA 3VJKA 2IF0A 3N7UA 3LUHA 3BCRA 4MUBA 5FHQA 2A5YB 3GT0A 4QJ4A 3THRA 4G85A 4B4VA 1Z6AA 3IUQA 3TRJA 3HPRA 4CF3A 4DDHA 2Q5HA 1YVDA 4A0SA 2RGXA 1ULHA 3DMHA 3N2GA 2AWIA 1RHJA 2ZTHA 3NC1C 2XOKA 4YXWA 4AQDA 1EUQA 3A6PC 2H0RA 2H06A 4IJQA 1NU8A 2FVXA 4MIYA 5FH9A 2QW8A 4X1IB 1ULTA 1TLLA 2VH1A 1GD1O 1HOXA 4YUXA 1VIDA 1QPGA 1DRVA 2WSMA 3BWBA 3LXXA 3H5WA 4GU5A 5LNK1 3K9FC 3EVFA 3FYUA 4BIIA 4EY4A 4ZFNA 1HFJA 5JXHA 1P6UA 5KHLB 5FOSA 1IEXA 4MYUA 2HA7A 3IV6A 3QLEA 2P9YA 3ND5A 4K2HA 1JXOA 3EGXA 3PWSA 5B1HA 3M1YA 2V7XA 4O63O 4RPCA 1TUBA 2RJ3A 1HDGO 2YTZA 2BCEA 1LV7A 3DMGA 2GFQA 2RE8A 1LS1A 3WSTA 2IYXA 2XXAA 5LDGA 3JWEA 3EIUA 3L1VA 4D81A 5BQXA 1MQ8B 1NI3A 3LT2A 4JLKA 1P18A 2Z2JA 4MULA 1RYDA 3EZ6A 4DSUA 3KDSE 4I7EA 1TQHA 5CX1A 2PUDA 4K1LA 2ZROA 1SGWA 4HWOA 3V6LA 1R6XA 2XTZA 4DQDA 3M7IA 4ETIA 4CL0A 1QZUA 2H5LA 1FDOA 3EF1A 4N18A 3K2IA 2AZMA 4I4TA 3H84A 3UMYA 3K09C 4B7ZA 3HTXA 1UBNA 1P5ZB 2HA2A 4UMFA 3UJ3X 1CEXA 1XAGA 5D3QA 5I9LA 4PN7A 1YR3A 2BOVA 2ZJOA 1Q0LA 5LDDC 2FMUA 4OMUA 4UUMA 4WBNF 4E5PA 1UK7A 4F4UA 2IZ5A 5B7PA 2LIVA 4YR9A 2I4RA 3W34A 1UXOA 4IHJF 1N6PA 3DTVA 2YZMA 1DPFA 1GQ2A 1V5WA 2I7XA 3ZVRA 2L42A 3P2EA 4ZJYA 4C2TA 3FUVA 2NO0A 1T3SA 1FU8A 3JZAA 3L1IA 3GN5A 4LJSA 1S3IA 1CDDA 2X7HA 2WZQA 4P32A 4JXXA 4Z0HO 4IO0A 2OY0A 3U4GA 4JNCA 1CUAA 2C7BA 1Z6XA 4CV3A 1E9SA 1KYVA 4J9VA 1MB9A 4WFQA 2OXEA 3BGDA 5J5AA 3RQIA 4GYJA 5HYVA 3UKDA 3BKXA 1JLLB 1YJBA 2J09A 4W5HA 4HEJA 4HN4B 4II7A 4MWBA 3JU3A 5FBVB 4GMXA 3I2IA 1Z0SA 2P65A 4FHZA 2CYAA 1V4NA 1X86B 2CNOA 2P9HA 1EXMA 2Q5QA 3GLGA 4IH9A 3EHEA 5BYJA 2J7KA 3HH8A 1Z4IA 1BWQA 1NP3A 1C8VB 1V16A 4G0MA 4PVDA 2R6ZA 5JS2A 1O95D 2WSSD 3GBVA 4QFDA 4WN3A 1WXHA 1D2RA 3OUTA 2CE7A 3NCHA 3LRPA 4HN2A 4R41A 2A9QA 4UAJA 5DNVA 4ZVLA 4DTIA 3QNUA 1L5HA 4E1BA 1XNRB 2J41A 5COBA 3JXDL 4BE4A 4UHKA 