5DTQA

Crystal structure of dot1l in complex with inhibitor cpd3 [(2,6-dichlorophenyl)(quinolin-6-yl)methanone]
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
328
structure length
320
Chain Sequence
LELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMENYVLIDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTNTRPSTGLLRHILQQVYNHSVTDPEKLNNYEPFSPEVYGETSFDLVAQMIDEIKMTDDDLFVDLGSGVGQVVLQVAAATNCKHHYGVEKADIPAKYAETMDREFRKWMKWYGKKHAEYTLERGDFLSEEWRERIANTSVIFVNNFAFGPEVDHQLKERFANMKEGGRIVSSKPFAPLNFRINSRNLSDIGTIMRVVELSPLKGSWTGKPVSYYLHTIDRTILENYFSSLKNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Optimization of a Fragment-Based Screening Hit toward Potent DOT1L Inhibitors Interacting in an Induced Binding Pocket.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Histone-lysine N-methyltransferase, H3 lysine-79 specific
total genus 103
structure length 320
sequence length 328
chains with identical sequence B
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2015-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08123 DOT1 Histone methylation protein DOT1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.60 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) 434 Repressor (Amino-terminal Domain) 5dtqA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5dtqA02
4YUWA 1ZG3A 1YF3A 3LKZA 3LKDA 2O06A 3KPUA 2YQZA 1ZGAA 5CM2Z 5CUQA 3KQTA 3LCUA 3PFGA 3EMBA 3KPJA 4KWCA 4K6MA 5DLYA 1TPYA 5LQAA 5EKUA 4P7JA 1UWVA 3OE4A 3B89A 2ZIFA 4WVLA 3E05A 2IP2A 2ZIEA 2OY0A 3LSTA 3ME5A 4A6EA 4YUZA 2PXXA 5JR3A 2Z6UA 3DUWA 4AUKA 2HTEA 5HFJA 2CMHA 4PCAA 5D1NA 3EPPA 2EG5A 5E9JA 3EMDA 2I7CA 1JG1A 3OE5A 4YV1A 1NW6A 2BR4A 3FTDA 3BXOA 4R6XA 1RJDA 3OZTA 3FRHA 1EJ0A 3LDFA 4U7TB 5T67A 3NW9A 3UJ6A 5EMJA 4RTNA 3DTNA 4OBXA 3GIWA 5FADA 2XVAA 4XUEA 2AOWA 1F3LA 2P41A 4X1OA 4FT2A 5E1MA 1INLA 4ZTBA 1JQ3A 3UZUA 3GWZA 2IPXA 4Y2HA 1RJFA 2P3OA 4PYMA 5ERGB 3R24A 2CMGA 4E31A 4RSRA 5K09A 1T43A 2ZLBA 4FT4A 4XUCA 5ICCA 4FSDA 1BC5A 3P2KA 1X19A 2UYCA 2K4MA 2O57A 3K6RA 5FCDA 4E2XA 4ER0A 3D2LA 1EG2A 1YZ3A 3DXYA 1I1NA 1PRYA 2QYOA 4AZSA 2YVLA 4EVIA 1RI5A 3EVFA 3UJ7A 3HA5A 3TM4A 5C1IA 5EC8A 2P3LA 3PFHA 1BHJA 4DM3A 3G5TA 2ESRA 5HOQA 3GJYA 3C3PA 5DRYA 4QTUB 5E1BA 3X0DA 5JUWA 1D2GA 1KYWA 3JWGA 3JWJA 4KIGA 5DTQA 1XJ5A 4ER5A 1XVAA 2PY6A 2XYQA 3BZBA 1EQAA 3PS9A 2YX1A 4IV0A 2G72A 3KQQA 4RTSA 2Z6QA 3EVGA 2V7EA 3PX3A 3QOWA 1WZNA 5E8JA 3DOUA 1NBHA 1QYRA 2ONZA 4GBED 5K0CA 9MHTA 4LWPA 3HCBA 4QDKA 4CTJA 2ZZMA 1X1BA 2BM8A 2P1DA 3DLIA 3GCZA 2AOTA 1QAQA 2PKWA 4DKJA 4MQ4A 4EQZA 1NW8A 5LQRA 1ZHFA 3DMGA 4YUVA 4HTFB 1Q0SA 3I64A 3TR6A 2O07A 2QRVB 2GS9A 4AZWA 4DF3A 3O7WA 3RIEA 5CD1A 2QE6A 5DXJA 5EMKA 3MB5A 3HVJA 2PBFA 2B2CA 1HNNA 3GRRA 3FUWA 5CVEA 2AN3A 1F38A 3A25A 1G55A 4E2WA 3UJCA 4P58A 4AX8A 1YB2A 1KXZA 5EHGA 4YUXA 1DCTA 1AV6A 1KIAA 2AOVA 1EIZA 1WXXA 2AOXA 4GOMD 3KR1A 3G89A 3BT7A 3BWCA 3KQVA 3GDHA 7MHTA 1H1DA 3KQSA 4OQDA 5LSAA 5GINE 3P2IA 1ORHA 3FPFA 3Q87B 4OA8A 2IFTA 1R6AA 1XDSA 2YXLA 3KQPA 3LCVB 4PGGA 4AZVA 2ZZNA 4ER3A 4E33A 2PSSA 5EOVA 2HWKA 4GC5A 2YR0A 2YXEA 3KQOA 4MWZA 1ORIA 1Y8CA 5BXYA 3AY0A 3PTAA 2PX4A 2GB4A 2AOUA 5DT2A 2FCAA 2GAFA 4RTMA 10MHA 5H02A 5HIKA 3KR2A 3CC8A 1JSXA 3BKXA 2R3SA 2UYHA 3DMFA 4L7VA 2G70A 4EK9A 5F2OA 1G6Q1 3GRZA 3FTCA 3NDJA 4DMGA 4P7FA 4BLVA 5GIPE 2NXCA 2OPBA 3BWMA 5KVAA 2P3QA 4CKCA 3M4XA 3P9KA 1O54A 4A6DA 5ICGA 3E8SA 1XXLA 3REOA 5MHTA 2XVMA 1AQIA 2PX8A 3I58A 4YUYA 3FPGA 3T0IA 3P2EA 4ER6A 1JSZA 3R6TA 5FA8A 4RX1A 4F86A 2VDWA 4P7KA 5E2BA 3A26A 2Y1WA 3MGGA 1XCJA 4KIFA 4FP9A 4R6WA 5E8RA 2C7RA 3DMHA 3R3HA 4QQKA 5FQOA 2AN4A 2NXNA 2PVCA 3HCAA 3EVEA 3DXZA 2Q41A 3GO4A 2JHCA 3JWIA 2UZ4A 5DM4A 3RODA 3EGVA 8MHTA 1X1CA 2ZCJA 2NXEA 1N2XA 2NP6A 3AXTA 3SXJA 3HVHA 3C6KA 1KHHA 4HG2A 1L3BA 3EVAA 1NV9A 3MCTA 3QV2A 3O4FA 5K0JA 5CCXA 5K0EA 4PYKA 1WXWA 3T7TA 5HIIA 1NW5A 3FPJA 4BLWA 2N47A 4P7GA 1U2ZA 2AN5A 2IH5A 4HC4A 1VL5A 2FK7A 3FPEA 3EVBA 4NECA 4C4AA 3HNRA 5LR6A 3GRUA 2XBMA 3DULA 4GUAA 1NW3A 3OCJA 1Z3CA 3HP7A 3NVMB 5KQSA 4RTOA 2IBSA 2PXCA 2R6ZA 3BGIA 4PYOA 4V0RA 4XCXA 3GNLA 3LHDA 5EG5A 1KPIA 1JG2A 2ZBPA 3MERA 1EAMA 2PT9A 3G8BA 5EZQA 4PYIA 2OXTA 3C0KA 3SMQA 2AOUB 2OYRA 1D2CA 5F2NA 1L3IA 1Q0TA 3R9XB 2JJQA 3M6VA 2WK1A 3FPHA 3DR5A 4PWYA 4X41A 2BM9A 4PCLA 3KPWA 3TOSA 4BP3A 3E23A 1YFJA 1VP3A 5E9QA 5GP1A 5T6BA 3G2OA 4CKEA 2NP7A 3M6XA 3NTVA 3G2QA 3KQWA 2VZ9A 1NW7A 2PWYA 3EEYA 3UFBA 2ADMA 3P9NA 1P1CA 1G8AA 3FUXA 3P9IA 1XTPA 1R00A 4YMHA 3HTXA 3H2BA 3GGDA 3OZRA 4M36A 5CVVA 2DPMA 3TM5A 3EVZA 3KQMA 3M6WA 1MJFA 1DL5A 2P7IA 3UA3A 1IXKA 2AZTA 2PWPA 5M5BA 4DQ0A 2YTZA 3BUSA 1FP1D 1M6EX 1RJEA 3A7EA 3LX6A 4E2YA 4PONA 5HILA 1O9GA 4E32A 2Y1XA 5IH3A 3SSOA 3UJAA 3FRIA 5EZSA 4KDRA 4KVZA 5DSXA 2B3TA 3MHTA 2JHAA 4CXMA 5EEHA 2OB1A 3BWBA 3ORHA 4RVGA 5EHIA 3NWEA 4GOLD 5IKMA 3FYDA 3PB3A 3U81A 4B17A 5LQJA 2ZBQA 1VP9A 3IV6A 3TQSA 3UA4A 3EEOA 1R74A 3UJ9A 5K05A 5CVJA 4C07A 2ERCA 2VDVE 3AXSA 3GRYA 2CL5A 2HV9A 3P8ZA 5K8VA 2WA2A 1ZGJA 2FHPA 3HCFA 4RTQA 4OQEA 4YV2A 1JR4A 2I9KA 4OX9Y 4QVGA 4X63A 4CKBA 3CJRA 3P97A 5DM0A 3HEMA 3GXOA 3VSEA 3B5IA 2DULA 3KPVA 2ONYA 4KRGA 3ELDA 3OU2A 3PVCA 2F8LA 5FWAA 4C05A 3B3FA 3R0QA 