5DTQA

Crystal structure of dot1l in complex with inhibitor cpd3 [(2,6-dichlorophenyl)(quinolin-6-yl)methanone]
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
328
structure length
320
Chain Sequence
LELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMENYVLIDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTNTRPSTGLLRHILQQVYNHSVTDPEKLNNYEPFSPEVYGETSFDLVAQMIDEIKMTDDDLFVDLGSGVGQVVLQVAAATNCKHHYGVEKADIPAKYAETMDREFRKWMKWYGKKHAEYTLERGDFLSEEWRERIANTSVIFVNNFAFGPEVDHQLKERFANMKEGGRIVSSKPFAPLNFRINSRNLSDIGTIMRVVELSPLKGSWTGKPVSYYLHTIDRTILENYFSSLKNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Histone-lysine N-methyltransferase, H3 lysine-79 specific
publication title Optimization of a Fragment-Based Screening Hit toward Potent DOT1L Inhibitors Interacting in an Induced Binding Pocket.
pubmed doi rcsb
source organism Homo sapiens
total genus 103
structure length 320
sequence length 328
chains with identical sequence B
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2015-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08123 DOT1 Histone methylation protein DOT1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.60 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) 434 Repressor (Amino-terminal Domain) 5dtqA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5dtqA02
2AOVA 2WA2A 5DX0A 2JH8A 3C0KA 3DXXA 4M7RA 5EIWA 3BWMA 3C3PA 3T7TA 3H2BA 4KWCA 3PFHA 1IM8A 2IDJA 3GRYA 3LECA 3CBGA 4ER0A 1RJGA 2GH1A 2P1DA 2XYVA 3DMHA 2A14A 3U81A 2HTEA 2JHAA 5BW5A 1JG3A 2R6ZA 5LQCA 3I5UA 3KQTA 3B89A 4IWNA 3BGDA 1YB2A 4RYLA 2HNKA 1WG8A 2XVAA 4OA8A 5D1NA 1X1DA 2XYRA 3KPUA 2I62A 4MTLA 2IFTA 3FTEA 3HA3A 3C6MA 3P9KA 3PS9A 5T67A 2IH2A 1RJEA 2CMHA 3M6UA 4M36A 1ORIA 5ICFA 3HA5A 3OCJA 5EMMA 3EVFA 3A7DA 3RODA 3SSOA 4GBED 3HNRA 4QTTB 1I9GA 4OBXA 3NDIA 4HRAA 1XTPA 4QPPA 5GINE 3DTNA 1WXWA 3BKWA 3FRHA 4POOA 2AN3A 2ZFUA 1BC5A 1ZKDA 3FPJA 3TOSA 4K6MA 4PWYA 3R9XB 1JSZA 5DM1A 4RV9A 1HMYA 4HGZA 1WY7A 3R0QA 5DTQA 1JG2A 5HIJA 4DCGA 5C9ZA 5M5BA 2N47A 4M37A 3SM3A 5U4XA 3R24A 5KQSA 1IXKA 4QDKA 4GOLD 3REOA 4PGHA 5JR3A 5K0CA 4LECA 3A4TA 1SUIA 1VE3A 2PXCA 5G02A 4PCAA 4C05A 4RSRA 2P7IA 2I6GA 2VP3A 2IBSA 3NW9A 3SR4A 4GC9A 5EZSA 4F84A 2ORED 2YR0A 3GRUA 1KIAA 3JWGA 1M0EA 2P3OA 4YUXA 4E2ZA 5HZMA 2FPOA 4Z2YA 2PSSA 5GWXA 2XBMA 2GLUA 3JWJA 4OX9Y 2ZTHA 4AZWA 3TLJA 4P7KA 2AOUB 1RI5A 4C06A 2P41A 3ELWA 2OBFA 2FK7A 4AUKA 1AQJA 2PX5A 3HCEA 4R6XA 1L3CA 5EHGA 4GC5A 4PYLA 2JHPA 3LBFA 3G89A 1QAOA 5K0NA 2FCAA 2ADMA 1ZGJA 5DRYA 2B9EA 5ERGB 4F85A 2PT9A 4R05A 2Z6QA 3NTVA 3HCBA 5CVEA 2JHCA 4EMSA 1NW6A 5CVVA 1FPQA 1QANA 4XUCA 2NXCA 5FQNA 3DP7A 3Q87B 4HH4A 4CXMA 4RVHA 3R3HA 3LDFA 3FRIA 2JJQA 5P8WA 2PY6A 5DXAA 1ZQ9A 3TFWA 4AZTA 5LQJA 5LQRA 5E1OA 2EFJA 4GEKA 4KW7A 3UA4A 4DKJA 2H1RA 2PWPA 1JQDA 3GRRA 1NE2A 2BH2A 4RTKA 2V74B 5EKXA 1D2HA 3ANXA 5DX8A 2I9KA 2YX1A 3HCCA 3HVIA 4U7PB 5CVUA 2O05A 1F3LA 3KR2A 4CWAA 3EVAA 4FGZA 2BR3A 2PXAA 3DOUA 3PB3A 2H11A 1F38A 3C6KA 3GDHA 1DCTA 3KQMA 3P9NA 3TM4A 3P9IA 1O9GA 5GOZA 4KIFA 1WS6A 4H0NA 3NJRA 2QRVA 5T6BA 3P2IA 3PX3A 5ICEA 2YUIA 1AF7A 4KDCA 5F2NA 2Z6UA 3NWEA 5D1HA 4E2WA 3TRKA 3FTDA 4GOND 4P7JA 4EQZA 3E05A 2P35A 5CCXA 3LHDA 2BR5A 2IIPA 1R6AA 1XDSA 2PWYA 3FUTA 2B2CA 3KU1A 2ZZNA 1UFKA 4CTJA 1O54A 4PYJA 1INLA 3O4FA 2PX2A 2ZVJA 3TMAA 3CJRA 1RI3A 5E9JA 5FWDA 2QYOA 3FUXA 3GNLA 1PJZA 2P3LA 3FTCA 3GU3A 5HIMA 3ER9A 1N2XA 2ZZKA 4MWZA 5DWQA 4YUWA 2ONYA 3KKZA 1G6Q1 2Q41A 1QAQA 4PYOA 2KW5A 2NXJA 3UBTA 3KPYA 2VDVE 4EK9A 4HGYA 3PTAA 2IP2A 1G60A 4M38A 3PLAE 2OY0A 4G56A 3ELUA 3NVKI 3HVJA 1XVAA 4X1OA 4XUEA 3EVGA 5F2KA 1VPTA 3T0IA 5DTRA 1VBFA 4C03A 5IKMA 1QZZA 2H00A 2AOXA 2CMGA 3SSNA 1SG9A 1JR4A 3M70A 4X60A 3L8DA 2UYCA 4DCMA 3A7EA 1BOOA 1Y8CA 5ICGA 1EAMA 4OA5A 1UWVA 1MHTA 3ER8A 2NP6A 5MHTA 5FQOA 1L1EA 2G8NA 5E2BA 1NT2A 5E9QA 3SMQA 2ZSUA 5EHIA 4CTKA 5GIPE 3DH0A 2PXXA 1FP2A 3GWZA 3G2OA 2QE6A 5CVDA 4C04A 3TKYA 3IHTA 3MB5A 2B3TA 4KIGA 3I53A 1Q0TA 1L3BA 1VL5A 2PGXA 3EGEA 1NW5A 2O07A 1YZ3A 2NYUA 4FP9A 5DPMA 5K0LA 1EG2A 4BY9E 3FYCA 2AOWA 3MQ2A 4HC4A 4XCXA 3A26A 4QTUB 1XXLA 5B1SA 3VC1A 5LSAA 2G71A 3DXYA 3X0DA 4RTSA 4RTNA 3OZSA 3OE4A 1R74A 3LCUA 3MCZA 4PINA 1FBNA 1DUSA 3ERCA 3UJBA 2Y1XA 1R18A 3OU2A 1SQFA 1VLMA 4WVLA 3FUVA 1NW8A 3T7RA 2Y1WA 3ELDA 4X41A 5LQUA 3LX6A 2F8LA 4PONA 1SKMA 5CD1A 5FA5A 2O0LA 2CKDA 3M33A 4ER7A 3T7SA 4AZSA 4E33A 3BWCA 5K0BA 2ZWAA 4X61A 3BWBA 3OPNA 2YQZA 5E1MA 5EPEA 1OR8A 2BZGA 2AN5A 1RI2A 3ME5A 2QM3A 3EVEA 3OE5A 4L7VA 1SVUA 4YMGA 5K09A 5CVJA 4OQDA 2IH5A 2AR0A 3KQSA 2P7HA 3GRVA 3K0BA 5HFJA 2PT6A 3PT9A 3AWIA 4P58A 2AOTA 2IGTA 5K05A 3I58A 1YFLA 4RTJA 2UYQA 3KPJA 5EOVA 3UA3A 4YV0A 3CVOA 3B3GA 5LQKA 4NECA 5EEHA 4RTMA 3HTXA 1R8YA 3GRZA 3CJQA 2ESRA 4MQ4A 3CGGA 3VC2A 1TW3A 2GA9A 4O29A 4DMGA 3FUWA 1UIRA 3ELYA 3V8VA 4QVKA 2BM9A 2VZ9A 2QY6A 3DUWA 3OU7A 3LSTA 4E30A 1KP9A 3DULA 3TKAA 1XJ5A 2LD4A 4E31A 2FHPA 4RVFA 2PVCA 3EMDA 2YXDA 3VYWA 1PRYA 3I64A 1G38A 1N7JA 3BZBA 4IKPA 3DMFA 3KR9A 1YFJA 5E2AA 1Z3CA 5GIOE 5DRTA 5EMKA 1NV8A 4QVGA 4UOEA 4PYQA 4A6DA 4GOMD 2ZBQA 3OZTA 5LQNA 3G5TA 5CCBA 3DLIA 3VSEA 2ZULA 1DL5A 3E8SA 3IYLW 4FZVA 3G2MA 4BP3A 1AV6A 1KPGA 1TW2A 