5E4JA 4YQFA 1NFQA 1T10A 2NN3C 2GETA 4ISCA 2AUWA 2VVTA 3VAZA 1KI1A 5BVGA 2FFJA 4PSUA 4MUXA 1KI2A 3LL4A 1V1MA 1LSJA 1V7ZA 2XD4A 1SAYA 2QJTA 4DC9A 5EEHA 3I5UA 1JA1A 3HO8A 4F21A 2PJRA 1UM9A 1HOTA 1L7AA 2OFPA 2EFCB 5U1PA 3W5JA 5MFPA 2CHUA 1AO3A 1Q7GA 1ZU4A 3VKGA 1FFAA 3QTBA 4KO4S 1TCBA 1JMKC 5T4HA 1D9ZA 2XRFA 3I9OA 1GJRA 3LUJA 1EIZA 4PPGA 3N39C 4B6SA 2CFTA 4KQWA 3U44A 1CDEA 1YB2A 2JD1A 4TLDA 4GXRA 4RBNA 3MUFA 3HR4A 4OHCA 1JPNA 3I12A 3LBNA 3TIVA 3RVKA 3ICQB 2GZ1A 4ZRDA 1DBPA 1FRQA 3AV3A 1N8SA 3GFSA 2ECOA 4Z9BA 1FYEA 2JGNA 5ALNA 1FX1A 2CVZA 3X44A 2J9GA 3H1BA 5F3DA 5GJBA 3RYCB 2GJ9A 3IPLA 1FP7A 2AFIA 1AQUA 3UJPA 3GG9A 5EYPA 4AS2A 2DC1A 1TYBE 2C7RA 1PWHA 1WMEA 3I9NA 4DIDA 4DLPA 3LQKA 4KMOA 2WVGA 3V8NA 4DQ0A 2VSNA 2CXXA 1YRBA 1JQKA 2GZSA 2NXWA 1PR3A 4PSAA 3TBKA 1YDHA 1WXWA 2F59A 4UCWA 5DN6A 2B4YA 5CB6A 4L7VA 1FFXB 1S6YA 1NDUA 3DOFA 3K15A 1QB8A 4ON9A 4ZXFA 1U80A 2DGDA 4ND3A 2C8VA 1AN9A 2Q2NA 3DAOA 3IIKA 1SWVA 5TB5A 1K8QA 1JFLA 3JZDA 2X14A 5BRAA 4GLJA 1KY4A 5K6RA 2JGJA 2QTNA 1VYVA 3TSAA 3H8JA 5B58T 3OQ6A 3VK0A 2CNBA 3C5EA 1FYWA 1GUBA 3VYVA 4I4TF 4UCFA 5F5LA 1Y34E 4GPBA 1W29A 2E4UA 4DQVA 2H85A 2RJNA 1WW8A 1PNQA 2P9GA 2BY4A 1ESMA 3S6JA 2FB9A 2XZPA 3K8OE 1HLPA 1R0LA 5H9WA 3TJMA 4D9FA 4AK9A 2EKLA 4KR2A 5KQPA 3TQFA 4QVIA 3HB5X 3S5JA 3W0LB 1DWUA 2VDWB 4PNHA 1W36D 3W8FA 5EJIA 5T7BA 5DHFA 4LW8A 1Z5NA 5D2CA 5DT9A 3WGQA 1A97A 1LX7A 4YT4A 4NE2A 1QUEA 4WY5A 1R64A 1ACMA 5F9FA 3JATA 1YIDA 3LVQE 3EWSA 3EBOA 4DJ5X 2X5OA 1FNDA 2J4CA 1SC3A 4RY9A 3BDAA 3TX2A 1FB5A 1BEZA 4E4YA 1WCYA 3MEJA 2WILA 3EA4A 3GOQA 4YH1A 2GCOB 2VO1A 3PUYA 5FFMA 2YDYA 5KTTA 3I9V6 2E82A 3B51X 1WNFA 1PRUA 2VZ8A 3U39A 3Q4GA 4E32A 2JFZA 4N49A 1NJSA 4TRRA 1O4WA 3E4CA 3K30A 3INYA 2PUFA 2A92A 2QTFA 5CW1A 2OYCA 2DUMA 4NBNA 2R1VA 3AG5A 4AJ2A 4ENUA 3RF6A 3PJRA 