5DTQA

Crystal structure of dot1l in complex with inhibitor cpd3 [(2,6-dichlorophenyl)(quinolin-6-yl)methanone]
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
328
structure length
320
Chain Sequence
LELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMENYVLIDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTNTRPSTGLLRHILQQVYNHSVTDPEKLNNYEPFSPEVYGETSFDLVAQMIDEIKMTDDDLFVDLGSGVGQVVLQVAAATNCKHHYGVEKADIPAKYAETMDREFRKWMKWYGKKHAEYTLERGDFLSEEWRERIANTSVIFVNNFAFGPEVDHQLKERFANMKEGGRIVSSKPFAPLNFRINSRNLSDIGTIMRVVELSPLKGSWTGKPVSYYLHTIDRTILENYFSSLKNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Optimization of a Fragment-Based Screening Hit toward Potent DOT1L Inhibitors Interacting in an Induced Binding Pocket.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Histone-lysine N-methyltransferase, H3 lysine-79 specific
total genus 103
structure length 320
sequence length 328
chains with identical sequence B
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2015-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08123 DOT1 Histone methylation protein DOT1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.60 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) 434 Repressor (Amino-terminal Domain) 5dtqA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5dtqA02
1MHTA 3EVFA 2O07A 3KKZA 4CXMA 4NECA 5E9QA 3ELDA 1PJZA 3JWHA 5DM2A 1ORHA 2VDWA 5FWDA 3ER8A 3SSOA 5HIJA 4GQBA 2O0LA 4PIPA 4RVFA 2FYTA 1XDZA 4FSDA 3LHDA 2ADMA 3UZUA 2ZIEA 3JWJA 3KPUA 3MCZA 4GOND 4C04A 1ZQ9A 5K0JA 4RTOA 4P7FA 2F8LA 5E1BA 3V8VA 2QRVB 4LWPA 4GF5A 2NXCA 3TR6A 2EG5A 3PVCA 2ZWAA 4C4AA 3IYLW 3M33A 3FUXA 1I1NA 3O4FA 3KQTA 5EHGA 2HMYB 3CJTA 3HCDA 3NVMB 4PYLA 1UFKA 5HOQA 1WS6A 2ZBQA 3GO4A 4RVDA 3OFKA 4GOOD 3SR4A 1Y8CA 5K03A 1NV8A 4FP9A 1G8SA 5HFJA 2R3SA 5C9ZA 1ZKDA 4E70A 5E1DA 3FYDA 2AOUB 4KIFA 4QQNA 1ZGAA 1IXKA 3TM4A 1D2GA 4BLVA 2P1DA 2QRVA 2I6GA 2NNWB 1R74A 2XVAA 3A7DA 1RJFA 3G89A 3P2EA 4PYKA 1G38A 2ZULA 5DXAA 1FPQA 3BWCA 2BR3A 2PWYA 3DMFA 4E2XA 5BXYA 1I9GA 2ZLBA 2NP7A 3B3JA 3KQQA 3SX0A 5CCXA 3DUWA 2I62A 3M6WA 4HGZA 2GLUA 3EMDA 5EIWA 4LWOA 3MCTA 1OR8A 2YUIA 3GXOA 1QYRA 5EHIA 4UOEA 3THSA 4PGGA 3BWBA 3H2BA 1T43A 2AN3A 4RVGA 2C7RA 1L3BA 2AOUA 1Q0TA 3HA3A 4RTRA 2ZWVA 2Q41A 1ZGJA 4PYMA 3EEYA 2H00A 3JWGA 3BXOA 2EFJA 2DULA 3FPHA 5DM4A 1AQIA 4RTQA 2G72A 4POOA 5HIIA 3KQOA 4X60A 2O05A 1AQJA 1U2ZA 3BWMA 2XYVA 3FRIA 5K0EA 3G8AA 3R24A 5LQJA 2UZ4A 1XVAA 2HTEA 1KYWA 3UJCA 3I58A 2Z6UA 1YUBA 3OU7A 3SVZA 3NWBA 5ICGA 5JR3A 3KQWA 2C7OA 1V39A 3KQVA 2JG3A 1P39A 2XBMA 2QM3A 2IH5A 4U7PB 1X1DA 4DKJA 5LQRA 3U81A 4DMGA 2EJUA 3EVCA 4DCMA 2ZW9A 5EOVA 3HCFA 5EMJA 3G2PA 2VDUE 1VIDA 3HVJA 5GM2A 3CJRA 3T0IA 1M0EA 3NW9A 5BW5A 1NW5A 4ISCA 3GRRA 3MTIA 2OZVA 3GRYA 5C1IA 2G8NA 3AWIA 3SGLA 3GCZA 3TM5A 4ER0A 2ZVJA 3MERA 3P71T 1M6YA 1JG3A 1I4WA 3P97A 5FHQA 3B3FA 5CVUA 5T64A 3TMAA 3CCFA 2YR0A 5LQUA 5LR6A 3G7UA 5CVJA 3T7RA 1NW7A 2IDJA 2I7CA 4GOLD 3LKZA 1YFJA 1IM8A 2FCAA 2YXLA 3BGVA 3EGIA 3EGVA 4KWCA 3FZGA 2A14A 4DCGA 3O31A 4DF3A 3I53A 4K6MA 4M37A 2LD4A 3KPVA 4X41A 4HSGA 3BT7A 3RIEA 3CJQA 2P35A 2JHPA 3IEIA 4PIMA 4R6XA 5EKUA 5B1SA 5CUQA 2NXEA 3HP7A 3CBGA 3B3GA 3VC2A 4KVZA 5EGSA 5GIPE 5GIOE 2EX4A 3UJ8A 4AZVA 1BHJA 4ER3A 3MAGA 3KR0A 5E2AA 1VP3A 3DTNA 5ICEA 5C0OE 4BP1A 3AXSA 3LDFA 2IBSA 4OBWA 5DLYA 4CKEA 3OZRA 4F86A 2ZZKA 3DLCA 3ERCA 3FUVA 2KW5A 4P58A 1N7JA 1WZNA 2AOTB 4V0RA 3UJBA 4AZWA 1RI1A 3SMQA 4PCAA 4CKCA 4XUCA 2BR4A 2K4MA 4FR0A 5GWXA 1VE3A 3NDJA 5CVVA 5FTWA 1KR5A 3G88A 4FS8A 3VSEA 2E5WA 4HTFB 3UA4A 5E8JA 1JG4A 1L3CA 3P9IA 2BH2A 4E2WA 5KQRA 1JSXA 2JH8A 3A25A 2N47A 1XDUA 2AN4A 3LDGA 2PT6A 2XYRA 2B9EA 1FBNA 2P40A 1VP9A 8MHTA 2WA1A 3OZTA 4EVIA 5DM1A 4HG2A 3K6RA 2GH1A 2BZGA 2O06A 1SKMA 1P91A 3OFJA 3TFWA 3UJ6A 3GWZA 2HWKA 3QV2A 4IV0A 5E9WA 5FCDA 5CCBA 2NXJA 4QPPA 3IV6A 3NDIA 4L7VA 4OA8A 5G02A 3SXJA 1SG9A 1UIRA 5P8WA 4DQ0A 1M6EX 3ELWA 3EVAA 3OPNA 2OKCA 4PYOA 4AX8A 3DP7A 1X19A 4EQZA 4C06A 1WXWA 1YB2A 2PXXA 2ORED 4ER7A 2P7HA 3E05A 5DSTA 5F2OA 1FJXA 4XUEA 1NBHA 5MHTA 2P3LA 3KR1A 5DX1A 3HEMA 3UJ9A 4A6EA 1NV9A 2PXAA 4QPNA 3T7TA 4IV8A 5T67A 3FYCA 2P3QA 5F2KA 2V7EA 5E1OA 5FQOA 4FT2A 4YUXA 3GRZA 2PGXA 1FP1D 1G55A 3REOA 2DPMA 1O9GA 3KR9A 3CVOA 4YUWA 2JJQA 1SVUA 5K0CA 5DTQA 3P9NA 5ERGB 5FHRA 2GPYA 3GIWA 1EJ0A 4CKBA 3PLAE 3ER9A 1XCLA 2VP3A 3GJYA 2B25A 2UYOA 3C3YA 2UYHA 2PKWA 4YV1A 5EVJA 4RX1A 1B42A 2GS9A 3LBYA 3DOUA 4PONA 4OX9Y 2V74B 2NYUA 4R05A 4RV9A 4AZTA 5EC8A 5HZMA 2AR0A 1F38A 5HIKA 2BM8A 2HR1A 3MB5A 4GEKA 5E2BA 1RJGA 3HCCA 3G5LA 3P2KA 5KQSA 2FK7A 4KDRA 1YZ3A 4KIGA 2I9KA 2ERCA 4KDCA 4QTUB 3FPFA 4C05A 3G2MA 3HCEA 4XUDA 5DM0A 5FQNA 4C03A 3PTAA 5DTMA 5HIMA 1YF3A 3D2LA 4YMHA 3QOWA 2Y1WA 5FA5A 5BW4A 2OBFA 3LX6A 2IPXA 3CKKA 7MHTA 3TOSA 2ZBRA 5FA8A 4X1OA 3AXTA 1L3IA 3LBFA 2AOWA 1IY9A 1VPTA 2OB1A 1RJDA 1VLMA 5EEGA 5DT2A 3M6VA 3UFBA 5KYGA 3G2OA 5CD1A 5EIFA 2JHAA 3DXXA 3EVEA 3PFGA 3SSNA 3UBTA 3FRHA 4C08A 2B2CA 4F85A 3C0KA 2PXCA 3ORHA 3BGIA 3EEOA 4CTKA 3MQ2A 3ME5A 4M38A 1ORIA 1SQGA 5D1NA 1JSZA 1KIAA 3BZBA 3Q87B 2PVCA 2ZBPA 4PNEA 3TKAA 1EG2A 2ZIGA 2IH2A 5K0BA 3I64A 2ZTHA 4EKGA 2AZTA 3TPZA 3EVZA 4OQEA 5BP7A 