4GOOD 4WXHA 3CJTA 3UFBA 4CKBA 2NXEA 1JG1A 2YXLA 4E32A 3MTEA 2P40A 3MHTA 3G7UA 3GGDA 1RI4A 1KYZA 5DSTA 4AZVA 2OO3A 3QOWA 3SX0A 4P7GA 5DLYA 1MJFA 5DT2A 2O57A 1SQGA 2VS1A 3BXOA 5IH3A 1JQ3A 3HVHA 3TM5A 5JUWA 1D2CA 4LWPA 3UJ6A 4OQEA 1KPHA 2I7CA 2PBFA 2ZIEA 2G72A 4FSDA 3ORHA 10MHA 3UJCA 4RVGA 1FJXA 4GF5A 3HCFA 3V97A 2G1PA 3HP7A 3EMBA 3FPHA 4E70A 4DM3A 2CWWA 1G8SA 2P3QA 2YVLA 3C3YA 2EX4A 4Y2HA 5E8RA 2VDWA 4HG2A 2PKWA 2NNWB 3THRA 4BLUA 4DA4A 1KHHA 2OKCA 1KYWA 3M6XA 4FR0A 3KR1A 3SXJA 2HWKA 4KVZA 3B3JA 2DULA 1JSXA 2E5WA 3BWYA 3M6VA 3P8ZA 2OXTA 2FRXA 2BM8A 2AN4A 2P8JA 2NXNA 3P2KA 5KS2A 1O9HA 2UYHA 4EKGA 1X19A 2K4MA 1NW3A 2IBTA 3CCFA 9MHTA 3A27A 4DQ0A 2OZVA 3G88A 3G8AA 5E1BA 2VDUE 1WXXA 3AJDA 3FPGA 1EQAA 3HA7A 3G5LA 2G70A 3CC8A 4R6WA 5EG5A 2OYRA 4AX8A 1JTEA 4QPNA 3TR6A 1JQEA 2ZLBA 3OZRA 2JG3A 1NKVA 3NMUF 1BKYA 1NBIA 4DZRA 5E1DA 3P97A 1KPIA 2IPXA 3DXZA 1EIZA 3E23A 2QRVB 3LKDA 1AQIA 3BGIA 5DTMA 2WA1A 1L9KA 2ZW9A 3DLCA 5K01A 5BP7A 5EIFA 3PVCA 3R6TA 1EJ6A 4C4AA 3FTFA 1NV9A 2WK1A 5HEKA 2ZBPA 4PNEA 3JWIA 1R00A 1NBHA 4YUVA 2CL5A 3PX2A 2XVMA 3GO4A 4RTOA 4RWZA 3G8BA 1KR5A 3FZGA 3LCVB 3FPEA 4HSGA 1X1AA 3FYDA 3HCDA 1L3IA 4C07A 5DM0A 5EEGA 2ZBRA 2AS0A 3B7PA 3G2PA 5K0FA 8MHTA 4BLWA 2AOUA 3MCTA 4HTFA 3KQVA 3WSTA 2IDKA 5BXYA 5HIIA 2YXEA 2FYTA 3LGAA 4YMHA 3GCZA 2HMYB 3GXOA 1XCLA 4IV8A 5FHQA 2AVNA 3KPVA 1XDZA 1QAMA 5DM4A 1R8XA 1HNNA 4ER6A 2B25A 2ZIGA 3KHKA 3LKZA 5FWAA 3UJ9A 3FUUA 2UYOA 3MTIA 3KR0A 3MGGA 2PLWA 1IY9A 1XDUA 2B78A 1G55A 3SSMA 3OU6A 3B5IA 4MIKA 2ERCA 3HCAA 4MHTA 5FHRA 1P39A 3BKXA 5DSXA 3OFJA 4PIMA 5EZQA 4FT4A 1X1CA 2JH9A 5GM2A 3BUSA 4F86A 1M6YA 4XUDA 4PYNA 2FK8A 2PX8A 3QV2A 1G8AA 1VP9A 5C1IA 4RX1A 5DXJA 3THSA 2EJTA 3PFGA 3EEYA 5KYGA 3KQQA 5EVJA 1T43A 1TPYA 3EVDA 2OB2A 2OPBA 5BW4A 2ZCJA 3RIEA 3KQOA 3KQPA 3GJYA 5LQAA 2HV9A 5FTWA 5CUQA 3KQWA 4ISCA 4CKCA 5K8VA 4PCLA 1VP3A 3MERA 5HOQA 1P1BA 4QQKA 2GS9A 5FA8A 3HEMA 5K0EA 4RTRA 4BP1A 1I4WA 3AXSA 4FSXA 5GP1A 4R8RA 4PGGA 3KQYA 4QDJA 2DPMA 5EKUA 1NW7A 3MAGA 5GM1A 1ZGAA 3M6WA 3GIWA 5H02A 3ID6C 4B17A 2PJDA 4QQNA 1V39A 4YUYA 3BGVA 1WZNA 1I1NA 4LWOA 1YZHA 3EVCA 4HTFB 3EEOA 3SGLA 3UJDA 3P71T 4E2YA 2C7PA 3G2QA 3DMGA 3EPPA 3KPWA 2NP7A 4EKIA 1RJFA 5HILA 5CIYA 4E2XA 1P91A 3NWBA 1B42A 1VQ1A 1YUBA 2GPYA 3B3FA 3P9CA 4PIPA 5FUBA 5FULA 1H1DA 1M6EX 1YF3A 4RTLA 2AZTA 4YUZA 3OFKA 5FADA 3E7PA 4PYMA 1RJDA 2Z6AA 7MHTA 1ORHA 4FS8A 4LG1A 4P7FA 4PYIA 4KRGA 1XCJA 2C7OA 2IH4A 3LL7A 3AY0A 2ONZA 4V0QA 3LPMA 5DM2A 5T64A 3RW9A 3EGIA 4RVDA 3TQSA 5E8JA 5E9WA 5CM2Z 4ATNA 2ZWVA 3FPFA 3HM2A 5LR6A 5EQJB 3EVZA 3O7WA 2AOTB 3IV6A 5EC8A 4JXJA 4KDRA 2XYQA 3NDJA 5C0OE 1JTFA 3S68A 4YV1A 3AXTA 3F4KA 3UJAA 1BHJA 3O31A 4BLVA 1RI1A 1U2ZA 3LCCA 1ZHFA 3UJ8A 4RTQA 3BT7A 2V7EA 5HIKA 1D2GA 5KQRA 4A6EA 4IV0A 2EJUA 2GAFA 3D2LA 3LBYA 4EVIA 2YTZA 5KVAA 2AVDA 3LDUA 4ER5A 1N7IA 3CKKA 4X63A 1QYRA 4ZTBA 3K6RA 3EGVA 2ZIFA 4C08A 4CKEA 2ZZMA 1ZG3A 3UWPA 2PV0A 4Y30A 5K0JA 1X1BA 3M4XA 1KXZA 2R3SA 3UZUA 2UZ4A 4GQBA 4RTPA 2HR1A 3A25A 3SVZA 3DR5A 4OBWA 5K03A 3LDGA 3Q7EA 2O06A 3QOXA 4ER3A 5DX1A 5F2OA 3EVBA 3JWHA 2EG5A 2OB1A 2GB4A 1EJ0A 5FCDA 3UJ7A 1FP1D 2PX4A 3NVMB 3P2EA 4DF3A 4U7TB 5EGSA 3I9FA 2BR4A 4FT2A 4GUAA 4V0RA 3IEIA 3TPZA 5ICCA 2C7QA 1Q0SA 4R8SA 5EMLA 5EMJA 4YV2A 3HVKA 1VIDA 4PYKA 5K0GA 2C7RA 1JG4A 1P1CA 1SUSA
chains in the Genus database with same CATH superfamily
1XWRA 3CNQS 1CUVA 2YIMA 1NVWQ 1YL6A 2DGDA 4Q6BA 4YCDA 5DX0A 1TMYA 4LRYA 4EB6B 4M7RA 4HUTA 2GRUA 3FR8A 4JLMA 3R5SA 4WZZA 3QPAA 2GH1A 2P1DA 1WP9A 2WFAA 1VRCA 4DOMA 2PXTA 4LF7B 1BGXT 1Z56C 2Y0BA 4FZ5A 4Q7KA 1OA1A 2QNRA 2O8FA 3KP1A 4J3FA 4JNCA 4UMDA 3U60B 1G5QA 2W58A 2XVAA 3RYFB 4FB4A 2X1HA 4Y6OA 3OCWA 5TDHA 2PHZA 5THXA 3I1FA 4FFOA 3B2QA 4N01A 2Q6LA 4FXOA 2NU6B 1JIVA 3CLTC 2P65A 1YKSA 5B55A 4U7DA 1W36B 4XDHA 3CPJB 4OK6A 3O4RA 3PWSA 1DWKA 3NEJA 3F7TA 3IQFA 5JDCC 1AUXA 4GH5A 1YCHA 5I4IA 2Y1CA 1UKCA 4FMCB 2YDYA 1KZ9A 2C4KA 3IOEA 3ILSA 2J0UA 4QPPA 4DV5B 3O94A 3TTYA 3S0JA 2ZFUA 2X9NA 2C5HA 4E0BA 1C9EA 1OWMA 3H4IA 2VH5R 3BC1A 4YDRA 1PJ4A 4IQ8A 3IOMA 2GCEA 1QO0D 2C42A 3RYHA 1DJQA 5J5VA 1N7GA 3ZLJA 3W6UA 4D02A 3SKXA 4BO4A 4DJEC 4MR8A 3N7UA 3WYNA 1VKHA 1ZSVA 5KQSA 1L4YA 1VA5A 3C4VA 2IVFA 3PRYA 4B4UA 1OLSB 4XWYA 1JKJB 3OG9A 1QIKA 2W70A 4GNKA 1FTNA 1AKUA 1V1JA 4HB4A 3ZZ0A 4D8YA 7REQA 3E9EA 4CN8A 2WW8A 3V7WA 4P4NA 4NPAA 1NHGA 3GK3A 4YAEA 1M0EA 1UDAA 3ZUGA 3J80A 3VXKA 5HZMA 4Z99A 4LVUA 2ZYDA 2ZI4A 2V59A 2PUBA 4P3XA 2H7XA 5K2MA 1PS9A 4HLCA 3H5NA 3PITA 4KLRA 4PPNA 5EJMA 2AWNA 1X57A 1S3GA 1E1NA 3KWFA 3AF4A 2A1IA 3G6WA 1KK0A 3P0IA 4EY3A 2BGWA 5KC8A 3I6QA 3DOHA 2ODAA 2PMFA 1L3CA 1J2JA 1EHCA 2BD0A 2FUNB 3ZCVA 3NYRA 1SQ6A 2JHPA 1PV1A 4TYQA 4WUVA 2J4DA 3I2IA 2VSNA 1OXSC 2PUTA 2XTNA 5CMLA 5DRYA 1IMOA 1MOPA 1M66A 1TTQB 1UEJA 1UK9A 3HCBA 3SC6A 1EP3B 2CXSA 4F46A 1A9QA 1OAOC 1DADA 1JZQA 3GFFA 3NROA 3UK7A 1MG0A 3LDFA 1V2HE 1HDEA 1WD5A 2A84A 2I5PO 3IELA 4CT0A 3USES 3UA4A 1WABA 2UAGA 1N3IA 3CQ9A 2VT6A 3H0CA 3HH8A 3V7YA 3ZBPA 2X1MA 1BMFD 3V1YA 3N8IA 3CR3C 1P31A 1P0CA 2V9PA 2XDYA 4JBXA 2WIKA 2FW8A 3E4CA 1S8OA 2UZAA 4M86A 4PM4A 1TQHA 3HVIA 3AU8A 3IURA 5T3YA 5ES4B 1CQXA 1DUIA 1DEHA 1G3UA 3DMDA 3FDJA 2ENUA 5LZ5A 3UH1A 3H6HA 2ZBFA 