1FUKA 1MJFA 2X6TA 1P74A 4U2CA 2B7CA 3H4TA 1M0WA 4XYEA 5CVVA 2VJDA 2I0FA 1O8CA 5JROA 1TYAE 3ABRB 3NANA 3ONVA 3B7PA 4NABA 3WXBA 4CM8B 1N6HA 2OESA 1RKBA 2PS1A 3CKMA 5BV1A 2FQQA 3VHXB 1QLHA 1ZSVA 4R8SA 4TV9F 1NRJB 4LX8A 3PL5A 3K16A 4TT3A 2R6AA 4X5OA 5AI6A 2Q0XA 3V8PA 1WDKA 3A9CA 5GVSA 2W6PA 3U81A 2RGDA 1EFHA 2WMDA 4GM4A 2NTNA 4FOLA 4NV3A 3MMZA 2BF7A 2HV8A 4KO3S 1WQ1R 4N01A 2VIIA 4MLCA 4Q3BA 3GJ3A 1ABBA 4RULA 5IDVA 1VLVA 2ZB4A 2NVUA 1BQEA 4LJYA 5LQAA 4RZUA 3R7WB 4GH5A 4J2TA 3G0TA 4BFUA 3U37A 1DEOA 4DWJA 1T2FA 3EIXA 3QX3A 2ERXA 4KIGA 1ZZ7A 5FPPA 3K0FB 4DLRA 4ZYWA 5IBCA 2HMVA 2M6KA 1E5TA 1BRMA 1M2VB 1OT3A 2FN3A 2R66A 1T9GS 3D7NA 4RQBA 3ZV6A 4CIYA 3GVIA 4H6XA 3OX1A 2VP0A 2JEYA 3SBXA 2C9DA 1ZCBA 3ZH9B 1J5XA 1F4PA 1O94C 4PO3X 4B4OA 3AYXB 1VBNA 3W6OA 3ZLTA 4EHBA 3QRWA 1ZUNB 5DTEA 5C8YB 5DNWA 3G68A 3T7RA 4GX1A 1PJQA 4HXGA 4ZCSA 3EXAA 2W2LA 2GR9A 2Q9UA 4EP1A 1OGJA 1QFYA 3A4LA 3I04M 3CLUD 3CW9A 3M9WA 3EMBA 4Q1EA 5PNTA 1KYTA 4D0NA 1V37A 3ENNA 2WT4A 3BXHA 4ZOLA 1GN8A 5EWJB 4Z3KA 1XRPA 4ZIRB 4KB5A 2OQRA 1C3VA 1R9JA 3KUDA 5J5CA 1G3MA 2X2EA 1NONA 1MAAA 1N2GA 1W49A 1W4AA 2HJWA 4YVFA 2PYDA 3T4PA 3NV9A 3IDSA 1GPBA 2P3QA 4KR3A 4J03A 1BMTA 4KJXA 4BFCA 1CUDA 1T3HA 3B52X 4GX2A 5JSZB 2IXFA 1G59A 4RDCA 2GF0A 4TUYB 1DC5A 1Q0SA 2TMKA 3UJ6A 2IYYA 4I99A 1OAOC 1CP3A 2I29A 4G0XA 5ALXA 3BGOS 4C87A 4O2BA 3EUWA 2XI4A 1XV5A 3SJUA 4YG4A 4M1WA 4NDWA 4X4IA 1Z26A 1CS0B 1MEJA 1KYWA 3FLBA 1VHLA 3CUUA 3GJ7A 4OUDA 3VSBA 1RHUA 4YJFB 5AJUA 3TTVA 3BD9A 4DM4A 4MQ6A 3ZIAA 3WADA 2W6ID 2R8RA 3B8EA 3W8EA 5KWVA 4EGCB 2QN2A 4FKMA 4ODIA 2YVKA 2WM2A 2WMOB 1NTOA 1U4OA 1FXSA 4KIWA 1KSJA 2OD2A 1WZCA 4NPAA 1DKNA 5F52A 2AUNA 1MU0A 4OHZA 3I73A 4AD8A 3QVGB 5AICA 3UN1A 2GJSA 5CHEA 3KZXA 2HXYA 2D8AA 2NSJA 3A37A 4IV5A 4Z7NB 1LB1B 5BN1A 2QWXA 1QJ4A 4IIBA 2BGJA 