1VE3A 1TW2A 2OKCA 4RVFA 4DCMA 4RVDA 1XDUA 3OPNA 1X1AA 3G7UA 1HMYA 3HCCA 5C0OE 1AQJA 4FS8A 5ICFA 1M6YA 1KP9A 3AJDA 2ZWAA 3HVIA 3KKZA 5EMLA 1R18A 5E9WA 1P39A 4G56A 2ZSUA 3HA3A 2UYOA 4BP1A 2GH1A 4PYLA 3CCFA 3EVCA 1FJXA 2O05A 3ELWA 3TMAA 2JG3A 5BP7A 2H00A 2AOTB 2ZIGA 3BGDA 3HM2A 5FTWA 5D1HA 4FSXA 2GLUA 1G60A 3TKAA 3TPZA 1OR8A 2CKDA 3MCZA 3UWPA 3ERCA 3OFKA 4PGHA 4HH4A 1UIRA 1NE2A 1VLMA 3O31A 4HGZA 2PT6A 2IDJA 3PX2A 4KW7A 4IV8A 2VS1A 5KS2A 3KQYA 4BY9E 5DTRA 4X61A 5GIOE 4LECA 5CVUA 3DXXA 4PYQA 5GOZA 2P35A 3GU3A 4OBWA 4C08A 4E70A 2G8NA 1G8SA 2G71A 1N7IA 4HGYA 5LQNA 1R8XA 3FTEA 1FP2A 1B42A 1KPHA 1NV8A 1SQFA 2I62A 4LG1A 4AZTA 5DSTA 1IM8A 1BKYA 1SUSA 3FUUA 3MTEA 1WY7A 5B1SA 5K01A 2G1PA 2EFJA 3IHTA 1XCLA 2P8JA 5DXAA 4E2ZA 5FA5A 1I9GA 3V8VA 4PIPA 2FRXA 2OZVA 1SG9A 4IKPA 2HMYB 5K0NA 1M0EA 1KR5A 4RTRA 3LCCA 3CVOA 1EJ6A 2QM3A 5DM1A 2ZTHA 5DM2A 4HRAA 4HSGA 1RI1A 1JQDA 2ORED 2E5WA 2GPYA 5EVJA 4DZRA 2H1RA 3FUVA 1V39A 2ZFUA 5GM2A 2PV0A 2ZW9A 1JG3A 1KPGA 5DX0A 5HIJA 1VIDA 1XDZA 3NWBA 5EMMA 3UJDA 4DA4A 2NXJA 4RTJA 5P8WA 5HEKA 2B25A 4GOND 4KDCA 3IEIA 2PX5A 4O29A 4POOA 1G38A 4Z2YA 2AR0A 3B3GA 2VDUE 1D2HA 3A27A 3OZSA 3LL7A 5E1DA 3T7RA 1R8YA 5BW4A 1VQ1A 3HA7A 3HVKA 3VC2A 2FPOA 3RW9A 5ICEA 3P71T 4Y30A 3EVDA 3I5UA 2PX2A 3TKYA 3IYLW 1RI2A 1YZHA 2BR5A 1L3CA 4HTFA 3I9FA 3B7PA 2QRVA 4QPPA 1JTFA 5FHQA 5LQUA 2P7HA 5K0GA 5KYGA 3A7DA 4JXJA 4CWAA 4PYNA 3FYCA 4R8SA 1KYZA 2JHPA 3BKWA 3LGAA 4PIMA 3HCDA 5T64A 5FUBA 4MIKA 2Z6AA 2OO3A 5FHRA 2EJUA 3TLJA 3G88A 1UFKA 4BLUA 3KHKA 2B9EA 3DLCA 3EGIA 3ELYA 3PT9A 3SM3A 1MHTA 3QOXA 3SSNA 5LQKA 2ZULA 3SX0A 1JTEA 3I53A 3L8DA 3NJRA 3TRKA 1RI4A 1VBFA 2JH9A 2H11A 2HR1A 2QY6A 2OBFA 5GWXA 5HZMA 3SGLA 1ZQ9A 3NDIA 3T7SA 2C7OA 3G5LA 2EX4A 1AF7A 1IY9A 3VC1A 4EKGA 2P40A 4FZVA 3BWYA 2ZBRA 3KR0A 2PGXA 3LBFA 1P91A 3MTIA 2BR3A 5FULA 3UJ8A 1P1BA 3MQ2A 1YUBA 5EEGA 2YXDA 1NKVA 3ID6C 2IH2A 2C7QA 4LWOA 3THSA 3CBGA 2HNKA 3AWIA 4IWNA 2PJDA 3G2MA 4R05A 5EPEA 3CJQA 3NMUF 2EJTA 3UJBA 2IGTA 4C03A 5K03A 4U7PB 5KQRA 1FPQA 3LDGA 5EIWA 2IBTA 4C04A 4X60A 4WXHA 1SUIA 3P9CA 2C7PA 1L1EA 4XUDA 4UOEA 1PJZA 3EGEA 2IH4A 3DP7A 3Q7EA 3ER9A 2A14A 4M7RA 3A4TA 1NT2A 4MTLA 4RV9A 4CTKA 3S68A 2AS0A 1SQGA 3LDUA 3VYWA 2FK8A 1WS6A 5E1OA 5U4XA 4GOOD 3FZGA 3E7PA 5K0LA 1N7JA 5K0BA 2VP3A 3M6UA 4GC9A 4QDJA 4M38A 2LD4A 1FBNA 4QVKA 2PXAA 5FQNA 3OU6A 4E30A 3LECA 4QPNA 2JH8A 4ATNA 4V0QA 3ER8A 1QZZA 1YFLA 1RI3A 3HCEA 3M33A 5F2KA 4M37A 3NVKI 4EKIA 3ELUA 5EKXA 4EMSA 4C06A 5DTMA 4QQNA 1QANA 5DPMA 4ER7A 2UYQA 3V97A 5CIYA 4PINA 2OB2A 1TW3A 5EQJB 1BOOA 4F85A 3DH0A 3C6MA 2BZGA 4QTTB 3K0BA 1I4WA 2GA9A 3GRVA 2ZVJA 3ANXA 3LBYA 4PNEA 3PLAE 3KU1A 3G2PA 3FUTA 2ZWVA 2CWWA 4OA5A 4PYJA 3UBTA 3CGGA 3CJTA 2IIPA 2O0LA 2ZZKA 1O9HA 3JWHA 3B3JA 3BGVA 3WSTA 4RWZA 4R8RA 1SKMA 4DCGA 5E2AA 3KR9A 4FR0A 4RYLA 3KPYA 5FWDA 5DRTA 3TFWA 5DX1A 1X1DA 3FTFA 2B78A 4F84A 3THRA 2V74B 3SVZA 1QAOA 2NYUA 5DX8A 5K0FA 3SSMA 1WG8A 3OU7A 2WA1A 4H0NA 4RTLA 4FGZA 2AVDA 3CKKA 2NNWB 2AVNA 5DWQA 5CCBA 2KW5A 1ZKDA 2XYRA 3G8AA 4YV0A 5EIFA 2PLWA 5EGSA 1QAMA 3F4KA 3M70A 3LPMA 4MHTA 1VPTA 1RJGA 4RTKA 5C9ZA 4RTPA 2BH2A 1SVUA 2FYTA 4ISCA 3OFJA 3C3YA 4GEKA 4GF5A 1DUSA 2I6GA 5LQCA 5GM1A 5G02A 1L9KA 1NBIA 5HIMA 5BW5A 2YUIA 4YMGA 3SR4A 4RVHA 4GQBA 1JG4A 2IDKA 2XYVA 1JQEA 3MAGA 5CVDA
chains in the Genus database with same CATH superfamily
3GOHA 1CNMA 5F5LA 5CU7A 3I5MA 3N1UA 5KREA 2CCKA 1AKNA 1GGNA 2JGEA 3SJAA 3T8YA 5B3LA 1EHYA 2VCYA 4JL6A 5I47A 1MB9A 2RKOA 2Z8ZA 1GT6A 4A8TA 1F51E 1NULA 2OMEA 2R6AA 4G63A 4K6MA 1V4VA 4HWTA 1X1SA 4O4IF 5DLYA 3RVLA 3WDSA 3ZI7A 2A4MA 5JLAA 3GFTA 1V8OA 2ZYGA 4D9NA 1C7QA 1T3HA 2ZIEA 3E5RA 1HFKA 1OFVA 2I55A 4IDQA 4D3DA 1VG0B 5B7PA 1KI3A 3I5XA 3DSRA 2PUDA 1KDRA 4G5QA 5LWQA 2IBMA 1GG9A 2X0EA 1I1OA 4I8IA 4WVFA 1VA4A 2WM9B 5KAPA 3TK1A 4C6SA 2I7CA 3ONVA 3ROTA 2BR4A 3HH8A 1ACJA 1X2EA 2HIMA 3X1DA 3OPVA 3P96A 2OO5A 1E1RA 4RPCA 2B92A 3BH7A 2EDAA 5B3KA 4DQLA 5LN1A 4B7CA 2F3RA 3Q7RA 1NBMD 2P41A 1NZDA 2VBGA 3DDOA 3F5QA 1S8OA 2AI3A 4MS1B 4YRKA 2ZRBA 3LLUA 3P9PA 1GPNA 4DLAA 3R0VA 2CK3D 2VJQA 3LV8A 3K0AB 3L0DA 1NASA 5L95A 3G0GA 1MORA 4WN9B 4OEHA 4D8VA 2PH5A 2AFIE 5AJXA 3LY7A 2FMUA 4IHKA 4KXLA 3ZE2B 5L4SA 5LOVA 1A50B 2AMYA 4PN3A 1N9KA 3OQNA 3H8JA 2CL6X 1ISHA 4RPLA 4Q01A 2EQAA 2QX6A 3ODGA 2OO7A 3VYUB 2XBUA 3UHJA 5DHUA 1J39A 1R5JA 3AHIA 2EX1A 1OV4A 2X9NA 3M1AA 4GAEA 4TVOA 4UEOA 1YMVA 3ZD9A 1T9CA 4B33A 1R15A 1SA0B 2GEJA 2LE0A 5DRYA 3WAKA 2GO1A 2LW7A 4KGDA 1MG0A 4RVCA 3NYWA 4QM7A 3QFIA 1XJ5A 3GUYA 2CNDA 4CKBB 3ENQA 3PUZA 2Q9CA 4IZOA 4OHPA 4JSRA 4KBGA 3QIAA 5DHAA 4LXUA 2PXTA 4IXMA 3QUTA 1F1JA 1G9XA 2QU7A 5TGDA 1X1BA 5EE3A 3C16C 3P5SA 3I8XA 5K3FA 3UMMA 3WK6A 3HU2A 2FJ0A 1RWNA 2AUWA 1L5OA 4EMTA 2VZLA 1ZHFA 5BSWA 3EYAA 4LFAB 3TL6A 1MX3A 3MD0A 1SAYA 3V3TA 2O07A 3BF8A 1G2OA 2VFAA 3UBMA 3VGJA 2PM8A 1Z07A 1XJWA 1ZC4A 5CD1A 3N86A 2FX5A 4Q4AA 1MZVA 2RDMA 4ZZ1A 1Z25A 1XPOA 3LRTA 2PBFA 3GRRA 1HNNA 4XOUA 3RVSA 4PC7A 3D6NB 2P5YA 3EXFB 4KBFA 1KOJA 4DCJA 2FWIA 1ZONA 3JALB 1V7CA 1O5TA 3KKQA 4XJVA 3TKLA 5EHGA 1SCQA 1W88A 3NAMA 1NSFA 4WN3A 5GZ1A 2AW5A 4ASUD 2Q28A 2ZRQA 1O4WA 4MS4B 2WD7B 1AURA 1XEWX 1YBVA 3OIYA 3PGMA 4Y9TA 5G41A 3ZE8A 4QNNA 4Z4HA 