5KYUB 3THYB 4XD7A 1J0DA 3T5DA 4U7WA 1RYYA 3KZNA 1TECE 4C30A 2C4MA 3FYUB 3T7DA 5DLQC 5JZSA 2RK4A 2WD7A 2CJXA 3WYDA 2JFOA 3WZ2A 1NXSA 4MKRA 4BNDB 4C7BA 3VNRA 3T06B 2YUIA 2P9EA 2ZE6A 2QV0A 4TKMA 2Q7OE 1XNRB 4CV0A 1P0IA 2HMVA 4LJ7A 4JV5B 7GPBA 4BBJA 1P81A 1E69A 1RXUA 3QU9A 3PHGA 1N25A 4QOGA 4FWTA 3T3OA 2ALJA 1UXJA 4ZT3A 4ZOLF 1AGYA 1B2RA 2NZ2A 2NMVA 4CDRA 1DBPA 4YFVA 4X54A 4YH1A 2QYOA 3KOMA 2DLCX 3W4KA 1IG3A 3CO0S 2P4HX 3G3EA 1U7PA 2GQ0A 3QFCA 3S2EA 2ZZKA 1N2CA 2DPXA 3WFJA 4EOGA 4YUWA 4PHHA 4YCLA 1PL6A 4UHFA 4HOYA 3F6WA 3T9EA 2JNWA 2GK7A 3TSAA 1WB9A 3DZ8A 1OFVA 2BFDB 2JHGA 4HAOA 1J21A 2RKWA 5IDWA 2VDVE 2E87A 1Y48E 2VNIA 4EGJA 8AT1A 5IJ9B 4ZICA 2V7QD 3SS7X 1H2EA 2IYPA 4ZN6A 4EYGA 5IHPA 2C07A 4YB8A 4XUEA 2JFVA 3CR8A 2IUUA 2C9DA 2ZIVB 1NVKA 1ZUWA 1M34B 2I3BA 2ZPTX 1GUAA 2H3HA 2NUAB 3CNNA 3RTDA 2GM4A 2EG9A 4RY9A 3TINA 1JR4A 5BQ3A 1GTJ1 2UYCA 4N48A 2JAQA 1HTBA 1LVGA 2ODNA 2OORA 2VT7A 3L1KA 5CB4A 4I4TA 1PKEA 2GAJA 1L7OA 4FYIA 4ZCIA 1DRUA 2XPCA 2QIPA 3HYLA 2VXOA 3G0IA 3LDAA 2QRQA 1XL0A 3EZYA 3GJRA 2FB9A 3WLKX 3CINA 2V3WA 4H4EA 4EO7A 1NQUA 2GK4A 4I6RA 3LQ4A 4ZOQI 3QE4A 3KELA 1OI2A 5ALYA 2XI8A 2ZJ6A 4FUQA 1VHLA 2SNIE 4RJ2A 1T5IA 4IIFA 3GP3A 3OPMA 1MA3A 4RW0A 2W2MA 1GOTA 1PWZA 4G4SO 3AR9A 4EHAA 1A2QA 2G67A 3O8QB 4XIIA 2PUGA 4NRDA 5D3QA 1JQBA 4MS3A 4PINA 2QT0A 1VE5A 4IUBS 4M8NE 1PQYA 3DBLA 1P7WA 5FJJA 5LFAA 3TLKA 3D7NA 1SRQA 1NW8A 1J0BA 2BFEB 5J58A 1QHIA 3GPCA 3LQXA 4PRKA 1JQJC 4OOEA 1MORA 1QCZA 3NIWA 3RVMA 1V43A 2OXFA 4S0XA 1XA3A 3NP7A 2DC1A 2QD2A 1RP1A 5DDIP 3IX7A 4JC5A 5K0BA 3H83A 4PFKA 3WGZA 1LK0A 3CKYA 2JI7A 1MNQA 2P77A 3GV0A 4KEAA 2F1JA 4ZC8A 1F7VA 4DABA 4Q3KA 1N78A 2CDAA 2CYAA 2O1EA 2VNHA 5ITWA 3FWNA 1VHQA 2J9XB 2FW1A 1HEUA 3DBRB 3OE5A 5EJGA 4DIBA 3CT6A 1ZNQO 4DQVA 5H0IA 3KFXA 4J0DA 2NU8A 5MGNA 3UIEA 3VAAA 3NGMA 9LDBA 2GFQA 2ZVDA 1G18A 2QN6A 3VNVA 2VJMB 3DM9B 1WMDA 3N2LA 3VR1A 4OHZA 3ZWVA 4M60A 2Q0HA 5HZKA 3COPA 1FSFA 1QE5A 1I0ZA 1R6XA 2YCLA 3NNNA 4QDOA 3O4HA 2JFZA 3OWQA 1OTYA 1YFLA 5TXGA 3NO4A 4FFWA 4RIEA 2YS6A 1F4VA 1ONOA 2VPXA 4G9GA 4O29A 4J6EA 4U8GA 3ELYA 1USIA 4I8XA 3OM0A 2C8KA 3DUWA 1LPPA 2OSBA 2N75A 3AI2A 3HMQA 2ZYVX 1H2WA 4XR4A 2ZM6B 1SAYA 1XYGA 4NFHA 2BN4A 3ICQB 4HGRA 1T0IA 4LV8B 1PRYA 4XYEA 3TTWA 1HFWA 1YBAA 3K3PA 4BCDA 3CLSC 2FWIA 2QRPA 4WLUA 3G17A 4OHXA 3DAPA 3KD3A 2ZRBA 2Q1UA 2Q6TA 4BKRA 4JI0B 3L7MA 1BEZA 4BWGA 2P0EA 4DMMA 3V8RA 2O14A 1NRXA 3ZGYA 1VKNA 3ONWA 5FAXA 1QPZA 4GOMD 3HR4A 3OZTA 4R2KA 3LY8A 4E5NA 3QYPA 4BFTA 2J0QA 1XLVA 3DD1A 2GZDA 3CH6A 4JLWA 3ND5A 1YT5A 4JGGA 5KQLA 4E32A 3MTEA 4IXNA 4MLPA 3MHTA 2R4UA 1RM0A 3UK6A 4P7GA 5ENZA 6PFKA 2IU7A 1O6BA 2XEDA 3OCZA 1NUAA 4C6HA 2GFIA 1RQNA 5CCEA 1GTSA 2RC5A 3K09C 3F0TA 4HNQA 1STOA 4B40A 4BVKA 3ORHA 2Q5EA 4B7UA 1ZNXA 3KT8A 4CJXA 7MDHA 2V5AA 1V8OA 2FEAA 1K2VN 3GPDG 3JATB 4Q4AA 4X85A 3FPHA 3GI1A 4NCXA 1BXKA 2F55A 1E7SA 2YVLA 1VPWA 1PQ4A 1KZ4A 4HLUC 4F3RA 4Y2SA 5ECWA 3RS9A 1AU7A 4HJRA 4F71A 1GT91 5E7IA 1A96A 1C1DA 2VUUA 5DIZA 1X1EA 3U3JA 4RULA 4P92A 4AFNA 2WB2A 1NMXA 2XX3A 5L3VA 3CX4A 3K71B 4QYIA 1YB4A 3P9SA 5DGCA 2J67A 5DYTA 4RMHA 1LQ2A 4NFLA 3RIYA 4KR7A 3H1PA 4QBKA 3HKDB 2Q9AA 2X8AA 4G3XA 1V1RA 1N0IA 3ET5A 2AN1A 3MTQA 5EG5A 3H5IA 1NYQA 3IT1A 1I5OA 3D8TA 1L5SA 3AMVA 3HXQA 4HDNB 4OI4A 3SYMA 1FNSA 2AEEA 2VDOB 3AH8A 2JARA 3L1HA 3NHMA 3QYJA 4LE0A 4M6WA 4J1WA 4MKGA 5JNUA 1KPIA 5TMBA 2NU7B 3AEUB 3TS1A 3GD7A 3NHUA 2A0XA 1AF4A 3PEVA 4WOJA 5HTOA 3O0DA 5DW3A 5JJLA 1TVKA 3H3XA 1XPOA 1PZXA 4EEXA 3C7KA 5BP7A 3KQNA 1YQWA 2ZJ2A 3HDHA 2C04A 3NASA 3R6GA 4C22A 3KXLA 3GZCA 2H8RA 1J20A 1OLUA 2COUA 2IQIA 2P6MA 2QMYA 3I37X 3JQFA 5GONF 4MA5A 4KFRA 1SHTX 3JPWA 3AEKA 1CRPA 2VDWB 2VDPB 3G8BA 1IK4A 4HAUA 3VC3A 2YHBA 1SN7A 3K70B 4FEYA 4UM7A 1P1KA 1XTJA 2IHZA 2ZBRA 1N9KA 2AS0A 4LY6A 2IV3A 2BHRA 2Q99A 4A8TA 2WOOA 4K6GA 1QWOA 4R4JA 1MQAA 2G5PA 2OHHA 4FFSA 4K9PA 5HIIA 2OFPA 4JIGA 5TS3A 5HRAA 3ASVA 2ZYHA 1D5CA 4NJEB 3I61A 5IYZF 3NLLA 1JBEA 3M9WA 3UCXA 1NW4A 3KDSE 1RCTE 4RWEA 2Y2VA 1N34B 5HKKA 3ISVA 3O91A 4O0MA 4ZYLA 1PR9A 3KR0A 4EZIA 2HCFA 3FSJX 2C9YA 4OF4A 4I9GA 2BV3A 1P9RA 4WCFC 1GN8A 5IX8A 3IHLA 4HNAA 3HI4A 4L95C 2FMIA 3AUAA 3U44B 1AXGA 1KJYA 2J6HA 2QX6A 4OP1A 3X1YA 5AVKA 3A31A 3QV2A 2WJWA 2PJUA 1QBGA 4YI3A 4Y1RA 5C1IA 5DXJA 4D82A 5EL0A 3ZJVA 4UM9B 2H2IA 4FFLA 4AJ4A 4MP3A 3PC2A 1BD4A 5B3AA 5HBGA 4C01A 3PTZA 1QIGA 3NJ4A 3NOQA 4M55A 2FV8A 5GGYA 3RRBA 4DC9A 2KE5A 5DXFA 3QVKA 4KAJA 1X8KA 2AXUA 3R1IA 2GPNA 2FPGB 1XZHA 5DHTA 4PR0A 4QTZA 1ADYA 1SMKA 3L0DA 4V38A 4W7IA 4JEMA 5AOAA 4BP1A 2EARA 4UASA 1MT0A 2HCRA 2H1LA 3KQYA 4K9OA 4QDJA 2HRBA 3MAGA 5SZHB 4EVSA 1T8TA 3I62A 1JECA 2BBSA 5H02A 3ID6C 1QRAA 1V0JA 4H3SA 5TPZA 4ZQIA 5A02A 1LI5A 4BLTA 6LDHA 3FYUC 1AVTA 3Q3EA 4DXAA 4X91A 4D9FA 4CPDA 2VP9A 3QU2A 4FJ0A 3RVNA 4XWOA 1PERL 8OHMA 2NZXA 1HYBA 1DBSA 1JNYA 2OZEA 4G84A 5AI8A 5AJTA 4D0RA 5BW8A 1SBYA 1VQ1A 1QIFA 2VSOA 3ZIAA 5FUBA 4CM4A 2UU9B 1BXRA 4OXRA 3AERB 2HQBA 3U4MA 3A9UA 1W35A 2CD7A 3E9YA 1GUDA 1WPQA 2HGSA 1PFKA 2QN7A 4NAHA 3RHTA 3DWFA 1DX9A 2FRVA 3WK6A 4HQ6A 4IVQA 5FB3A 1X39A 4BQIA 4NU6A 3V4LA 3CZPA 1YGYA 3DTTA 3CEMA 3KZCA 1CTQA 5LZ7A 1JW9B 3RZZA 1TCBA 5ALUA 2WWTA 6ABPA 1AX9A 3RROA 4F1KA 2VHTA 3VHXA 4UNSA 