1JHMA 3QYFA 4WZZA 2RAPA 3EY4A 3BK1A 3P9KA 5KQRA 2DBRA 1HYEA 1Y82A 2ZXUA 1QANA 4P84A 4JC0A 2HPHA 5B4TA 3F9CA 8GPBA 1G63A 3N3AC 3T7AA 1D7OA 2XVAA 2CF5A 1P9NA 3BMXA 1U3FA 3MLAA 2H7YA 2ZRLA 2HIMA 4F1KA 4Z7OB 1EYZA 9ATCA 1JNXX 2YQ4A 3VPHA 4BRZA 1AH2A 4EIWA 1XTIA 4LZAA 5C5EA 3LW7A 5B3JA 1Z8HA 4Z0PA 3LE8A 3JYLA 1Z4MA 4JBWA 3P0RA 1PQYA 5ECGC 2YNMA 4N1AA 3GELA 3EZYA 3OHPA 4ZOAA 2AW5A 4WINA 2J3DA 1GPNA 5JJBA 1S2GA 1IOVA 1K92A 3TOSA 1KH1A 1CW2B 1WCIB 1UIMA 4A2QA 4QE3A 1PSDA 1A5ZA 1HUQA 2WOJA 1ZC3A 2ZAYA 1XROA 3KAQA 4YO8A 5AKGA 1V6AA 4F96A 2J31A 3WMWA 4J49A 4I8TA 2P90A 1M2OA 3P97A 4U3JB 2YJZA 2ZRCA 3QF3A 1NPDA 2QR2A 5CGQB 4ZYZA 3GUYA 1IBMB 3W9YA 4PG8A 3DBLA 1BDHA 1GP2A 4FZJA 3RBVA 4AKTA 1P39A 2O1XA 1YU9A 2CLSA 2X4GA 3E70C 4BKMA 3IMCA 3GRPA 5AXCA 5AD1A 2C0PA 1K5DA 4C3OB 1X3SA 4BC1A 4MH0R 3ODPA 5CM8B 2RH4A 3OOYA 4LCEA 4ME6A 5JAOA 2MQKA 3G0CA 3M81A 4WJLA 4FN3A 1ZD8A 2AXQA 5BWLA 4F2WA 4HDRA 4Q48A 4UDXX 4DJDC 5JRZA 3T3HA 1PDOA 2A8YA 4PAGA 1VIVA 1W44A 4LY0A 2AJBA 2ZJBA 3CXUA 3IAS1 1HT0A 1KE1A 5JS1A 1LMB3 3RHTA 3NT5A 4I6RA 1QH1B 3O8CA 1G5QA 4JKYA 1NGSA 1WCXA 4PLHA 2FPIB 3GARA 1G64A 2YY7A 3VTFA 2B2CA 1GQSA 2NT4A 1GWNA 1O7JA 5JNVA 3VTZA 3CECA 5G1NA 3UA4A 2WZCA 1C9EA 1GILA 5F7OA 4BWVA 2OG1A 1SCBA 4ZOLF 5K4GA 4K81B 3SDSA 1RPTA 4HTFA 4BN0A 3CBGA 3EVAA 3U3MA 3MT9A 1S89A 2D2VA 2QRKA 1VHTA 4H6WA 2BP7A 4QEZA 4PC6A 3RFCA 4YRRA 4AMZA 1N75A 3ZNNA 3L92A 4LRWA 1P3JA 2CBGA 4HXYA 2XXJA 1IHPA 2Q3MA 2V5AA 1T5SA 2HPAA 4ZZ0A 3RZZA 1CSEE 1FVOA 4A6DA 5FPHA 4O2BF 1JR4A 1MF7A 1QQTA 1NVTA 2IJGX 3C48A 3IXLA 1X8LA 2GBIA 2QROA 4BRUA 2ST1A 4BAGA 5KYKA 3HZHA 2FUG1 1ZISA 1SZPA 1BAPA 3EEQA 1N32B 1W76A 2NNLD 1UK6A 3NC0C 1OF1A 5CX4A 3FMYA 4TL8A 4RL6A 2Q1WA 1Q1QA 3LHKA 4EJSA 2F9MA 5IHPA 3JQEA 3IXMA 4WDQA 5JYDA 1DEAA 2GN8A 2CDRA 4JP2A 1X7WA 