5U4XA 2ZZNA 5DX0A 3FPJA 2YXDA 3HNRA 4E2ZA 4C07A 4Z2YA 1HNNA 3BGDA 2AOXA 3LECA 3M70A 4M36A 4U7TB 3SM3A 1O54A 1Z3CA 3M6XA 4CWAA 1EIZA 3HTXA 3GU3A 3THRA 1VL5A 1SUSA 1TW3A 3B89A 3LSTA 1EJ6A 2Z6QA 5DWQA 3KPYA 2ONYA 2ZSUA 2GB4A 2Y1XA 3ELUA 4QQKA 3UJDA 3GGDA 4RTMA 4OQDA 3LDUA 2PV0A 3TRKA 3NMUF 5K05A 1X1AA 2IBTA 2AOTA 4P7KA 2IIPA 1QAMA 1X1CA 5DX8A 2G71A 4BP3A 3GRVA 1KPGA 5DRTA 4R8RA 2BR5A 4AUKA 1RI3A 2C7QA 3AJDA 1KPHA 2AN5A 4RVHA 4X61A 3KU1A 1RI4A 2OXTA 1Q0SA 5K0GA 1XDSA 1UWVA 1ZG3A 3EVBA 5DPMA 3PB3A 2IDKA 1R6AA 4GBED 2Z6AA 2BM9A 3HVIA 1G6Q1 1RJEA 1DUSA 2P8JA 2B3TA 3FUWA 4GC9A 1NBIA 2AOVA 4E32A 4RTSA 4RTKA 3O7WA 4RTPA 3M6UA 4E31A 2WK1A 1NW3A 3ID6C 2UYCA 5DSXA 5DXJA 1H1DA 3T7SA 3R0QA 3Q7EA 5E8RA 1QZZA 2XVMA 1HMYA 3P9CA 4HGYA 4LG1A 3I5UA 2YX1A 3UA3A 4BLWA 4PGHA 4PYQA 3BUSA 1QANA 3NJRA 3UJAA 5FWAA 1AF7A 4KW7A 3LCVB 1EQAA 3HCBA 2AS0A 5ICFA 5IH3A 9MHTA 1D2HA 2HNKA 1WXXA 4DZRA 2JH9A 3HCAA 3VYWA 1VBFA 4PWYA 5FULA 3RW9A 1XXLA 3GRUA 1F3LA 2OB2A 3MTEA 4HTFA 2HV9A 1NW6A 4QVKA 5GP1A 3DXYA 4EKIA 4BY9E 3PX2A 1SUIA 3BKXA 3G5TA 3G8BA 3KPJA 2QYOA 2PX4A 3NTVA 5EZQA 5FUBA 2CKDA 4DM3A 5CIYA 4MHTA 2PX8A 5FADA 5EQJB 5T6BA 3TKYA 3M4XA 3P2IA 3A4TA 3EVDA 3HM2A 4HRAA 2YXEA 3FTEA 5DTRA 1ZHFA 2O57A 4EK9A 3FTCA 3DMHA 2H11A 4CTJA 3LCUA 3QOXA 3P9KA 3OCJA 2G70A 4Y30A 3KQSA 1INLA 2CMGA 2H1RA 3ELYA 4FSXA 4YMGA 4YUYA 1P1BA 3CC8A 2PLWA 4FZVA 4FGZA 4ATNA 3C6KA 2C7PA 1JQEA 2ESRA 1TW2A 1XJ5A 2G1PA 2JHCA 3GNLA 1JG1A 2YTZA 1YFLA 2QY6A 3IHTA 5LQKA 5EG5A 3LCCA 4QVGA 5K0NA 4E33A 3BKWA 4WVLA 1NW8A 1WY7A 3KHKA 3OU6A 4MQ4A 1JG2A 5CVDA 4DA4A 3A26A 1G60A 1N2XA 3K0BA 5E9JA 3DULA 4B17A 5EKXA 5EMLA 2B78A 3CGGA 4PYIA 2ZCJA 4ER6A 1MJFA 2VDVE 4KRGA 3AY0A 2EJTA 3SSMA 3UJ7A 5F2NA 5LSAA 1SQFA 2IFTA 2OPBA 3OZSA 3NVKI 1PRYA 2WA2A 2QE6A 3HVKA 3BWYA 3KQMA 4GUAA 2OYRA 5CVEA 5K8VA 1KPIA 3PFHA 1BC5A 3FTDA 3DMGA 3X0DA 4RTNA 1XCJA 3LPMA 4E30A 1R18A 5GOZA 3VC1A 2IGTA 1JQDA 4QTTB 4YV2A 5GM1A 4MIKA 2FRXA 4GOMD 5H02A 5CM2Z 5HEKA 2PBFA 3FPGA 1L1EA 1QAOA 1P1CA 2ZIFA 2PJDA 3GDHA 4O29A 4R6WA 4FT4A 5EMMA 4PCLA 5EMKA 1JQ3A 4H0NA 3R6TA 3C3PA 1NT2A 1BOOA 3KR2A 2PSSA 4M7RA 3B5IA 3ANXA 3OE4A 4JXJA 3TLJA 1RI5A 5EEHA 3E8SA 3UWPA 1FP2A 3OU2A 2PX5A 1KYZA 4PYJA 5LQCA 1AV6A 4OBXA 1D2CA 4G56A 4A6DA 1JTFA 3WSTA 4EMSA 5K09A 2R6ZA 5DRYA 1TPYA 5LQAA 5HILA 1KXZA 4OA5A 1YZHA 4V0QA 1X1BA 1XTPA 3RODA 5LQNA 5K01A 2NP6A 4BLUA 3E23A 4RTJA 4Y2HA 3L8DA 3MHTA 3DLIA 2ONZA 1G8AA 2FK8A 2PWPA 2PX2A 3HVHA 3JWIA 4RWZA 1DCTA 3HA7A 10MHA 5GINE 3S68A 2VS1A 3LKDA 4RYLA 3F4KA 5KS2A 2GA9A 2NXNA 4RTLA 1R8XA 4ER5A 3I9FA 4IWNA 3DXZA 2IP2A 3P8ZA 4P7GA 4PINA 4YUVA 3HA5A 1KHHA 1NKVA 2P3OA 4YUZA 4HC4A 4QDJA 5ICCA 2YVLA 1WG8A 2P7IA 2GAFA 3EPPA 3TQSA 3A7EA 3PX3A 4ZTBA 1EAMA 3EGEA 1RI2A 5D1HA 3FTFA 3OE5A 2FPOA 4RSRA 5M5BA 2ZFUA 2P41A 3B7PA 2CL5A 3PS9A 2UYQA 2PT9A 4HH4A 4R8SA 3A27A 1DL5A 3EVGA 1JR4A 4WXHA 3FUUA 5K0LA 4AZSA 5K0FA 5EZSA 3EMBA 3MGGA 1R00A 1KP9A 3KQYA 4PYNA 2IH4A 4X63A 3R3HA 5KVAA 4F84A 2CWWA 5IKMA 3FPEA 4MWZA 3LL7A 3KPWA 1VQ1A 2YQZA 1L9KA 1JTEA 2AVDA 3FUTA 3LGAA 2PY6A 4P7JA 1NE2A 4GC5A 1BKYA 3E7PA 2FHPA 4XCXA 4LECA 2AVNA 3NWEA 4E2YA 1R8YA 3V97A 3PT9A 2CMHA 1N7IA 3DR5A 3KQPA 3G2QA 2VZ9A 3R9XB 5EPEA 2OO3A 4YV0A 2ZZMA 4MTLA 1QAQA 2XYQA 3C6MA 1O9HA 5E1MA 4QDKA 5JUWA 4IKPA 3DH0A 2OY0A
chains in the Genus database with same CATH superfamily
1JFSA 1II8B 1MHTA 2NZJA 3Q6NA 2Z9CA 3TDMA 1L8LA 3G5GA 5BMVB 5H9VA 2C2MA 5HVNA 2PUTA 4JCYA 4GR9A 4MW9A 2CYCA 3TG8A 4B40A 1YE8A 4UATA 4W7HA 4MRMB 2WUGA 5TPZA 3RKUA 5FWYB 4Z53A 3WLAA 2JCVA 3GDOA 2PO7A 1ACLA 1WD7A 3BD7A 3UC9A 3WHLA 4RTOA 1O7JA 1RBMA 4A91A 2Z8YM 5AKJA 4UU0A 3TD6A 4E5PA 1YVDA 4CEHA 1L1MA 4TKUB 1HPLA 5AMXA 4EITA 1QQ6A 3M89A 2IY7A 3CJTA 4PBTA 1BE1A 2XECA 4BWGA 3W6PA 3HUFA 1NXXA 1ZMOA 4I6TA 3F3KA 3R0ZA 4B6FA 5MFPA 4HNAB 4O2BF 2CV1A 3KZMA 3R8CA 1JB9A 3QUSA 1NUQA 5K03A 3GAZA 4MCXA 3KSZO 4GPD1 4GM4A 2R3SA 3D0OA 1ZKDA 1WDWB 5FIUA 4IDCA 3F47A 3CW9A 4QQNA 4ITRC 1J9GA 1UQRA 2I1QA 2J6IA 1GZ4A 3OO0A 1A1VA 5B3KA 2IOFA 3IQIX 1OGJA 1XD2A 1PRAA 2NNWB 2BNOA 1R6XA 1L7PA 2WF8A 2FN8A 4E2XA 3TGLA 2CFIA 5KTSA 3QKSB 1BA3A 4F93B 4J1WA 3IPYA 1E1NA 2NIPA 4L28A 4C22A 1OR8A 3O74A 2FH5B 2LBPA 4LHEA 2B0JA 4QOGA 1E2GA 1FE8A 2C8KA 3JATA 1PSWA 1UZAA 2FEKA 3MMZA 1U8FO 1F3OA 3NHUA 4MYCA 4IKOA 5FLYA 1LKZA 3B2NA 3WK5A 3FVWA 1QC5A 1JIIA 2NZUG 3ZVKA 1NFFA 3KTDA 1R12A 4ZTZB 4IDOA 4ECEA 3G0DA 3FJOA 4ZMSA 4XWWA 5DM4A 3B3AA 3WZ2A 4IBOA 2OBYA 3AOEA 5ILOA 1ITZA 1MB3A 1FPMA 3ITDA 3DHYA 3NAZA 5LQJA 1ILEA 2GPJA 1MR3F 3GJTA 4BU1A 5BN5A 5L4SA 3Q8KA 2ZB2A 2E3JA 3T9FA 3SICE 2UZ1B 1UQTA 3KQWA 3NPMA 3JD3A 4CMEA 2V6GA 3L6CA 5HWSA 4UEWA 4IZIA 2X0DA 2H8KA 1E6LA 3L1HA 4KQ9A 5CXSA 5IVKA 4ZARA 3QUAA 1F48A 1COWD 2AR7A 3EZYA 4MW7A 2IOHA 2XRFA 5DN9A 4CMJA 2WD7A 3TWOA 3UUGA 4DLVA 2R8XA 1W4BA 2ICAA 5BNWA 4NK4A 5SICE 3BIWA 2YCBA 3M6MD 1RKXA 3N74A 2X4GA 2BFEB 1BA2A 4NCJA 1GG5A 4GLFA 3AWIA 4H0CA 4C1BA 1MEOA 3HM9A 3HKEA 2R6JA 3PXAA 5G0UA 1GITA 1LJ8A 1YE3A 3AI1A 4LQ4A 1M6YA 2NO7A 1I4WA 2J32A 4EB8A 1C8VB 3WQRA 1OILA 4A92A 1CUGA 1OFUX 1P5RA 2XOKA 3BM5A 4Y7DA 3ZZ0A 2VYFA 4LTNA 4RC9A 3UUFA 5CT5A 3GLRA 2OOKA 5C7YA 1RZRD 1V2HE 2QEQA 4RUKA 4C9BA 1A72A 1JG7A 4HEJA 