4Y9UA 4MHOA 2Z4TA 3G7NA 1UC9A 1P4RA 1U2GA 2OCIA 1WB4A 5JMPA 3UN1A 5KYWB 5LMNB 2G9QA 2WYVA 4ZGWA 2DBRA 1C0LA 3R6WA 3BT7A 4LIPD 3SQWA 2V7EA 3D0QA 3NEPX 4E14A 2A58A 2OV2A 5FP0A 1D1QA 1JHYA 2CEAA 2ZYGA 4YAIA 2EHJA 2X86A 1Y8AA 3HU5A 4HGQA 4KREA 4BATA 4UE2A 1IVSA 1YE5A 3DCNA 3Q2IA 4BVBA 4WY8A 1DGQA 1PJQA 4EG7A 3A1VA 4TVSA 4A2CA 5ER6A 1J0AA 5HFAA 3OECA 1WWKA 2XZPA 1L5NA 4BLQA 3NC0C 5DBGA 3ANMA 3T9BA 4F2GA 4DSOA 1MO6A 2ZBDA 1NIJA 3WNBA 1T0BA 1E1KA 2E18A 1F5SA 4R40A 5THKA 1U8EA 4BGIA 4MPTA 1M2VB 1XEXB 3A4MA 1CZKA 4WACA 5J4LA 2F59A 4L76A 5CG1A 1RVDA 1P1HA 3ENNA 4LW8A 1U9IC 4J16A 3RFXA 1WH6A 3P96A 4IUDS 3FHTA 5CJPA 3EISA 1Q0SA 2HJVA 4UOQA 1VZ2A 3HB9A 2WF7A 5JMWA 1N2GA 5GPBA 3CZCA 1MIOA 1UOEA 3TECE 2O4AA 5HCNA 1N1GA 2HA7A 3KWLA 4FEAA 3C98A 1VMIA 2OT3B 4WN9A 4NYMR 4F2DA 1G3IA 1D6SA 4FDAA 1MRZA 4H7DA 1JWBB 1PN3A 1VGVA 3GUZA 2YZGA 5KPDA 4KLZA 4R9SA 4YBRA 2BGMA 3I5UA 3MD0A 4LMPA 1RQ2A 4G65A 1QS0A 3BGDA 2IZ7A 5C8YB 5BR8B 1XP8A 2VQ3A 2D2EA 1X1DA 4K2AA 1KSFX 2WKWA 4P3YA 4PAOA 5H68A 3EZXA 5KZMB 1I3KA 2QRUA 3DL2A 5CYOA 5JBQA 4XM0A 3B7HA 3GXBA 3I6BA 3PS9A 1B0UA 4FHFA 4FYHA 1P9OA 3V9PA 1R0SA 4N39A 1NSYA 3EARA 4XYGA 5J4HA 2Y1DA 1V3QE 1ADJA 4HPXB 1XZFA 1AQYA 3KS9A 4L2IA 3HJUA 2J3HA 1H1TA 4F04A 2RBEA 2AKEA 3LPNA 4ND4A 4AJ2A 1SELA 2AN3A 1BG6A 1SA0A 1WPGA 2ZS8A 3BMXA 4HNHA 1YAJA 3TOSA 5B57C 3L1PA 3SIRA 1E2JA 1JSZA 1J9EA 1LSOA 1UBEA 1W30A 3COYA 1F7UA 3JU3A 2PXUA 2YFYA 1RQ7A 1Q20A 2DLNA 4IGAA 3EXEB 3GJ4A 3JSXA 5U4XA 4YMTA 2HCBA 4CQLA 3PRJA 4AKSA 3N75A 1VYTA 3ZCSA 1SQ0A 1RT9A 2ECQA 3CMMA 2POQX 4XKJA 2YMQA 5JI2E 3SR4A 2YXNA 4CNBA 3NZEA 4KUHA 2PUVA 4ND1A 5DF1A 3HL4A 3AUTA 1YRYE 3GGPA 1MABA 3EH1A 4WLFA 5GWXA 4MVJM 3VRHA 1GLGA 2ECPA 3CUKA 3EOAI 3PIDA 3LAWA 4UU7A 4BO7A 5KO2A 1U28C 5CCDA 2J0VA 4AL4A 4YYZA 1DP4A 2F3RA 2G7MC 1XLTA 4A2WA 2EFGA 4LJ6A 4D9JA 3WK9A 4F7DA 2NSLA 2D0PB 3EXIB 4R01A 1AQJA 4GX5A 1NFRA 4LHVA 5FLEX 4PYLA 3LBFA 4KVFA 3OOEA 5DEIA 4CV3A 3D1NI 2MSEB 2B9EA 1D6JA 1U6KA 4R05A 2D1TA 3WJ2A 1BEUB 4EJMA 1SKYB 3KAJA 4YJHA 2QVZX 2R8ZA 1CT9A 2XUOA 4MUHA 2BGRA 4K5QA 1I1HA 4BB0A 1TE2A 4UAVA 4CEJA 3STVA 1KYYA 1NURA 3QLUA 1Y3AA 1OW3B 3DMYA 2Y1OA 3TFWA 4I1PA 4F1JA 3QVXA 2YJ6A 3BGWA 1DAIA 3KYDA 4PLPA 3WBBA 4XTCS 4CMIA 2X2EA 2RB5A 1DTEA 3HXPA 4U5QA 1QJCA 2OVFA 3RS5A 1QZUA 1K4MA 2ISCA 3OUZA 4S12A 4DDVA 2RBGA 2QXTA 2XVXA 4IJQA 1QFSA 2Y68A 1ILWA 1DBQA 1RKUA 2R6CA 2C8LA 3F4BA 4CWAA 1EGVB 2FRDC 3SYTA 1SOWA 4KPGA 3PE6A 4NZPA 3AGPA 5C3MA 2P1RA 3H8VA 2LCVA 1SC1A 4F4DA 1CG6A 2GOYA 1WS6A 2DETA 2VDKB 2RMKA 3LQRA 2FQXA 4MUXA 5AKLA 3AKEA 2D2FA 4YAJA 3UWMA 4B3IA 1IBRA 3F5QA 3NBZC 2O1SA 4I55A 4KDCA 5D1HA 3WB1A 4HVLA 4E2WA 3O84A 5FUVA 3FPKA 4NU0A 3TI9A 1GCOA 4OP2A 4HNGA 3LHDA 1I14A 1BWRA 5KWJA 1G98A 1FLNA 1LS1A 1R6AA 1WTCA 2FPIB 3AO0B 3H1EA 3IEKA 4CG0A 5IZCC 1UFKA 2ZSBA 4PYJA 1CUWA 3AEYA 2XE8A 4EMTA 3TMAA 1TYBE 1CBUA 3NEAA 1FMTA 3E3MA 4HDAA 5CX1A 4EJ0A 2O54A 5HS4A 2P3LA 5HG0A 1PR5A 1FQKA 4Z6KA 1U1FA 3ER9A 3QMWA 1SC9A 4PFQA 1G6Q1 1T3ZA 2Z58A 4JAVC 4UVGA 1KOJA 3Q8XB 5BW6B 1KDOA 1XD2B 1DG1G 4QNNA 4EL5A 1RM3A 3FAZA 1LC0A 1YQTA 3PTAA 3V4VB 4MLZA 4PHTA 3ETEA 4TGLA 5DBFA 3TEJA 3FTQA 1J70A 4RK7A 1XN4A 1EFVA 4HDSA 4QEKA 4BEWA 3AKYA 4N41A 1LBIA 4EBFA 2OGSA 3TLXA 3UPDA 4JYZA 3A6DA 3DR3A 3Q0EA 3Q9NA 1T36A 1E32A 4CDMA 5KOIA 4IIYA 1YJCA 1WIWA 1Z8FA 3HHPA 3WIVA 3C70A 1SBIA 4M9UA 4FD2A 4QNRA 4UCWA 4Y67A 2Q62A 3DKIA 2WSBA 2AE1A 2IGBA 5E9QA 1T6YA 4HDKA 2FWJA 3GWZA 2O8NA 4U9IS 3S70A 1CF2O 1BYIA 1VCOA 3OQHA 1EP1B 3I2KA 4YRNA 1PVVA 4UNIA 3DPUA 2WQ7A 1ZFNA 4CIBA 5LIRA 1G8HA 5ITZA 3L4KA 2ZAMA 4R8LA 1V8ZA 3G9QA 3H1AA 4QGHA 1Z38A 1G5HA 2J6CA 2PSJA 1JFLA 3H19A 3TO5A 1NR5A 2LCIA 4N8DA 4EG0A 1GFSA 3JXEA 2HCNA 2G71A 3IP3A 3ZNOA 3T3MB 1DXHA 2BT4A 3AM4A 2Z09A 4IX1A 1VC2A 1ZQ1A 4QE3A 3BGSA 3DMNA 4LK3A 1OB2A 1MGOA 4PBSA 4JJ8A 4UUMA 4M1MA 1ZXXA 2J3LA 4C7XA 1LCCA 1Y6JA 3W7VA 1U7ZA 3KALA 3P5BA 5GGXA 3EOZA 4NDAA 3WL5A 2O0LA 5ES3A 5KYXA 1QHSA 1LKZA 2XWPA 5BSFA 5KVQA 1PX0A 2ZRJA 2PSHA 3DHVA 3LNCA 2I4TA 1Z4IA 4IG4A 5DYYA 3OPNA 4ZMBA 4PE5B 2HWXA 2F43B 3A9TA 2XB9A 3IDAA 2GNOA 3DHYA 2HSEA 3LCJA 1RI2A 2W6PA 3KT3A 3I5MA 4H59A 1J2EA 4I6JA 4M76B 1WXFA 3FLMA 3RVSA 5HJ5A 5K09A 1S8FA 2QL5A 1GDDA 5F5XA 5DTEA 3PXCX 3HJTA 3U09A 2CZQA 3SIPA 5I7EA 3MT0A 3MRSA 3HDJA 5HFJA 1NJSA 2PT6A 3OTGA 4B2PA 3AR6A 4N5MA 3KT6A 1ZZ8A 5FL7A 1CR6A 1PLLA 1RWWA 5T4EA 5LQKA 1CDDA 3EAGA 1M34E 4BHTA 1R8YA 3DFKA 4JOQA 1X9HA 2JRLA 1NI4B 2RDMA 2XUQA 2BHLA 3VYUB 3ZKWA 3JAKA 3OIDA 1PLJA 3I9V1 4HH3C 2WE7A 2IPLA 2V6IA 2LR0A 3TUIC 3FOZA 4MCXA 1F9EA 2D1RA 2FY8A 3LHSA 2HUNA 4OHPA 3ZCXA 2FPSA 4PC7A 1G38A 1Z4MA 4IY1A 4P84A 4S35A 2QRNA 2IVZA 2DBZA 5EFOA 2NQ8A 4B76A 2C3UA 2WUGA 1KVQA 2I4IA 4Q15A 1JA0A 2Q2WA 3GARA 3MMXA 1C1XB 2EWTA 1YA8A 5FWYB 3LOQA 3BB4A 5ELXA 1FZQA 3ZWYA 1KJQA 4GFDA 1WW3A 2NXEA 3I9OA 1IZ8A 1E2QA 4LYHA 5KUTA 4J3NA 1ZPDA 2P40A 3LBNA 4GGPA 4PC2A 3ZW7A 4NEHB 4X7PA 3D6JA 2GI4A 2EBUA 5DSTA 4CIAA 1D4FA 4XOIA 2NO7A 1U90A 2A9JA 1WZCA 3WGIA 2HSDA 4LWPA 3GJ8A 4MS1A 3IDSA 2H5IA 1LRKA 3G9XA 5A5EA 3EQ7A 1QB2A 2D8MA 2HMTA 2VAVA 4EHFA 4EB6A 3OQPA 4OYHA 3A3KA 4WKBA 2J3MA 3A11A 3AOGA 1R88A 3F6SA 3K1TA 2P4EA 1NMYA 4QFCA 5AK5A 5DWVA 5TY0A 1KJWA 3DEJA 4W9NC 2I6SA 