3A6FA 4MCJA 1VJ5A 1JDVA 3CZ9A 1VPLA 3D3JA 1M2GA 3CZ5A 3JD2A 4JN6B 3C41J 3MWDB 3BFVA 5FEMA 1AXEA 2NU9A 4FTWA 4IV0A 3A1SA 4J0IA 1KFEB 4ER3A 1O97D 3FTCA 1IZYA 4LC9A 4D0SA 2QXYA 2V6FA 2ZB8A 4LNUB 3ZHBA 1EX9A 2BBOA 5DCUA 3DJFA 3SCZA 3EFOB 3W1WA 3VZSA 3ZY6A 2HXSA 4ZEMA 1LVUA 4XVQA 4RV9A 2WIDA 1U9CA 3K2BA 1IAVA 1DIGA 3MG9A 2CVQA 4MS1B 1L8QA 3VR6D 1QZZA 3ML1A 4A6PA 2YRWA 1YJQA 2ZJ7A 3D7LA 5TLSA 1M6WA 3VU3A 4LDJA 2J7PA 1J2YA 1EWKA 4DZRA 3J7TA 2DQYA 4WOCA 1IQPA 3RM3A 3EFBA 4D46A 3PT5A 5FQNA 2OCGA 3GB9A 1L3IA 1MPTA 2C1EA 2OBYA 2OSBA 3P27A 3NIWA 4QPPA 1L6IA 2R8ZA 2PUTA 2Y0EA 2NZWA 1B73A 2VUIB 2HINA 4L0QA 2P7IA 3K92A 3OI7A 4C7KA 3C43A 4GBMA 5F5XA 4A73A 4AJKA 4O59O 4PV7A 5ARBA 1ZCFA 1PQ4A 3WJ2A 1VKNA 1LDEA 1LWNA 3QEOA 4S35A 1I30A 1WZEA 3U48A 4D45A 3BQMB 3NDBB 1P45A 2A14A 2G1PA 1U1EA 1NNI1 4R7ZA 2DTXA 4BN4A 3LSTA 4PINA 4YRFA 4QOFA 3O8NA 3ZE6A 2DEUA 1PO7A 2X19A 1KMNA 3QMVA 2YIVX 3FCSB 1WB5A 3RWBA 3U26A 3Q1LA 4HD8A 5FORA 3QOYA 5A0VA 4RE6A 3HM9A 1WB9A 1ZD9A 1DLIA 1W34A 4MCXA 3KZVA 5FPTA 5FD8A 4D26A 3S81A 4Q4AB 3NAMA 5HUHA 5DTMA 5ERGB 5IXJA 3CKKA 4RHXA 4KQEA 4REQB 4GC5A 4WX2B 4ZAVA 3F4BA 5C0OE 1TTPB 1ZITA 2AYXA 4W6QA 2G6TA 5BNTA 2QMQA 1ZZ8A 1UINA 3GFPA 1DBVO 2ZAGA 3E1KA 3I32A 3KAPA 4ZREA 4LF9B 1HDIA 3TPFA 2F3QA 2EP5A 4HRXA 2BELA 2X3UA 2Z2XA 3G02A 3OIUA 1MO6A 4OXXA 3P20A 4PE5B 3S40A 3GZJA 4ZYXA 5IANA 2I76A 1R4NA 1ZVJA 2B4RO 2PT5A 2VOJA 1PJ2A 2WJWA 3HKDB 2HL6A 4IRUB 3SC4A 4HDAA 2C8KA 2IYFA 4CMJA 3RYFB 5JSHA 1AJEA 1M8GA 3PXEA 3W8RA 3OZBA 4IR7A 2SKEA 5CG2A 2OXCA 3T12A 1N8TA 2PKQP 1JJBA 4D4KA 4BFTA 2D0OB 5FAKA 3T5PA 3CR8A 1MIHA 1WB4A 3F67A 4OQQA 2AMYA 1UP4A 2FPWA 4DOMA 4G2TA 3GMDA 4BFXA 3LBFA 2CUNA 3AFIA 3ZDCA 5DGHA 1UL1X 2QL9A 3IXQA 4QBTA 2GHRA 4KYUA 5L3QA 4EH1A 3OQOA 4JUCA 2ROQA 1G41A 1ZINA 4WESA 1B74A 2DKNA 3DZKA 