3BWCA 1U8UA 2V03A 1G3UA 3QFHA 1JJFA 4J1TC 4DPLA 4XIFA 1J06A 4EPXA 2BIFA 4MW7A 3B6KA 1YVRA 1OZAA 2RGDA 2XMZA 3K35A 2YWEA 4R9UC 3W9YA 1OH5A 2EBFX 1UPCA 3EPJA 4PHGA 1QH8B 4GPZA 3LF1A 4QYIB 4NMLA 2QD1A 1QKIA 3FHCB 1J8FA 1XZNA 1Z16A 2K2WA 2QJRA 2XTZA 1DQNA 4LZPA 4QXOA 2QMYA 1U7DA 1YDGA 2FGKA 2JK1A 5IP5A 4AVYA 1ABBA 4U2CA 2V0GA 3HB1A 4A9AA 1JJBA 3QVKA 2E48A 5K8LA 1P0CA 2BH9A 4OKIA 1LRJA 1RIFA 1W581 1YA4A 3BSFA 3ZJTA 1QORA 3QOFA 4ZPXA 1XRLA 1UJ5A 4G2TA 4GQAA 2C98A 1FXSA 5KWIA 5JO0A 5AVKA 5CXUA 3RANA 4FBGA 4WERA 1VHLA 2I29A 5HPYB 1K7EB 3QE2A 2PX8A 2QQFA 2F9MA 4G01B 4JLOA 3P2EA 2LCQA 1JSZA 1OD6A 4GI2A 3SC3A 1N2HA 1D07A 4RX1A 4F86A 4D9JA 3TZHA 2BKEA 4AMUA 2ZAIA 3G2NA 3LKVA 4KIFA 4Y8VA 2SNIE 5E8RA 3F6EX 1UKCA 2N0SA 2NTYC 3H8SA 5FQOA 2IOFA 1PTJA 2NUPA 1SHLA 2WWIA 5JNUA 4BX8A 1T9BA 2CUKA 1F2TB 3LUHA 4BWGA 4JT4A 1L4GA 3BCUA 2FE1A 3GO4A 3JWIA 3P4UA 4OXYA 2WPDD 2V4ZA 5DM4A 2QTFA 1XA4A 1GZ4A 3X1ZA 4XPIB 3N8KA 1CR2A 1S3GA 2EV9A 1YR1A 2JFYA 4JYPA 3T34A 4IF4A 1DBQA 2W6PA 5G3YA 2PD6A 3KL2A 4R68A 1JEJA 1MJGA 3I1JA 2PIAA 1JHDA 1OLXB 4MYDA 5E2IA 2J0QA 2R1TA 3IVAA 2WU3A 1WW2A 2X5OA 3LWNA 3N05A 2B34A 3DW1X 4RPGA 5MGBA 1LI7A 3NKFA 3DULA 1NYQA 2HWWA 3KZVA 3MJ4A 4ND5A 1PK7A 4OHFA 3DEHA 4G1UC 1SCBA 1GGKA 1P29A 2PR2A 5DNVA 1OKKD 4B81A 4Y6RA 1P2TA 4CDMA 4EG8A 3HXPA 4FDTA 1SUAA 2P5SA 1XVUA 2QG6A 4XD2A 1UMBA 2IHBA 2YWCA 3V8MA 3WLMA 1JR6A 3SMQA 3AEXA 2ZRFA 2EERA 2A0UA 1XZMA 3G0TA 2AOUB 2WAYA 3EC2A 5EXPA 1A9QA 5BSFA 3OO1A 2AYYA 3E7FA 4UHBA 3HFRA 4Y6OA 4X41A 3TX2A 5LD2C 1R0WA 1L5ZA 3R76A 5CFNA 3GAFA 2VPPA 5EHQA 1EK5A 2NU7A 1OTXA 2XJ9A 3AB8A 5AXDA 3UFBA 3BFKA 4C4PA 3PI7A 1P1CA 3RABA 1ZN8A 4IVPA 1G8AA 4IFTA 1K3UB 4PBSA 4MGZR 5D6OA 2JARA 3MUFA 1KA9H 4PTZA 3E22B 1OV6A 1XZBA 5CYOA 4KK4A 3KSDO 2FMXA 3R7NA 3TR5A 1U2GA 2UYYA 5FBQB 3L0PA 3M6WA 2P7IA 3GROA 3JRXA 3MD9A 4U9UA 1KAQA 3NZEA 3BUSA 4DQ0A 4PZEA 4YT4A 5M5BA 3EAFA 3SYMA 4JT8A 1N5IA 4P3NA 1FXWF 4TT3D 2R6CA 2MSNA 4HP8A 5AM5A 5HFNA 5IH3A 4BDSA 3HMKA 3TIXB 2JJ2D 4H9GA 4MKZA 3RD5A 5I51A 1QPBA 4K0KB 2JHAA 4HLCA 1H23A 3TOCA 4Z8YA 1F6BA 1T13A 3K5PA 4I1UA 2I2CA 3WGGA 4NE2A 3HRKA 4DIMA 4WBNF 3MXTA 2BGIA 3KUCA 4KYUA 2CJPA 4OHOA 2VHQA 5K05A 5JZBA 1X86B 2A5JA 3CLSC 3DZGA 3GRYA 3O0DA 3AF6A 1QM5A 3IOBA 3Q7SA 3K9HA 1I3NA 2WA2A 4QICA 2WLTA 3C43A 4JLPA 4YV2A 4KO1S 2C4HA 4CUKA 2CHGA 3PC4A 2GN8A 1SKQA 1FFBA 3EB9A 4XDYA 1W19A 1Z38A 2XDQB 4MQEA 2X40A 5AIAA 1H1LA 5A0FA 2O2GA 2F8LA 5HS4A 5KMGB 4UVGA 1B2RA 3V2IA 3GJRA 3R0QA 2HEIA 4XEHA 1P1KA 4ODIA 4TVSA 4YPVA 4QSMA 4RGVA 1SHZA 2Q9AA 5HF5A 1NVFA 2B37A 1YV9A 3CCCA 1BG6A 3FFXA 1WKBA 3VTZA 1F60A 4E94A 2NU9A 1ZQ1A 3KKZA 2C1EA 4P32A 3BMQA 3IAAA 5L3RA 4A5OA 4E1VA 3NBAA 1VSUA 2Y4OA 3ABSB 4GOJA 4J91A 2O3TA 2RHRA 1SQ5A 2D1RA 1YZNA 3KLNA 4J29A 3ELWA 2A58A 3M6LA 3G02A 4UBMA 5JSZA 1V6AA 1CEEA 1E3DA 4JB2A 5T4FA 1RCUA 2YC4C 1PS0A 5IAOA 4TYYA 2JIQA 4AKGA 3GQBA 2FZEA 4GOKA 1OR8A 4H18A 1W35A 2H9YA 3A1SA 5FUWA 4L5CA 5BRNA 1NE2A 3BTOA 3R5FA 3F6SA 2F55A 2CXXA 1U5CA 2IDJA 3IURA 3PX2A 4L4UA 4ZHQA 2PUTA 3KQYA 3H6HA 3WIBA 1O0BA 8AT1A 4I5DA 2H31A 5EHXA 3B36A 4OBWA 1W94A 2AC2A 2VAWA 2GOYA 2QRQA 1N7IA 1Y3IA 1S2GA 2HRCA 4D3SA 1X6VA 3KD2A 2DUMA 3PQDA 2OGUA 2FG6C 1DG1G 3MTEA 1FRNA 2XX3A 4X6XA 2KM1A 1XCLA 2P8JA 2GBLC 2JZCA 3IHTA 4QODA 4C21A 4D0LB 2QR3A 2FRXA 1KH2A 2NUBA 3BORA 1GEGA 4MV0A 4NH4A 3BXZA 3WB0A 4DEXA 3VPDA 5B4TA 2C2HA 2FUG1 4UTNA 2FRDC 4ZCMA 1ZK1A 1GT0C 3HL0A 4LMRA 2YWFA 1RI1A 1N2ZA 3PC8C 5CGZA 3UANA 4FM9A 1F8GA 2JASA 1P0MA 3PE4A 5IS2A 5AW1A 1GSOA 1UMCB 3ULKA 4PSDA 1DV1A 2KLBA 1PDWA 5TPWB 3ZLBA 2D6FA 1D2EA 1JVNA 4MB6A 3SCHA 1Q3TA 2G5PA 2PX5A 4H4CA 4MHSA 4W1RA 4Z2YA 1C1XB 2NUAB 4KX3A 2PUCA 3S44A 2DWOA 4BMOB 3WGTA 2XGOA 1IBMB 1SCDA 4NY1A 1ONSA 4MCHA 1K7CA 5A4KA 4MIYA 2V6FA 1U4OA 3ETJA 3IPCA 3ZZUA 4PRLA 1G8GA 1ESMA 1X8XA 3NGLA 5EJ2A 4D43A 3QYAA 3K71B 4UM9D 2Q1YA 4K6GA 4NNJA 4XEUA 1FZQA 3RUPA 1HY3A 3ZCPA 3HVRA 4G36A 2FPGA 4BQOA 1IUPA 1PU2A 4OX9B 2WJPA 1GEEA 2FW0A 1XYVA 2ZPTX 2RH8A 3L01A 2O8DB 2EDCA 1UUFA 2DM6A 2GBIA 1PQUA 2HIAA 2P7HA 2XYPA 5KSOA 2QX4A 2VK1A 2J59A 2NO9A 3HNOA 4PYNA 1KYZA 2FN9A 2WYHA 3BKWA 1U7OA 3C8HA 3LW7A 1Z4MA 4I3HA 3DZJA 1OTHA 3F52A 1MAUA 1C9DB 3DLCA 3IEUA 3KEOA 4Y9RA 3R1FA 1KS2A 4ZCTA 1WZCA 2IHNA 4M88A 2VA8A 3NASA 2XUZA 1E3EA 3GNSA 3HBAA 1S2NA 3FDXA 3WMRA 1V48A 3FPAA 3EG9B 3G5LA 4K88A 1AHNA 6REQB 3RBAA 4G07A 1SKYB 3BHNA 3FB4A 2KZ8A 1T1RA 2E49A 3MOGA 1ADBA 3N2KB 4TQ9A 1SY7A 2JIZD 1JAXA 1M2OB 3FDZB 5MFZA 2CY0A 4X1YA 3IVXA 1KDPA 3H5OA 1ZZ6A 1OSLA 2RC6A 4OP1A 1V3QE 3PTLA 4K0RA 2EGHA 1AHIA 3FCOA 1PNRA 1U3VA 4DR4B 5A0TA 3U3ZA 3LLVA 3HBLA 2Z9BA 2R751 3GLQA 2GN9A 3LQQA 1DCFA 4FZJA 4EW3A 5K03A 3IJPA 1FPQA 1SC4A 4TMFA 5EIWA 2CE2X 5B2FA 4FFMA 2DX7A 2NO4A 4DC9A 1BN6A 3VO2A 1OOEA 1BCSA 3R6GA 1PJRA 5IC4A 1TDJA 3LI2A 2D4AA 1P0IA 1TT5A 3PJGA 2NQTA 3M81A 3SMVA 2XGGA 1WF6A 1D6NA 1XZCA 2Y1FA 1YBMA 3OT1B 2IV7A 4GU5A 3BGWA 3GB9A 1S96A 1CQXA 3KOUA 1BH2A 2PD4A 4MW0A 4RD6A 3S68A 3QMWA 1E3TA 3W04A 3U7IA 3R0IA 2M9MA 3Q8MA 3Q40A 4M0LA 1NM5A 4L28A 1EZ4A 1G5IA 3NHJA 1GUZA 1K6MA 4KXQA 4M6WB 2WAMA 4ZGGA 4L85A 4YR9A 4NZYA 1Z5PA 3UMJA 2G7MC 2ID7A 3DAHA 3P9XA 4IZ6A 5ALXA 3EPLA 2VF4X 3LOPA 1VB3A 1G8YA 2IZ5A 2LD4A 5DHPA 