1DELA 4XB1A 5EIBC 2PM8A 1QG4A 2BF4A 3SWWA 3BWYA 2CLFB 5KWVA 2Q21A 1ZUHA 2R87A 5CW2A 2X0DA 1O9HA 1EUYA 1X19A 2VK4A 3MWKA 1BS9A 2MU1A 4UU0A 2WHXA 5KTMA 1RC1A 1DS6A 4GGOA 2WHPA 3CZ5A 2O2YA 1DKQA 1TKBA 2XTAA 1ABEA 3RI3A 4OHYA 1VDZA 2R79A 3M9XA 1UADA 2HLHA 4I8IA 5EJFA 5I45A 4V1CI 2JCYA 4Q21A 3WDLA 2HZBA 4EHJA 2C2KA 4BJHB 5IAGA 2ZR9A 4EYQA 1ATZA 2B5WA 4NONA 1EFPB 2D4AA 1B3RA 1HFEL 4Q9NA 4J7XA 5ALOA 16PKA 3RG2A 4PU0A 2WILA 2QE7D 1KL7A 2RHRA 4MW6A 1TVCA 3IUQA 2ZW9A 5I7SA 5SZIA 1Q7CA 2FPMA 1OLSA 3SOPA 1Y89A 3W78A 1JKJA 2A30A 4U2CA 3R6TA 5JCOC 2VF2A 2E4XA 3OZ7A 1NV9A 5ILQA 2V4ZA 1BQ4A 1IJKA 2ZBPA 3UMRA 1XKLA 4L75A 3V34A 5GQSA 5K3AA 2ORYA 4DA9A 2FF5A 3DKRA 1ZMXA 4ENWA 4CGYA 1Q1GA 1DOHA 1E3WB 4DNOA 5JEDA 3B7PA 2Q3EA 5CB4F 2GM5A 4X84A 4HBGA 3ZVLA 4MUMA 1LSUA 4N3GA 4W9RA 1WOYA 4LVNA 4NVRA 3TL2A 3EUEA 3TZKA 1E5VA 1TADA 2VUHB 4B6OA 5I4CA 5JY6A 2XXAB 3IXMA 2VHZA 2XZDA 1ZAYA 1TQ2A 2PMCA 5ILOA 2WTAA 2W48A 1SK8A 2EP7A 3H5OA 2OBLA 1AZWA 3A6LA 2VBIA 3NV7A 3SSMA 3L7NA 4A1FA 2PCJA 3DWIA 2K7ZA 2XDAA 3G1TA 3GROA 3GVPA 1Y4AE 1DAKA 1ORWA 2XJ9A 2FWNA 4L51A 1NZJA 5BUCA 2FZKA 4DG9A 3HG7A 1DCMA 1UK6A 1V35A 4MH0R 4Z8XA 1ENOA 3HN2A 1EUCB 1PT5A 1O7JA 1Q7EA 3ZQKA 4YG1A 4G4GA 4N03A 2PGOA 4P2GA 4RENA 5DI9A 1R9GA 1GM5A 3T3DA 1Q44A 3O92A 2GKOA 3H18A 2XB4A 2FKNA 3GFQA 4KMOA 5CPBA 3TB6A 3W5UA 3KUDA 4F97A 5K0EA 5BRNA 2SBTA 4F2HA 2ODEA 3C6QA 4FSXA 3OBBA 5DGHA 5DSZA 5KYUA 4C7VA 6REQB 3THYA 3FNRA 1UC4B 3C3WA 4HS9A 4O2AB 4QFMA 1GFWA 3IMKA 4XGNA 3ZE7A 4QQNA 4W5OA 2AJTA 4TVBA 1WZNA 4BNDA 3JQCA 3WMXA 3WMFA 1ZBDA 1E9FA 1GU1A 1FFEA 4DVJA 4AKGA 1LX7A 3KPWA 5A7GA 4BNXA 4LCBA 4PAQA 1GHTA 2RHJA 2Z0MA 5KB3A 3ESAA 2QUIA 4BNUA 2H0AA 1NVEA 3I0ZA 2WFLB 4IFEA 3EJWA 1BVHA 1A50B 2GWHA 3MXTA 2ZRCA 2E49A 4FYYA 4AY4A 4EX7A 1DRWA 1CY8A 3ZCRA 1C7JA 2MSDB 2Z6AA 4MDFA 2V7TA 4DMKA 1P33A 1XRLA 3IBSA 3OEED 2Z1MA 3CLUC 4LYGA 3WAGA 1CY0A 2VG8A 2IC5A 3MUOA 3O3NB 4NZZA 3WLNA 5HXAA 1DTSA 1NEQA 2O1XA 2QV7A 4YJFB 5E9WA 4ATNA 1UXOA 3D3JA 2BFDA 3JX9A 1LBSA 4OQLA 1D7AA 3TW0A 2F2TA 4QYXA 3W5HA 1IXYA 1F17A 1LPAB 4IUCS 5EESA 1E96A 3VU0A 4F45A 4XYLA 2WWWA 5FPQA 1M76A 2WTBA 5FOUA 2IITA 3O73A 5H82A 3O8LA 1M34A 1UODA 1UM9B 3KOXA 2QNBA 2HRDA 1N6LA 4N3CA 2X3YA 2GN2A 5KQRA 3V8BA 2DWPA 2W4MA 1IHDA 3OWXA 3OT5A 2VJOA 4GYJA 5CT4A 3U48A 4D99A 2PUFA 4F2WA 5L3QA 3E9ZA 2KM1A 3RCBA 4CLXA 5BV1A 5B1EA 4EFNA 1WNFA 2VF8A 2QRJA 2YXBA 4TMXA 3DOFA 3URKA 2XLCA 1UJ6A 1ZUD1 4OL0A 5SV2A 1R3DA 5A7LA 3K6JA 2PV0A 3O90A 1TJ5A 1FNBA 1IUNA 4RD6A 3N28A 2R3SA 4KKVA 3MCAA 4L72A 1U1DA 1Z62A 5KYYA 1O6FA 4M1SA 3WWEA 2DB3A 4E09A 2F8SA 2INGX 4GSYA 4I4IA 3ABRB 1SU6A 3IO3A 3U3KA 3KKNA 1QZXA 4H3HB 2FH5B 2QRHA 3C7TA 4Z1OA 2H2HA 2VYND 1K9SA 4X1KB 5B7QA 1EJ0A 2DZDA 1GIAA 2I1LA 3G5GA 3ESXA 3O8QA 4KXLA 1U81A 1JEDA 2HSWA 3BRWA 1VPVA 3C8UA 3I9FA 1DB3A 2Q49A 3PUHA 4RKYA 5B5SA 1S2MA 4F9GA 4CQMD 4MAMA 2C7QA 1M1XB 3LY9A 3ST7A 3VYVA 4FFMA 4L9WA 1L4KA 3DT6A 4B48A 4YCSA 5F35A 3NDRA 5LQMA 4DILA 2DF8A 4BN0A 1DQZA 3K5WA 1E89A 1U04A 3OTQA 4HEJA 1DULA 4IMRA 4N0DA 1Y1QA 2W98A 2XCUA 2XMRA 3ON5A 3ISJA 4LJRA 1XTBA 2ZIWB 3QFTA 4O8CA 2REBA 3T1NA 3WKBA 2XYVA 2OUIA 4O4LA 1CJTC 2IXFA 3DL7A 3IOCA 4I1RA 1LGYA 3PUXA 2WWHA 3LPCA 5TVKA 4ZVOA 1UBKS 4YROA 3DBRA 3SD7A 5JALA 1WSBA 1E3JA 2UZ3A 4GXNA 2C9ZA 3GRKA 1E3MA 2GBGA 2XMSA 1X42A 2IEGA 1KY3A 2LXNA 5HUQA 3AB3A 4PXAA 1CUJA 2OV3A 3HA3A 5HTKA 4BQOA 4Q19A 4IJUA 1C1HA 1J33A 4M36A 1GNSA 3BXEA 2H8KA 1JSCA 5GV7A 4BRSA 3DCYA 1N2JA 3KXKA 4OBXA 1V3TA 4IA8A 3UNXA 1M1NB 2DERA 1R0CA 1WXWA 4UHCA 1E0KA 3G2KA 4UVEA 5CYPA 1PIWA 3JASB 1A7UA 1PFWA 4QPJC 3M3HA 4RIGA 1Y4SA 4Z4FA 3E18A 1JG2A 3RUPA 1R2QA 2OHIA 2VKTA 3LFUA 4TTRA 3GVHA 3OJFA 3SNKA 4UEWA 4PGAA 3U31A 3W05A 1IBKB 1XVUA 2AG6A 4M37A 4DRYA 2XECA 1IXKA 1XZMA 3SF0A 5CEEA 3AL3A 5D8DA 4J1TC 1WKCA 2ILTA 2PRSA 3WGUA 4D26A 5F7JA 3EUSA 5D6NA 3DKVA 2F3SA 1Y6FA 4PS0A 2Q8QA 1U3FA 1W49A 3L6EA 3OCUA 5HZGA 2HCTA 3QXHA 3ADCA 3AFHA 1FJ2A 4CG3A 3OPYI 1UMKA 3VX3A 2VSFA 3GMIA 3VDXA 4CG1A 1A8HA 1R63A 2OILA 1QH1A 1ZOLA 2WTNA 4XLTA 3SPXA 5FWXB 4MB6A 3WHPA 5K4AA 5JCJD 3FJ1A 3DQQA 1NP3A 4DM4A 4XWKA 3T1VA 2PX5A 5AM0A 5JRDS 1CUGA 5ENVA 4C0LA 3QH4A 2C5GA 3BREA 5C4GB 1GGHA 4B6QA 1KMQA 1QMGA 1RAAA 3E53A 3PC8C 5I3ZA 2W2TA 3A2MA 1NVAA 3EA5A 2H1CA 4PANA 5IC5A 2ODQA 5T4HA 5CVVA 1KO7A 3PUVA 1YI0A 5FQNA 3RS3A 4MJ7A 3SKVA 3OIFA 1U2QA 2YWJA 1EWVA 1XMPA 1Z75A 1VHJA 3BA6A 2OQVA 3BMCA 1B7GO 5JANA 3ISTA 1Q7TA 2HTFA 3ED1A 5U1PA 4C5CA 2QOEA 4AULA 1ONBA 1P77A 2ZJZA 3F1KA 5LOVB 2B2XA 2Y9PB 4UBNA 2NVUA 3LHKA 4ZO8A 5C8XA 2VTEA 3CNOA 3HKDA 3KVNA 2IXTA 1D2HA 4QELA 1FFDA 2HKIA 4K0RA 1Y5MA 3PGJA 5DI3A 5KTNA 2JJ2D 1T3LA 2Y1FA 1HL7A 3F1LA 2IWRA 3GDHA 3QFFA 4RZ2A 4NX2A 3TM4A 2D5CA 3SE0A 2IYEA 3PGKA 4WA8A 4P93A 4NMHA 5CP8A 5G4KB 3ROTA 4YALA 2I91A 5L3RA 1L9XA 1A9PA 3VHRA 2BZSA 3I28A 2O0JA 1WU8A 2DE0X 3IKVA 4FZJA 3RSOA 3S81A 1HYHA 5LZ8A 3EPHA 3E0XA 3N8HA 2EFEB 4R1OA 1ZNYA 4HAYA 1YRLA 4EYSA 4P7JA 1UWLA 2AYZA 3ES9A 4L3WA 4HGOA 5FFFA 1JILA 3NXHA 1HG0A 4MIEA 4FGLA 3E82A 3MS2A 4M1EA 1HY3A 4ZYTA 2HV8A 2ZZNA 2GBCA 2PO5A 4BKMA 5CLFA 2FN9A 3FSGA 1I6LA 2APJA 3BFJA 5JSFA 2D5VA 1JIKA 3UKOA 1P72A 1BO6A 2J8ZA 2EGHA 2YHIB 3GNLA 2PT7A 1R37A 4UBOA 4PSCA 3URMA 1H66A 