3SCFA

Fe(ii)-hppe with s-hpp and no
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
193
structure length
193
Chain Sequence
TASTGFAELLKDRREQVKMDHAALASLLGETPETVAAWENGEGGELTLTQLGRIAHVLGTSIGALTPPAGNDLDDGVIIQMPDERPILKGVRDNVDYYVYNCLVRTKRAPSLVPLVVDVLTDNPDDAKFNSGHAGNEFLFVLEGEIHMKWGDKENPKEALLPTGASMFVEEHVPHAFTAAKGTGSAKLIAVNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Epoxidase
publication title Structural basis of regiospecificity of a mononuclear iron enzyme in antibiotic fosfomycin biosynthesis.
pubmed doi rcsb
source organism Streptomyces wedmorensis
total genus 43
structure length 193
sequence length 193
chains with identical sequence B, C
ec nomenclature ec 1.11.1.23: (S)-2-hydroxypropylphosphonic acid epoxidase.
pdb deposition date 2011-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 3scfA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3scfA02
1PM7A 3NJZA 3KCCA 4AVAA 2D40A 1IPKA 2PUBA 2PUFA 3ES1A 2CAUA 3HIFA 1RC6A 2EVXA 1LMB3 1QY4A 4KL1A 2R63A 1B0NA 1EYBA 1ZRCA 1CAXA 1PRUA 2XKPA 3OF1A 3JXCL 1Q3EA 2WFPA 3D0SA 4WVZA 3UKVA 2AXZA 4HSLA 5HI0A 1NEQA 2MHFA 3JXDL 4FBFA 4PU3C 1POUA 2D93A 3DKWA 1YFUA 2XCJA 4KWJA 4QGLA 2KPJA 2FJRA 1E3OC 3U10A 2ZCWA 3S0MA 3H5TA 2O8QA 1EY2A 2UY8A 2KZ8A 4XETA 3H7YA 4A2UA 1FXZA 3LISA 3JXBC 2EAAA 4MGKE 4IEXA 3EBRA 3EQEA 1DGRA 3BPZA 3TNPB 5CADA 1YUDA 4Q29A 4LLOA 5BV6A 3NSTA 4EWDA 4NDWA 2R1JL 3GN5A 4OFGA 4PIXA 4J1WA 3HT1A 3KJXA 1SFNA 3HT2A 3G7DA 5LEJA 1HW5A 4XFCA 1QWRA 4MGIE 4IEQA 3DNVB 4HVRA 4QMAA 1WH8A 1LCCA 2ICPA 4L11A 1JFTA 2XKOA 4IEZA 1LRHA 4LEJA 5EZWA 4Q0VA 3L2HA 5A7LA 4Z82A 4XF1A 3LA3A 2B9UA 1YLLA 4JCYA 5KHJA 2L8NA 3OP9A 3WW4A 5BPXA 2IVQA 4IA8A 4BH9A 1WETA 4JCXA 3HQXA 1OSLA 4UBHA 4GULA 1ZVFA 4OLLA 4I6UA 4FAHA 2PIJA 1X82A 2BGCA 2D5FA 2UYBA 3DV8A 2OFYA 3EJKA 3KXAA 1QXJA 1CAVA 5I8SA 3IVPA 3MDPA 2HINA 3F6WA 3E5QA 3PLQA 5AVPA 5I93A 1QP7A 3H3UA 5LEKA 2LYJA 3E5XA 2GRLA 3DL3A 2QCSB 3NL1A 2EWTA 4XF4A 3S7IA 2GC0A 1JUHA 1UCXA 2PHLA 3LOIA 3OD0A 2CROA 3FYAA 3ZHMA 4HBNA 4HSJA 3SHRA 3SMHA 2VECA 3BS3A 1NZCA 2MNGA 3SCGA 3FX3A 4LTAA 2EA7A 4ZU4A 3R6SA 5I0SA 4FT8A 2CGPA 4JTNA 2WUSR 1UW8A 4HZFA 3ELNA 2Q0AA 1XRUA 2VQAA 2BJCA 3PVBB 4X4FA 2KEIA 2XL7A 3H3ZA 1RIOA 1UXCA 3HZIB 2OZ6A 4LULA 1WH6A 4ONUA 1LR5A 4X4DA 3M70A 2IUOA 1I5ZA 1NE6A 2XGXA 2PUCA 2JCGA 3LA7A 3O14A 4WBBA 5T3NA 4E2SA 4QX5A 4Z58A 3MYXA 5E16A 1CAVB 4MCTA 3UKTA 2PQQA 4AQ2A 4I6TA 2V09A 5K8SA 3EHKA 2KXLA 3RNSA 3RPQA 4N9IA 1ZREA 1X8EA 4ZU7A 3D1NI 4I01A 3I59B 3LWCA 5I91A 5J7MA 2PA7A 4E2GA 3USSA 1UXDA 1L3JA 2HSGA 2OR1L 5KHGA 3CEWA 2QNKA 4MCXA 2LYSA 2BNNA 1O3QA 2H6CA 2AXVA 3FHIB 3NKTA 4KWKA 4MGYE 1PERL 2ET1A 2PAEA 4KU8A 2BNMA 4YG1A 3H7JA 4D7SA 4AXOA 2GH2A 3E6DA 4HLTA 2ATFA 1QQAA 3KMHA 4I09A 4QGNA 1DW9A 1LQCA 3PNAA 4HMZA 1ZRDA 3KGLA 1ZPQA 2O4AA 1J3RA 1PMIA 4MZUA 2EF8A 2B5HA 2XIUA 2IXJA 3CO2A 2XJ3A 4J1XA 3QOPA 4QM9A 4FBIA 5D1IA 4BYYA 2GU9A 3QQ6A 4I3PA 3IDBB 2IC1A 1Q5OA 