2FSSA 2GPWA 1BKSB 4I1RA 4N12A 3I53A 4I1PA 1NUUA 2LD4A 1AHIA 5CA1F 3IPAA 3U4QA 3PYLA 2P4HX 4RIGA 1FFSA 3HBAA 4AN0A 1FDVA 2ZU0C 4A8HA 4D9BA 4R6XA 1CLUA 4BZZA 4ZZ3A 3ETGA 1II8A 1LNQA 4KAXA 5JVDB 1JL3A 3UJ8A 1PUJA 2BRUC 3PBKA 1WBJB 4GAEA 5E2AA 2QTZA 3WL7A 3K09C 3IFSA 3JQ7B 4WJLA 1MQ9A 2INGX 4BP1A 2A4KA 5TMBA 3ZDBA 1HFJA 3EYAA 4HZUB 4B4KA 4LOKA 3H5RA 4ARCA 3DCYA 1SULA 3KLMX 4N5IX 1SQSA 1N7JA 1YL6A 1ZGBA 2IVZA 3R6LA 4KQ2A 1VMAA 3ESXA 2WILA 2JLSA 2ZPUA 3NGMA 4XUCA 2ORIA 1VJ0A 4UM5A 1KI1A 1QRRA 4XIJA 1XYGA 4OOFA 5HTKA 4BO2A 3E9DA 3RSLA 2BEVB 2QM7A 1H2XA 2I29A 2OAEA 3FCOA 3ZWPA 1JSXA 1MMFB 1L1QA 2Q2WA 2ZUDA 3EGXA 3JQ7A 3W3AD 3ZWDA 3RRMA 2P40A 1DAKA 1XQ9A 1A5TA 3PQEA 5LZ4A 4WKCA 4DRXA 5DCLA 4EG1A 1ORDA 4L9SA 2YWHA 4R2HA 2OFWA 3EOAI 3OWXA 4F9EA 3BHMA 4H3SA 1WXIA 3WIBA 4WZ6A 2EX0A 2SKDA 5BSWA 3GJ0A 4JA2A 4UVHA 1C0EA 3UT6A 1P2DA 1UPAA 2VXCA 3N8HA 1ODTC 4W1RA 4XPZA 3ZWWA 2ZP1A 4CW7A 4RM3A 4A2CA 4Q1DA 1JE1A 2HUNA 2TSYB 3E05A 3EQ8A 3HBMA 4YAEA 4UHKA 1C1XB 1J21A 1JEJA 3JVDA 3T7TA 5JJCA 1FS4A 4GO1A 4Y2QA 5KSZA 4EGCB 1SRQA 4FBGA 2LIVA 5IN5A 4FT2A 1NIPA 2CN1A 1DINA 4BCDA 1MBZA 3NM5A 1MF7A 1FP1D 2Q3LA 5L6MB 4TS3A 1FDRA 1HEUA 3AR8A 4WD3A 2I9PA 1QRSA 1ECLA 3FLEA 3JPWA 3GEPA 3MCAA 1BDHA 4HVLA 2QE7D 4KI7A 1AKYA 2C5EA 3M1YA 2H92A 2UYOA 4YGXB 1OPRA 4FN4A 4OAQA 1WXEA 1F5SA 2VHCA 1V1RB 2JFGA 2RHGB 3FNFA 3LXRA 4LTDA 1W94A 3UWMA 4LVNA 3L92A 4F72A 1LC3A 2GRAA 4BMNA 5JU6A 2AX3A 1E2DA 4WN9A 5EC8A 2EQBA 5P21A 4DVJA 1Y7HA 2BM8A 1P5ZB 3RVDA 3JXEA 4MHOA 5FR1A 1JDUA 1E1CB 3CF6R 4F4JA 5TJ9A 1EQ2A 4OAPA 3FPFA 4RKRA 5I9SA 3E22A 1FXWF 1KEVA 2HHHB 1U3FA 2EHJA 3SY8A 1R0CA 1R4NB 4KGZA 4KL8S 3K05A 4KVGA 5HIMA 4CN8A 5HQTA 2ZUBA 3TAHA 4DR7B 4FHEA 3T1VA 3TOSA 1A98A 1J56A 1IL0A 5FA8A 3RM3A 3TL6A 1DGQA 2PX0A 3LBFA 3W5VA 1D6NA 1VRWA 2Q5HA 1NN3A 5JZMA 3HXLA 4HX9A 4Z5DA 5AD1A 1XPOA 4K0RA 1TKBA 3H75A 2H3EA 3PHBE 2E4AA 3B1YA 3SSNA 3FRHA 1QHYA 1AKWA 3FPKA 3S7TA 4EUNA 4H1UA 1I4EB 1O6BA 4TZ0A 2HF7A 1M9NA 1OX5A 3L1VA 3K73O 3ADDA 5M29A 1C41A 3Q87B 4QFCA 1ECFA 2IU7A 4PV7A 1JLHA 4PNEA 2R5WA 3N2EA 3M49A 1BQ3A 4UZFA 1XNGA 2P91A 2XB6A 4OGFA 4YMSA 3LISA 2J0EA 3HWX1 1ISJA 4OQEA 1CUSA 2MU1A 2WPDA 3IUMA 3H3FA 5FB3A 2JA1A 2FUCA 1QE0A 3U4QB 4J75A 4KSCA 5IFLA 1Y8ZA 3DEAA 4KMMA 2ONKA 4PLVA 2I66A 3M70A 1YTUA 5LWQA 1BS1A 4OO3A 2HMVA 4CI9A 2HCTA 2OORA 3K0HA 4PSVA 4DPMA 1VHWA 3DFMA 2FI1A 3H9EO 5BN1A 1T9AA 4HLNA 3ZE2B 4TS1A 4EAAA 4UJ5A 1SUFA 1AS2A 1JMKC 4JEMA 2Z4TA 3SEQA 2QRQA 3AEQB 1F51E 3HKEB 4MX8A 3BMOB 2W6ID 4ALMA 2WMDA 2ORVA 5BR7A 1G4UR 3UK2A 1DP4A 2Z1NA 1NGSA 1SVNA 4LBZA 2P0EA 4N0QA 1HE2A 4OHBA 3P27A 2JGRA 2RBKA 5DRTA 3ZCPA 2QY9A 3A6KA 1E77A 1EK1A 2AV6A 1XJCA 1C0KA 1QYXA 2EZUA 2FEOA 3NHRA 4DG5A 5ECYA 2V5VA 3OPXA 1IDOA 5AK3A 1TMYA 2PXTA 2JFWA 2OCXA 5HIAA 4G25A 2B3TA 9ATCA 2TYSB 3H7AA 1ATIA 1JG6A 3NHYA 5K8TA 5A6SB 4MYDA 4FLMA 4KDEA 4R2WA 1KOFA 1ACMA 3TE6A 4GP9A 3L7JA 4RORA 1Z0SA 5J3JA 2O8FA 5DSXA 1HXHA 4MPRA 5DXJA 1DHTA 3SEZA 4GUDA 4JVOA 1GVNB 1MW8X 1EX7A 2F3UA 3I6BA 4M4SA 3RUIA 3I0NA 3U3XA 3V34A 5HS4A 4MVXA 2VHTA 3GUVA 2LNDA 4GNKA 4YG4A 3UK1A 2QTGA 5FWAA 2R6CA 4HNTA 3LCMA 3VVMA 4DLXA 1NOIA 2C2BA 1IZ0A 1LDBA 3D1VA 4CLOB 3D8RA 4TPKA 5HX7A 2RK4A 3EXG1 4JYPA 5EWJA 1XXLA 2I4OA 2WU3A 3HSYA 4UCXA 2A9JA 3HZOA 4HTFA 1E2EA 1N0VC 1UT8A 3IUYA 3H04A 3MJDA 1K6IA 3Q3JB 4LQLA 4LMAA 3EIOA 4ND4A 4KPUB 1LBIA 4JVLA 2I6SA 2CCGA 1O2DA 5T6BA 5C7IO 2UVDA 5AKZA 3KOUA 1N8TA 3OT1B 2HO5A 4G5QA 4YDQA 3OZDA 3ZYZA 1FFEA 2H11A 3PE5A 2Y71A 1GN9A 2CHGA 2G70A 2Q5OA 3OCJA 4EB0A 2MMCA 5JPDA 1OB2A 2IYPA 2AJDA 4PO8A 1GTRA 2CMGA 4B43A 2H1RA 4YMGA 4OU4A 5REQA 1EESA 3DV0B 1XD8A 1U2TA 1B2RA 4WEOA 1Q92A 3IIEA 1J4AA 4AJ9A 2G1PA 3PE3A 1MX3A 4V3CA 2HDHA 2JHCA 3AMVA 2HWYA 1WCV1 4LYGA 3ZIDA 3M6AA 2IX9A 1SMKA 4TMVA 4BO0A 2JBAA 3LO8A 5LQKA 2YYAA 4JOBA 4WLEA 1R15A 2BD0A 5DBFA 3SEFA 2FG5A 4E33A 3L0OA 3WMRA 4WVLA 5DGDA 1NATA 3MWEA 4KG7A 4ZVUA 4YCSA 3DT6A 4N5LA 1C9YA 4EZIA 4FHGA 5G0TA 3UH1A 3KFXA 3KXDA 4NCXA 4N8EA 1KOLA 2RHHA 5TIIA 5HUHA 4UXHA 1M72A 1G4AE 3L07A 1AUQA 2EJTA 5F2NA 3Q85A 3PI7A 2OR3A 4IS3A 1ADGA 1IPHA 1R9MA 1XE3A 3H19A 4FOLA 4GPBA 1H9BA 1CR6A 5B6PA 1LQ2A 1LS1A 4U8GA 3I1JA 1C81A 5CVEA 1KPIA 2OBMA 2QIPA 4KMOA 3H1AA 4WBNA 5GADl 2MEZA 1Y1KE 4QQRA 1XMJA 3NWJA 5M04A 1DIHA 5JS1A 2BMDA 2XQIA 1O03A 2YJTD 3AHFA 2W37A 2GF2A 5ITZB 2XA2A 4D5EA 2HMTA 1DAMA 4ZMRA 5BN4A 3ZJ4A 1TUBA 4WCVA 2R9VA 1HOXA 3L84A 5EMMA 5EMKA 3L1PA 5DM70 4PU4C 3H0CA 3GJ3A 2AJLI 7AT1A 3AJAA 3BHJA 1QFMA 5J5CA 3BS4A 3OE4A 1XRLA 1LZLA 3H9JA 2DUUA 3SE7A 4ZO9A 4EPTA 5IWCA 5JOQA 1VXOA 4MW4A 4W9NA 1JVSA 4G0OA 1AV6A 2R1UA 3ZHQA 4BPBA 4L4XA 4YNBA 5CX4A 3DVLA 1P4JA 4CV3A 1LVGA 3BULA 2BH9A 2GFIA 4UASA 5K09A 3CB2A 4C2UA 3ODPA 1TYCA 3PT5A 1L4BA 4CUJA 5JAQA 2EZTA 1HEIA 2VF8A 1IBLB 4BOYA 3CXUA 1PJTA 4BNVA 2V0GA 1N1GA 2YW9A 2NP6A 1ST2A 3QQ6A 1XK6A 3EA5A 1EK0A 3G2KA 3HVHA 3ZHRA 3WLMA 2PUJA 2QYTA 4M7OA 1VJTA 1V5WA 3ICWA 3OE7D 3DE0X 2H4ZA 4D3YA 2FE4A 3ZLJA 2O2SA 1LX6A 2P69A 3EZNA 4H77A 4Q37A 1R8XA 4J0HA 3CB4A 2COKA 4XPIB 3VYVA 2PXEA 5ALZA 3OLCX 1XTTA 5HGJA 2CT8A 3AB3A 1J42A 3E15A 4EW1A 5C37A 2HBRA 3LBAA 2HN9A 5YASA 3G02A 1ENYA 1IY0A 1QIJA 2NSHA 3CLUC 2PT9A 3M1IA 4H7PA 4LSWA 4M83A 4WXHA 3T4EA 