4NCJA 3WLJA 3CW9A 4L6AA 3N8NA 5IJWA 3QA9A 5BN3B 3U13A 1QRSA 3LLSA 1FFHA 5K2OA 1COWD 2OFXA 5JD5A 3CHYA 1V47A 1XO1A 4HGYA 5TX7A 1QFMA 2G0TA 2B7BA 3OMLA 3AFNA 2QHXA 2V7BA 3H6GA 3EVGA 2XF2A 4Y6QA 1XRPA 1G4UR 4ZDIA 1XWWA 4ENVA 3H2HA 3STUA 5IBQA 1SKYE 4CR8A 4G0XA 3TXYA 4G07A 1KETA 1LBQA 4DCMA 3LUDA 1TXGA 4IHKA 3NZLA 5MDHA 4YJ3F 3FH0A 2EJVA 4PO8A 1KZYC 4Z0NA 1D04A 3IULA 3HACA 5E2BA 3WXBA 4DE8A 4XD2A 2ZVPX 4G4SP 2O8EA 1I94B 1TM4E 4M99A 1G7TA 5I9SA 4BJ3A 5AUOB 1PR2A 3KG2A 2FWBA 4D9HA 3C6BA 2HDWA 1YMUA 4GOXA 3PL5A 3GNTA 3L18A 2FPGA 2M4HA 3TIIA 3UK1A 1Z35A 2JGJA 1JAYA 2FU5C 3A26A 4N6NA 4WOPA 3ROMA 3M2PA 2VYFA 1QHGA 2BFOA 2DWCA 2VHCA 2CD9A 5AJWA 2E0IA 4CCYB 4IKEA 4EPYA 1RXYA 1G8YA 4ZT4A 4TSRA 4JBIA 1SZDA 3WWCA 1TA4A 1E2KA 3U3WA 2IXDA 3AJ8A 2F64A 1DUSA 4X20A 4ZC1A 3V7NA 3O2SB 1TLFA 2X7XA 2UXDB 4OFBA 3N1UA 4DDWA 4M54A 4OJQA 3QXSA 1EFRD 1QO7A 4DY4A 4OXYA 5H4GA 3LT2A 1JT2A 5FLYA 4II3A 3BIXA 4FXPA 4Q3NA 5GMOA 3U0BA 4BO1A 3DQZA 4BEBA 4YT8A 2D5IA 4Q05A 4OGLA 3C15C 1SFRA 5IC6A 1OH8A 2A5DA 1UXKA 1BH2A 2P0AA 3H8JA 2BZGA 1TGVA 2EZTA 3L02A 3ME5A 4NBTA 4HEA1 4DLYA 1EYZA 1KBQA 2DBVO 2X8BA 1NYRA 5DLEA 1QQ5A 3MGAA 1T5OA 1LF5A 4QOEA 2Y9MB 1VHTA 3TFQA 1XRNA 1KI4A 4QUBA 3NIDB 4FQ7A 1TZKA 3SCGA 1GAEO 2HJWA 5ALLA 2AR9A 3V32A 5K05A 4PAWA 1PO7A 2X3FA 3W3AA 4RNCA 1P5ZB 1R5NA 4JBNA 3TZ6A 3LPLA 3I9JA 5LU8A 3QMVA 1F51E 1CUAA 1FP6A 3CGGA 4TQ9A 1Y7IA 4LRSB 3FUWA 3GQVA 3ZH9B 2SCUB 4E30A 5AVWA 3H8WA 1XJ5A 4INAA 5HM8A 1N8TA 3O2QB 4YY3B 2AYXA 2CGEA 3I64A 3T5TA 3I9MA 3BZBA 5DN6A 2ACWA 2WPNA 4KP7A 2D62A 5CPFA 1AHHA 2OGWA 3CVVA 3KC2A 4OH1A 2XMPA 1IY0A 2O6HA 2II6A 2C9MA 1KQOA 1KK3A 1MMFB 3G13A 2Z9DA 3OTWA 2X1LA 1GUYA 2CNWD 2R85A 2XCQA 3QE3A 4KNWA 2H63A 3Q8WA 4QPZA 5ED0A 3E8SA 2A5JA 3TEPA 1PNOA 2D1FA 4DE5A 3EIUA 5DN9A 4NOLA 1P5FA 2YNMD 3OC0A 1XEXA 1CQJA 3ORRA 3Q2KA 5IJ0B 5IUJC 3G68A 1DC7A 1U3DA 2QTFA 2WSSA 1GXSB 2O57A 4Q4JB 3GGJA 3HKEA 4LXHA 3UJ6A 1M10A 2ZIEA 1OA0A 2HMSA 2P30A 2ZT5A 2JAHA 3B7GA 3C41J 3R6DA 3VJMA 4GF5A 2FMFA 4IHQA 3IESA 4UUNA 1UINA 1FTQA 2QI9C 4AVYA 5E3IA 1AN9A 1FDTA 2H92A 2Q2OA 2RBKA 3L5OA 3LY7A 3T7KA 4DWVA 2RHHA 3KHSA 1ECBA 3LA8A 1XT6A 3KKOA 5IANA 1GZDA 2WSYB 3GUHA 1L4MA 5IMBA 4AO6A 1ZGGA 4D8TA 5HX7A 3UG7A 5K8CA 1IY1A 1ILEA 1M8KA 1OZ0A 1WVMA 2FI1A 2C9OA 2DAPA 2G28A 2OCDA 1A9YA 2W0MA 2PR2A 2ZJ4A 4WY5A 4KVZA 4HDMB 3TZLA 3JZFA 3BD8A 5C8DA 1CSEE 2OCYC 2BM8A 1P5HA 1D9XA 3GZ4A 2K4MA 1DAFA 5GV8A 4UATA 4OJTA 2ACKA 4I55F 3IQXA 1P0PA 4YTEA 3RSHA 3TRBA 1G16A 2VI5A 2YCBA 3KSUA 3U37A 1XTSA 1DXYA 1QQ6A 3GAAA 3QWIA 3R6LA 4OM8A 4E5MA 2NX2A 3IVPA 2HX1A 3JRXA 3QWAA 2LYPA 3OFSA 4ZPJA 3OZUA 3DFZA 5HCUA 1OU4A 1W2HA 4B2YA 1VG9B 5LIPA 1PE0A 3CEJA 4RM2A 4XA8A 1I2DA 4AP9A 5KKCA 5DTMA 3DNFA 4P5EA 4KFCA 4PWZA 1XMXA 3H17A 3CF4G 4QUKA 3ADBA 2NNLD 4JFRA 4X4DA 2EZ9A 2HF9A 1UPAA 2WK1A 2I67A 2QK4A 2CUKA 2R9VA 3GT0A 3VKFA 5M34A 1I4DD 4EJ2A 5KHAA 1M2OA 4RTOA 1H9BA 1RKVA 4DRXB 1A2OA 1EDZA 3CH4B 4MDHA 1KR5A 2BBTA 4FINA 1U2RA 4ZU6X 2A7XA 2OYSA 1CUZA 2HSGA 1OE0A 1XJCA 2A9VA 1U0FA 3A1UA 3I92A 1XCOA 4XIFA 4C07A 1NY5A 2JIQA 3LT1A 3QKSB 4O5AA 4KIWA 4AN0A 4RANA 1QF7A 1YR3A 2EYQA 3GEEA 3Q3HA 4QBIA 4UTZA 5FBLB 5JH7B 3EXIA 4R9UC 3WL6A 2HLNA 4XRGA 2ZIGA 1VMAA 2R1UA 5LA6B 3HDVA 4QFBA 4LPSA 5FWAA 3OD1A 2UYOA 3MGGA 3DAHA 3EXFA 2VPZA 1ZISA 1PG0A 3ADKA 4DLPA 1U1GA 4EB8A 5EYPB 2J41A 1SBNE 5KC9A 1NR1A 3P9PA 4EHIA 2BGUA 5EZQA 2PN1A 4MVJA 1RABA 1D0IA 3PICA 1T5LA 5J4VA 1EVYA 2GKGA 4PF1A 4WPGA 4JT8A 4TKUB 1QRDA 1OYVA 2IYOA 1ZH6A 2BEUB 4BO2A 2A3RA 2JIBA 2ISSD 1ZBQA 3K16A 4IX9A 3Q3VA 1JR6A 1OVGA 1V45E 3P0FA 4BNGA 4DQKA 3AHCA 4AZ3B 1JHQA 5FTWA 5HRUA 1FFGA 2P79A 2Q7XA 3P1JA 5A7HA 2O49A 3RSCA 1KYVA 4UTPA 3ZHOA 3A10A 4LC1A 2A7QA 1XRSB 4BO6A 3S2UA 2QUZA 3F46A 4TTTS 5HPYB 1IBCA 5UKDA 4AMGA 4B17A 3ICEA 2J7UA 1UMDB 4C3ZA 3OO0A 3FMPB 3I2FA 1WMSA 3IGFA 1L5LA 4Q9AA 2IZ5A 3UTCA 2JLAA 4DM7A 1T2AA 2VRNA 4RPHA 4BP9A 2CZCA 3NWBA 1RADA 2VP2A 1S02A 3OZIA 2P5SA 3PC6A 2WOJA 4M21A 4URUR 3ZE2B 3ZIDA 4CVNA 3EXHA 2AXVA 3FYTA 4U9HS 5I7OA 2Q0QA 4EEZA 5GVSA 2IYZA 4X1IB 3ZU5A 4F72A 7MHTA 2IK8A 3WIOA 4P7FA 1Q2XA 4H7KA 4UJ3A 5DE3A 4OQMA 3QUAA 3ROZA 1RYNA 2NO4A 4ZEXA 2R68A 4ZA2A 4B35A 4CMGA 3KJIA 4D4KA 1WKVA 4D0GA 1XD2A 1I7QB 2BF7A 4NCAA 2FMTA 3JD2A 1GPLA 3LA6A 5KU7A 3GUYA 3B9PA 2EWWA 3FKJA 3IV6A 2DUNA 3ODGA 5C0OE 5I6DA 1W73A 4KJZA 5ALKA 5BN4B 4YV1A 3A37A 4G41A 2G6TA 1BHJA 4M7WA 5DHUA 2JFXA 1GR1A 3OP4A 1VYVA 1G5PA 1VCMA 1O89A 1L5QA 2XTZA 4CNQA 1ECGA 1II8B 1YFKA 2NW6A 3W1VA 3WLRA 4QJBA 3ZLVA 4ERNA 3PXXA 4MYUA 4Y2YA 4NBRA 5FV4A 1ECCA 3A28A 4FQ8A 2RGBA 1JHMA 4JU9A 3UENA 4X63A 5YASA 4BFYA 5AW0A 1NRIA 4ZTBA 3AWDA 1C7EA 2H1WA 5F52A 2AMYA 2HA0A 2ZB7A 4B46A 1QTNA 3L07A 2X0FA 5A4DA 1IBMB 1HOXA 1V1MA 1Z0ZA 3BGOS 4GWGA 1KXZA 4Q5IA 4UCXA 4GMHA 1W0JD 5CYGA 1ULZA 4XGIA 2HPVA 2LBPA 1VE1A 2Q8PA 4P4UA 4ACAA 3QQ5A 3SR0A 1WRBA 1Z6AA 1OYWA 2C77A 2O06A 3I2JA 1ESEA 5CX4A 4JBYA 3EVBA 2I2DA 1S4QA 3DT9A 3KZXA 5A6SB 5LP6C 3M89A 4ARAA 5ERYA 2IS1A 1KEPA 4JBLA 1BD3A 2HU2A 2ZS7A 4X8LA 3ZH2A 1Q17A 5A4KA 2I2XB 4CEHB 5D7NA 3TYXA 3PD1A 1NRJB 3UXMA 2CV1A 4QJIA 4ZVLA 2P5TB 1FUYB 4LHXA 4DTIA 2B61A 5K0GA 5JC1A 4HGZA 4V0OA 3U39A 3RK4A 3I9NA 2NPOA 1ODKA 2VJNA 2IUYA 3G7SA 4V2UA 