4IEOA 4HN1A 1O4XA 4Q0UA 1CAWA 1RUNA 1QXRA 2HKXA 4NVPA 1O4TA 5FPZA 1NE4A 1O5LA 4F8DA 1RZSA 3OTFA 4ORFA 1NERA 3M3IA 4X4CA 4QM8A 1BDHA 1J3QA 4ZU5A 1LKNA 3WW3A 3ETQA 4BIFA 2AWIA 2ZKLA 4AVCA 2Z2SB 1YHFA 1UTXA 4FN3A 1X8MA 5KBFA 4JQDA 5E1RA 4LUMA 3OGJA 3E6CC 3SCFA 3CJXA 1Y3TA 2O1QA 4IEVA 3ZKCA 1JFSA 2LYRA 4IEWA 4X6RB 3OCPA 3RYRA 1LCDA 1ZZ8A 3LZZA 4XEZA 2PUGA 4O9GA 5FLJA 1UIJA 5FQ0B 5F1RA 4LA3A 4I6RA 1OCTC 1CAWB 2OPKA 3ZDSA 2PTMA 2PUDA 4YARA 3RYPA 2AW6A 2OZJA 3TRBA 4IEYA 5EFUA 4F7ZA 4XF0A 4HVOA 5I0TA 3QF3A 4H7LA 1SQ4A 2GAUA 1GQHA 3E6BA 4JTOA 3I59A 2BYVE 4RD7A 1UPIA 5I0RA 1ZZBA 2F4PA 1GQGA 4HN0A 2XSDC 5CU1A 4CYDA 2QJVA 1CGPA 5JSOA 5BXXA 4JV4A 1WA4A 3H8UA 3TNQA 2EBYA 4X6QB 1V70A 5BUVA 4R52A 2B5AA 4XFBA 1BDIA 2B8MA 4X4HA 2OA2A 3RDIA 3KZ3A 2Z69A 5C6CA 1YFXA 4I0BA 3N4MA 3F52A 2DCTA 1ZX5A 4YRDA 2JVLA 3CLCA 1ZRRA 2PAMA 4META 2PUEA 1ZZCA 2IXIA 1R69A 2H8RA 3IDCB 4MUVA 4LUKA 2PUAA 2N7GA 1RGSA 4IESA 3F51A 3BALA 2KEKA 3U0ZA 3CLPA 4PU7A 3MLFA 2BEOA 2CAVA 2CV6A 2GC3A 2I45A 1OMIA 2PFWA 2AXUA 4O9EA 5LRSA 3CF6E 1YWKA 1O3SA 1DZTA 2KEJA 5JSPA 5CVRA 1CAUA 5I8TA 2Y0OA 1L1MA 1X2LA 2FMYA 2LYPA 1XE7A 1YSEA 5BY5A 2PPXA 1ZZ9A 3FZ3A 5I0UA 5KHKA 3BCWA 4WZCA 2UY9A 3B02A 4Z59A 4XF9A 4YYOA 4Z5CA 3OQMA 4PIZA 2OYZA 1H1MA 3O9XA 1OD5A 4PU4C 1Y7YA 1RPEL 1ZZ7A 2XLFA 1X7NA 5K98B 2ET7A 1O7FA 1ADRA 3E5UA 3PXPA 1ZRFA 5JR7B 2Q1ZB 1ZUGA 3OMTA 3CL1A 1YFYA 3WW1A 2IV1A 3OQNA 2LCVA 1CQTA 2IXKA 2L49A 3R1FA 1X57A 2MPFA 3BB6A 3U11A 1IPJA 5C8WA 3FE5A 5FQ0A 4QXKA 1VJ2A 2XHKA 1PNRA 4KU7A 1PRAA 3H50A 4UXAA 1YFWA 4IWRA 2GC2A 2LYLA 3H1WA 4MV2A 4GHJA 4D7TA 4Q0QA 3EUSA 1CAUB 2HJIA 5JSRA 3SCHA 2ETEA 1WIZA 1OI6A 4GQMA 4I8TA 2WC2A 4IETA 2C0ZA 1WLTA 4PIYA 3MPBA 3D0JA 2XLGA 3CECA 2Q4SA 4L2NA 3UFDA 1QQBA 3ZHIA 4MX3A 5J3UA 4XF3A 2A6CA 3S8QA 2PE5A 1VPWA 1RUOA 1SQ8A 1UIKA 2IXHA 4LA2A 3I54A 5JAXA 2P17A 3DN7A 2XLAA 3KGZA 4Z07A 1GT0C 3ST7A 1NYWA 4XFAA 2IVBA 3BD1A 3MZHA 1DGWA 2ICTA 3ES4A 2GZUA 1CJGA 2XL9A 4TLFA 1O5UA 1QP0A 3VHRA 4B29A 3IIAA 1XE8A 3GBFA 1LLIA 1ZZ6A 4N9HA 4R8HA 3FYMA 4X4BA 4YG7B 1RTVA 3FMYA 2IVGA 1EP0A 1FT9A 2UYAA 2O49A 1UD1A 1DZRA 2QVSB 3S7EA 5I8YA 3FJSA 1TQ5A 3C3VA 3LAGA 1S7EA 3RZZA 1ZS4A 1RZRA 1AU7A 4XFHA 4DINB 1NXMA 1O3RA 4PU8A 2MEZA 1CAXB 2IU7A 4X4IA 3QYXA 1EFAA 4IERA 4Y42A 4KWLA 4FAGA 3CROL 1I6XA 2PYTA 3RYKA 1O3TA 1ZAYA 4K8FA 4YG4A 4QGMA 5FLHA 3G5GA 2D5HA 2AUWA 4Z5HA 4I2OA 4EROA 2FQPA 3FFQA 2VPVA 1RL3A 5KHHA 1JH9A 1QP4A 1ZNPA 5JCTA 2PAKA 3LFPA 3H1MA 1U12A 2O38A 3SXWA 1DWKA 4PJYA 1ZVVA 3D82A 4AVBA 3OQOA 1QPZA 2PHDA 4YSFA 5FPXA 1XWRA 3ACLA 2E9QA 2GRMA 1OFNA 4EWEA 3GN5B 2GZWA 3L1PA 5FDBA 3B7HA 4I02A 4MGZE 3H9AA 4Q0SA 4E2QA 2IXCA 3E97A 3QACA 1J59A 3JZVA 3BDNA 2LYQA 1VP6A 1FI2A 3NVCA 1J1LA 4OB4A 3U3WA 4Q0PA 2BNOA 1SEFA 2K9ZA 4EV0A 1HF0A 4IEUA 1R63A 5KHIA 4YNIA 2H0VA 3VK0A 1G6NA 1WGPA 4O8BA 5FLIA 3ROUA 1IC8A 3UKNA 4MH0E 2WIUB 4EWAA 1JWLA 2Q30A 4AQ6A 2H6BA 5LRRA 4X4GA 1H1IA 1J58A 1LB2A 3I7DA 3GYDA 2IXLA 3FWEA 4JVAA 4X4EA 1EPZA 1Q43A 1PRVA 4XFGA 2LYKA 1J3PA 4P9GA 3BU7A 3H1YA 3IWZA 4IEPA 4UBGA 4XFIA 3IBMA 1RZRD 4F8AA 2MQKA 4Z5DA 4YBAA 2QDRA 3EO6A 4XFFA 4BHPA 2D5VA 5FCCA 4HVQA 2XI8A 3KSCA 2K0GA 2GC1A 5J48A 4IVZA 3NW4A 1VR3A 2CSFA 3WW2A 3QWGA 1Y9QA 3LA2A 4I0AA 1CX4A