2PL1A 3CMCO 3U0VA 2H3HA 5K4AA 3R3XA 3MMSA 1U3CA 4UFPA 1VC2A 1LRJA 2AXEA 2JI9A 1MQSA 3ZD9A 2DSTA 1OIXA 1R00A 3WDSA 1KJ9A 1WA5A 1D2NA 1JIKA 4K6FA 4OHCA 3E2MA 4OHYA 4V0OA 1WKVA 4BMYA 3LGAA 2F67A 2VRNA 1K5GA 4M86A 3TO5A 4KITB 3TNFA 1QIGA 2I7VA 2EW1A 3JQAD 2AFHB 3WXBA 4BC0A 4TV9B 4E2YA 1A7KA 3PL1A 1Z7YA 3L40A 4M0CA 5HKBA 1WBBA 5EESA 4R3UC 4RULA 3PKJA 2XT9A 3V9PA 2VSXA 2QRMA 5B37A 4DRXB 5C1DA 4JR0A 1AXRA 1T9KA 4YONB 3C6MA 3GFFA 2ATXA 3W05A 4ZOEA 4QE3A 2C1XA 4DJEC 3DH0A 5HSGA 5BXQC 3CMMA 4KO2S 4JI8B 1JHZA 4ND8A 3BERA 2M1ZA 5CBPA 4GIBA 2QK4A 5DASA 5CAEB 4A8JB 1AS0A 3FZYA 1SH7A 1TUBB 3CR7A 4ZYUA 3HDJA 1RHMA 1JSRA 4JLMA 4FYPA 5CP8A 1ESCA 3FOEC 2G0NA 2RONA 1ONPA 3MCZA 4F4CA 2WAMA 3O3CA 3V8VA 5E1BA 1CIJA 2Q4EA 3QE2A 4GHWA 1URPA 4Z86A 3ZU4A 2GCOA 2WT8A 2FUNB 4PYLA 2VK1A 4WASA 1P62B 3ESRA 4Y98A 5HOQA 2CYBA 4HVAA 3Q3IA 4JFRA 4OKIA 3BA1A 5L40A 4RVDA 3WAGA 2Z3WA 1DC6A 4P9NA 2CNLA 4BBZA 1CUDA 1LTHR 2BJHA 3WK6A 1YA6A 5HFJA 4PAGA 3GLHA 4F91B 5IVHA 2V9PA 2GPBA 2WKQA 1UBJS 1L5HA 2ICPA 2D8AA 3KL4A 2FWMX 1Z0UA 2Q07A 2Q62A 1XELA 4NJEA 1PSDA 5HF8A 3R74A 4DA7A 4WEQA 4NNPA 2B69A 4WL0A 1JFFA 5DXAA 2YMQA 3K2IA 3OBIA 3SU8A 1VI5A 4B6GA 3RJZA 3HFJA 3B3JA 1B4DA 4XKJA 3W5JA 2XF2A 1SCDA 4HAOA 1SZJG 3MCTA 2JRLA 1X7YA 3DVSX 4B32A 5LWHA 3VNQA 3NIWA 2V58A 4QVIA 2J08A 3D2AA 1VECA 5LP6B 1QONA 3ET5A 3QF4A 1I7SB 2D7JA 3JQFC 4P4LA 5BQ5A 3B9QA 1T43A 4QBTA 4RVGA 1FRZA 1UBMS 3DT9A 3RSCA 1N1DA 3OKZA 3RS9A 1U0RA 2B36A 4AAYA 2GRJA 2DBYA 3F46A 3KAPA 4WY5A 4COOA 1QG0A 1MAWA 2ZJ3A 3VU1A 3FM9A 4NMLA 4XXHA 1C9JA 2ZJ8A 5SZIA 5L4LA 4LF5B 4Q7LA 4MKHA 4RV5A 4D79A 1ULSA 4HYTA 1U2ZA 4YMUA 2I8LA 4FFOA 3H0KA 2QMQA 1PYGA 1V26A 5K0EA 1NNLA 2P6OA 5J4LA 4HAXA 1YCHA 3VR3D 3LOUA 4G41A 1ZSYA 1KZ9A 4ZK2A 2Y1CA 4F3RA 5DWDA 4RJIA 5IUKC 4TSRA 2JG3A 4OI0A 1EGQA 3MWFA 3O5AA 2IH5A 1JAHA 2JCSA 4ZVNA 3IT0A 3OP4A 4JLAA 2DTXA 4N7MA 1HFEL 1B8OA 2CXUA 2FLKA 1G8KA 4JI7B 1J06A 3NTRA 3QEMB 4AUNA 5EMJA 3QVGB 4R9VA 1AMOA 1W88B 4LC1A 4PLCA 4TKLA 2FN7A 2IITA 3NW9A 1BXKA 2V7QD 4PAWA 5E4YA 3V2UA 4DE5A 3MTIA 4ZOLA 2X1HA 3FZQA 1V7QA 2IEAA 3MRTA 2W2KA 2ZI4A 1SB9A 2QI9C 2PXLA 5ICSA 4WZAA 4H3VA 5LQUA 4Y2SA 1EVLA 2XIQA 1Z4LA 2D2VA 4MGZR 2GXUA 2C7GA 3IMKA 2D2IA 3NEPX 3IUPA 1ZBDA 3KT8A 3ABZA 1V8PA 3LKZA 4OSEA 5C7OO 1X15A 3B48A 4Z9BA 1BHQ1 5BQXA 4PZZA 1NQOA 1E6CA 3F5DA 5K0SA 1P0MA 5GPBA 2CVPA 4E4TA 3OZEA 1XWWA 2ZJ6A 4ZVPA 4F4HA 4FC7A 4DARA 2FWIA 1AK1A 2C1ZA 3PNYA 1YRAA 4M87A 1AX9A 4IQ0A 4PIMA 4WZBE 4IOKA 4ZI7F 3T0FA 4AJEA 3H83A 2E87A 4A16A 4DXAA 3HGTA 3HO1A 3FKQA 4KVZA 3ZHZA 1T0BA 3EK2A 2KZ8A 4QARA 1HDGO 1BDMA 4ER3A 2HA6A 4BN5A 4D3SA 4BKPA 1M7HA 3FGZA 1UK9A 1NZFA 3DTNA 1ZNXA 4GMKA 5E6SB 3T3MB 3LDFA 4OBWA 4CKEA 4JJEA 2WI8A 4C4XA 5BSRA 2ZZKA 4HBGA 1OWMA 4MGKR 2QAJA 4RHTA 2JFOA 3E5NA 4IDDA 2XITA 3L4JA 2GHQA 4CQJA 1XDGA 2KYRA 2Y9MB 3OPYI 3Q9LA 1W5EA 4GKAA 4RGQA 3NDJA 1NVVR 3DBHB 4YMLA 3K9FC 2WNSA 1KQ3A 1EUDB 1I7LA 1UEXC 2R6R1 4G1FA 1PT9A 1P1HA 3SVTA 3QWGA 3DBRA 1G8PA 1U02A 3P9IA 5KWJA 5HTOA 1V37A 1YQUA 3QFCA 1O57A 4P3OA 2Z5LA 1VLJA 4DUGD 5JY6A 2O3RA 1UOEA 3KKPA 1CZRA 5D3MA 2MCFA 2RAVA 4B9EA 4DYVA 4HT3B 4YYZA 4WLOA 5IM4A 1N3BA 3FAKA 1JQBA 3LD9A 5GGYA 1DKQA 2GH1A 1JSLA 4TRNA 4YC7A 1A9SA 5TPZD 3R8XA 3IQZA 2QU8A 3T7KA 4YH1A 5K3OA 5G3ZA 4E03A 4L7VA 4QREA 2QBYB 2GETA 4TTSA 4N03A 4DQ0A 3O2QB 1WUTA 4J1TC 5K2OA 2X2FA 3CBQA 3W5HA 2AFIE 2JD0A 3MD9A 2WKPA 2XNCA 3NM4A 1DMSA 4FONA 4FFVA 4J2HA 3WHPA 2PXDA 1S7CA 4QJ5A 2AIRA 1O95D 2WU8A 4E94A 5I7OA 5JANA 5L9AA 2Q8PA 2VDNB 2RHDA 1OKKD 2IW3A 3HEMA 4JLNA 3JASB 3TOCA 2WUEA 4D42A 1XL0A 1EFLA 4A1FA 4JYCA 2O1WA 4XDGA 3RH0A 5AVVA 4MEAA 4MWTA 6LDHA 5LMCA 5LP6F 1TC2A 3CN9A 5JH7A 3L4BC 1VE7A 3V2GA 1QFJA 4FM9A 4ALNA 4LHVA 2WRZA 5DGXA 2VHQA 1R0RE 2K6GA 4D44A 3H3XA 4HH1A 4DANA 1GQRA 3G5MA 3A4NA 3OTHA 4KR3A 1VRCA 1PNVA 3PRYA 4DJTA 1Z8HA 3REQB 4HMOA 1JIUA 1UC5B 3VVBA 3C3YA 4XR4A 3SKVA 5EE1A 4NCNA 3RZZA 2J3JA 4RX1A 5K8CA 3C3CA 4DNPA 3UG7A 4OHRA 2FN9A 3TIGA 5F5XA 2IWRA 1FYWA 3OQJA 1KAOA 3ABSB 3Q1KA 1T0UA 4IINA 4IXMA 4ZK6A 3M4YA 3MT8A 2W4MA 2QLJA 4XDZA 2ZSBA 4QNRA 2VRCA 5HQ3B 4G0NA 5KQSA 4N3NA 3LKBA 1HBJA 3DBLB 2I9KA 3OOJA 1K7XB 2I8CA 3PRJA 2DBVO 3HCEA 4Q18A 2XNDA 3DKPA 4NENA 1LPSA 1C7EA 5AW5A 3D2LA 1IC6A 5FA5A 3FYTA 4I9FA 2E4XA 1RS0A 3S5JA 1KF0A 2AG0A 2GN8A 4BQQA 3F6WA 1RZ3A 2H08A 4CT0A 2NSYA 2YHBA 3T9EA 3NT5A 1WB6A 2V4MA 2ZRPA 1GHTA 3ILHA 2WWIA 5CFOA 5IAKA 3D0RA 3F7OA 2IK8A 4EHAA 5T4EA 2IC5A 4XJTA 1W0JA 3V32A 1U7WA 2C31A 3HUDA 3TX6A 4G5YA 4G24A 1IU9A 1SELA 2HF8A 2PVCA 4X85A 4UQLA 1E8NA 3AVTA 1L5KA 5JFGA 1WSDA 5BN5B 2ZIGA 4O25A 5K0BA 2BVNA 3RVOA 2LP4Y 5I4KA 1CUXA 2IPAB 1L7BA 2Z04A 3IEVA 2XOXA 4J07A 3S2ZA 5I9NA 5JCJD 1Y8RB 4YJ2F 1LQUA 3K16A 3R0JA 4F8DA 1M76A 1ID1A 3BF7A 3INNA 4TLMB 1FP4B 4HRXA 4OG2A 1GGFA 2V1XA 2QAGA 4KXLA 4DLBA 2C4VA 3G3EA 5B36A 3VNVA 1A96A 1ESZA 3MFYA 1GU7A 4TROA 2IOQA 4BX3A 2ONYA 3H2SA 3NBAA 3D5EA 2BFEA 3NUGA 5JHGB 1GTL1 4GP6A 1FEZA 2HMSA 1J09A 4CF3A 5JJ5A 3QU5A 3JZMA 1R64A 1H3FA 3RIMA 5JALA 3WS7A 4CGYA 2CK3A 1C9EA 2PYZA 4QNMA 1P6XA 2IU0A 3IELA 1NXQA 1L4KA 1B0PA 1GR1A 2OT3B 1VHTA 2FR0A 3QUBA 3MMNA 3U37A 2C92A 2E4ZA 3ESQA 3IUNA 5DZSA 4YBRA 1PV2A 3RNOA 1N77A 3ZWQA 1CF9A 3IQXA 4J7UA 3S81A 