4ZP1A 1L5GB 2X9VA 2X6QA 1C3VA 3PFHA 3CBGA 4MS4B 4FMCF 4JX8A 3KZOA 3SI7A 2R6ZA 4F2PA 1K9VF 1OXXK 1JH9A 2QRKA 3EQ9A 1W4RA 1ZA2A 3GPBA 1XV5A 3CRNA 4P4TA 5H4HA 5K3BA 3RHFA 3BICA 4YPOA 4Q48A 4DARA 2DPHA 5TLSA 2XYRA 2FR8A 2AE2A 2I62A 2RJ3A 3VR6H 3DDNA 2IVBA 3DB1A 3IB6A 4XCQA 2R1VB 1SKUA 4DA7A 1KZ7B 4MV1A 4HYTA 3CSUA 4UFPA 2VQEB 4MGKR 3ZDFA 3WSWA 3DJYA 3GDOA 1QG2A 2VDLB 3GRAA 4C0WA 4ZZ0A 1JAHA 3ELBA 2WEKA 3ZWDA 2JFUA 4LSGA 4EUKA 3IUNA 4EY6A 2QGZA 1R15A 3EIFA 1BRTA 1K1EA 2XE6A 5TPWB 1EXWA 1U5AA 2QDXA 3UVEA 3GAFA 3ZHXA 3SJUA 1EVEA 3BBPA 1P75A 1SUDA 3JVVA 4GIBA 3OTIA 1Z13A 1NNLA 2DOKA 5DTQA 4WXMA 5BNFA 2FUG1 2YYAA 4RD0A 2Y71A 1QF9A 1CHNA 3PVZA 2B98A 2JFPA 1Z45A 4PGHA 1RJWA 4I1SA 4LISA 4GPD1 4D46A 3VTKA 4Z5CA 1EWYA 2YIJA 4O2LA 4NU5A 2DH5A 4Y9SA 2ZDHA 3GZNA 4UVDA 4BRWA 1P9LA 2YICA 4OAQA 1EK1A 2FZ5A 3LBIA 1JB1A 1RBMA 1KS2A 4LNHA 3QF4A 5AP9A 1FTGA 2V97A 5FWYA 3ROXA 2JFBA 2LYQA 3OAAD 3PQ4A 1MXHA 1N2HA 4PTYA 1XRQA 5AUQA 1JQAA 3QEBZ 1S3FA 4TROA 4NHOA 1YI8A 3ZWBA 4BN5A 1FDVA 3SEQA 3FPCA 4P7KA 4IQ4A 4FDTA 1WLYA 2XHEA 5DOVA 4W9MC 1NSFA 3KVVA 1PGNA 2QL6A 2IV1A 3QLVA 1BTOA 3BZUA 1Z0SA 4LGVA 4RYDA 5IAEA 5CFZA 2VOJA 4CQNA 2ASVA 1GARA 3CLHA 1IDN1 5L7WA 1ZH0A 5BNWA 2G3YA 2BBWA 3Q98A 4EBBA 3T5AA 4RF4A 2VA8A 1G8PA 5ERGB 1AZSC 2DUMA 1DCKA 2PT9A 2ZK7A 3NTVA 3SLGA 1O96B 3MUEA 3RWMB 3MJDA 3NHJA 3RREA 2WV7A 1E3QA 2QM7A 3R3XA 4PLWA 5DISB 3VR0A 3WOVA 2IYSA 2NUBA 3SYKA 2PGJA 2PYZA 2G7ZA 3A1SA 1JDBB 1V48A 2G88A 5ALWA 5EUMA 4E12A 2FEOA 1TTPB 1LJLA 2ZCUA 2WM9B 1KZ6A 3FBWA 3FRIA 3R5HA 3PK0A 2PRIA 1ZQ9A 1OLOA 3NCTA 4TTIA 5ENDA 1CQTA 1IN5A 3KFLA 3NTQA 1ML4A 2C1EA 4L57A 1ZL0A 3O1LA 3JQ7B 4NXMB 3ANXA 3T7EA 5EKTA 2I6QA 2DHRA 2ZYUX 2FE4A 5MGBA 1W85B 2H1SA 5KNDH 3OMXA 1R6UA 1Y1RA 4JU8A 4ZO9A 4EPWA 3H86A 2CCJA 5AT1A 4BNLA 1HV8A 1S2GA 2E89A 4XD7D 1KVTA 1SY7A 5D5PA 3PEEA 1K7CA 4ZCTA 4PSKA 3JXCL 1EFPA 4E5VA 1UKBA 5HSGA 2P6OA 4ZI3A 5LLTA 1SXIA 4MP8A 4YHHB 1HSZA 4NDZA 5DEOA 4BE7B 4AJ9A 2WF5A 5T6BA 1EX9A 4NMWA 2CSXA 2ZJYA 3ENZA 4INZA 4QFDA 4WJZA 1YC5A 5DZSA 1RZRA 3C87A 2WKQA 3E05A 2XOKA 4BZPA 2PMBA 3H5VA 4ZQHA 3SP1A 4FFRA 4IXMA 3HPRA 1PJAA 5DM60 4GI2A 4Z53A 1W59A 4YJGA 5IT0A 2O8BB 3AHFA 2D1QA 2ZVJA 4X95A 2ZUTA 3SBOA 5FWDA 3CR7A 5FYDA 3TCKA 1PJZA 2C4HA 2ZJOA 1I6WA 1I9CA 5HIMA 3RJMA 3CURA 3ROGA 4TVOA 1MAAA 4GI3A 3OM9A 4I3FA 4XPZA 5FJIA 2GEVA 2IV7A 1Q3TA 1N4AA 4J1QA 4QO8A 5JMTA 3STTA 4CUZA 4K8OA 4QU9A 3GWGA 4D57A 3HVUA 4M38A 3PEYA 4G56A 1ADRA 3CONA 2FNAA 4UBJA 2OQ2A 3NUZA 2GEJA 3H84A 5AK0A 2G1JA 3WKCA 1TI7A 4KFUA 2DRIA 3BXFA 5LNK1 2DBYA 1ZM2A 4FYPA 2AOXA 4BFUA 1KEEA 4DLKA 1W96A 4B3FX 4J0HA 3JQAD 4JZKA 2ZT7A 4WBNB 1IXSB 1ISRA 5FI0B 3PNYA 1ZD8A 3CROL 2CEKA 3Q6IA 1Y7HA 4FDUA 3H87A 4OA5A 3WRXA 1Z18A 1QE3A 5KCZA 4YQYA 2YWHA 5CFLA 1GPBA 3RSLA 4P34A 1EUCA 4NBLA 3KXAA 4IHAA 3CIFA 4JQCA 1NP7A 3H2ZA 2AK3A 4GP6A 4KN8A 1C8LA 3ENWA 1YJBA 1PBTA 1XRMA 3RRMA 1E79A 4QBFA 1F6DA 1Z15A 5EHQA 4XARA 3WGMA 4DJDC 1AHNA 1DWUA 4MXDA 2OHXA 5DBOA 1EG2A 3G2IA 2AOWA 5B1SA 1D9ZA 3L0SA 1T8RA 3R0JA 4N0MA 6REQA 3O4GA 2YFHA 3HWRA 2J4CA 2ORWA 5IT5A 2WJJA 4O4LF 2A78A 4L5AA 1X0VA 4V0NA 2VIIA 4N54A 4ZYUA 2H9YA 4HNVA 2F1HA 1QIHA 2VJPA 5EIAA 3GT3A 1I3OA 3UJBA 2XIUA 4R1NA 1N8NA 4CN9A 3FXAA 2CSUA 1K98A 2PR7A 4HXGA 4QWMA 1UKZA 2OD7A 1FP4B 2HIAA 2MIIA 4YCJA 5DGIA 4KO4S 1JGTA 4W5HA 2I4LA 4HAXA 1WCV1 2FMKA 4IS2A 3GZDC 2ZGVA 4JLUA 2IY7A 2PO7A 3D5QA 4RHFA 4AZSA 1YZGA 1M5UA 4MPJA 4QODA 2VWPA 3FX2A 4ZEMA 4QPCA 3PPXA 4EAQA 5KWEA 1HLPA 2Q4BA 2QM3A 5IDXA 4KSCA 5L9AA 4OQQA 1E98A 3RBXA 1MP0A 3VJLA 1FMCA 3MTAA 1HT2E 3RTEA 1E6KA 1Z6TA 5CLLA 3QEOA 5AKIA 1NM5C 4FW9A 4W8HA 3N2KA 4D0NA 1K08A 3OH8A 2Z83A 3WLOA 1F48A 3ECCA 1BJRE 1SXHA 2M6RA 2ADOA 2XNHA 1RZ3A 3ACBA 2OC4A 3NDPA 1UM9A 4I5GA 3TCNA 3NT5A 4GYWA 3KXDA 2VHVA 1ATIA 2EJCA 3QVGB 4ZDWA 1Z6GA 2VNAA 4X4FA 3EIOA 4X6UA 1A9OA 2EERA 2PMEA 4F4IA 2IDMA 4EGQA 2QMEA 1WDLA 1G42A 1YQQA 4ZVSA 1KP9A 3BSYA 3T9FA 5ESDA 4F7WA 2VDJA 3F3YA 5JG7A 1U3CA 2W8ZA 2YXDA 4I1VA 5AOVA 4HVTA 5JAOA 2JIMA 4URFA 2QAGB 4IEIA 3A1TA 3KJHA 4B4OA 5ALJA 1UT5A 1Z3CA 3QX9A 5DRTA 2XQVA 2H1VA 4GUDA 2C2BA 5EMKA 5GIOE 1LSJA 1G5FA 4L9SA 4A6DA 5JNSA 1MA0A 4TXNA 1UXGA 3EZ6A 1MEOA 4KSYA 1XZKA 1T6XA 2J5XA 1DL5A 4YMUA 3EYAA 2QJTA 1J6UA 4BAZA 4B3TB 1HYQA 3EIQA 1GRCA 4NATA 2JLCA 4BFSA 3RV4A 1WDMA 1KH1A 1RI4A 3LQ1A 3LUJA 2PXFA 3RVOA 1LU9A 3E5HA 4FLMA 4YP9A 5HS6A 2Z56A 4ARZB 3EZ9A 1SQGA 2Z5LA 3BXOA 3FLEA 2HT6A 2WM3A 1M0SA 3G9ZA 4HWOA 1XGKA 4IZOA 4L15A 1S0UA 1IRXA 2I7CA 3UC5A 4BU0A 2IE0A 5B3LA 1FYEA 1U4SA 3EBOA 4J91A 4MDEA 1IPFA 2X2OA 1FJXA 3S5UA 5CDYA 4UXIA 1P7PA 4E1BA 1NVXQ 1F0YA 2WNIA 1NUQA 2FG7C 5HKOA 3JQ8B 3HM9A 2VPIA 2GBIA 4XVUA 1LLQA 4GE3A 3CUUA 2UZ0A 3DLTA 3LMKA 4RD2A 3AINA 5K8UA 4QEZA 2PKWA 4P5DA 3E6AA 1KHHA 3SHFA 5HKAA 2XQJA 5ISMA 5SYNA 1HYGA 2E5FA 4AAYA 3L8EA 5AVTA 2YJGA 4XX0A 3EGXA 5LB4A 1JSXA 1YUMA 3HJGA 1HTTA 4JBHA 1Z6XA 5DGXA 1Q12A 1G1MA 2CV2A 4V24A 4WN3A 3JYLA 4EKGA 3E03A 4JC8A 5LB2A 4NH0A 5FBVB 2B5VA 5DNYB 4PX3A 3DE6X 4Q7JB 4AJLA 3A6HA 4REOA 4BFZA 4FOSA 2O0HA 4YJDA 3RRNA 4M8KA 1EQAA 2F1RA 4NBNA 1UEXC 4MV4A 1R8JA 3CV3A 4QOJA 1BFUA 4KV9A 4MVYA 1ZRMA 1ISHA 3KVYA 3S6JA 1YOVA 3OX3A 3W3ZB 3N8GA 5CDGA 3JASA 2WIJA 5G3ZA 2XMGA 