chains in the Genus database with same CATH superfamily
2XUMA 4WVLA 3NJZA 4MGQA 2I2SA 2VH9A 2JB4A 2PUBA 3LD8A 4IE4A 4RYDA 2HWB3 3TWIA 4AAXA 1MPXA 1R1A2 5FIXA 2VY0A 1VMHA 3A23A 1UAIA 2JDNA 2FDFA 2WRAA 1Q8SA 1Q8OA 2ZEXA 4XHXA 4AZZA 3POWA 1ZRCA 1DF0A 2VNOA 3NNGA 4JDNA 2E53A 3RVHA 4V2VA 3BU0A 1PRUA 1PMHX 3LQCA 3JXCL 1Q3EA 3MEJA 1GOGA 1GBGA 1MQTB 2ADDA 2WFPA 3D0SA 4FPOB 4HSLA 2LTNA 5IVYA 1HQ1A 1XSQA 2XJTA 4CDXB 2RR11 1J83A 1W2OA 5FZMA 3FMGA 3HMYA 2MHFA 3M2MA 1ST8A 1POV3 3LSDA 4HFSA 2D3RA 1POUA 2HWC2 3KM5A 2YGMA 2VE1A 3PUIA 4I30A 3RJ2X 3VZLA 4KWJA 2ZX1A 2KPJA 4ZHNA 5CFCC 3ZFFB 3KF5A 4YVSB 2J7MA 4RS5B 3N9NA 3M3CA 4WVZA 4D69A 1EY2A 4FTEA 3JBG2 2YZ4A 3VLBB 3LISA 1KXGA 1Z7S3 1G86A 1UF2C 4LBLA 4LBQD 5GALA 3ZR5A 4CCJA 2VZ1A 4DIQA 3J8F3 1QH6A 4NHKA 3TNPB 1YUDA 4EYUA 1BBT2 1G9BA 3RZKA 2PLV1 4XC9A 3C7HA 2ENRA 4DFSA 4E4SA 3ZKUA 4AG4A 2P6CA 1KDKA 2ZX4A 2J1TA 3BTAA 1DQ1A 4MGSA 5KC5A 1A8DA 3ZM8A 1NLRA 2ZGSA 3OUHA 1HW5A 4XQDA 4R9AA 3KWVA 1A8MA 3ZYRA 4XDOA 5JUVA 4HONA 3VDBA 4MGIE 4IEQA 1VBE2 3GGLA 4HVRA 2ARCA 4QMAA 4U36A 1NW3A 1XE0A 4IEZA 1F2NA 4K20A 5D8AB 5LBCA 1OQEA 1LRHA 4LEJA 4QHBA 4PLOA 4Q0VA 5A7LA 3LF7A 1R1A1 5K4LA 3QFIA 2W68A 1GOFA 2UWBA 2L8NA 3MLKA 2FCUA 2VQ0A 3LE0A 4IA8A 3N9LA 3NNJA 3T0AA 5FFOC 2RDRA 4WM7B 1OSLA 4NIAA 5FYYA 2KD7A 2Y26A 2V5DA 3WT3A 1Y9MA 3VKLA 4FAHA 2PIJA 2AYHA 4CVUA 2VL4A 2DU0A 5FY0A 3OGVA 3UGFA 5A3UA 2EIGA 3VKFC 3C7OA 1FOD3 3EJKA 5GLVA 3WVJA 1WLDA 1QXJA 1CAVA 3V0AB 4ER5A 3IVPA 4EZ4A 2HWC1 2VZ3A 3T2PA 4ATEA 1JHJA 5FZKA 3H3UA 1PGSA 3ZYBA 3C2UA 3VBFB 2QCSB 2YY1A 3N9QA 2BJSA 4DE8A 1RUD2 1TEIA 3JBG1 3Q8BA 4JKLA 4ER6A 3VHOA 1VB4A 4WVWA 3WNKA 5M0TA 1Y43B 2V5YA 3I2KA 4EQZA 4BB3A 2PXBA 3OD0A 4C1WA 4HSJA 2XXQA 1BBT1 2WLPA 3SHRA 1IG0A 1X9TA 2VECA 4CTEA 1C8M2 1VBB1 3FX3A 1G9DA 2YBKA 1GANA 1D0GA 2YMZA 4FT8A 2WUSR 4JTNA 1UW8A 2Y8KA 4CEWB 3BI3A 1RB8G 2Q0AA 1XPWA 1LAJA 2NYYA 5HXMA 2BJCA 2XL7A 3ZYFA 4AWDA 3S5AA 2BWAA 5DUVA 1KQRA 1VBE1 3MF6A 1Q56A 2OT7A 1RIOA 3H3ZA 3WNPA 1RYYA 4LT5A 1LR5A 4JGZB 4X4DA 1QJX2 4Q2JA 1AZDA 1T2XA 2QQLA 3VBSA 2FDIA 2A6XA 1I5ZA 2BFUL 4N90A 4FFGA 2K2SA 5GAGi 2XGXA 2EIEA 4NUBA 4Q4X2 4WBBA 2GP3A 5T3NA 3WF3A 4QX5A 1MR5A 5C70A 3HVDA 1OQ1A 1W0NA 5E16A 1CAVB 4MCTA 3K51A 5FMBA 3WP4A 3POYA 3AFGA 2P3YA 1F35A 3EHKA 3CU7A 3RPQA 4B1MA 4N9IA 2DVBA 2TEPA 4AEDB 4AI0A 1CIWA 1JODA 1TME3 3O1UA 1LOEA 3D1NI 2XOMA 3KQ4B 4BIOA 4HG6B 2BDRA 5J7MA 3MIDA 1BK1A 5I91A 2PA7A 1C4RA 4P9JA 1WW7A 1WW5A 4EN6B 1B35C 2TBVA 3PU3A 3VD4A 1W04A 2JIJA 3Q8EA 5A7QA 4NO4A 1W0OA 2QNKA 3ZFEB 2H6CA 1O3QA 2AXVA 1GP5A 4Y22A 2NLRA 3ZFGC 1HQLA 1W90A 2W1WA 2RJLA 4DUWA 3AZWA 1PERL 3KVBA 4PDWC 5H9SA 4D7SA 4YG1A 1C8M1 4DQAA 2PN5A 