4E5UA 4WA7A 4TT8A 3O74A 2FOLA 4F96A 2W71A 3OLZA 4QHYA 4RZXA 5KKNB 4FC6A 4C06A 3ABZA 3E0XA 1W6UA 3TZ6A 4I46A 2DHQA 4ER7A 1COWA 4ZAVA 5ADVA 1T10A 3D5QA 5JJ5A 1TW3A 2QTNA 1R50A 3BXGA 3D3WA 5IX8A 2P9TA 1NBAA 2BZGA 3HCWA 1XRNA 4IHJF 4LNHA 1BWSA 3ZHMA 2YN0A 1FB5A 4OMCA 3D1VA 4G1VA 4RY0A 1ZZEA 2HN9A 2HLNA 1H94A 1NVEA 5JD5A 3U4DA 3GN1A 1NMQA 4KIUA 3UBTA 4S35A 2YJNA 1NWCA 4L5IA 2VDWB 1WZUA 2Y27A 2VHEA 1HT0A 2E0IA 2XKKA 3U44A 5FLXA 1IK6A 1GA6A 3L06A 5REQB 1IZ7A 4OMFG 4ACAA 4WBNB 3E2MA 1IMJA 3NUQA 4A0SA 2J6IA 2CJWB 4NYJR 3UXEA 1LTQA 4CU2A 1X1DA 3BAFA 2HLDD 2J9FB 2WFAA 2G4LA 4IFIA 4RKFA 5DX8A 1RS0A 1SCIA 1T5IA 3IV9A 3MJSA 1N7GA 4G0OA 3CW9A 3EUFA 3SHTA 1IBRA 2IHKA 3AYZB 2EJBA 1JT9A 4D6YA 1T8WA 4I1YA 4CM8A 1AA6A 4D1YA 2CXQA 4L15A 3C5HA 4JLKA 3DBHB 4R3NA 4C0JA 3EXFA 2VHZA 2CMKA 4Q1AA 3E7WA 3JXDL 2CE7A 1YB1A 2HFJA 5JS7A 3W8FA 5KWVA 1GPMA 3DPUA 1E7SA 4PU8A 3RC8A 1DQZA 2ZI5A 3RI3A 2EFEB 4D4KA 1E5QA 2WMOB 3HGTA 4PGFA 1EUCA 2GM5A 4RF2A 1KI2A 1CIVA 1FLAA 4L76A 5CNIA 3U1TA 5IZCA 4LJ6A 3V48A 3DEZA 3TO5A 2X9LA 2HMUA 2O0KA 4M8KA 2DWUA 5BQPA 2P75A 4UU0A 3E7DA 3A1EA 3PE5A 1DXYA 4BO9A 1JDUA 1YF3A 3TPFA 1QXSA 1LPMA 2BFMA 2BAGA 1CUAA 3U4QA 3WGHA 3VHLB 1GPDG 5ALTA 3TW4A 3OTWA 2VTVA 4P3PA 3SCFA 3KSAC 5E6UA 3RFFA 1YHNA 3LCUA 1E3QA 1GG8A 3PFGA 1VKNA 2ZI3A 3B1JA 3RZZA 3IB3A 5DHRA 4P7JA 1KSFX 5DHTA 2VP0A 2LYRA 3HWWA 4IINA 4QYTA 3TAXA 5JR3A 2Z6UA 3WO0A 2Q6TA 4OBBA 1BXRB 3UTDA 5HFJA 3ZBUA 4F5ZA 4AJJA 5E9JA 1W75A 2FPRA 2LYQA 2VDNB 3B85A 5HKAA 3AVYA 4LDJA 3TFLA 5EFOA 4PXYA 1MJHA 2EZUA 4I6EA 2WKSA 2OD7A 3WLJA 4CIYA 1JHPA 3Q85A 2ZYHA 4FEYA 2C58A 4S1NA 4AX4A 1BVRA 4DRZA 1W6RA 4RDCA 3OO0A 4PYMA 2VCEA 3N7UA 1UXKA 1VIYA 1QB8A 4FFLA 3TIIA 2JLCA 3TLKA 5JI2E 1C4WA 3PD1A 3Q2KA 4TLAA 4E2XA 2WIFA 2TYSB 1Q91A 2V0NA 3UOWA 5JRJA 4EHDA 5F5XA 1CUYA 3SQMA 5KTTA 1JI3A 2YMMA 4MDYA 4BQNA 2O59A 4D4JA 1ES9A 3N7AA 3MS4A 1QF9A 1USKA 3UJ7A 2Q6VA 1W5AA 5AHKA 5HKOA 2HA5A 4AULA 2R1TB 4PV7A 2HNAA 4UUQA 5JANA 1MNQA 2JA2A 2W2LA 1U2DA 4UW9A 3OZVA 5EERA 5HWSA 4A23A 5AICA 3ZGXA 7ADHA 4N5HX 1QF7A 4JP3A 4MO9A 2P8SA 1PGJA 1YRWA 3NOVA 4FEAA 3TOXA 1QTQA 4OLJA 1SCUB 3N2IA 1FNSA 5DN9A 1RWVA 3ZHRA 4P3OA 4AZ3B 5K0CA 4OOFA 5G40A 3P9YA 1I3MA 3GVHA 2PO7A 2FWJA 2AXEA 3F6PA 3DLIA 3H6GA 1V25A 2SKCA 4ZD6A 3IQWA 5DZSA 3TQQA 4ZI3A 5B7QA 3GDFA 3HO1A 3MINB 4CQMB 2XD9A 1VPWA 4WY8A 1CYEA 3PXUA 3Q3GE 4FYYA 3EBPA 1UIMA 2KE5A 2QRVB 2WWRA 3FFWA 4MAMA 4ZQEA 2BCJQ 2QGZA 3AL0C 3D43A 4B40A 5JZVA 2JJYA 5EMKA 4FNAA 4OFXA 1O96B 3QKRB 1NXWA 4UCXA 5J1TB 1T9GR 4KN9S 1RAFA 2IXBA 4GI3A 4Z3DA 5KVVA 3PXCX 4E2WA 4HAXA 4HDKA 3ZIDA 1DCTA 3H0KA 3IBSA 5EJ4A 3HU3A 2I9PA 1M34E 1NX9A 1TT5B 4OTZA 2BKLA 4DFDA 2IXFA 1JBQA 4YAOA 3AR8A 2W8BA 5J2TA 3T3NA 1M7HA 3EIUA 4Y2GA 1E3MA 5TPZA 3ZE1B 1Z0IA 3RVDA 1JIXA 1HGXA 2NO7A 4KXWA 4OHBA 2C1XA 1T5TA 2VA9A 3ZK7A 1P2SA 5B6JA 4C6TB 3KELA 4Q1DA 3RSZA 4BDTA 2X6TA 4Z49A 5AESA 2GI4A 2YXLA 4HNRA 3RREA 4LMPA 4W6ZA 1EH5A 1JVBA 4MUHA 3M4YA 1GUAA 2P9YA 1YE3A 2XJ4A 3GBSA 4L51A 5EOVA 3V55A 1MDFA 1ORIA 1PRUA 2A59A 4XE5A 5KNBD 3UMFA 3O8LA 1KQNA 2RGCA 4J1SA 1ITZA 2IUSA 5LQNA 4MZXA 1A5BB 3AIMA 5EJAA 3CH7A 4YDHB 2VK4A 3WWZA 2RGWA 1G6Q1 2JFNA 3EQ7A 4KO3S 3GRZA 5HOEA 1VE1A 1UAYA 2P9CA 3H2JA 2BMEA 4OLHA 4BNFA 3GA0A 5GIPE 1FSPA 2XKBA 4MCTA 4G5GA 5KVAA 2VSNA 1T6XA 3O8OB 1P5ZB 3AKZA 5CLLA 3DLPX 4A6DA 1L6IA 4Q3CA 5AKZA 1RLOA 5MHTA 3AUFA 2X8JB 3B1YA 5TRTA 3V9AA 2IUYA 5KJCA 2G17A 1YJCA 3SZUA 5A4JA 1ZIOA 4L0QA 2GBGA 1E2HA 4PX5A 1K0UA 2MIIA 1JILA 5FI5A 3CE9A 4I5EA 2OXEA 2PYDA 4NP6A 2CHUA 1I4EB 1QG2A 4I50F 5AI4A 2AN4A 2NXNA 2WWWA 4WBNA 2VL7A 4C0LA 1GLNA 2HT6A 1Z0AA 2XADA 1PZNA 3EGXA 1E9BA 1IHDA 1WUHS 3EGVA 3EJ6A 4F8YA 1LJ8A 5ALUA 1N2XA 1KDOA 3QEBZ 1NI5A 1Z74A 3JQBA 4J9UE 4OHCA 4FZ5A 3KG2A 4BJ3A 3C1UA 2BGMA 1PZGA 1NV9A 1H6BA 1UBKS 2HH9A 2WB4A 3SF8A 1B0ZA 4ZV7A 3HXTA 3NC1C 4GLOA 4R98A 2HQSA 2Z2JA 3FPJA 3U6KA 1IVNA 5DN6A 1IPFA 4TSRA 5DYGA 4KGZA 4J1NA 1VL5A 2C0PA 4YGXB 4UXHA 4HPXB 1JDBB 3CX8A 5KQSA 2GDJA 1XELA 4FFOA 1S8NA 3EDRA 3JD4A 3TECE 1BO6A 2GSWA 3JR3A 5K6TA 3WL5A 2QGFA 4PYOA 3C39A 4V0RA 1ZWLA 2C04A 4ZOCA 3GNLA 4A8JB 4BX9A 1APBA 3RS2A 5EZQA 5F2NA 1BROA 5ENZA 3VO1A 1GT91 1UCFA 2IHUA 5K4HA 2XF2A 2WK1A 2PBZA 2REXB 4R1LA 2FPMA 4FCCA 4D8YA 2C4TA 3L6CA 1YFJA 1E5LA 5EJ5A 2BJCA 1RW4A 3M9XA 1E1DA 4HMQA 4J03A 1A1VA 2A78A 1RSZA 3FHTA 1V9CA 3JXCL 2A0YA 3EGCA 4O1HA 3KZ1E 2QORA 2WIGA 1CD5A 2VK2A 2AMFA 1UOEA 1E6EA 1VG9B 2C1ZA 2ZJ6A 2ZBGA 3V8EA 1XMVA 2F3PA 4C7OB 4D6PA 1BCSB 2JFWA 1QB2A 1R0ZA 4NZZA 4YRGA 2NV0A 1T0JB 1VJRA 2AX3A 1ZJ6A 2EJCA 2FU5C 3QTTA 2FUNB 3H19A 1B3RA 1DPGA 1XZ8A 2B7BA 2PS1A 5FOQA 3LX6A 2I7TA 6PFKA 5BT9A 3R7BA 3RFTA 1GAJA 1Z7GA 2FUG6 2O2SA 4UVEA 1BEUB 5EZSA 3T5GA 4MMYB 1E0AA 1JQJC 3U48A 4JI6B 1QFYA 3AW8A 4O08A 5DOVA 3RSOA 1JHYA 2OB1A 3STXA 2D5VA 1LH0A 2AI1A 1XTJA 1HT1E 1YQUA 2JFZA 3KT3A 5HFAA 4ZVUA 3RLIA 3EFBA 3RDPA 4YMTA 2ZYTX 2GXUA 4BB9A 1E18A 4G85A 1OBVA 5LBIA 3U19A 1G3RA 1BCRB 1DQPA 4ONEA 5F77A 4QPJC 4BFSA 1L4UA 1EWQA 1HFJA 2DB3A 4MKFA 4Z0HO 4G24A 4IGAA 1NM5C 1O6BA 4JBXA 2J0UA 1T2DA 3TB4A 2RG1A 1C8KA 3I9MA 2Z4SA 5FWAA 3T9BA 3KPVA 1TU0A 3AFIA 3PHJA 2WPDA 3JZAA 1XO1A 4KQKA 2BEWA 5DP2A 1Q1AA 3DG9A 2R85A 2FPLA 1XLUA 4RHCA 4RVDA 