1ZZGA 3PB3A 5CW2A 5SYNA 4FKZA 1ZXLA 4NZMA 1E2QA 2L0XA 4FINA 1Q57A 1E4YA 4RHXA 3WC4A 3GK3A 4GC9A 4AG6A 5A5GA 5JDIC 3E5RA 3QF4B 1N6LA 2WTBA 3FGOA 5CXUA 1U0EA 2ANBA 2O38A 4Y6GB 3O7WA 3R0IA 4JJ7A 2E21A 3FDZA 4C14A 1Z4OA 3ID6C 3D6TB 4AJLA 3L5OA 4EI9A 3CCCA 3VZBA 3LNTA 1UTXA 1NLFA 1ZPQA 4H4CA 1Z2PX 1H8ED 1HG1A 1KK2A 1VG9B 5EJMA 5CEFA 3WYBA 4OJTA 1PCXA 1H65A 2EJCA 2QN3A 5E8RA 4RY2A 4S2EA 1OXTA 3ZU2A 2DC1A 3UGTA 2AFIA 1L7EA 3ZOZA 2W22A 3BUSA 1DCMA 2XQJA 2Q0XA 3AVPA 3B9BA 5ALKA 4Z99A 3PRHA 2FPUA 1CF4A 4MRMA 1Z18A 4IJ6A 4W5JA 1S8OA 2MYUA 1L5HB 3FSGD 5ICFA 1EJBA 3PUJA 1D2HA 1K6JA 1YBMA 3VYRB 3WNVA 4D97A 3R5JA 4URWR 2D2FA 5LYJF 1RBQA 1LB1B 1S9DA 1VJ5A 3EUSA 3G2LA 4JI0B 2KLBA 2HGSA 2YJ4A 1DI0A 1WNTA 3RSFA 4QM7A 4S2UA 3OMXA 3CVVA 1V6AA 3A9XA 3OTGA 3I62A 4MUFA 1A88A 5TX7A 5G0WA 1CS0B 3FMYA 2LUOA 2QJRA 2VATA 2D1QA 4I6RA 2Z2JA 1DKPA 3JQGB 3ZKWA 3FNBA 3SC4A 1PR2A 4JS0A 3THXA 4KKXB 2XDWA 5FLKA 3M4XA 3PR1A 3TNLA 3PNLA 3QU7A 4M0FA 2VDQB 3U2QA 4JWKA 1OSLA 1PD1A 3F6CA 3FPLA 3O2SB 2OD7A 2OTCA 3FTCA 1HX7A 5M34A 1LLIA 2PRZA 3QOXA 2E6KA 2GD2A 2RHWA 3EXIA 4NIMA 2M2IA 3NH9A 1IBCA 3UBMA 1SQ6A 4CIBA 2GZRA 5ALGA 1H2EA 1XEXB 2ZYWX 1J9EA 4JGBA 4ND8B 1V8FA 5CDYA 2PLWA 1ZJ6A 4W5WA 3H5OA 1R5JA 3QX8A 3L04A 1J0EA 4NCIA 4B7CA 3O03A 4KYUA 3CF4A 4LXHA 1CBUA 4YLGA 5DLPA 1GAJA 1C4WA 3D2BA 5ADVA 3D3JA 3EG9B 4RVSA 3DLBA 2FWAA 3EODA 1U8AA 3A26A 3UCEA 4AF6A 3K0BA 5JXIA 4YDSA 1PR4A 3W34A 4I6GA 1PRVA 3FOCA 4HSEA 2XMGA 4MR7A 2XTZA 3CGGA 4UDOA 4KRFA 2VH1A 3B2QA 4N5DA 2H57A 2P9ZA 3N2IA 3PGKA 1RXWA 3FBGA 3HCOA 4B2IA 1HTBA 4IRMA 5IJWA 5AUNB 2FDXA 4XI9A 1E0AA 3AIMA 3GPCA 5H7XA 3T5TA 3TUJC 3H5NA 2G67A 3KQMA 1EZ4A 4OV6B 4DSZA 3QQPA 1XRJA 4EZBA 4Z4IA 5IC5A 1L8OA 2BF7A 1YCGA 1YQWA 2PQ6A 3DJFA 3ENZA 4DY4A 3U7GA 4OHPA 4D8UA 1CQIA 4YV2A 4PPFA 4GOMD 4OQPA 4JBYA 4IIJA 2A0YA 4F3TA 2E9SA 1P1CA 3LC2O 4ZYXA 2ID7A 3JVEA 1DUIA 3E8XA 4N3BA 5C8YB 4FN3A 2BFAA 3R6TA 3HKDA 2H18A 2PLRA 3U1TA 2IXDA 4RZHA 2EWTA 1OH7A 1O6GA 5CT8A 2AYXA 4DCJA 3UWPA 3REGA 1RXSA 3VJKA 4PYJA 3L02A 4LVOA 4A6DA 3MILA 5BR4A 2AH5A 1CJVC 3GLIA 2FGJA 1AHPA 1VMKA 3CIOA 3A6DA 1SUBA 4AM8A 2EBWA 4U2FA 5A71A 2RHLA 3BMCA 3LUJA 1RQ2A 2FJ0A 5JNTA 2ZQ5A 4TKZA 1RACA 1V4NA 1Z2EA 2IE0A 1DKMA 1PQUA 1KSJA 1TO6A 1U0OC 1WSAA 4Q6WA 4U7FA 3BTUA 1S3FA 1XVLA 3DE2X 4WCDA 3T9CA 1MG5A 3WLOA 2J85A 1AGRA 4F4FA 4F4UA 2YN2A 4MDFA 2PG3A 2A7XA 4LXXA 4RYDA 5DCUA 2GEBA 5ALDA 1L7RA 1RR6A 5C35A 3RJ5A 2IOYA 1OE0A 1T2CA 1PZHA 1KSGA 2HDWA 2R25B 5ICCA 5CTAA 3VHXA 4LTMA 3K0AA 1CVRA 4E2FA 3WLTA 3PXPA 2FW1A 3PK0A 4IIHA 5M5BA 5JNVA 2PH3A 5FHQA 2UYQA 4KXMA 5EUBA 5IDWA 3EVGA 5JNSA 1UZUA 5AXCA 4UBOA 1OU4A 3FWZA 4W6ZA 3C87A 5EZSA 5IXJA 4TQ9A 2HJVA 3EAGA 3M0EA 4GVXA 2YIVX 1HR0B 5IKMA 2Y2UA 4FGWA 3Q6IA 1AO3A 1LFDB 2P5SA 1LSOA 4G2TA 4J0EA 2O14A 4OB6A 3W2GA 3ZY3A 1IJEA 4BXOB 2R2AA 4HGRA 1GUFA 1QE5A 3K0AB 4UHHA 2O5RA 1SAYA 3UAYA 1ORTA 1Q0QA 1QG6A 1DRWA 4KX5A 2E0IA 1U4OA 3C7DB 3T41A 3AVUA 4RA9A 2DHQA 4CEJB 4LWZA 3SLGA 2IHYA 4QRHA 1BDJA 2UV8A 4YJFB 5EIEA 3NHKA 1JKJB 1G3QA 1RXEA 1FLAA 5ALXA 3PC7A 4D4LA 4NECA 3FCUB 3T3OA 1PJQA 4ZZ0A 2GJKA 1Z68A 2E49A 3QWBA 2C9ZA 3E2PA 2R6GA 1XRMA 3WL4A 4AMVA 3T1NA 3UMVA 2O0LA 2O2JA 4OCZA 4DT1A 1PZGA 3UFXA 3VOAA 1KEZA 2YV3A 1CUJA 4OXIA 2ADMA 4WY2A 1P4HA 2REOA 1RQ7A 3T9DA 4ETWA 1WBDA 4BO4A 2VPYA 5JRDS 1QQ5A 4PX2A 5ARDA 3E0XA 2CXOA 2VPXA 2ZVPX 5EHGA 2W6QA 3NVMB 4HATA 1QFYA 1ZVJA 3LJKA 1XTUA 3CZ9A 3OD1A 1L7OA 2ZUCA 3NVAA 3GJXC 4H9GA 4KLZA 1IFXA 5FTJA 2XQKA 3MJVA 1C1DA 3OF5A 3T3EA 4A82A 5DYWA 1BHSA 2QPAA 4WH0A 1C3XA 3D2CA 2P6NA 1A69A 2AOUB 3FYDA 4HQKA 2MDTA 2P78A 3FCAA 2C4TA 3LQXA 5KAPA 4M8KA 1LLQA 4X8MA 4KBFA 2OM6A 2B1JA 4Y2RA 4OIFA 3TZCA 5KHOC 2O3UA 1RC8A 5B7QA 4JP8A 3PXGA 1NJ5A 2VDOB 4PYKA 3QZUA 4BAUA 1G38A 2OV1A 3CCBA 1LI4A 4KQCA 1O4WA 1NVBA 2GUGA 3B1FA 1VE6A 1VKNA 2E4VA 2I99A 3IB6A 4MA4A 5F64A 1D5CA 2B1RA 3ZWMA 2AXVA 1JF8A 2X8BA 4UOEA 1QLHA 4W1SA 1GY8A 3IA2A 4MUXA 1ICIA 4W4TA 4LGYA 4F06A 3X44A 1T8YA 2PPLA 2VH2A 4IXTA 5KTPA 2ZJYA 3GVPA 1V6CA 2H2IA 1G8GA 4KQKA 4QGFA 1Z4MA 1RRCA 4UFNA 1UXGA 3E9QA 4A2PA 2CYAA 1M8GA 1Q1GA 3E7FA 3RBAA 4TXMA 4WMLA 1FIUA 4NU6A 4JL6A 3VK0A 2YRXA 4X60A 1U11A 5IJXA 3A1EA 2DFVA 2GEUA 3UJCA 3SJBA 3RUEA 4HS4A 2OQ2A 4UUMA 5FI5A 4BVHA 1KJYA 4RVUA 4LHSA 4WFJA 3SQDA 5AQ1A 2X7HA 1R5OA 2LYLA 3CKYA 5SZHB 1CPYA 3ZCXA 4QGAA 3OQ1A 1Z08A 1L4MA 2AQKA 5DU2A 3WK8A 2PBLA 3KLNA 3ZQ4A 4EYGA 5G4KA 1R0KA 2O23A 7ABPA 2OCPA 3ESDA 3NOOA 3A1TA 3HDGA 3HVJA 4XOIA 1YDHA 3NP7A 4PNZA 3T0IA 2GAOA 1F14A 3K6SA 4ISCA 4R98A 2Z98A 4L0MA 5AW7A 1LBQA 1KY5A 4QLBA 3IR7A 3SGLA 1U9CA 4G5GA 2C78A 5IDXA 1JKMA 3CH5A 4RY0A 3DE3X 4FR2A 5FBZA 2WFAA 2PRIA 4BNHA 2JGDA 3U5ZB 4FDUA 4IYJA 3T7RA 4I2VA 4JXZA 1TAUA 4EEZA 3CUWA 3ZXUB 3QJGA 3UAOA 4DOMA 2W0SA 4RE6A 2Q1WA 4XH9B 4XIGS 4ZGWA 4DCGA 2FZVA 4GFDA 3O31A 3Q7TA 3C8MA 3TRBA 2UZAA 2IV1A 3CX7A 3GA5A 1UAAA 5FPTA 3ZHSA 2LKDA 5K99A 1C1DB 1NVKA 2VHVA 3MXOA 3BT7A 5KNCA 1YC2A 3RIEA 1HYGA 2JHPA 4UVDA 4BNUA 1ZLXA 3L06A 3C8DA 3RC9A 4H6VA 2GHRA 5EJAA 1JWBB 1T2EA 4W5RA 1EFVA 5GIPE 1KYTA 3F9CA 4PHCA 2O8FB 5GGXA 3ZY6A 4LV8B 2R5FA 1MA3A 3F6YA 3LUGA 3QRWA 4QJ3A 4O4JA 5CG1A 4OIMA 4Z1MD 2J9ZB 4HYYA 4AW9A 3UFXB 1UK8A 5EWMA 2F17A 3TZHA 2ZR9A 