1M9NA 4Q3AA 2C97A 3S8MA 4YAUA 4WLEA 2B94A 3RFFA 3TJZA 5AQ1A 4ZV7A 2CXOA 2XHZA 1P19A 3LIIA 2C4VA 5BSMA 4BVHA 2UUBB 1SO8A 3WMEA 1VLJA 4JP1A 1QCDA 3WGJA 3GJ6A 1YRQA 3HFJA 3PVCA 4QD3A 5AW6A 5JDCA 2VQFB 1H0KA 2CYCA 5K1ZA 2PD3A 3F78A 1HF3A 1K3TA 1XE3A 4XJXA 1D4OA 4R0MA 2X9QA 2HF2A 4EM6A 5GJWC 5M3BA 4BS9A 2JCXA 2QGFA 1W7AA 1E99A 2GNPA 3K31A 4AXXA 5B2EA 5H81A 3PC4A 5E3JA 3KEMA 1GR0A 3O1IC 4M4SA 1VL6A 5ALDA 5EEGA 3A2KA 4BL5A 3EGCA 5CFOA 3JRNA 4TV8B 2E7ZA 3WL7A 1KZGB 3GOHA 3OMWA 1XCMA 2CROA 1O5TA 3IKLA 5FHQA 4A8JA 5JD3A 3G0HA 1BFDA 2ISQA 4I9NA 5DNEA 4JI2B 3GJ0A 4OV6B 3LKZA 1MX1A 1OGYA 4CKZA 1H5NA 1IH8A 3L9WA 2I7DA 4YRCA 2RGUA 5D7BA 1OYYA 5J23A 3BQMB 1IY9A 1U1CA 2X14A 1SKQA 3COVA 4WNIA 4MA4A 4DCCA 2RGWA 2GZ1A 1MCZA 1XL1A 1IOLA 1JE0A 1P39A 1CR4A 3VZBA 1LCIA 2JH9A 3AYZB 1S2DA 4MYHA 2OGTA 4IDEA 4KYUA 3RWBA 1FU8A 1WL8A 2NVOA 3HN6A 5JNTA 2VHXA 3D3WB 4QRHA 3PYXA 2QZ9A 4HXFB 4MQLA 2GUGA 3U3MA 4FGUA 4U8HA 4WX2B 1V8DA 3VGPA 2QRZA 4JFAA 2YV4A 3TQFA 4JY7A 4L8WB 5LOVA 1QLJA 2TYSB 1U8XX 4LY3A 4DUYB 2O5CA 3R5TA 3HR7A 3TW4A 1YULA 1YONA 4W1PA 1KI6B 2JATA 4MP6A 2YMPA 4Q24A 3UXYA 3ZS9A 3ZD7A 4JZYA 4XYMA 3GZJA 4MUEA 4R8RA 4W1SA 4PHCA 4ZVKA 1OY1A 1IVNA 1NYLA 3AJAA 3DLAA 5G4KA 5TPZD 1SZCA 1WQ4A 1ADBA 2I6FA 2PT5A 2QLNA 2Y77A 4RH1A 3WK7A 2XRZA 2J3KA 4Q18A 4MINA 2RIRA 4TL8A 3SCHA 3G2QA 4FIDA 4O1IA 3A9YA 1F0KA 2CFCA 2Q5OA 3V8PA 5KNCA 1QTQA 2JB9A 3UMYA 3E81A 1B4DA 1QPGA 2V9ZA 1OCEA 3OLYA 4U3JB 5K0TA 1ABBA 2CZGA 5KSYA 4PIPA 4UHBA 3ZIAD 3I5XA 1U11A 2AC7A 2YN4A 3A1DA 4OG2A 4ZALA 4DXDA 1T29A 2AXQA 5A4FS 3CVXA 4GP9A 5KYNA 2B34A 3E9RA 4IKOA 4PVCA 2A1TS 1IY2A 4PYMA 1JEJA 4LQLA 4OO3A 4RV4A 2R1ZA 2YHIA 1DC8A 3OZWA 4IGIA 4JJ4A 3V1MA 4E1AA 4WDRA 1L4UA 2GK3A 2ATVA 3LPMA 4LYYA 2ZRFA 3KSMA 4MRAA 4MVCA 4UUQA 2ATCA 1VPLA 3RW9A 3U3XA 1IWPB 2RCNA 3Q40A 2H0RA 2H06A 4QVIA 5LR6A 4Z7NB 1JMYA 2DG2A 4KDRA 3QPBA 4UAGA 5DYNA 3GMTA 3DZCA 3CG4A 3HZRA 1UDCA 2WIUB 4JL5A 2ZU6A 4UXJA 5TT1A 2HGZA 1FXSA 4DLXA 1B00A 5AXBA 4FE7A 5AYVA 3ZTYA 8ATCA 3ZWKA 1EZ4A 3DNVB 5L40A 1R0XA 1HTWA 2Y1GA 3AI3A 1DCFA 4LYAA 2WJIA 4G0OA 3MS4A 5B1YA 2PIDA 4AF8A 3PQ5A 4BCBA 4GE0A 5CA1B 1XOIA 1AOXA 1DFIA 4MI3A 2I2WA 4IIUA 2XGGA 3TBHA 1K92A 2DFDA 1QYWA 4NBVA 2R6HA 4EHBA 1G20A 2QTVA 4A16A 1PWHA 4PLTA 4W1RA 4J94A 1ULHA 4MV7A 1MB4A 3D5EA 4D4LA 3FCAA 4JMLA 3GLQA 1P7CA 1N1EA 1EK2A 3PNQA 4PX2A 2PS1A 3UJ7A 1FP1D 2EHDA 5AI6A 4EFDA 3CLCA 3AB7A 3L4BC 1W93A 2QW0X 1R0RE 3H7AA 1GAJA 3ZV7A 4DFDA 5C8YF 3PNMA 3B85A 3QF3A 3LFTA 1KYXA 4IJ6A 4DA8A 2HA5A 2BGJA 3HGQA 1I3LA 4E08A 3ZTTA 3HVKA 2C7RA 2KSQA 3Q1KA 3RS0A 4K0KB 4WK6A 4BMZA 3C3CA 1N2ZA 3FNBA 1TJYA 2I6UA 4NZYA 1F1BA 2Y05A 1SKBA 3F2VA 4RIHA 3T7TA 1SPXA 1Z5OA 3W7AA 1Q15A 2K7FA 5DT9A 4OFXA 3BMQB 1FFAA 1I0IA 2IA5A 3C5WP 3N7AA 4G1CA 4ER0A 1RJGA 4ZOLB 4R8VA 1FNDA 2A14A 5BW5A 1AUQA 3T5GA 5LN1A 1VLZA 4KQ2A 3M4ZA 4Y2UA 4M1QA 4CL3A 1EFLA 1YB2A 4AXBA 2QX9A 2Y1EA 1YL5A 3MG9A 3M7IA 3V5NA 2JFHA 4N5HX 3UV6A 1KBZA 3BMNB 2G5TA 3UJPA 3IJEB 4KQJA 5C7OO 2XCJA 4YDSA 3RVLA 1NQ5A 4W8OA 4XFDA 1ORIA 1AD2A 1EXNA 5HCIA 5CK5A 5C31A 3ZE6A 1JUDA 5C1DA 3HNRA 4B7AA 5A9SA 1LLCA 4A03A 1B23P 2UXBB 2PUJA 3HS3A 1XTPA 5DNAA 3EQ8A 3M83A 2GEUA 2WTEA 3GLHB 1PT8A 1YJ8A 1JSRA 2BI4A 2VCEA 2JJYA 1T1RA 3BE6A 3VGJA 1I5EA 4D0LB 5DM1A 3QVMA 1MHPA 3NBAA 3DYBA 2PUDA 1CP3A 1IHUA 1ZIDA 2WHQA 3H13A 3R0QA 4KGXA 5DHPA 4DCGA 3WFIA 3T1HB 4B31A 2CVZA 13PKA 1NT4A 3MRXA 1GT6A 2EWVA 3H3JA 4TXLA 3WLAA 5AESA 1GDTA 1ZD1A 4HZIA 1B41A 1PZHA 4TL9A 3TEMA 2H1HA 2YZKA 3L1JA 4QO7A 4G37A 3QOYA 1QPBA 3GN5B 4LECA 4P33A 4EX6A 3ETHA 4CLEA 2E2WA 2ZCVA 1T9GR 3B2EA 4H18A 1DIRA 3J81A 4F84A 2GD2A 5TF4A 2AIRA 2GVNA 1L4BA 4S1TA 4DPMA 4Z7QB 1IDOA 3BILA 1SZPA 4BO3A 5IJ0A 2DLDA 3W90A 3REQB 2PSSA 4FBLA 5JCPA 2GLUA 1OT3A 5KOHA 3BA1A 3O8DA 3TLJA 1Y1LA 4S05A 1YQ9A 1GXSA 3B36A 4Q4JA 2P6NA 5JJ5A 3IDQA 3LFHA 3NOOA 2DR2A 3BK2A 2HQRA 3O47A 5T8KC 2C5AA 1X8JA 3P19A 2ZSIA 4YQZA 4AUKA 1QYIA 1OU0A 3W8NA 1NG9A 1USUA 1TCAA 4B6GA 3L7AA 3TN7A 2EAUA 2H9IA 2BKLA 3EASA 4GMKA 5B7PA 4DR4B 5B58C 1PFUA 2PD6A 3HXOA 3IILA 4LRQA 1NVVR 3R5FA 4JK3A 4EABA 5CT6A 5F21A 1LDYA 2PUWA 2NOAA 2C61A 2DUUA 2I1QA 1F8UA 3HEAA 4FKBA 4G0MA 4PY2A 1Z88A 2F8TA 5J4YA 1ZH8A 1CEXA 2ZEJA 2BKVA 2KB0A 2YDXA 3EWAA 4RVHA 4B4DA 3K09A 4HDMA 4Z7JA 3PE5A 1AK2A 3FR7A 2PY6A 4Q1VA 3OM1A 3WJ7A 2XB8A 1GG5A 2MR6A 3WIBA 4N18A 1LBTA 1QYDA 1SKAA 3ZXIA 3WI7A 1G7RA 4LXYA 3OC6A 2ZPAA 1N2BA 3IHKA 2ICAA 3NT4A 4EY7A 3PSHA 1P1FA 3MLEA 4G25A 4P4GA 3SEFA 1BS2A 2IYNA 2AI3A 3C5HA 1E66A 3KR2A 1NX6A 2G82A 4UMVA 3PDIB 2PXAA 4KXMA 4TTVA 5JADA 3T8YA 3AB8A 3NONA 1F38A 5L7YA 5BPFA 2VOEA 2BHNA 1RYHA 4BRZA 2HC9A 4UAUA 2HOQA 3KJXA 3BRCA 2P0YA 3Q5DA 3K8QA 3W5JA 3KB8A 4YS6A 2LUOA 3M0EA 1NXVA 4C4YA 2JBAB 2JANA 2XUKA 3CKLA 3N5KA 3T5BA 3AR4A 4BTLA 5CB0A 1E6CA 5CDFE 2VTDA 1SVOA 1DEAA 1DWOA 1QCYA 4MK4A 2NPFA 5BWOA 3PNBA 4OB4A 4MJ3A 2YY7A 1XDSA 1PNRA 3IQGX 4ALJA 3ECSA 3RE1A 4DRXA 3F5FA 3NAGA 2PX2A 1QB7A 2HEGA 4KL8S 2ONJA 1AG9A 3ESDA 4NC9A 4BNHA 3QEAZ 2H4JA 2BKEA 4UTRA 5BN1A 4FYKA 4HMPA 2A4KA 4IJVA 1YZYA 2PQMA 2ZT8A 3I2YX 3QKSA 1YHZA 2FWAA 3KKZA 4RF2A 3RO7A 2OKGA 5JH7A 3IBTA 3OJEA 1VKRA 1SCAA 1IN7A 1MDFA 1UWKA 3KPYA 3DV0B 1WHTA 3L2OB 4NBKA 4QRDA 4CODB 3K0AB