3VBHA 3TEZA 3IPVA 5FYCA 1BJQA 1DZQA 2GMMA 3HN1A 3ECQA 4Q4V3 3I3MA 2ATFA 2XJSA 3KMHA 4I09A 1ND2B 1QJEA 1WW6A 2A1XA 3I2FA 5EV7A 5C4WA 1E5HA 5IK4A 1QZXA 2AZ5A 1YCIA 5BNPA 1FV3A 3O12A 4S2HA 1JW6A 2J1RA 1RMU2 2D7FA 5KC6A 1ENXA 3URFA 1ZPQA 2YFUA 2O4AA 4OVEA 4UW6A 2FDKA 1QDOA 1R093 5DXDA 3T2QA 3A4UA 2J1UA 2B5HA 3PE5A 1PVC3 3ETPA 1WCUA 1RUE1 2GN7A 1QJX1 3GJAA 3QOPA 4XMAA 5BYNA 4BYYA 4RR3C 2GU9A 2XXPA 3RG0A 4FXGB 1OF4A 4I3PA 1E5SA 4Q4X1 1W6NB 1RUH3 2Z79A 5FWJA 3A9XA 2WQ8A 5A32A 1MS8A 4CXWA 4CU6A 1RUNA 5F9TA 2PXDA 1UWWA 2ZEZA 1VLNA 1OA2A 5FPZA 2F6BA 1S1AA 4YZ2A 4XCAA 2WWUA 2RJKA 4ORFA 5JZGA 1LHUA 1V6KA 2VAUA 3WCSA 5HBAA 4KG8A 1OOPA 2JG9C 5C3PA 4M0HA 2ZGNA 4IV3B 1BEV2 2I07B 3GBWA 3WW3A 4XE9A 2ZOEB 1POQA 4FVVA 4K3UA 1ASJ3 4QDRA 5A7NA 5C3SA 1QXPA 2Z2SB 3WQ7A 2WZR2 3K4AA 1U0AA 3WG4A 2FDJA 2ZEYA 2P4EA 5ABJC 3D3AA 3WF0A 1S55A 2JE9A 5C4WB 3HQRA 1FMD3 1M4WA 3WZ1A 4LUMA 4OHYA 4CDQA 4YG6A 4E9KA 4YGCA 3SCFA 5KWRA 2GALA 1S0BA 2D97A 2O1QA 1I3HA 4EJRA 2OXBA 2ZAAA 4SLIA 3MPPG 3RYRA 2IFWA 2NPIA 2QQWA 1RMU1 2JIGA 1YQCA 2PUGA 2R7EB 4GH4C 5FWEA 2XJPA 3WLUA 4YM1A 5FQ0B 2YPJA 5F1RA 2ARBA 3LB9A 5AC91 3BTZA 2EIDA 3MW3A 2XQXA 4FPGA 4XBLA 1AF9A 3HNMA 2RJ2A 5FUNA 3THTA 3AMHA 4LK7A 4ZPIA 5EFUA 2AR6A 4XF0A 4CUGA 1ND3A 5A1FA 3ZXAC 3QF3A 3WUCA 2JENA 4JTOA 3E6BA 2ZS6B 2E33A 1MS5A 2QQKA 5EJ3A 5C8CA 5I0RA 1ZZBA 3M3QA 1OOPB 1WCDJ 1WKYA 1PX4A 5CU1A 5F2SA 5GLTA 2QJVA 4RFT0 5JSOA 2VZUA 4YFWA 1WBFA 1WA4A 2Y6KA 3H8UA 5DDJ3 1CWPA 3TNQA 2VO5A 2EBYA 3HR9A 4AVAA 1CPNA 5D2AA 2VBDA 4FP2A 5BUVA 2RMU1 1BEV1 3AJZA 4PBPA 4R52A 2WYSA 4OMDA 4XFBA 5FXXA 3ZXJA 4YFZA 4X4HA 2OA2A 3LSEA 4QT6A 2VTXJ 2VTFA 1RHI3 1TG7A 2WZR1 3OBRA 4XJAA 1D4VB 1IGOA 4C0BA 1JYWA 2XBO2 2JDPA 3ITQA 4I0BA 1ZX5A 4IE5A 3WG1A 2JVLA 3AZXA 1K42A 1H8TA 2PUEA 1EV12 1OKQA 1RVF3 5GLWA 5H9RA 5IATA 2W3JA 2D98A 2ZX0A 1NA1A 1VBC3 4COYA 1HJGA 3N9OA 2OQ6A 2KEKA 3I2JA 4XVHA 4IDZA 1RJ8A 1UU5A 1K12A 2BEOA 3MFCA 4A6OA 5GZEA 5CFCB 3POIA 4H3WA 3IN9A 2ZABA 2PFWA 3BIWE 3PHMA 4QB6A 1DZTA 3WP6A 2KEJA 1F31A 1RUG3 2JE8A 3QBQA 2G4IA 4UFIA 1BVVA 5CYYA 3UYJA 1VRH3 2JWPA 4O7XA 4QXCA 4DOUA 4LQRA 5FKBA 3VZOA 5K7PA 2JJ6A 1EUTA 1W2UA 2BZDA 5K0UA 4NOTA 3FZ3A 2R073 5I0UA 2ODRD 5KHKA 4OHWA 3WV6A 4BU2A 1HV1A 4AFAA 5FO7B 5CG9A 4U2AA 4XF9A 3BTXA 2C9AA 4Z5CA 1W2TA 4PIZA 2OYZA 3MW2A 1AR73 4IGPA 1Y7YA 1C3HA 4GKYA 2DCJA 2XLFA 2MXDA 4QPIC 1NCQA 2WUHA 4Y20A 5A3NA 1DYKA 2BBVA 4BE3A 3D8CA 1UZZA 5JR7B 1APNA 2VUDA 3FHQA 3PUHA 3I3DA 2IV1A 2FZ1A 2BP6A 1HRV1 1WWYA 2AGSA 1SG3A 2XBO1 1AXKA 4FPEA 5CB7A 3OSDA 1CQTA 1RUJ2 2NM1A 2ZZQA 2IXKA 2MPFA 3HOBA 3KV4A 5APAA 4OYUA 3RRDA 3ZN4A 1W8UA 1A78A 2IFRA 1EV11 3LGRA 3UGGA 4LBQB 2QQJA 2XHKA 2RM23 1QOOA 3GM8A 5C71A 3H50A 5DZFA 3ZYIB 1PO12 4AHYA 2XJRA 2LYLA 4BQ4A 2WSUA 1B09A 3ASIA 4MV2A 4BZ4A 4Q0QA 4ARYA 2HJIA 1ENQA 3SCHA 3B3QE 5L9BA 5JOWA 4I8TA 5FOBB 1DG6A 2A6WA 2FCTA 2C0ZA 2D6NA 1W9WA 1WLTA 2HWE3 3OEAA 4IETA 2HBUA 3NAPA 4PIYA 4YGBA 2BERA 2NQYA 4L2NA 