2FUKA 1FX1A 1P19A 2G6TA 3UK7A 1MABA 1WPQA 2R65A 1J1IA 3K30A 3NV9A 3LT4A 3PG5A 4KLAA 1B43A 1EP1B 1TU4A 2GPSA 5LQDA 3CZRA 4Z7JA 5I5EA 1PFUA 1JDBC 3GWGA 3H5VA 5J2TF 3EFOB 2ZR8A 5TQ2B 5CB4B 2H5EA 1UR5A 4U0KA 1M1XB 5H82A 1OUMA 3HVRA 1RQPA 1RAAA 2WTAA 2WU1A 4CM5A 2QTRA 5EE3A 4KQ1A 1POWA 4BN4A 4N47A 5A03A 1PQ4A 4X20A 2PT6A 5KIAA 2KWIA 4MDYA 4KNVA 5HQJA 4C0LA 4EW2A 2QXUA 3ADCA 4P0TA 2V0CA 2Z08A 4BE7B 3K6RA 2BZGA 1IUOA 4PLGA 4MVJF 3MT0A 2YWGA 3BIFA 2ASVA 4IV0A 1AB6A 2M1XA 1E3MA 1T8SA 3GOQA 4FYIA 3IV6A 4D9MA 3KUKA 1NI4B 1SBIA 1ISHA 2C2XA 3PPVA 3V00A 3ELWA 3QVOA 2IZ7A 3LMKA 4F1KA 1GA1A 1I7DA 4DE8A 4ACAA 1Y9QA 3V4ZA 1FJXA 1L4NA 4XUEA 1NBHA 1Q22A 3C8UA 2GO1A 5DX1A 3GVCA 3HZRA 3A2NA 3C85A 4LJ9A 1MTZA 2G25A 3K1JA 4YASA 3UNXA 4YRGA 6CHYA 1EVIA 1ZS9A 2ADOA 2ZYRA 4YCCA 3AV3A 2F3SA 3MRSA 2PPXA 1T1IA 4JLKA 2FKNA 3B70A 3W2HA 5J4HA 2PUAA 1I2AA 3I72A 4JUDX 4A8JC 3KR9A 1Q0TA 3K72B 3RU7A 5DTQA 4MVJE 3IKLA 3ZNPA 3IDAA 1M1NA 3MS7A 3HB0A 4LCJA 4GBJA 4QX6A 3KCQA 2QMZA 5DBIA 3PIDA 4F8EA 3STXA 4AJ2A 4D9KA 3ZIUA 2B35A 4UE2A 3LBYA 1PGJA 3LUCA 3IBCA 3TG2A 2B30A 1DKOA 4OX9Y 4HX5A 3VZQA 1Z88A 3VKUA 1ZC4A 2C94A 4M7WA 2IUOA 1LMB3 4H16A 3MNFA 4QJIA 4AN4A 1RAEA 4MMXB 1RJGA 4IDNA 2BCJQ 3ZUGA 2ERCA 1CT9A 2FZCA 1Y3DE 4LRXA 4BQSA 2JAPA 1S8FA 4KGXA 4X6LA 3RJTA 5AI6A 1MRZA 1N5KA 2P9JA 3RVPA 3D59A 5JRJA 3KQKA 4EEXA 5B58C 1YWGO 2AOWA 2VZLA 2PFKA 2OB1A 3MWEB 1CZNA 1BNCA 1SIBE 1T0JB 2XNJA 4J76A 4BB9A 4HWPA 3WL3A 1O96A 3F8SA 1VBMA 3EVEA 4L51A 3TTXA 1P3DA 3N2ZB 4NBKA 4ESOA 3RVBA 3D8BA 1KIMA 3BGIA 4EIWA 2R63A 3ABQB 3O92A 1NMEA 3H2IA 1J49A 2AMJA 3EGCA 3MS4A 3PEUA 2WKSA 2BDUA 3JZFA 2WZCA 4UBKA 4DEVA 5J4KA 1FW6A 3KAKA 2X9LA 3EZXA 3KJQA 1M8JA 4TTAA 3I64A 1UODA 4Z4EA 2Q50A 3D43A 3V8QA 1JI0A 1EFTA 2YFKA 4IIGA 5BP7A 4NG5A 4HUTA 4C07A 4RKWA 4C4YA 2EL7A 2DCMA 4TXJA 1BH6A 1DE0A 3LECA 3DDOA 3VV3A 1UJ6A 5JI3E 1EIZA 3TLAA 2MSNA 4JP5A 1ISRA 2IA5A 2V4ZA 3D3WA 3GU3A 3EH2A 4G1UC 1DX6A 4H7DA 4E5NA 1NC3A 2AMYA 5DK6A 4UPVA 3ZQJA 4EW6A 1KFKB 3T99A 3UB4A 2D5CA 2HM7A 1E20A 4BKUA 4QQKA 1QMPA 1BU5A 4UTZA 5DJ5A 2VRWA 4JI2B 2AOTA 2ZPAA 2I6FA 2IIPA 3DBHA 3KZKA 3VQTA 3ZWYA 1OKKA 1X1CA 4AKTA 5KVSA 1JA9A 1O94D 1PAUA 3V42A 3WYCA 2QZJA 4OI2A 3GDFA 3P5SA 1EIWA 1O95A 1EFDN 3KWFA 1X2BA 4NYIQ 4OGGA 4RPCA 4TWJA 4X61A 5CCDA 4C5AA 4DDVA 2HMWA 1ZG3A 3U56A 1UM9B 2C2ZA 3GQVA 3TOVA 1U0TA 1UJCA 4NEHB 1HE4A 4GBMA 4Y67A 4F3NA 3NJ4A 1NU6A 5AK0A 3ZK7A 1XA0A 3EC1A 2WY2D 4ISBA 2WU0A 4L4ZA 3TIVA 4A9AA 1YFZA 2G77B 4PGAA 4D8TA 3SCGA 2XJ4A 1OYOA 1IBMB 1S6YA 2BJCA 5AK5A 3H5AA 4JI5B 3UB2A 1N4DA 1HC7A 1GKYA 4MUHA 3HB7A 5BYBA 1QZZA 1P1KA 4KBGA 2GN0A 4L4UA 1JJVA 1SVMA 1Z0AA 2PUFA 3QUCA 1OB5A 3ZKAA 3DS8A 1KAGA 1UKYA 4KUHA 3QWAA 2JD2A 1M2EA 3KEGA 1PS8A 3E70C 3H97A 3KOOA 2W90A 4N18A 1N6HA 1P31A 1YDWA 3CF2A 3I52A 1XPRA 2L18A 4L95C 1TRHA 2WMNB 3M4NA 4Q1AA 2RGBA 3BD9A 3HB5X 1R0BA 1MEEA 4LCEA 1H6AA 1NLYA 1PLJA 1QO0D 2F43B 4QPJC 2D6FA 3VYWA 3RT9A 2VUTA 2WICA 4PR0A 2ECOA 3CN7A 2FF7A 1U2PA 3EDQA 3L1KA 3W1VA 1QJCA 5ESDA 2IXBA 5IBQA 3N6RA 3I9KA 2E2WA 4L4YA 3HS3A 4P53A 3CRQA 3ONVA 4NU5A 3GCXA 3UY4A 5ADWA 4G5XA 2WQZA 3CLRC 2F43A 3JATB 3IRUA 4KPYA 2Q0QA 2ID4A 3GLVA 1K5DA 3ZWOA 4HXYA 1CNEA 1ZHFA 1K86A 1YDFA 3N87A 4NAHA 3X2FA 5KYUB 3DF7A 3NHBA 2O8NA 5FPHA 2ODNA 1Z5OA 3WRXC 3HJGA 3DM9B 5IFKA 4RSMA 4BMPB 4MWCA 5WRFA 2DE0X 3JWPA 4P4NA 5AO9A 1AF4A 4JVSB 4DR1B 5FLEX 3DZFA 3FMFA 2DP4E 4A26A 3O4IA 4FZVA 1JIQA 4CM6A 1DRKA 4C7BA 2WIGA 2ESRA 3HN7A 3W6ZA 1QTRA 3QVWA 5FWXA 1UMBB 3QKIA 4CV2A 4MVJI 3W8DA 2PUDA 1M8FA 5J63A 4BMXA 3U1BA 3KXAA 2HJGA 3PYXA 1JIVA 2WZDA 3DO6A 3L6UA 4N40A 4OD0A 2GPNA 4WW0A 3KTFA 1RLIA 4P4SB 1YGPA 2XUJA 3SFVA 4MVCA 4JJAA 1QO9A 2HU7A 3GJRA 5KTYA 3HR4A 4GPAA 3DEJA 1GGJA 2ECFA 1IY2A 1UBSB 3AX6A 1ZZCA 1N8SA 4IDQA 4RKYA 1T4CA 3WLFA 1CEEA 1E6KA 4DA8A 2DJ5A 4NPCA 2B34A 2JFPA 4FBIA 2NU7A 4YQEA 3VOBA 4DR6B 2BY4A 1M2OA 1ID8A 4LKRA 3I9V1 2D0DA 2JZNA 1XCJA 2X6TA 2PTGA 4HDNA 2DU8A 3PDUA 3G2NA 2IGTA 4HFMA 1DBWA 1FFDA 1PKXA 3UH0A 3VR5D 3NQ41 3NZLA 2OZLB 1KJNA 2NO9A 2PBFA 3CO5A 3ACBA 3FRJA 9ABPA 4DRYA 2ZYTX 1EFRA 1GPLA 2ILTA 2WNIA 1KU6A 1NLZA 4NMXB 2X9QA 5DT9A 3TCKA 3LH5A 2MSEB 2QX6A 3FYUB 3ICCA 4DZTA 4MUKA 1HT0A 1VJGA 1ZAKA 4MULA 1QPGA 2ZAMA 5AOBA 4AJNA 3FIUA 4C76A 2CL6X 2H1FA 2PS3A 3B1JA 4DMCA 2FMUA 1DCKA 4IMRA 3ZXYA 3THWB 3KSBC 2VXYA 3DAHA 2Z5FA 2GBIA 3AESB 3IHWA 3R6GA 2YBDA 1FSZA 1Q0ZA 1SUAA 2I3BA 1GM5A 5JAIA 1M0SA 1S2IA 2P1RA 1MLDA 3STHA 3BHNA 5LQNA 3R1FA 3T15A 4EHIA 1S5PA 2CL0X 2QRNA 3CUTA 3G0OA 2H9IA 3GNTA 2C3UA 1EFPB 1CC1S 1G8AA 3MQ4A 4FCVA 2VJCA 4P8RA 4YRRA 4XE5A 5JCXA 2O2XA 3UGJA 3CECA 1D0SA 2V03A 2WWVD 2DWCA 1IQRA 1BDBA 1VBKA 1X38A 3QBVA 3I9FA 2X1LA 4FFRA 1Q1QA 4DRZA 3WFJA 1X14A 1E1KA 2A92A 1UXCA 1H8HD 1PWHA 4X4IA 3MJCA 3UMRA 1ZBQA 1OI2A 3EGEA 2XT0A 2BONA 4RQTA 3PNPA 3CZ4A 2LDXA 3KLPX 3OPYA 4IDFA 1EFPA 1SEPA 5B3LA 4AECA 4G85A 2W93A 1F06A 3DZKA 3KDAA 2KSQA 3LQRA 4L76A 2BFPA 3A31A 1PZMA 1X42A 2C9CA 3DG9A 1C2TA 4PYNA 1V16B 4B76A 4J90A 4XYBA 1N9KA 4F84A 4L85A 4MCIA 1XTVA 4MXDA 4NABA 4DREA 3PCXA 1N0UA 3PLRA 3CQ9A 5B3JA 3ANYB 4QWWA 2PY6A 1DNPA 1TF2A 2YC2C 2RGCA 2Y0EA 4YYEA 2R0QC 3ZV3A 1XXHB 2WJ3A 4B5KA 3A3PA 1D4FA 2C0PA 2Z2YA 1NHWA 2FPRA 