4TQAA 3VMMA 3G7UA 3KYIB 3HCCA 4B32A 1I4LD 4HK4A 1SMKA 2NT4A 3KJZA 1JYFA 3TELA 5EMLA 4J7CA 3VOBA 2R87A 4PW0A 4CMKA 1YZUA 3Q0IA 3F9RA 4JB3A 3K09A 1HRKA 2I4LA 1FJXA 5ITWA 4BKRA 1NOKA 4RVOA 2W98A 5FBHA 1M72A 2CNWA 3AI3A 4KI7A 4NJOA 1GNTA 4B3GA 4BFZA 1ARZA 1C1HA 3HDQA 2DCMA 4AS1A 2IK8A 5KPJA 3UWPA 4CN8A 1P3DA 4XGKA 4HAOA 2MHCA 5BQFA 1Q1BA 4E6EA 2R8RA 1GYPA 1QOQB 4KW7A 3WGNA 2P4SA 2NXWA 1Y89A 3P19A 3EISA 4W7SA 5CFQA 1E62A 5CVUA 2PCJA 2W00A 2KPOA 4FFDA 4QSHA 4G0YA 4PZ9A 1VLZA 4RH1A 2BUCA 4HWKA 4E1AA 1V7PC 1W5TA 5AW4A 1BGXT 1XQVA 4M0PA 1C7FA 3DE1X 3HZHA 1SQFA 1JLHA 1V1RA 2YH2A 3LH5A 1H0RA 4K2AA 3RWMB 3GP8A 1IM8A 1PKEA 5K01A 1SU4A 4C0XA 4OAPA 4QTXA 1I4TD 1R4MB 2C20A 3EFHA 3LP6A 4HS4A 4KFTA 2KI5A 2ZYVX 1JBKA 1U7TA 3SDZA 5CDSA 5MN5A 2A5YB 3B82A 1KJJA 1H8ED 4IKPA 4ZEWA 3R7FA 3VR6H 3T5PA 1DG3A 3PEWA 3CVOA 2CVQA 5FPQA 4I1RA 4DGSA 4CV3A 2GX6A 2AK2A 2PYZA 4WOBA 3PGXA 4MVJP 3CF4A 3L7OA 5FXMA 5G3ZA 2VYNA 1KNXA 2DUWA 3QTBA 1VL0A 1PFKA 1I2ZA 1U5BA 3AYXB 5E6RA 3IP3A 2XUAA 2I65A 3NBFA 2B20A 1TIBA 5LZ5A 3GFBA 5BN1A 5C5IA 2ES4A 1UFVA 2Z4RA 2X5XA 3WKCA 3KE8A 4EX7A 4WACA 4R8LA 3JZDA 1XB2A 1NERA 4O4HF 1ZM7A 1D2HA 3OZSA 2RCYA 3R6DA 4HWGA 1VQ1A 1IDN1 1ONPA 4D57A 3LYHA 1OFIA 1RQPA 2B21A 3DL7A 5JVDA 5TS3A 4AW9A 2W9XA 3JQFA 2VPWA 3SYTA 1VMKA 1X7DA 4CEIA 2AFIB 2XKAA 2G9RA 1C3JA 5DE3A 1U6KA 3GLHE 4C88A 1M6VA 3U49A 5DLEA 5C7YA 3GZDC 2GVNA 4E0BA 5B53A 2AXNA 2C78A 2YOFA 3OX2A 4P83A 4BKPA 5K3EA 1DNPA 1X38A 4QDOA 4RMNA 3RVQA 3BRQA 4ENSA 2JCVA 3GV0A 5IYZF 5KOHA 2H4HA 4CCAA 1FA9A 4WINA 3B2EA 1QHGA 1ZKMA 3DZFA 3D7KA 1VE9A 2UXBB 3IP5A 3LGAA 2XGMA 4O5AA 1ZEMA 1K8RA 4KE9A 3GVPA 1Q5PA 1IQUA 1S6YA 1OQAA 5HDQA 4W8HA 3LL4A 3ROEA 2G83A 4OHXA 3S28A 4QGGA 4PN7A 4YQFA 2PUJA 5ARCA 4YNBA 1FOEB 2FE4A 2XMRA 2YWHA 2VT7A 3F8SA 4RKEA 4F8JA 4IGKA 1F1BA 1FLDA 2L19A 4GXTA 2WI8A 4R9NA 4BX0A 4UQLA 4WXMA 1TA0A 3FGPA 3BD1A 3S7TA 3UWDA 3BWYA 2Q3HA 2XIJA 4DXHA 2HKIA 3K0CA 4ZEVA 2X86A 2IVFA 3TSOA 4GVPA 4DLPA 5IRCD 1XKXA 3JQQA 4DLNA 4FDMA 1L5RA 5A9SA 1FP7A 3P9ZA 3OCZA 5JCPA 3G23A 1XP8A 1CEQA 4MWSA 3NS7A 2QN3A 1GWNA 3PE3A 4JB8A 2DH5A 1MGPA 2C9ZA 2QAGB 4BXOB 2V5AA 4GLFA 1YONA 4UMFA 5B2EA 4BC0A 2WQ7A 4UDOA 1TMGE 2YVKA 5EJ7A 5BRJA 3Q15C 3GPDG 4XGRA 3ZLJA 3VYRB 4BMNA 2O2DA 4JIGA 4PX9A 1QYWA 2TMYA 5IZ4A 1P81A 1XRRA 2YQ4A 4RA6A 1E1NA 5KYTA 1Z06A 4EAAA 3WTCA 1E5DA 4O4IA 3D1NI 2CHVA 2J46A 2OGTA 2B2NA 1ZLYA 3S8MA 2V3CC 1ZZGA 3ZS9A 1BGVA 1Z4OA 3HLYA 4MINA 1KP2A 2NUPB 3FCEA 1CUFA 4AXXA 4JGIA 2PXAA 2JI6A 2ICPA 3OU6A 1LLUA 2O54A 2X0NA 4MLZA 4ARAA 3NB0A 1H6DA 1WDWB 4JJAA 4BNJA 1MTZA 3O4VA 4HN4B 5H1YA 1GGVA 1S1CA 2B35A 2MYUA 4RA9B 3L7JA 1DT5A 2NAPA 2EBHX 4P2GA 5H8WA 1WP4A 3KHUA 3M6MD 4DY6A 2DZDA 3DAGA 1ZFNA 2YMPA 4DCCA 1NF3A 2X14A 5K3AA 1LSJA 4QTTB 8ATCA 4HI0E 3K0BA 4MI6A 1WMSA 4MKHA 2B4YA 1HSZA 2FJPA 4KRXA 4XM0A 3ZIAA 3AI2A 3KU1A 5IYZB 2ZWVA 3MUNA 2LIPA 1QIKA 3RYFB 3OY2A 1RZRD 5JYEA 5J23A 3QFTA 4HNQA 2QTHA 3EZYA 3L7CA 4Z0TA 3U2QA 5CD9A 2NOAA 5E9AA 1XQXA 1CQIA 1D1TA 3E3OA 4UFOA 3ADKA 4HDAA 1TX4B 1LBIA 1DLIA 4FX5A 3V7FA 5JAPA 3ENWA 1VCNA 4IJUA 4TWRA 4LEIA 3WJAA 4FMBB 3TG2A 4CHGA 1HNZB 1T15A 4ZYYA 2I3DA 1C7ZA 4XWKA 2QV0A 3FPSA 1RZRA 2ASVA 1QNLA 3W1VA 4KL8S 1ZKDA 5JDCC 3TD9A 2C07A 3PQFA 3TVTA 1QAMA 4D9IA 3P27A 5TIIA 3JTMA 1G5RA 3HACA 1Z0KA 1NWHA 3F98A 1SVUA 4GNRA 1Y63A 1KYTA 4FZ3A 4AF7A 4B3CA 1GTMA 4DLLA 4B84A 2AHRA 3RVOA 2J85A 1I9CA 1E3OC 4AJHA 5LPNA 4QZVA 2Q50A 1RMTA 2L1PA 3A2NA 4D0NA 3HJUA 4DIDA 2OLKA 1FRQA 1Y7HA 3OJWA 5AVTA 1M34A 4IXTA 3S8QA 4GPAA 3OESA 2J07A 3TTYA 1EXVA 2ADFA 1FMFA 2O3SA 1DAIA 3SEAA 1E2MA 4IDHA 1GZSA 3A10A 3TGPA 1TZ2A 1XWIA 3IQXA 5C8YA 2NADA 2VVTA 3OQBA 1RQ2A 1WMDA 3MGAA 4XJTA 3QA3E 2FVYA 4FR5A 4KXFB 4ARSA 3UH1A 2CLLB 3QVWA 4GECA 5DYWA 4LWQA 1ZX1A 2PH7A 2XOKA 4YUZA 4BKUA 3VVLA 1ZH0A 3SC6A 2ZRNA 1C0LA 1XTVA 3UG7A 4E21A 1SD2A 5IT5A 2I54A 4YAJA 1AOXA 4ZVQA 3H87A 1B4DA 3WDMA 2WU1A 3A4VA 3GHHA 3KKEA 5J2TF 4RANA 5LDGA 2NZ2A 1P5RA 1XZKA 4U7TB 3M34A 3LDFA 3BMOB 2J3HA 3W2FA 3ACDA 2YIVX 3MT0A 4PLWA 1QGUB 3W2EA 4CT4B 3AKCA 5BPHA 3GN2A 2VSYA 5E7IA 3GWZA 4ZTBA 2GYUA 2XI4A 3EIQA 3QYFA 3R24A 4ZI5A 1T8YA 3QUSA 4GMDA 3WHKA 5HKBA 4K03A 2BGUA 4ZRNA 3V7UA 5BR7A 4RSHA 1FQKA 5JADA 5BNFA 1H2XA 1UEXC 3E9RA 3CLHA 3EUAA 1AN9A 5JSYA 4B6GA 2JAUA 4PLGA 2WYIA 4DLRA 3JQ6A 1KMIY 3SF8B 3KIPA 3IO3A 3WGQA 1J49A 3RJMA 2X4IA 2J3QA 4GQMA 3HZZA 2GPSA 2IPLA 4JVSB 4OSPA 5EE0A 4BN0A 3F3MA 3IVCA 2YHIA 4HNHA 3V4RA 2BFBB 1US8A 5BV8A 5HQTA 3QEOA 2VQ6A 4LRXA 1WV1A 3UK0A 3UFXB 1IXYA 4BMCA 1CQJA 3P0RA 4MB2A 5TSDA 2G72A 1GUBA 8ABPA 5AUQA 1H3FA 3SX2A 4RHTA 1VRCA 2UZIR 2V7EA 3B53X 3EEFA 4N3BA 1WQ1R 1JG7A 2FW1A 3TAHA 2JFVA 3NHUA 3HCBA 1XTKA 4INJA 2H18A 2OG1A 1NIPA 2VLBA 3CEMA 3DEFA 1HYEA 2B4KA 5IVKA 3COJA 3QPDA 1S7GA 2YXPX 4HB0A 4KQ2A 3D8RA 2Q4EA 1RRPA 4M8IA 1XU9A 2BBTA 2E89A 2GTHA 4ESEA 4V0MA 5B1YA 5AVUA 1B6GA 1AV7A 3N2EA 1Y6FA 2QVYX 2XMGA 3D8SA 2XE4A 3F8WA 5FPKA 1WXIA 2XNDA 4RZQA 5ALPA 3I42A 4GWGA 5T4BA 1NN0A 4O4JF 3FUWA 4IR7A 3IH5A 4BB6A 1RM5A 3RRNA 1V9SA 4UFNA 2QROA 4MARA 1X13A 4OK6A 4Q3LA 4NSNA 1J0AA 2V1XA 1KY4A 4F72A 1ZMRA 3NXKA 4P34A 1M1XB 1IXRC 1E99A 4Y0VA 3UGTA 4M1EA 4JHLA 3BREA 3O8CA 3HV2A 4PZCA 5AJTA 4GM1A 3RF7A 2FSGA 2J4FA 