2VVEA 1YEWA 2Y6FA 3AKSA 3AZVA 2R042 3GDBA 4Q26A 5BNNA 1LNSA 2DBIA 3S8QA 2PE5A 1WLWA 1RUOA 4LA2A 2E7TA 2JDYA 3ZMNA 4XUTA 1RUI1 4LLFA 3FUQA 1UYZA 4MGTA 2VCAA 3DPRC 2VNVA 3BD1A 3IAPA 1GMMA 4CUCA 2ICTA 1DQ2A 5FPLA 1AVBA 1DGWX 4IW3A 2XUEA 4LE4A 1ZA7A 3GBFA 1LLIA 3MIFA 4N9HA 1V6MA 3DECA 3CIHA 4ZKTB 4N53A 1N1SA 2ZMLA 1FT9A 2UYAA 4WM8A 1OUSA 4XAAA 4XCBA 5EHDA 2O49A 4P9XA 1REEA 2VJXA 2QVSB 1IHMA 2EXIA 4CSWA 5A6ZA 1FV2A 1TQ5A 1I5PA 3LAGA 5CG8A 1RUJ1 1AYM3 1EUUA 4TTGA 2BFUS 1PGW2 5FP7A 2BV4A 2ZGKA 3MW4A 3ORJA 5FZIA 3QYXA 3S30A 3U37A 4AI3A 1G9FA 3HN3A 5DG1A 1VBA3 1I6XA 1PX3A 4G9SB 2HWB2 1PO22 1PO11 4DPNA 2D5HA 5FMDA 3ZDVA 2FQPA 3WSOA 4CDWA 4QHZA 3X29B 5FMCA 1OXCA 1JH9A 1QP4A 1C5HA 4Q4Y3 2ZX3A 3POFA 2W47A 1UY0A 2WFF3 4Q4W3 4LE3A 1B35B 3H1MA 4KI5M 3VZMA 4XDPA 4CP2A 2WDBA 1K45A 2R041 1OC1A 2PHDA 2XONA 3ZFGB 5GAHi 1SDDB 2AH2A 2PHUA 5F37A 1UY3A 4PDWB 5J36A 1OFNA 1HB1A 1W6PA 4PF5A 1UYPA 4EWEA 1MZFA 3WD5A 3AC0A 3VN4A 1QJU1 4I02A 1ZA4A 1Z7S2 4MSVA 5DTQA 1DULA 4PI2A 4AFBA 2Q8OA 4CEYA 5FCCA 2LALA 2IXCA 1PM4A 3J8F2 1VBD3 3E97A 4N43C 3JZVA 4R9BA 3WP5A 4RL7A 2WN3A 3BYWA 1FI2A 3NJXA 4BCUA 3V0BA 3H42B 1NQDA 2QTWB 4LIVA 4HKLA 1HXS2 4MXWB 4RR3B 3P3NA 4KBZA 1HF0A 2VQTA 3AYCA 4IEUA 4IV1C 2WNVA 2ZXQA 1W2AX 4XJ9A 2GSYA 3TN91 1G6NA 1AX1A 1WGPA 2YXSA 3KV6A 1IC8A 3KT1A 5FLIA 2VOWA 1RXFA 4MH0E 3ROUA 2JX9A 2ZX2A 1JWLA 1PGW1 4GXLA 4AQ6A 1W03A 2H6BA 5FZOB 3LFMA 3AK0A 3IT8A 3BOWA 2W94A 3T0BA 3FWEA 1PO21 1EPZA 2HCSA 3GALA 2GNDA 2ZGMA 4ES9A 1Q43A 5KXDA 1V0AA 2XXAA 4XFGA 2P6HA 2LYKA 3WUDA 1C57A 2BTVC 1J3PA 3OYWB 3NJYA 1UX6A 2JG9B 2VW2A 1EAH3 4LBMA 4LMFA 4CDUC 1BYHA 3MLLA 4BQ3A 5IYYA 3PUSA 3CJIA 1O8SA 2MQKA 1W6PB 5ANQA 4BHPA 1QGLA 1CZSA 5FZLA 1MACA 2VOTA 4YW6A 4KGGA 3SEEA 2GC1A 2P34A 1HN0A 4JQRA 2ZBJA 1XNTA 4JKKA 4HXCA 3LA2A 4QPWA 3ZN6A 1YIPA 4QHOA 1W9TA 2JKBA 4GWMA 3OUIA 4OUSA 4ZS2A 2YG0A 1MFQC 2D40A 3AL5A 3ES1A 5IT6A 2ZHLA 5LZ6A 2HWF3 2UWAA 1UKGA 4NR1A 3B69A 4W6YA 1XJAA 2QQMA 3J8F1 3OBTA 4GH4B 1B0NA 3OJBA 3PJQA 2P2KA 2VZQA 4HK9A 4YW4A 5FAXA 4J25A 1CAXA 2Y6JA 3JXSA 1HXS1 3WDYA 1S0CA 3GJBA 2F17A 2XKPA 5GZCA 3ZXFA 1D4M3 2BGOA 2X5IC 2AXZA 2RS13 5F3IA 5HI0A 3AP9A 1NEQA 2YBSA 3JXDL 4FBFA 2VMEA 4L97A 5DAWA 1M06G 4QPGC 2J7UA 4EQVA 3CMGA 3AKPA 4NHLA 3J7MA 4GAZA 3U10A 2FJRA 1E3OC 5LASA 2ZCWA 4TWTA 1GP6A 2O8QA 4YVWA 4C91A 3A0KA 3UV9A 2FHRA 2KZ8A 5JUWA 2BGPA 2EICA 4HPKB 3ZSJA 4A2UA 3JXBC 1IZ3A 2EAAA 2SBAA 4MGKE 4BLIA 4AHXA 2HH9A 3G6JB 4NRPA 3ZLIA 5T50A 3EQEA 1DGRA 5CADA 2GNTA 4LNVA 4LLOA 5BV6A 3NSTA 2ERFA 1FATA 1V6OA 4J6GA 4EWDA 2D44A 2R1JL 3M1HA 5LWBA 3GN5A 2ORZA 2QQVA 3SX0A 1S2KA 3HT1A 4ASMB 4N8MA 3IDAA 5LEJA 1TME2 1SBEA 1W9FA 3UK9A 3TEWA 3ZPXA 1BXHA 4GZ9A 1NX9A 1QWRA 1YC61 2Q5TA 3DNVB 3I8TA 1H6YA 4LBOA 1W6QA 1WH8A 5FZ0A 4E4ZA 1JFTA 1W8HA 4E27A 2W9XA 3P1IA 3SEPA 3AMPA 3PUQA 5A6YA 3LA3A 5A33A 4EN0A 1YLLA 1HKDA 3OP9A 3RSJA 2DFBA 2BQPA 5BPXA 1DQ4A 3WW4A 3WG3A 4A6SA 4LOSA 1LOBA 3HQXA 5J1XA 3KCXA 5LA2A 