4G1EB 2HCBA 4CHGA 2X9GA 2Q27A 3ZCTA 4C0AC 4CDRA 4EHNA 5A4MS 5JPIA 3QYFA 5THKA 1A71A 1IEQA 2GM5A 1NN5A 2MINA 4GEGA 3OURA 3KHTA 3MINA 4LW8A 2XMCA 1QZ3A 2P79A 3JQAA 4MGEA 1NDUA 5LXTA 3O8OA 4MV3A 4ZO7A 3URMA 3HDYA 4IPTA 4DDTA 5K3CA 4JK3A 2D54A 4EF4A 4XTCS 4CIWA 4L5IA 1YBAA 4RMGA 4DQDA 2IYXA 3SHTA 2BKLA 1TX4B 2GGSA 1M2NA 1FNCA 3UEOA 2C5AA 2O0MA 3NXHA 2KX7A 1E63A 2Z9BA 3L0CA 4HNGA 4ZQFA 5K0TA 1KQFA 4AZ0A 1CEYA 2NX2A 4XGRA 5U9CA 1B41A 1PHRA 3N75A 5DV9A 2BTQA 4HDMA 3ONEA 1B8VA 3OCUA 1STOA 2HU8A 3NTQA 3A37A 3UQZA 4JROA 4NY1A 1CSEE 3QLUA 1YNSA 3GUHA 3OQIA 2ZQZA 2HMYB 4XQ9A 1GG2A 1Z8DA 2IHNA 5EZ6B 1GYQA 1CWUA 1RE0A 1HYQA 2L49A 3BD8A 3I6QA 5E3JA 3H1EA 2FPIB 2OGWA 3TTWA 4O1MA 3DMPA 4J4BA 3W2TA 4RF4A 4F9FA 3SZ3A 2FY8A 3B6JA 4AJPA 4YAIA 3PITA 4WIAA 3IJPA 2Z57A 4RETA 2QUIA 3T4XA 3WQSB 1D2GA 1KJQA 2RAFA 4CLRA 4GMGA 4WXEA 5LP1A 4MVJH 4JBXA 3Q11A 1TIKA 3DR3A 3VH1A 2YASA 4FE3A 2Q3CA 1RRGA 1DXOA 5JMTA 1WQ4A 4JJGA 4O8BA 4FQ7A 1O3YA 4EHDA 5HKKD 2DKNA 3KDPA 4N7RA 4UM7A 3QBEA 3HG7A 3ZV4A 2WJZB 2YIMA 1E7RA 1G98A 2D13A 4ZFNA 4RTRA 2ZIUB 2RD2A 3GLGE 1XOIA 2UKDA 1SBQA 2WB4A 3O47A 1HFWA 2A8YA 3ICPA 1I5EA 4POAA 2ZSJA 3U9LA 1XNJA 1XN1A 3J81k 4Z3DA 1AQJA 2WD7B 3BDAA 2A9KA 3G8AA 3QHQA 2UZ4A 4R8VA 3K20A 1DBIA 4D9HA 2DF8A 3OHSX 3NWBA 1L5QA 5CNIA 5LZ8A 5L95A 2AJCA 3I30X 1V39A 4N5NA 4DHWA 5HZHA 4U7PB 7REQB 1JR6A 1AKTA 2OHVA 2VWGA 4FXOA 4R1UA 3LW8A 1VRVA 1I0LA 3K9QO 2HKIA 3U4IA 5BOSA 3NG1A 5T4HA 2J9GA 2QP9X 3LRTA 1VIDA 3AF1A 1ZINA 4HQRA 4US0R 2J4CA 3CJRA 3EEBA 4GXRA 4XD7D 3R75A 4DS3A 2P65A 3F96A 4R7TA 4HDAA 4URHA 1UDRA 5C46F 1M2WA 1NUTA 2OL4A 3ORYA 4F6RA 1P9WA 3V4PB 2CSXA 4Q7QA 4QASA 3MERA 4DCMA 3HLYA 2VKQA 3KE9A 1X3SA 4FFMA 5CVUA 4Z4QA 1W4AA 2VWHA 1A7AA 4GQMA 2PYDA 1XT6A 4L73A 3UAVA 4AL4A 2VP5A 3RG2A 4PS0A 3CNLA 3JARA 3Q5DA 1NZJA 2FCAA 2NZ2A 5B55A 3AR5A 4ND1A 4MS4A 2A14A 3TDNA 3K09A 4ZHQA 3UJHA 4IZOA 1E1QA 1G5FA 3NDRA 4F11A 4PLPA 4F45A 3UMCA 3DMTC 3MK31 2AWIA 3AUKA 3LW7A 4AUMA 3DP9A 2WHXA 2C04A 1Z6XA 4HV4A 4MINA 4Y2PA 2C96A 1CUIA 1E3TA 1BMFA 1GPAA 1BHJA 4AZVA 4CQMB 3VAYA 2QX4A 3U1VA 2ZEJA 4OBMA 1N5IA 3E9MA 3TLMA 3CX3A 2BBWA 1WF6A 4QL3A 5AOVA 3OZRA 3GRFA 4F2GA 1FFYA 1J7KA 1SUEA 3IQHX 4W8HA 2XCSB 2H4XA 3A4YA 3N07A 3AB8A 4GVPA 3WK4A 4C0QC 1GKLA 2PX6A 3C6ZA 1P72A 3LUFA 3H5WA 5LLTA 2O9JA 5C4GB 5G40A 3WGQA 2FF5A 4FR0A 2ZTLA 4KLRA 4AK9A 4DIDA 5B6IA 3IP7A 1ZGHA 3FWHA 3H86A 4EL5A 3SHOA 3TELA 4FQ8A 1LW6E 2H2DA 2IEGA 3AQIA 4I4LA 4OLFA 1MV8A 1KVUA 1LLFA 2FE1A 4S24A 2WFLB 2QG4A 1PR3A 2ZIWB 1JPNA 2IP1A 2FOIA 4ZT4A 1ZY2A 1PV1A 2I1WA 2ILVA 3GLHB 1HG0A 3FHOA 4JBGA 1S8NA 3GBSA 4LSGA 1TZKA 3EWNA 1N8NA 3TH5A 5DYTA 3FI9A 3Q41A 3IIIA 2R7AA 3SBEA 4CG3A 3EGWA 4UTVA 1H8HA 1QM5A 2APJA 4LYFA 3WL5A 1E98A 4OL9A 1RXUA 3MWKA 1USIA 4E09A 1W4CA 1MQ8B 5F35A 3GEBA 5IZCC 1U1IA 3KZCA 1SBHA 4R2XA 3FPSA 3TQOA 1F1JA 1SKUA 3VGJA 1GQFA 2YY7A 1FMCA 4P7BA 4W6QA 1D1SA 3K0FA 2J9XB 3HJTA 4TTJA 5L8VA 1R16A 1KZ4A 4FKBA 1Z63A 5T67A 3TI9A 4U3JA 2O3SA 2O3QA 2I2DA 4YGYA 2CB0A 5JCOA 1WW3A 4HADA 4HD8A 2WKRA 1JLRA 5FTKA 2PGXA 5K3SA 4RWEA 5JSZA 1ZOOA 1I6LA 3OQIB 2DPMA 3CEPB 4HX2A 4YUWA 4ZJUA 2A0UA 1G9XA 2XTMA 2X40A 5ERYA 5ERGB 1I24A 4TKVA 3U60B 5JJKA 2WUSR 4TYMA 5DEIA 2PFGA 3I2JA 3U3KA 2VP3A 1ZM3A 2BFFA 3WWDA 4BO8A 2QAGC 3FG9A 1FW8A 1NXVA 4TL7A 1SVLA 4TMWA 1WHTA 2FLVA 2YS6A 4OYLA 4CKXA 1YQDA 1EFRD 1G19A 1KARA 4HH3C 1PT6A 5EAIA 5LA6A 1U90A 2J59A 3BL6A 3ROFA 3UMFA 4CLRB 1W52X 2LIPA 2QN8A 2X1VA 4Q4DA 4PN7A 3TUZC 4FGSA 4AKSA 4P0QB 2CNWA 2QLTA 4Q4HA 1CJMA 3HK2A 1DWOA 3JYNA 3COSA 3BXPA 4RD0A 4U7WA 3MFQA 3K2BA 4WNCA 4BQNA 4YLYA 3QBTA 2KHZA 2XMBA 4X93A 5FQNA 1YGYA 2C3MA 2FQXA 2QMOA 4ZXFA 3AF5A 2GN2A 2ISSD 1XCBA 2OBFA 3BSYA 3CKKA 2BFDA 1CB0A 1S1CA 2NO4A 3Q5EA 4RA9B 3RI3A 2AQ8A 4U5XA 2GFQA 1YR1A 4KPEC 4ALKA 3Q10A 3EHEA 5DHRA 3LIPA 1K7SN 2C5HA 2DBZA 1GZ7A 1SQ5A 4XLZA 3KJGA 1E2FA 5FJIA 5KTRA 1D4ZA 3O93A 3A9YA 4O4IB 2PXHA 5I9TA 3V7WA 1ZD9A 1D4OA 4I46A 2I03A 1SA0B 3DLPX 4P3YA 5FX2A 1L8XA 2F3QA 5A5EA 4CTKA 5EJ9A 1ORIA 1SQGA 3ZHUA 3VVCA 5EXPA 4WDQA 3BL5A 3CH4B 4W9RA 1LLUA 2VVTA 3TRIA 4J29A 2GEFA 1GQQA 5C18A 4BTVA 1COZA 2ATVA 2VYNA 2PZJA 1BE0A 3EN0A 3BE4A 4ARBA 2VYND 4UC0A 4I3GA 5A7GA 4U7TB 1TQ8A 2V7BA 3OPQA 3LHFA 5F7OA 3PZBA 2O0JA 1XZKA 3HV2A 4D4KA 2XKAA 2IKQA 4NL4H 5IBRA 3RC7A 5JH7F 1SKYB 1JLMA 4Z5HA 2F64A 5AKXA 1R6TA 1BMTA 2CFSA 2JGJA 3UN1A 4ZOQI 1EJ6A 1XXHA 5ISMA 2E89A 4HXFB 3BRCA 4R51A 5KOJB 1K2VN 2AI3A 2QUKA 2ZJ7A 3F74A 4HN2A 4AJOA 3VNRA 3I5YA 4HGQA 2YHIA 2DTDA 1W4LA 2XA9A 4HL6A 6ADHA 3EX7C 5K05A 1TK2A 3I42A 2WU4A 1SVKA 2G76A 1QYCA 1LLCA 1Z5ZA 1N78A 1WHSA 3HYTA 3S70A 2JAXA 2DSNA 3ANTA 4TLDA 2DT8A 1ZUD1 2WNHA 1OOEA 1YBFA 3TZLA 5MN5A 2NZWA 4ALJA 2P9FA 3OPVA 3MCVA 1W48A 3LX8A 3RRJA 3WMEA 2CJWA 4BNTA 4E5KA 2CNWD 2OCKA 2PRSA 1E9VA 3L79A 4AJJA 3QKWA 3FZEA 4B0PA 3AY7A 5AW9A 3L3BA 3CNNA 4L72A 1ZRNA 2D1SA 4UUOA 2AOVA 4RZXA 1T6BY 4NHOA 2P6RA 3U49A 4MAAA 6ABPA 1GPJA 3KQNA 3EPJA 2V7UA 2VHWA 5CURA 4G63A 1DARA 2QAIA 1DFGA 1QHIA 3NX4A 3RF6A 4K5QA 1NVFA 4KIJA 3R3ZA 2R8PA 2C5GA 4GZMA 5F21A 2H1SA 4EYEA 5GV8A 1IZYA 3HZHA 3UA3A 2O4AA 4BLWA 3VR0A 5K20A 1XZHA 4JQYA 4G23A 3N39C 2YZ7A 1ZS4A 5IW8A 1DAEA 5BV0A 1F4PA 4Q0MA 2F59A 3W1EA 5BWCA 3LCVB 