3DZHA 3PV0A 3KT8A 3KQPA 2VXOA 3ZE7A 2I3GA 2AKYA 4UE6A 2HWKA 3KQOA 3LRPA 3GJQA 4P81A 1Y8CA 3D6UA 4EMBA 2HINA 1JYSA 3PL1A 4JLMA 1KERA 2CVFA 1BQ3A 4G4GA 2KEJA 2VWGA 2GAFA 3BG5A 3I1YA 3WWYA 3ZZNA 4RO0A 1E9RA 3A9YA 1UKZA 2CD9A 1TF7A 4PR3A 1CG6A 4EPWA 2FLWA 2X7HA 2BFFA 5A3QA 5IDXA 3M5WA 3J81A 2O5RA 2NXCA 5E6RB 1H85A 2V9PA 3O3OB 2NGRA 4KKXB 4LYAA 3WLRA 2PU7A 5DGTA 3GX1A 2I33A 2GGSA 3FSGD 2ZJ0A 4QQFA 1TM1E 2J7KA 3HKCA 4L8FA 4YRDA 3HBFA 3OLCX 1XXHA 3MGGA 3ZCUA 4KJXA 1LK7A 3DMHA 4OHKA 3RV3A 1P0PA 4G97A 4TXMA 4ZZIA 3KAJA 3CNOA 3F0TA 5G2OA 5JSZB 4Z9XA 1RVV1 1LLIA 2J41A 4KCGA 1A4IA 5HUJA 3H5RA 3GT4A 3O0TA 3O92A 5ITVA 3HVHA 4UE2A 3CH4B 5AUOB 3U7HB 3T95A 4B7AA 5CDGA 5L45A 2VUIB 3H75A 1L5KA 1D03A 3TBFA 5EA2A 2NSHA 2DP4E 4BLWA 5KAMA 2D5IA 2AZMA 1N2BA 2WNSA 4XDGA 2ZROA 1GZHB 4O3MA 1B15A 4FR2A 4NHEA 4NCBA 5ILGA 4C4XA 3FPEA 4I81A 3A9ZA 5EY5B 1CJSA 2BZSA 3WOHA 3OCJA 4E09A 1Z33A 1S7EA 3NYQA 3GJTA 3KKMA 4QULA 1SU8A 1AQ6A 3ZDBA 2YRXA 1SZCA 1EVKA 1TAUA 1TB4A 1Y9EA 2J08A 4CQLA 4R2HA 5HJEA 1ZD3A 2F59A 1B16A 1QIMA 2FJRA 1TJNA 1HQDA 2IYRA 1JHAA 3CLSD 2VPYA 1Q1ZA 3C0KA 4UU7A 2AE2A 1L3IA 2PXUA 3N07A 5K3CA 1U0FA 3VH4A 4QJ4A 3NJ4A 2GK6A 1PGPA 2XZDA 1FYXA 4M46A 3WP1B 3ASUA 4JQYA 3GJ7A 3I4FA 2W83A 3TVYA 5DNYB 4B8ZA 3JVDA 2VZ9A 3TLYA 1O7JA 2A3NA 2XXAA 1OREA 2PWYA 3LTEA 4JY7A 3GZCA 1MAWA 3NXHA 2GRAA 2J5RA 2E1PA 1YS9A 2E4ZA 3OLQA 2KWIA 1NJSA 2QRGA 1MW8X 5LBUA 4L3VA 4QYXA 3RRMA 1G9TA 2AKAB 4EI2A 4RE5A 2PMCA 2UZ1B 1Q0QA 1QH1A 2ODWA 2V6JA 3C4JA 3E22A 1PJ4A 2Q1UA 2QD3A 3N8IA 3DTTA 1DL5A 5CBKA 5CB4A 3WRXC 2YYZA 3FYSA 5IULC 4MS4A 1HQKA 1RJEA 2FFAA 4DCOA 3L1PA 3LY5A 2Y1LA 4QDZA 2IU6A 1TTHA 3UAOA 1RPEL 5TLSA 3PPVA 1QWSA 3LY8A 4GSYA 2VQ3A 4YEDA 3ZVRA 4OHYA 3IOMA 4ZI7A 4GOLD 4LK3A 1G5FA 3UK6A 5EQTA 1FW8A 1NVXQ 4ZVNA 3AM3A 1NR5A 4QXAA 2H1SA 2DBZA 5GV7A 2W2MA 3TNLA 1Q92A 1QTIA 3U7RA 1M5UA 1U11A 1J2YA 3UJ9A 3EXG2 4EHAA 2KBEA 1JJIA 3H99A 5KDLA 3JQBC 1B8VA 2R1UA 1BMDA 4R0VA 5ALDA 2PTHA 5H5JA 1J22A 2VP6A 2EFYA 4L4ZA 1IQRA 1ADRA 2P90A 4HRYA 2YHSA 3LBHA 2QZZA 3KT6A 1J0CA 2D1FA 1HFEL 2NZWA 3AUTA 3PDWA 1FMJA 3L18A 1CJTC 4TKMA 3FA2A 4RY8A 1PS8A 4Q4LA 4MSUA 5C1OA 3SQLA 2X1VA 4BBPA 1ULZA 1WBJB 2ZT8A 4DWOA 3PF8A 2HK6A 5C0OE 2RHWA 3NKLA 3ZTWA 1BE8A 1QFXA 3A58B 3PFFA 2ZSUA 3LX8A 5H68A 1L1MA 2GPTA 3BHMA 1TFRA 3CROL 1SR8A 3OAAA 4Q3DA 4LRWA 3HSYA 3HM2A 3N2GA 4MCIA 5JY6A 2XGSA 1II8B 1OHHD 1J0EA 4UMVA 5T6MA 4KYTA 1E92A 4HNUA 3ND5A 3X2EA 3RKUA 3O31A 3LC1O 4X7BA 5C5CA 5TX7A 4WCVA 3VC7A 1RHQA 3E18A 1ZRMA 4HV4A 3M2TA 2NVUA 4LECA 1ZH2A 4M49A 4UCQA 3KZNA 4EQ6B 4EUKA 4DBLE 5M04A 1GGHA 2CN1A 2FSVA 3VSCA 2WHQA 1RT9A 4D97A 1IZ0A 3VNUA 4MWDA 4MQBA 1KO4A 1SM4A 1VI5A 1XTBA 4PQFA 3WK8A 1TE2A 1E6MA 4GOXA 1SG0A 1WY7A 4CL2A 1EFAA 1BA3A 2NV2B 3IUBA 2O2ZA 2HCJB 2Y2VA 4R8VA 4E1BA 1ZUIA 2EFGA 3VOAA 5DTJA 3OZBA 5A6VA 3PEVA 4UDXX 5KJEA 3ZDRA 5H3HA 4REMA 2QM3A 4PHTA 4AF8A 2X0FA 1HX7A 1E79D 3PQ2A 1G1AA 1YK0A 2EKPA 3D3NA 2HUPA 4BRZA 5I8WA 3H1BA 3H42B 4Q93A 3FG9A 3QWAA 5KTYA 2BSQA 3PNQA 3WV4A 1REQA 3L7AA 4LK2A 1TT7A 4IS2A 4QJ5A 2VDMB 3NTOA 4ZAGA 4AXBA 5JNVA 4G0VA 4ML3A 1NP6A 3T52A 3FAZA 1CF9A 2F4VB 2P2DA 5KJ6A 3WZ2A 4B9AA 4ZICA 5CFOA 4YIHA 4Q19A 1XU4A 4FIZA 3L04A 2X19A 4GP9A 2AN1A 1YQEA 3NAQA 3RJ9A 3WC4A 1MB3A 4PQGA 3FVTA 1DEKA 4KKVA 2G9NA 2HT1A 1BS1A 4QBGB 1HDXA 1J9EA 3GFGA 4R0MA 4NV0A 1MCZA 3X44A 1SXJE 1V5WA 2CVOA 4RV5A 5HCNA 4LDNA 3NXSA 4FVTA 3ZE0B 3LPNA 3I6ZA 2WSSA 1TD9A 2Q3DA 4IHJA 1GGEA 3A7DA 4IQ4A 1Z36A 1E0DA 1FDUA 2VWPA 2Y05A 3DDUA 3EEIA 1UXIA 2X2EA 3QKUA 1GKUB 1A9OA 1UDXA 2IL1A 2WUVA 3DTVA 3I37X 4GGOA 1HTTA 1G6KA 5AUNB 1OWPA 4F3RA 3L0SA 1Q7BA 1XHLA 4JJ4A 3P94A 2CLMB 4O2BB 1QK4A 3FB1A 4WL0A 4CETA 4CDRA 5L7TA 2GAAA 2H11A 2I66A 3LT5A 5E6SB 1ZCFA 4I99A 1TCUA 4IMRA 4EBFA 4QHTA 3L05A 5DBOA 1AF4A 1OGYA 3SDBA 5JRDS 2CVZA 4OSEA 2FG5A 1ZOOA 3IX7A 3TBKA 3WK9A 5CEEA 4A15A 1JEYB 1TYEB 1NTRA 1LDBA 3EIWA 4U3JB 4UHFA 4AO8A 4DLXA 4DVJA 4UUPA 4ED9A 6REQA 1P91A 4O3FA 2PSHA 1QDEA 1Y6RA 2WRZA 2CF6A 3MQ2A 4L4RA 1D5CA 2I8LA 4KX5A 2FHSA 1WR8A 1U1CA 3GFOA 1QGED 4LSMA 1HI9A 4PFSA 4CM6A 2P2ZA 5CAEB 4RJ2A 4DC0A 4FXOA 5KTOA 3H13A 4MCAA 1R8SA 3NRBA 3FHJA 1XKLA 1WULS 4C04A 2CDRA 3W5BA 2F43B 2GYVA 4DQVA 1JIKA 1RM3A 3QVLA 2XVXA 2FF5A 4DWJA 2I7VA 4C4RA 2WD7A 4KNWA 1QH1B 3PK0A 1IN8A 1PR0A 1C7IA 2G77B 4RNCA 4UUBA 4DEVA 4NKRA 3OOYA 2VPQA 2FPXA 4ND8B 3L8HA 1I3LA 1SCNE 4V3CA 4XB1A 5TR9A 2INGX 4QUIA 1U8ZA 3D7SA 5FORA 2UUPA 1DUIA 3HJHA 3LDHA 5IM5A 3SHFA 4YRBA 3HG7A 5LU8A 2W5UA 3OJFA 4R01A 4G09A 3U3WA 3PIIA 4J90A 2WU0A 4OI0A 4ATNA 1MQ9A 2ID9A 3DA8A 2HRQA 1K6XA 1HSOA 1ECFA 2ON6A 1YFLA 1O6GA 1RI3A 2HHAA 2P30A 3K31A 3ELUA 5DHFA 5JCZA 1DO2A 1TUIA 4K8RB 3WGLA 2XUJA 4UHEA 2LNMA 3MMXA 3PDCA 3QBVA 3GP5A 2OB2A 2IWHA 3SKVA 3ZY3A 1F6DA 3HE3A 3HK2A 1Q7RA 1NW9B 3BBPA 1QVVA 3C6MA 1GPWB 4ZCSA 3I8OA 3TRDA 1U7PA 2GA9A 3QZUA 4KAAA 1FUEA 3LBYA 2RGYA 2REBA 4W8GA 5BVGA 1XRQA 2JJMA 2XIQA 2CWWA 2O8CA 1X2LA 2XOEA 4BJ5A 3CGGA 4WFQA 4OP3A 2XSDC 2O0LA 1T1IA 2CBGA 2DFTA 2POQX 5DI3B 1T0BA 4O4LB 3TLGB 3HJCA 3TJMA 5LZ4A 2ZRAA 1VHJA 1A9SA 2OAP1 3FNRA 5T3UA 5AQ1A 4FR0A 3QIVA 4H6WA 2WSYB 4JQSA 1BD4A 1E2NA 4IMJB 5D3MB 4CRWB 3OUUA 1CZUA 1J33A 4Y67A 2CSXA 1NOIA 1HXHA 1A2OA 