4M8IA 4BQNA 3NG1A 2MT9A 2VKQA 3L1UA 1KXJA 2XGSA 4ZGBA 4TVKA 4XVRA 3S1SA 4PYOA 2VYFA 1QHHB 4HDMB 4OM8A 5KBYA 4PC7A 4RZHA 1QJCA 3LGXA 2B21A 1VLJA 1E92A 3KPVA 4DJAA 3LTNC 1H3EA 9MHTA 4HFNA 3A70A 3GPCA 1I24A 1YDWA 2IEZA 3FWNA 4XYBA 4BDTA 2H54A 2PR7A 3T9EA 1JZSA 2OYRA 5FPKA 3OPYB 1EP9A 3V46A 4KYIB 3WLOA 3CTPA 1YZGA 4KOAA 4EQ6A 5L53A 2PJDA 1XF9A 4PYJA 2XTAA 1I7SB 2P68A 2QRMA 4WZAE 1Q20A 3SC6A 1NVMB 3TZEA 3T5BA 5CT9A 1NASA 3ZKWB 5CCXA 1FEZA 4C9BA 3EGDA 3A1NA 3HCNA 5ALOA 3VZBA 3LQ4A 1KP9A 2V0GA 1T9DA 1CUYA 1L5YA 3QVTA 1ZZGA 3BBLA 1MJNA 3QNMA 3PDWA 1IWBB 4NXNB 3RIYA 3AKDA 4UTXA 4DC1A 1ZW1A 3OQMA 1COWD 1KEVA 1WUYA 2FY8A 2VBFA 2IBMA 2P4QA 3IJPA 3HLKA 2CLHB 3H5NA 4LTDA 1TVCA 2V7QD 3OBBA 4DYDA 4C5CA 1ODSA 1SVUA 2AB0A 3FYHA 4LKOA 4Y30A 4O8CA 5BWNA 2R1UA 1O89A 1K06A 3C7KA 3HJRA 3CPHA 4HMOA 2ZCJA 2DHQA 1W2HA 3IV9A 4XIJA 3HABA 3CEAA 1T8WA 2EHDA 2LRHA 1R16A 1XK6A 2G0NA 2HY7A 2R4TA 1D2MA 2R1TA 4JJKA 5K6TA 3P9RA 1ODJA 3RGGA 1MV8A 1GPKA 3B9RA 4FE7A 4RWEA 1R9MA 4I3GA 4Q7LA 3TKLA 3ROZA 3KWMA 5GIPE 1X7XA 3BIWA 3GLSA 4LFAB 1UFRA 3NJ8A 4P4GA 1BXGA 1M66A 3KJGA 3Q15C 4D79A 2Z30A 3O8DA 5A7HA 1GZVA 2Q3DA 1C9YA 3IT3A 4KZPA 1GVNB 1Z4LA 5DNDA 1G5PA 4F1JA 1M8KA 4ITUA 4X65B 3HJCA 3NO4A 2W8BA 1E62A 3RC9A 1DQRA 1QHGA 3EPLA 1SU8A 2PGAA 5B4UA 5ALKA 2KJQA 3GZTB 1RPEL 1C8KA 4FBMA 4YG1A 1MRSA 2X8BA 4GBGA 3EIEA 4OI2A 3T0FA 3DAGA 3T41A 5L6MB 2FWIA 3PXXA 4AL4A 4F4CA 5C3UA 4FE4A 4X4BA 3IODA 1ZIDA 3D7SA 4L9SA 3KPUA 4R40A 4ZYVA 4CEIB 2Q07A 1UMCB 8OHMA 2H2DA 5D5HA 2CHQA 2PGLA 2Y1FA 4ENTA 1ZXXA 3DE3X 4BFVA 3OT1A 4DLVA 3DZGA 2R0QC 4RGQA 2K4MA 1SUWA 2B2XA 2Q27A 5KYXB 1ZVKA 1NW3A 1UPXA 2UKDA 3C4VA 1VPDA 4K6MA 2QUBA 5DULA 3OE7A 1BSVA 3C6ZA 1YDEA 4G86A 1ND6A 2NSHA 2QTAA 4JOSA 2P5TB 3FMPB 3ETLA 3QPVA 3JCZA 4FFDA 4NH0A 4XH9B 5G0TA 3T52A 1RVV1 1UWVA