2HIMA 2P67A 1M34B 3ET4A 9MHTA 5KJFA 1X9GA 3LFHA 4WPGA 1X7ZB 4QXOA 2I3ZA 2GBFA 1ZH6A 3BXGA 2E18A 5H9WA 1X7WB 2QL7A 3THWA 2HF9A 1JLSA 1BWQA 4U7GA 1UPTA 4DG8A 2OB2A 3PDWA 4RL6A 4RKQA 2VJMA 3SI7A 2N9UA 1HLPA 4X71A 4O4HA 3RG8A 4OGLA 1UINA 1QIEA 3AF4A 2FXIA 3R5KA 2PZBA 1MG0A 4HY3A 2RIRA 3RVRA 5DI3B 5IDQA 2AXQA 5FUBA 4X1KA 2H1CA 1X1RA 2LYKA 3AP1A 3EIWA 3LL4A 3QLUC 3OM8A 4UAJA 3SIPA 2GCGA 2ZRQA 5EQJB 4RXMA 1Y48E 4DLPA 3W7VA 1APBA 2KPOA 1U2RA 4ABTA 1XVTA 2YWDA 1W73A 1GTG1 1YNOA 2O57A 1WH6A 5D3KA 4ZD6A 1PJCA 1FQJA 3CR3C 1GAWA 1XC7A 2PZGA 3KALA 4XB2A 2YDYA 5I3CA 4UHJA 4WRRA 2NSJA 3L7NA 4MVWA 4PZ0A 1K5HA 3WB0A 4PO1A 4OLJA 2P2SA 2XOKD 4G0YA 1L5RA 4HDSA 1WUJS 4BMDA 3RYCA 4ATNA 1SCIA 3C6KA 4IR7A 4OP1A 3AONB 3AGQA 3BK2A 1N2HA 3AQ4A 1HE1C 1RPTA 2OHFA 4J0IA 3G0BA 3ZCRA 2OBLA 1BIFA 1ODLA 4JSRA 3U4HA 5FBQB 3WL8A 3AB7A 1N7HA 2ZCUA 3IR6A 1IY1A 4HAUA 4NDZA 1C9MA 5EKXA 3TQQA 3MGAA 2BEJA 4ZOBA 4MROA 1AKUA 3HL4A 2OK8A 3P2OA 1BMFD 1K8XB 4UBMA 4FMCB 2I1VB 2E6UX 3OZSA 1RIFA 2WSBA 4AI6A 1NYTA 3EXG2 4JQSA 5AW3A 3DDHA 2ABWA 4NONA 4DVGA 4J0DA 2WJJA 1F17A 4I0WB 3JQ9A 4UZEA 1UPBA 1E1QD 5GOZA 1C3EA 3SCHA 1JKJA 2HLPA 1C4OA 3AC0A 3D3WB 3LYUA 2OCDA 3PE4A 2GEJA 1HZZA 2OOSA 2VCHA 1T4MA 1OVMA 2H1VA 3JS5A 3QF3A 5ENZA 3RFUA 4GG1A 4C0HA 1E9FA 2P5UA 1X7DA 3LUKA 3DTTA 1Z34A 1K63A 4TGLA 3WV4A 5CHYA 5SY4A 3ZU3A 2POCA 5JYDA 1NVGA 1QCDA 5EHZA 4YECA 5IMSA 3AERB 1KA9H 1U28A 3IAM1 1ULZA 2H2AA 3LVRE 1X8LA 1UBGA 3BJMA 3JZDA 1TMGE 4AD8A 4IP0A 1FP2A 1U2EA 1ZN8A 4WVFA 5IBPA 3A2MA 4K9KA 1KZ7B 3OJWA 3QVUA 4G56A 5F77A 4J0QA 1OYWA 1ZM4A 2JVIA 4EMSA 5BNZA 2ZIZA 1FQWA 3MPOA 4YMWA 3M3DA 5DHAA 1CULC 3IAS6 3HCWA 2FCRA 4RVCA 3CUYA 4LXIA 4UHBA 3WLKX 2CNOA 5EUMA 1SXJA 2JLCA 4K9RA 3UANA 3HJHA 1MDBA 3EXHA 2VR1A 2P3SA 3I0ZA 4LJYA 3EDYA 3ZDCA 3CSSA 2ONZA 2IZ5A 2YMLA 3EISA 3SLKA 1KEKA 1L4YA 1E79D 2WWFA 4NRDA 1ZU4A 4HQFA 4RANA 4IRXA 5LFAA 1E5TA 1M74A 1RTTA 4MS1B 4NZYA 2SKCA 2AFVA 3O26A 2OV6A 4Q4JB 5A05A 1E1RA 2Z43A 3D4BA 3MYYA 3R3YA 4BGEA 2Q0HA 3QI2A 4PSDA 4A6PA 3NKVA 1KHHA 3ORFA 2IDZA 2GWHA 3TAUA 2VF4X 3WADA 4WHMA 3WFZA 4FGKA 4CM8B 4YUZA 5CXXA 3R20A 1HKUA 2CXPA 3HGMA 1RXVA 3NHLA 2P4EA 1LVHA 3AH8A 2J9FB 3NHSA 3BA6A 1GFSA 2B1IA 3GMTA 4N01A 1OY1A 3BH7A 4GZ6A 5K6RA 5ALHA 5IJ0B 3LY9A 2VSQA 4HVTA 1J1ZA 2GLTA 3PP8A 4J0JA 1X77A 2GVZC 2YZGA 2O19A 1U9IC 2QDKA 2ZB8A 3WYDA 3AHIA 1E1CA 1WXFA 3SPXA 4LVCA 4YAOA 1EZ1A 1V1JA 2VP9A 3AOEC 1BFDA 2SCUA 3RAEC 2AVDA 3X1YA 1SU4A 2XZPA 1YKFA 4ZZ2A 3QPCA 2GZ1A 4I36A 4LOJA 5DHFA 4PZ9A 2AVNA 2CZCA 2E7ZA 2D1YA 1GZ5A 2MHCA 3G9QA 3V1NA 3QX9A 1A9PA 2HLHA 5BV1A 3AI2A 4DR2B 1RW4A 4IWXA 3T9BA 5ED0A 1RWBA 2R87A 4ZU1X 3T5BA 1J00A 1SHUX 1QJ4A 1C3VA 2O6HA 1DOAA 4MWDA 4GM0A 1GNTA 1PZFA 2O5VA 1QKKA 5H3LA 3RVQA 4MRAA 4B7UA 1V71A 2HV8A 1UPCA 5DP2A 4ZEVA 2G07A 3A1WA 3AINA 1O1YA 4MIOA 5EXTA 3BILA 2OEPA 4BLTA 2CNBA 4G4GA 5GONF 4KAAA 4OHZA 4LJ4A 3SSOA 3IE0A 3AILA 3N53A 3B20A 5KNCD 1ICEA 1M1UA 4IKEA 1B8NA 1TNDA 3L8HA 5F9MA 4D3XA 3Q3EA 2OHXA 3JWJA 1ZM9A 4IGKA 1M1YB 1MHPA 5KC8A 2F9LA 1F8UA 1WL8A 1SOWA 4LWPA 4GF5A 4AQDA 5KZMB 3DVRX 3PVCA 1NBAA 1U9ZA 2MSCB 4EY3A 4KLNA 3NS7A 4Z5XA 3KSRA 3EFOA 1J8FA 4LYAA 1UFKA 4MLCA 3DBRB 3HNOA 3BWVA 4AZ3A 2IIQA 1PRUA 1KETA 1KEUA 3OFKA 4KTTE 1UPXA 4PBRA 5FLXA 1USVA 2EKQA 2B7BA 2RAUA 2V6MA 3GP5A 1GGMA 4MR9B 1EGMB 4P92A 4B9AA 4E70A 4DDWA 3U16A 1GRQA 1ND5A 2RGAA 5E4TA 5I4BA 1P5HA 3LA8A 5CFLA 4J94A 3B1WA 1E5XA 3GRAA 1NBEA 2PGIA 4KZPA 2D4HA 2QNBA 5HK9A 2ZPTX 3DONA 3HRHA 3M5CA 1X1QA 4IMIB 3PCTA 4M1TA 3G89A 2O2DA 4ZAXA 2CDRA 4QXAA 2BR3A 1I2MA 3D31A 2ZTSA 1I9GA 3AERA 4TYWA 3NAQA 5CCXA 2E85A 1NX6A 3VYSB 1ZNQO 3R77A 1JXAA 2AI2A 4MRPA 5EIWA 1YE5A 3JQGA 1MO6A 1NBMA 5GOTA 2GBGA 2TS1A 1UP6A 3RV3A 2IYOA 4BFLA 2FA9A 2PXFA 1J22A 2PT7A 1PG5A 3HJBA 3F73A 1UDAA 3CLCA 4ZICA 1YQEA 2BGRA 3T1OA 3A1UA 1OSNA 1Y6JA 1ZGJA 4NEGA 2YY6A 1YHNA 3JXDL 1CR2A 3T0GA 2YOFA 4P0PB 1FP7A 2DULA 1F6WA 3LQ1A 3F9RA 3OMWA 3K5WA 4JENA 3EXHB 5HHTA 5JATA 4CMBA 1A95A 5J23A 4QAJA 2Y99A 1EVQA 4KMSA 3F90A 1WU7A 1KYWA 4EZEA 3V3TA 4D43A 1PYOA 3TN7A 2C7OA 3KC2A 1VFPA 1Y1SA 1Z47A 4P35A 1LCIA 1OFVA 3NBQA 2XBMA 3MJSA 1OTXA 2GTIA 2R11A 4DKJA 2I67A 1O97D 1ZMRA 3KV1A 5BWBA 1FA9A 4WX2B 3I39X 1KNQA 1QC5B 1FTGA 2NSLA 3CZCA 3GQBA 2XH8A 1XEWX 3ESZA 3FFBA 3LPNA 1L4EA 4ML3A 3CLSD 4Q9LA 3T9AA 4EJ6A 3KXKA 3H13A 1TU0A 5TGZA 3R7BA 1Q0UA 1QGUB 2WSMA 2Y92A 1P1IA 4CKCA 4WJKB 1K0UA 3WIDA 1KC3A 5F23A 1ZZ8A 4JYZA 3TM5A 3MG9A 3U3MA 2BMJA 2R7LA 2ZVJA 5EGNA 1P1RA 1QHNA 4BVEA 1USKA 4O2AB 4UNQA 1KZGB 1FMFA 3HXPA 4K7JA 4R54A 1WH8A 3G7UA 5KTMA 4R1TA 1BFUA 3D1JA 1PLLA 3WIUA 4D45A 3K2EA 2B4KA 2FQ1A 3ILVA 3JAWB 2BMFA 4IX9A 4KWCA 3ZNOA 5KREA 3TVDA 2BDEA 2W11A 1UXHA 5CEJA 3QWHA 1TA0A 5ECGC 4HSGA 2GPAA 2W2KB 3PUZA 3TRDA 4RS4A 5AM4A 4DYHA 3GG2A 4GXQA 3PYMA 5CUQA 4MEJA 1AK2A 1PZEA 3U3JA 2AHRA 4G4JA 1Q14A 1RYDA 4B7AA 1H1TA 2O2HA 3GLSA 3L8EA 4E5UA 3UWSA 1CHDA 3U9TA 2H85A 1CNMA 3KVOA 2HEIA 5I6DA 3VTZA 5A4AA 5ICEA 8ADHA 4JP3A 1QKJA 3ISTA 1AQNA 4HK4A 4QIHA 3GLTA 3RHSA 1R4ZA 4A8JA 5CAEA 3GGGA 2F55A 4RIHA 3LQFA 1QYWA 2JLZA 3VOSA 2LYSA 1FK8A 1U2GA 2AOTB 2DQSA 2QORA 2WWXA 2IYNA 1Z5NA 2VDKB 3FOAA 4V0RA 3WLRA 4UM9B 2N3ZA 2HA0A 3NKLA 3UV3A 5JS8A 2IEIA 3I1FA 3O95A <