5EGSA 1NMZA 2VXYA 3LPMA 2ODTX 5TT0A 2A9VA 4M3NA 3ZEAA 1NUAA 4OREX 2GJ9A 3FYUB 3G49A 4U8HA 1KEEA 3GLFE 1EXMA 2XBLA 3LPLA 4NG5A 4WESA 2GD6A 3U3MA 3AHJA 4GX5A 5TGZA 1O96A 3QKRA 2YW9A 2O2YA 3DC2A 1KETA 3E15A 2W6QA 1C80A 4GBGA 1WBDA 4DOMA 2FFBA 2CF5A 1F12A 1VJ1A 4XOIA 4EW1A 2QOEA 2WFLB 4G5FA 2G09A 1Z8DA 5DW0A 1ZRHA 2GRMA 3MAGA 1XTZA 4EA9A 2XCOA 3CX6A 1PT8A 1YCDA 4K9QA 5EWJB 4GPD1 3BB3A 3CEAA 3LWBA 4FOTA 4Q18A 4ZDWA 2FLKA 1IHYA 4ZAZA 2P5TB 4HQKA 2HHCA 5HVNA 4ND2A 2AYXA 2B6NA 2FUKA 3SLGA 3EXHA 4QT4A 1TU4A 2FPSA 2PGNA 4I4IA 2VR1A 1ZVVA 2AV6A 1VG1A 1ISMA 3LOUA 4PZDA 4KLRA 1IIRA 5C81A 1C14A 3ORRA 4PVCA 3QNWA 4H7FA 3R8FA 2NMVA 2DWQA 3DUWA 1THMA 3WY9A 4LISA 2ANBA 1WB6A 1BMQA 3V8BA 1HZJA 3WAJA 1YJ5A 2IY8A 1JIUA 4AJPA 1GO2A 2IZ1A 2LGJA 4KC0A 2OR3A 3JQEA 4JJFA 4WXYB 4E7PA 4CKZA 4I0WB 3ZBQA 4LE0A 1EU1A 4F45A 3V2GA 2DAPA 1KXJA 3DLHA 1D6MA 1Y3AA 2AOWA 2EGUA 4DARA 4CM4B 2W2KB 4E13A 2XZPA 3GW8A 1SFRA 3WGVA 1ZK3A 3Q72A 3V7YA 1RC0A 4U7WA 3IVRA 3PXGA 2VPZA 1J5PA 3BK7A 2CT8A 4BECA 7REQB 5C31A 5IT0A 3BEOA 5LXTA 1CY7A 1Y5RA 1A9TA 1RXEA 2V3WA 4MV9A 2XH8A 2PKYX 4YO7A 5FRDA 2Z58A 4YMSA 4TKZA 4BZWA 4N7RA 1XNHA 1I1HA 221PA 4RKYA 5FUQA 3W2IA 4FB5A 1N2JA 1S4QA 2BI4A 4AZSA 2XB9A 3QV1A 5FTLA 4IJ5A 2VRBA 4BCCA 3AV3A 4P98A 3QUBA 4MUNA 3HJBA 4MKGA 1D4OA 3I04A 5EC8A 1ZYUA 3A6JA 1YDFA 3PFHA 1X94A 3G5TA 2ESRA 1QIHA 5D85A 3S6JA 4EAQA 5AW0A 2QKYA 2XUKA 4Y1EA 1CHDA 1G8PA 4E08A 4OB4A 3JWGA 2YASA 2ORWA 1OLUA 3IAS1 5KNDA 2VWQA 2NQ2C 1EQAA 2BEVA 4QJIA 1R4NA 2JVKA 3TFOA 2EF1A 1NEQA 1NMXA 1P1FA 1UJCA 2WJ4A 2ZU6A 3IPXA 3KUDA 4I4CA 4OO3A 4LDRA 2YQ5A 4IJMA 1RR6A 2X0JA 3OF3A 4PANA 5CT5A 3TS1A 1DBRA 2FWAA 4AP9A 2JKYA 4AZ3A 5KHOC 2CXTA 2ILTA 4A26A 1K27A 2QQGA 1KI6B 1L5GB 1FVXA 4QUGA 1PUIA 4YUVA 3TWOA 4DCPA 3I64A 4JFRA 1O97C 1U6JA 4MV6A 4L8WB 3KXDA 3DHWC 4FLEA 4LSZA 1X7YA 4NAHA 1K4KA 3RJZA 3VR0A 2ZJFA 3TW0A 3ZG6A 1N32B 1ZGHA 4OL0A 2FZ4A 1O58A 3IMKA 3PKJA 4UBJA 5IPFA 2UVPA 4DUGD 1F38A 3PYXA 4GWLA 1PJ8A 4GXQA 3PUWA 1TEHA 5FWYB 3EHDA 3ZJVA 2ZDHA 3UJCA 1I4OA 5IDYA 1KMNA 3GJ8A 2GJ4A 1DFHA 3L6OO 2PVSA 3PENA 4A0FA 3W5CA 3KDAA 1TYAE 4X3OA 2XVYA 1J25A 2D1SA 3L02A 5ILOA 3OP9A 1H1DA 1RP7A 2I2FA 1JKJB 3UV3A 5IUKC 3W8RA 1E6UA 2HSEA 1RWWA 2RC5A 4GM4A 5F12A 4LQLA 4DMKA 2I5PO 4F91B 3OKZA 2G0NA 4N5NA 4E33A 2ECKA 3AHHA 4YRFA 5KOHB 1V7ZA 2VF5X 3G7DA 1HLDA 4WKBA 1FX1A 2JAOA 4IIUA 5K8UA 3FW1A 1RPTA 3ICWA 2XXPA 4TT3A 3KYDA 5JAIA 1AY0A 1JSXA 1MOSA 2LBPA 4E4RA 3DMFA 4LQDA 4BFTA 4JQOA 1I8TA 2L49A 5F2OA 3AR6A 3ADBA 1YMQA 2PD3A 4P8RA 1JNYA 2R8ZA 2J67A 4KLNA 4M9UA 5FFNA 4XRRA 5AYVA 1LDNA 4OXKA 1NF9A 4NCIA 3M4XA 5HKKD 1NLZA 1PKXA 3OA2A 4D99A 4UNNA 2A84A 3WDKA 1VMEA 4WCFB 1F8UA 1PTJC 2A88A 1EIWA 3ZV4A 2HIHA 1UH5A 3DAFA 4OOEA 4ZYVA 1XZGA 2GD0A 4WSOA 3SS8A 1UXJA 3QVVA 5L9AA 3AVUA 3N8DA 4PPQA 3IQFA 1G5PA 3FWZA 1HL7A 4I6RA 1Y42X 1N5RA 3LD9A 2IHJA 5SYMA 3GCWA 1M2KA 2FSPA 4ARVA 2UZ4A 4OG2A 4TUYB 3GWGA 4HFJA 3GLRA 4WXEA 3DMTA 3L1UA 3VH2A 1UC4B 1KS9A 2RGXA 2JZNA 1TUGA 3CNLA 4M86A 3I5AA 4AECA 3BVPA 3ESBA 4OGLA 3K1AA 3MT7A 3OSZA 3BE6A 2CLEB 1W36C 4Y6GB 1AKUA 4OGWA 4D3FA 3HUFA 5AKLA 3FYHA 1GGMA 3N59A 1CKEA 1L5MA 5A3VA 2ZI9A 3WAGA 5E6SA 4M8SA 1IY8A 4DV0B 3FETA 2RSLA 2GTIA 2Y71A 5C35A 4G5HA 2XXJA 3NPMA 1VECA 2F62A 2QXYA 2REQA 1UOOA 4RM3A 5EG5A 4QM6A 3G8BA 1A8UA 2OXTA 5BOVA 3H2SA 9ATCA 1O4VA 4FOLA 5DYYA 5IF3A 1ECLA 2DCUA 1EP3B 2VHVA 5L3SA 4TL8A 2V55B 1JXQA 1WCWA 1NSYA 2C99A 2WNHA 3HBNA 4EHIA 2ECFA 1QRSA 1YRBA 3PNSA 2ZBFA 4CHTA 1XL0A 1E98A 4OLBA 2JGKA 3DQZA 2G1UA 1ZCZA 5FEUA 1SRQA 5DISB 1LB1B 1OC2A 4MQ5A 3T1QA 4WJLA 1UQUA 5DCWA 1J0BA 3O9VA 4JUBA 2RJOA 4AY3A 1N77A 2CV0A 5JPIA 1K7XB 4LYFA 4BNMA 5ELXA 3GGDA 3OF5A 3QI7A 1OGIA 5CVVA 1YCHA 3QHQA 2VPTA 1KY2A 3WYNA 2AZTA 1ZY2A 4QFDA 1MDBA 5CGQB 1QQ7A 1WXHA 4PONA 2CNLA 2I1LA 1VSVA 3D4BA 4LN1A 5HILA 5C37A 1FDRA 1B2LA 2A1IA 2YZKA 3Q7TA 3IT2A 4INZA 4X3PA 1IONA 5JVDB 4RBNA 3K8QA 1ONNA 3CX3A 4WLVA 4PX2A 4B48A 4B4WA 1Q15A 1SO8A 4R1QA 3V42A 2JCYA 3URKA 2QP9X 2EHDA 5LCXA 3IKLA 1M2VB 1K4MA 1H65A 1R74A 1QHYA 1MZPA 1UPXA 1IHUA 3VX3A 4W5OA 1E4EB 1QHFA 4MMZB 1RACA 3FROA 3IPLA 4GRDA 3ZQ4A 3QSYA 2C9MA 3QMVA 1G21A 4KLAA 3RYTC 3V4LA 5AK4A 3CR7A 4Z7QB 3R9WA 5DM0A 5FL7D 2W70A 1TK2A 5KIAA 2XEXA 3WYGA 1EGQA 4Q3OA 4ZMSA 4JDUA 4PSUA 2JATA 3NTUA 4I9GA 3OOWA 3EDMA 1FDVA 1CULC 3GZ4A 4JA0A 3AJRA 4XJXA 3UKJA 3DMYA 4G89A 3V4ZA 2JZOA 5D6NA 5SZJA 3TUJC 3AJDA 4LRYA 3HVIA 3U4CA 4XRGA 4QX6A 3OQJA 1Z3IX 2PZ8A 1UANA 5KVQA 2BF4A 2UYOA 2B3DA 3EQ2A 1HFWA 2E87A 2Q3MA 4CR7A 3BERA 1UZMA 1WD5A 1TQ2A 3AI7A 3C3XA 1IN4A 3CF0A 2DFDA 3OZ7A 4QOIA 5D1HA 2Z8XA 3O1LA 2NNLD 3OIWA 5TPZD 4BNWA 4EY4A 1G60A 3MWDB 1KMHB 2B1IA 3MW8A 1L4NA 2C5SA 4GZ3A 4HH4A 1AMOA 5DCYA 4EB3A 2EEZA 4PLPA 4PLYA 4WOCA 1P6UA 1UOQA 2J0SA 4Q24A 1X7ZA 5GIOE 1A0OA 1ZITA 2F64A 3NANA 4JP8A 3C1AA 1YA6A 2EARA 3FYUA 4CM3A 2PSFA 4MR7A 2YV4A 3ZQUA 1U0OC 1CLUA 3ZGOA 4XSHA 3Q11A 3QRWA 1ZK0A 3A06A 1ZMBA 3LK6A 2WUGA 3PQEA 1T3GA 4Q4CA 5JS8A 3KJNA 2XTAA 4PPGA 4DE9A 1ZU4A 1GQOA 2GEKA 4E2ZA 3ZWAA 2ZATA 3K53A 2B8NA 3NHZA 1UMDA 4GIBA 3LUKA 1G1MA 1Y8RA 2Y77A 4JLAA 3ZHBA 2QL9A 3Q3IA 1IWBB 2PZMA 5AVJA 3R7SA 5DN6D 3HHEA 3MJTA 2CUZA 3V4FA 4HYEA 3OFND 2HV8A 1EUDA 1FTSA 2RHDA 2ORED 