4UBHA 2A3XA 4KH9A 4UF0A 4I6UA 4MYEA 4Y5TA 2D5FA 2BGCA 4RQPA 1ACCA 4K9SA 4I3GA 4F83A 2B7YA 5JI9A 2VMIA 2LLWA 2JICA 3MDPA 2YUEA 3F6WA 1R092 1RITA 4C8DA 1REFA 1D2SA 1QP7A 5CKNA 1PVC2 1W6MA 1ULDA 4A7YA 3E5XA 2GRLA 4QB2A 4OHVA 1PZ7A 5DAXA 5HXVA 3S7IA 1RUH2 2XHNA 2QQUA 1JZ6A 3M8LA 1S0FA 2OQ7A 5FY7A 2R49A 1W3XA 4Y3OA 2CROA 3ZHMA 3GXUA 1BK0A 1YO8A 3KV5A 3BS3A 1NZCA 2DU1A 3OD4A 4FPLA 1JU4A 3R6SA 5F8PA 1AR83 5T52A 1X50A 4HZFA 1AJOA 1HB2A 3BN6A 4D94A 3WDUA 2BOIA 1TME1 2VQAA 4QU1A 5JLVA 3PVBB 5K9YA 1G9AA 2WWJA 4L8QA 4W8JA 2KEIA 1YNAA 1YQ6A 4LKSA 1DBNA 3DF0A 1IS3A 3NNLA 4OI0A 1CIYA 3NV1A 2C24A 1ASJ2 1LOCA 2OZ6A 1WH6A 3P6BA 4V2WA 3RWKX 4G4FA 1D0HA 2DVAA 3M70A 5T5PA 5FY5A 2DCZA 2EALA 1LHOA 3UL2A 2WQ4A 1FMD2 4CDXA 3LA7A 5A7SA 1NUKA 1YQ2A 4PLMA 1GICA 4Z58A 2WSVA 3MYXA 4ZY9A 3T2TA 1LENA 4CU8A 3FLRA 2PQQA 3VKOA 3GZCA 2VOKA 3KF3A 3ZFFA 3ZO0B 2V09A 5K8SA 4YVSA 3SR4A 5IUQA 4RS5A 1F5JA 3PJYA 3ZXDA 1VRBA 1IKPA 1ZREA 3TEYA 5H9QA 1R091 2RVAA 1H4GA 3LWCA 1NY72 1PVC1 3C7FA 3VBUC 3DPRB 4JAAA 1QJY3 3GBGA 3I2DA 3WEZA 5KHGA 1CJDA 2ZHKA 2LYSA 1QNWA 1RUH1 4DMIA 5A3LA 4P9YA 2XWBB 4W6WA 4ASLA 4L0PA 2X53S 4XMIA 2VZTA 4MGYE 2QQOA 2QQNA 3WR0A 3ZXKA 4KU8A 2ET1A 1ULGA 3V65A 2BNMA 1OT5A 3GZAA 4CRQA 4XZPA 3VBOC 1CN1A 1AL22 1DU3D 2RDSA 2VEOA 1O4ZA 4FCAA 2GDFA 4AR2A 5D8AA 1QOTA 3I49A 3LEKA 3K3OA 1BMV1 2ZEWA 3TOJA 2QZ2A 3AYDA 5DDJ2 3QD6A 5FZCA 5J96B 1WCQA 1ZRDA 2LS6A 5L73A 2W52A 1OURA 4FQZA 3G0TA 3L9JT 4MZUA 1OUXA 3VGIA 1ASJ1 3D4KA 5EYXA 4WM7A 2HEYF 4QM9A 1RHI2 4GWIA 3SKJE 1HRI3 1FMD1 3IDBB 2AREA 1AR63 4IEOA 5FXWA 4Q0UA 1RVF2 3V0AA 5DTRA 2E31A 2VXJA 1AHSA 2VMHA 3LDBA 1VBC2 3GHNA 4ER7A 1UOBA 3THPA 4AE2A 3OEBA 3VBFA 4DEVA 2ZTNA 1O5LA 1W6OB 2FMDA 2BU9A 4QKNA 4BMBA 1OVPA 1PZ8A 1WMXA 1NERA 4ZXEA 1TNFA 1SDWA 2JD4A 5FK8A 4A44A 1NY71 1ZM1A 1J3QA 1UY1A 4WVVA 1QU0A 4YW1A 4CCCA 5C9AC 1RUG2 5FZGA 2YU2A 4P5YA 1JZ5A 1XBFA 4CEWA 1VRH2 4QDSA 5FXZA 2PXLA 1YHFA 1KJRA 2WIIB 1UOJA 4LHLA 4N43B 1SPPB 2A6YA 1Y4WA 5LBEA 5GZFA 1ZBA3 1HDKA 1MEC2 4K40A 1OA4A 3A9YA 4DXSA 1C1FA 1UN1A 3HNBM 3QOWA 1ULFA 1AL21 1W8NA 3CJXA 3OGJA 1S0IA 3E6CC 1Y3TA 4FPCA 4IEVA 1C8NA 4HKWA 4JGZA 2FD8A 3FL7A 4COVA 1O4YA 1GSLA 2PXJA 1NAEA 3AP4A 3DXUA 4IEWA 4IGOA 1AR72 3NMBA 4X6RB 5DDJ1 5KR7A 4DY5A 3LZZA 4W65A 5FLJA 1NZIA 2Q8EA 1VMFA 2PQSA 4LR4A 4LA3A 1PMJX 1F4AA 2ADEA 2WZPP 2F4LA 2OPKA 4EZHA 1QJFA 1V00A 2PTMA 1RHI1 2Y38A 5LB6A 3WNLA 4CP9B 1UX7A 2V3CC 3S5QA 2DVFA 2AW6A 3TRBA 1UYXA 4HRAA 4F7ZA 4N7UA 1S2BA 4WZFA 3DYOA 4HVOA 5A1LA 5EWSA 4K1YA 4AEDA 1RVF1 1SCRA 2QZ3A 4Q27A 4ATFA 3OOXA 5GZGA 1DQ6A 2BYVE 2RM22 1UMZA 1VBC1 2A75A 1AXYA 4NPLA 1S0DA 4QAWA 2F4PA 2WKKA 4CU7A 1J84A 1SACA 1CGPA 1W8FA 2YROA 3ZFEA 5FO9B 5L7OC 4PQQA 1WCKA 1D2QA 1ZBE3 1V70A 1GNHA 2HWE2 3R05A 4LO4B 1ODMA 1H2KA 3OUJA 1PVXA 2G1MA 3W20A 1RUG1 4XABA 1UL9A 2TUNA 1NG0A 1VRH1 1HIXA 2P3JA 3RDIA 4XOGA 5A6XA 1ND2A 5JMCA 1KFXL 2O14A 2DV9A 1ZRRA 2PAMA 1N3OA 4META 5FYUA 1MEC1 2A70A 2IXIA 