4FYJA 2SKEA 4HLUC 5EVJA 2H1RA 4BAZA 2GASA 1V39A 2YY7A 2B5WA 2ZW9A 4X44A 3CWQA 1JDZA 1VIDA 2IXGA 1Y37A 2XI8A 1FJ2A 4M0CA 5EMMA 4WV3A 1U3TA 4DABA 3LX5A 4NV1A 5BR1A 3WLSA 1PJTA 4GOND 4TSFA 1XA0A 4BKQA 3AEKA 1J8YF 3F5DA 3ROKA 3A27A 5CITA 3QU7A 3CGWA 1KOLA 1KE2A 3IA2A 1XEWY 1W8DA 1H42A 1GPJA 1OAOA 2PZJA 3EAGA 1TKRA 4URZR 3UNXA 3E03A 5I8ZA 3WE7A 5IEJA 3QWIA 3R77A 2ISCA 2B1JA 3KCNA 3CZ4A 4MUMA 4RD4A 3RK1A 3TTXA 2G0TA 4AP6A 5HJ7A 5K51A 2UV8A 4ZI7B 4W1QA 1M74A 1J21A 3EQZA 4JVOA 2QSZA 4F2PA 2C8JA 4Z0NA 4DG9A 1IC6A 1KEPA 3QU4A 4Y0AA 3JXEA 2UXCB 3H9BA 4ARIA 1ZCAA 2IA5A 2BTEA 3OEEA 3PJDA 2PKEA 2W11A 1EFVB 3B2QA 3GGOA 2ZSDA 4DZTA 2IZOA 5EJ6A 4C2UA 1DWUA 1N5JA 2X6QA 3QEMA 4O8ZA 3TQTA 2JD1A 2JVIA 4ZYZA 1D8AA 4ZOLB 1KK3A 3DVQX 1QV7A 1OXVA 3KOMA 1LWNA 1RQLA 2RK3A 5ALYA 5BV2P 5ER6A 3ELYA 1OCTC 3U31A 3QWFA 1ISIA 3BH0A 5ALFA 5UKDA 3TXXA 3EDYA 3KKPA 1PSZA 4ND3A 4C7VA 1EVJA 4RJTA 4OHVA 4JDPA 2BP7B 2QZPA 2FNAA 4KTVE 1DVRA 1T4MA 3R8CA 4HFRA 3T1NA 4TKUA 1VCMA 2A5DA 2J33A 3AQ4A 1F9EA 1Z22A 3OOSA 4Y18A 2NUTA 3L7NA 4OKSA 3MTIA 3M3PA 5FULA 2QLNA 2C54A 3BMCB 4DL9A 3HCPA 3ZVNA 1N7HA 3VPCA 1OZGA 2HRRA 4DQXA 4LGYA 2I67A 2R8EA 4TOIA 4CPDA 3TI9A 2PXVA 1WM1A 2Y3IA 3PICA 4F2HA 4HX9A 2QMOA 4U7PB 5LDDC 4QYWA 4BVAA 2BF7A 5BSHA 4EF5A 2O1EA 1UKEA 1T9DA 2Q5HA 2C7PA 5KYUB 4G86A 2HPHA 4XUDA 1MB0A 4CF5A 4D25A 2Q6OA 4A2PA 4GWKA 1ZD9A 1D7AA 1KJ8A 1YZYA 4DN6A 3BD6A 3BDVA 4IH4A 4D0SA 1UZUA 3ER9A 6GPBA 3JVUA 1G41A 2H8KA 3HP4A 4ZQCB 4JN6B 2ZIUB 2PMBA 2ZDGA 1WZ2A 1CQWA 1ZUWA 2JFHA 3QQPA 4JODA 4AN4A 1H9BA 3K9NA 3X2FA 1HYQA 1GV0A 1N8SA 2PX3A 2VDRB 1Q0LA 4LHVA 2RGRA 4DANA 1TECE 1X3SA 2D54A 4AMGA 5K0BA 3J81k 1DJOA 3PNKA 1N6RA 4FMDB 4KWHA 2C42A 5CYGA 1XWFA 1A8HA 1RYHA 4KOAA 1AIPA 1RWBA 1U1IA 4ZT2A 3R3ZA 1SVIA 2IQIA 4NXNB 1L4KA 2QZ4A 5ENDA 4ZI2A 2W2OA 5DHQA 3VR3A 3P45A 1OX6A 2HA4A 5HIAA 2VHWA 4RLFA 5DPMA 4ZC8A 1K9SA 1I94B 3DJYA 1JMVA 2FAXA 3A32A 1CFJA 4RMHA 5K8IA 3NIBA 1ZNQO 5GAJA 3DCIA 4BLTA 4X1IB 2P9HA 4JQDA 1JG6A 1U0GA 4QWWA 3KVOA 1G7SA 2FWRA 3IPRA 1KEZA 1DJQA 1YRQA 3FUTA 2O0MA 2CLCX 3QLJA 3QYJA 3ICQB 2B5VA 1JN0A 4UPVA 1MABA 1NRJB 1NYRA 1AT1A 2HCRA 3FI9A 5FPHA 1KI7A 3FYMA 3W8DA 3JSXA 5DGXA 4D4MA 2NZXA 3WO1A 1JB9A 4BE4A 4DV2B 2G82A 3IQZA 3SG0A 4YR7A 5JH7F 4D96A 1C50A 3EGXB 4U6NA 3ZY2A 4FFRA 3KXAA 1JDPA 3ZXYA 1PQYA 3F67A 3PC6A 5F1YA 3DHNA 5K3DA 4GX2A 4L6AA 1LC0A 2IUTA 2NPIA 3G8AA 1IEVA 3HYLA 3D7RA 2CMDA 4OXIA 4P3YA 4ZCLA 1PIWA 1E1KA 1B0PA 2X42A 3E8XA 3IQEA 4JFAA 4BFVA 4C5AA 5KNCD 4RTKA 2YWRA 3EXIA 5HUQA 4YALA 3DEIA 3IKMB 3O4IA 5AVRA 4EG0A 3OCUA 1LDYA 2WDZA 3JASA 3T15A 1PAUA 1HOXA 5TEWA 3V32A 1XWWA 4INAA 2C3OA 3OCXA 5AXCA 5BW5A 2RCNA 3OZXA 4L02A 3HCNA 1XGKA 2ZB8A 4RVHA 4RK0A 4WDRA 1FX0B 4ZEOA 3Q10A 2GD2A 4NK5A 4NU0A 1KWGA 4JCYA 1UKBA 1LW7A 4FCVA 3DWIA 3DZKA 1HE8B 3PNBA 4OY3A 3OM1A 4OXQA 3H97A 4PO1A 2ICAA 5YASA 3T7KA 5CUQA 1H9AA 2G5TA 1TZCA 2XCUA 4LHSA 4MQ6A 1E64A 3R5JA 1B1CA 1Y3DE 5EKUA 3G0HA 4YBZA 4TSKA 3QPUA 3E05A 4WVLA 4X65B 3MT9A 1VMAA 1UMCA 1A76A 2Q6IA 4L2IA 1Y9QA 3WQBA 2H52A 2PHZA 1QHSA 5K6AC 4MUXA 3SJUA 1FNBA 3F3YA 3ND9A 3CW8X 3G2JA 5EE9A 2AXZA 2ABWA 4FUQA 3RFXA 1RC1A 3UJ6A 5IWCA 2PIJA 5C52B 3H2YA 3ZHOA 1I33A 4ZO4A 4C0AC 1EJBA 2RAFA 2NTVA 3G0IA 1E61A 3ZCQA 1NVGA 3WL8A 2NM0A 3VK0A 1VFPA 4E31A 5TGTA 5K09A 5E4JA 1PX0A 3KFLA 4XUCA 1MIOB 5GJWC 4BNLA 2KLHA 2OBBA 3FOZA 1N0VC 2K4MA 1EJ2A 1YQTA 1GV1A 2P2YA 2HI0A 2JEZA 3E81A 1EG2A 1NHGA 2BSAA 3KU4A 3M2PA 4F5EA 4QUEA 3WIDA 2WIJA 1O89A 2QYOA 3DV0B 3AIIA 4C0QC 5JS6A 1XN4A 4LIPD 4Y2YA 1SXJB 2Z83A 4IL5A 3QQ6A 2DE0X 1RI5A 4B5KA 2PT7A 2J87A 1XAIA 1NONA 3E9YA 1XD2B 3HA5A 1GQSA 1OLXA 1T3SA 4PZUA 1JALA 4KOEC 5JBQA 3WA7A 2R62A 1TGYA 3L49A 5AHWA 5EPOA 1D6SA 2BEWB 5TY0A 4IPTA 3EVNA 1Z68A 1KYWA 1J9ZA 1FNCA 1P4JA 3E0QA 1KARA 5SY4A 1I1QB 1WPGA 3ROGA 1Y7IA 4I9NA 2OG2A 1PEAA 4WZBB 3ZH9B 1G59A 3OZGA 2Z6QA 4J7UA 2IV3A 3S2IA 4CCSA 1QYRA 3ZCSA 9MHTA 4LWPA 4Q66C 2ODAA 5L3SB 3T35A 4DC1A 5BMOA 3MLAA 2HGSA 4P36A 1Y3BE 1RLIA 3LRXA 1XQYA 1Z6XA 1IH8A 3KKKA 3OETA 1U65A 1WABA 2QAGA 2V7UA 3EF0A 1CUDA 4HTFB 4Z9BA 4BXOA 3OJLA 2HPVA 3AINA 2I2AA 1KDTA 5COQA 3P2YA 3OSUA 1XLTA 5DXJA 5A03A 2A9RA 2H48A 3PE6A 2LUOA 1SNYA 1OZFA 2WJVA 2IKQA 2ZAGA 1UDRA 3EULA 1ULHA 4U0JA 2GEDA 1BU5A 1E96A 1KXZA 3KUKA 4TVKA 4YUXA 1WNTA 4GYJA 4NU6A 2V8BA 1P72A 3SP1A 3TE6A 4MWBA 1DKNA 2XQIA 3LQ2A 2P9EA 4LPSA 1J90A 2P6OA 2EAUA 2E7ZA 2WOOA 5IF9A 4EENA 3B1WA 2UZ1A 3MPOA 4OQDA 3BOSA 2YY6A 1Z0UA 1QU3A 1PJCA 1ULAA 4KR0A 5AVOA 5DM60 3VA7A 4M6WA 1Z2DA 2I4NA 3RU2A 1VHQA 1PR6A 3C45A 4YJGB 2R48A 2IW3A 4HHEA 5A5GA 1HV8A 1U04A 1WZIA 1QMPA 2QK4A 3AY0A 3HN6A 2IEYA 5D8DA 5DT2A 1C1DB 2D5LA 2OFPA 10MHA 2HQRA 1J07A 3ACCA 3EW7A 3D3WB 1WMFA 3U56A 2G70A 4HGPA 1X1RA 1R6BX 4QPZA 4GI1A 5DGCA 5LC1A 1JPUA 1PTKA 1TO1E 3TJRA 2LDBA 3DLAA 2QRKA 3ZZMA 3RKRA 1L7EA 3WZMA 5EMNA 2FDCA 2P3QA 1Y5IA 4QXQA 4NCKA 2PRYA 2XDWA 4ZDIA 4LZWA 3E8SA 4X20B 2WIDA 3H84A 3BX1A 1FUKA 1PJQA 3A4MA 1QTNA 2MR6A 5G0WA 3RSQA 2ZUWA 4B31A 1ZNWA 1A7JA 4M4SA 3MM4A 1BNCA 1KMQA 2VDWA 4XWTA 2QN8A 3JX9A 2GEBA 4OUDA 2OK7A 2PGDA 3K9QO 1IN6A 4Q1BA 4QOEA 4B6SA 3W79A 5BNZA 4BQFA 3EBLA 4PS0A 4YLYA 4KR9A 2BN4A 1L8QA 4IUDS 3DT8A 1DEHA 4MVJG 5KYWA 5KEIA 1AMNA 2GFQA <