1ZZCA 3UWPA 5FV3A 2PUAA 2X5IB 1RGSA 4IESA 1HB3A 1ULOA 3MIGA 3DEMA 1US2A 4GWJA 5GZDA 3U0ZA 3WG2A 3V56A 3KHCA 4QPGB 1W6NA 1WZXA 4XZUG 2I45A 3IZOA 4PCRA 3WNOA 2C9KA 5A70A 1OMIA 5F6LB 2VVFA 4O9EA 4M3CE 4H55A 3IMNA 1DFQA 2WO1A 5FYHA 1O3SA 4GA9A 1WUVA 4GB33 5JSPA 2EXKA 5CVRA 1CAUA 4M01A 5JMOA 3F2ZA 2RG4A 1AYM2 1JZ3A 1RUD1 1WD3A 3A0NA 5FTTC 1MS9A 1OQDA 1ZZ9A 4LHSA 3T3YA 2RM21 4AQSA 3O1TA 1JZ7A 2VW0A 3PTYA 4CCLA 1U2ZA 4IV3A 3KB5A 2ZMKA 3K2OA 4FFFA 3B02A 4Z59A 3DKQA 1YRZA 4ISRA 1UZ0A 3O9XA 2C26A 2CSGA 2OUJA 5FPAA 4AEKA 3I4IA 2DF7A 1SBFA 4ASKA 2GP5A 2HWE1 3NV2A 3NV4A 5K98B 3IDEA 1GR3A 3E5UA 4KWUA 5JOXA 2WNEA 2R30A 5FRAA 5FZFA 1GP4A 3VV1A 4JGYC 3UESA 3ZIWA 2QE3A 3OQNA 3DGTA 3WHTA 4UOJA 5T54A 2W5FA 3R1FA 1X57A 3BB6A 3C7GA 4IUGA 3FE5A 5FQ0A 1F4HA 4QXKA 3AJYA 3T30A 1VJ2A 2HEWF 4AF9A 1T6GC 4KU7A 5IK7A 3LKJA 4RHV3 1YFWA 4BQYA 5HCHA 4GWNA 4CUAA 1VBD2 2GC2A 3B9IA 3H1WA 4XAEA 5JXJA 1CAUB 1DLCA 2P3KA 4XJ8A 1G7YA 3KV9A 2CU5A 3NXHA 4LBNA 3ZXGA 1XQNA 3CECA 2Q4SA 3GZEA 5J3UA 3ZHIA 5LA9A 1CONA 1AYM1 1VPWA 3PMSA 2GMEA 2ARXA 2WNUC 3WF1A 2W95A 2JE7A 4L9BA 3NNFA 3U4SA 2W0XA 1SLCA 1AR93 1GNZA 1Y9GA 3FLTA 4OUEA 1LOAA 5FZ4A 3I2IA 3ZMOA 3NZLA 3ALQA 3VBRC 4AL9A 1POV0 1XC6A 1UMIA 2WYFA 2PXKA 1MS4A 2Y6HA 4W4ZA 5LY1A 4AFCA 1DGWA 3ES4A 4TLFA 2XL9A 4UWDA 1O5UA 1QP0A 1QHDA 1COV3 4FOQA 4UI9L 5FZ3A 3VHRA 4UT5A 2ZHNA 1XE8A 4Y24A 1EAH2 5HCBA 1ZZ6A 4K7JA 5JIUA 2Z4FA 5CFDC 3RZHA 2BPA2 5A3MA 2D3SA 2YU1A 4YG7B 3IB3A 1RTVA 2IVGA 2G9FA 5DTMA 1DZRA 1QQP3 1PK6C 4UFMA 4A3ZA 2ZGUA 4EE2A 1XB9A 3RZZA 2L9LA 3VDDC 1ZS4A 1RZRA 4DINB 2QKDA 4PU8A 1VAKA 4RGAA 3OPTA 4X4IA 4IERA 4NN0A 4JX0A 5CFCA 4QX1A 1PZ9A 2JDAA 3W21A 3LEIA 4K8FA 3ZYPA 5F2WA 4YG4A 4QGMA 5FLHA 3G5GA 2X8KA 5FYMA 3FFQA 4CU9A 5KHHA 2PLV3 4RSUA 4OI1A 5JCTA 1JI6A 2PAKA 2YYOA 3VBUB 3AKRA 1VPHA 3MV01 4DRVA 2O38A 1D4M2 3SXWA 2RS12 4XIOA 1UZVA 3D82A 2A7AA 5DUUA 5FP3A 1QPZA 4QX8A 1UZWA 3DXTA 2OKXA 2LRPA 1NCRC 4FTSA 2JXAA 5F5QA 3ACLA 1N3QA 2GRMA 4XYXA 4Y5SA 3VBOB 1F9KA 5FREA 2M4HA 3PU8A 4LBJA 2GZWA 4WVMB 1UO9A 3B7HA 5CA6A 1JZ2A 4BISA 4Q0SA 4P14A 1RUC2 3WP3A 1QF3A 3QACA 1EAH1 4NRMA 4AVTA 1LTEA 2LYQA 2BVBA 3SQOA 1SEFA 2K9ZA 1BHGA 4EV0A 2HLEA 4LBQA 2GN3A 4CA9A 4NAMA 4HL0A 4YNIA 4D8MA 3U14A 3VK0A 3UKNA 1DHKB 3UJOA 2IVJA 1PGL2 4CXXA 1TE1B 2PHXA 2Y6LA 1JYTA 1H0BA 4YG3A 1H1AA 2HWD2 4H7MA 3O0XA 3N7MA 3B94A 1H1IA 4URTA 2D43A 3I7DA 5IWFA 3T09A 4W6XA 2ARAA 2IXLA 5EJ1B 5F5AA 4OBMA 2HEVF 1LOFC 4XHBA 4YZ4A 4AHWA 4BXFA 1FPN3 1LULA 1FYUA 1I1EA 1VBB3 1YQ5A 4FPYA 4AK3A 4COZA 5T55A 4IEPA 3ZXLA 5C9AB 2FDGA 2YBPA 2JQEA 3GF6A 3IBMA 3PDQA 3VD7A 4NIHA 1D4M1 3EO6A 4XFFA 2QDRA 2RS11 3CQOA 5FZBA 5J98B 4DEQA 2D5VA 1PNGA 4HETA 3GCWA 1W06A 4ES8A 4Z8BA 5DAQA 4JRAA 3VD5A 1JYCA 1R1ZA 3VZNA 5FYVA 3LQXA 3ILNA 3NW4A 3WW2A 4XDQA 4P9WA 1KD7A 1Y9QA 1SLAA 3MI8A 2RV9A 1W28A 2CWMA 4YW3A 5KXEA 2A3WA 4DXTA 2CHHA 3A7QA 3USUB 3AVSA 1A34A 4INDA 3KCCA 3BIEA 3HIFA 4FPKA 3SNMA 3TELA 4EN9B 2CAUA 2PMWB 1RC6A 1SHWB 5J37A 1RUC1 4BQ5A 1QY4A 2J1VA 2R63A 3UJQA 2XG3A 1EYBA 4D7YA 3WXPA 5A7WB 1CESA 1OFSA 3ACGA 1AR82 2VZVA 3B5LB 3VWSA 1GV9A 4Y4YA 3UKVA 3OF1A 3W58A 2WA3A 5DN2A 5E8AA 2VNRA 1OBNA 1V6IA 3I2HA 1PGL1 4NHYA 4PU3C 4HANA 1JUIA 2D93A 2W39A 3VZJA 4AYUA 4QX7A 2HWD1 4QGLA 4YPJA 2J7WA 2R6QA 3R09A 1XNAA 3ZYHA 1LJ7A 1B35A 2JDMA 5FZ8A 3RFRA 3UETA 3S0MA 2FZ2A 1Z0HA 5G05L 3WNNA 3ZIXA 1PHMA 4A4AA 5BNOC 4E8CA 3H7YA 3WX5A 2HYKA 1K5MC 1FXZA 5JXIA 5L7OB 4IEXA 4Z92B 2BBAA 1C8M3 5IAVA 1GZWB 1QMJA 1X33A 2BWCA 3BPZA 3J4UH 3ZFGA 1S2EA 4PDWA 4NMIA 3LIGA 3W9AA 4DE9A 5E6HA 1RUF3 4QXBA 1WW4A 4OFGA 2NMNA 4PIXA 4J1WA 4E8DA 3KJXA 3GZDC 3EMRA 4CE8A 1NLQA 3G7DA 5CNAA 4AEMA 5IVEA 2VVDA 4XFCA 5DABA 4XPVA 2RS53 3OY8B 1RUE3 4LKDA 1QJY2 1S4CA 1UPSA 4BPZA 1YYNA 4QKBA 4DB5A 2XKOA 1K3IA 1JOPA 4MXWA 4RR3A 5EZWA 3VHPA 3WDXA 4XF1A 4TZDA 5DQ0A 4JCYA 3HEIA 3KL4A 3J7LA 1LEMA 2IVQA 1N3PA 4M3CB 4XUNA 3ZX7A 5FMOL 4BH9A 5FZOA 3FC0A 4DXRA 2XVGA 3JQWA 1XYNA 3NRUA 2VQUA 4GULA 3RQ0A 1HJFA 2VOXA 4OLLA 4D0QA 1OD3A 3POEA 5FPUA 5IVBA 2XPJA 1X82A 3DV8A 2UYBA 4M4PA 2JG8C 3AYEA 3D5OA 3KXAA 4R9CA 2VM9A 4OMCA 4PHZA 3T2OA 4DNYA 1A3KA 3CKHA 1ODNA 1NQJA 1GQPA 1Z78A 3K4ZA 3OYWA 2JG9A 3BOPA 4Q1RA 1MQTC 1V6LA 5A7PA 3DL3A 3NL1A 2UU8A 4XF4A 1MZ6A 1LGNA 1XOYA 4YM0A 1HRI2 3WOGA 1AXZA 2GC0A 1G8WA 1KEXA 3O5SA 4ITCA 4Y1XA 1JUHA 3ZSLA 4BDVB 5ABJA 4DY3A 3ACIA 1C28A 1UCXA 4JHZA 4MOAA 3LOIA 5A80A 3FYAA 3SMHA 3M9LA 3W5MA 3J7HA 4LK6A 3OGSA 4ZU4A 2EA7A 4JGYB 4MLOA 5A6QA 5I0SA 4YW7A 3ELNA 2VW1A 3B93A 4XJZA 2RDQA 1XRUA 1GWLA 1DP0A 1K5JA 4YW2A 4AW7A 4V1PA 2CGOA 4GH4A 2X05A 3ACFA 3F95A 5AC93 1WMDA 1A6CA 3N9MA 1QJY1 2EF6A 3P5BA 1UXCA 3HZIB 4LULA 4OCTA 4E4HA 5F5IA 2IUOA 1NE6A 4JDMA 2PUCA 1ZBA2 2HWB1 2RE9A 2V73A 3JQXA 2Q8DA 3BGAA 3GZTB 5LBFA 4GMP3 4XQ4A 2DWRA 3UKTA 1LHWA 5SV5A 4I6TA 1GFF2 1KDMA 2DDUA 1FX5A 1L7QA 3IAQA 2QBXA 3AMNA 3ZSEA 4AI1A 5FZ7A 2WNUB 1JYIA 1H2MA 4HPKA 5B2GB 3R4UA 5I0DA 4ZU7A 1KFUL 1S0JA 4I01A 2RMU3 1FOD2 3HBZA 3I59B 4CCEA 5ABJB 3VBRB 1POV1 4Q5OA 3USSA 3V64A 1UXDA 1UXZA 2JDKA 2OR1L 4ER3A 1CVNA 2OX0A 2WZR3 3I3QA 2Q8CA 5EIYB 4MCXA 2CGNA 4EKIA 2BNNA 1S0EA 4XW3A 2OVUA 1GWMA 2BUKA 3NKTA 3T4HB 5CFDB 5IVFA 1Z7S1 4OUMA 4GIQA 3ZVXA 5FUIA 3H7JA 5AVAA 2LNMA 3C7EA 2GH2A 2EAKA 4FPHA 3E6DA 4KG0A 3VUOA 1QQAA 1PK6B 2WS93 4QGNA 3AKQA 1LQCA 4XTPA 4IL7A 4HMZA 1L7LA 3VDDB 1ZBE2 3ENRA 1AUYA 1VB2A 3VD9A 3KGLA 2YPDA 3ILFA 1PMIA 4FXKB 1LESA 2VNGA 2XIUA 2IXJA 5JVVA 1IOAA 1PNFA 1XNCA 3CO2A 3BODA 4Y1ZA 3S6PA 4FBIA 5LA0A 3RZLA 2A6VA 1ENRA 4UW3A 3VDCA 4W50A 3BPSA 2UURA 4UW5A 1PIV3 1BZWA 3RWNA 3MIBA 1Q5OA 3FHAA 2W1QA 4HN1A 4AI8A 3UGHA 1CAWA 4F3JA 1YQ8A 2YV8A 3MICA 1VIWB 1QXRA 3RS6A 4A45A 4NVPA 1O4TA 4M4RA 2D6KA 1ULCA 3MHZA 1EPWA 2ZACA 3LEGA 1NCRB 1RZSA 4XURA 1X36A 3SC7X 2D6LX 3WDTA 1QEXA 4LIUA 4X4CA 1FOD1 3MUY1 1BDHA 4QPIA 5A3OA 3FN9A 4XQWA 5FKCA 1LKNA 3RGBA 3ZSKA 2ZKLA 4GB32 4KQ7A 1HRV3 2PXEA 1OPOA 2QQIA 3T08A 1N47A 2CNAA 3JD73 5KBFA 5JI7A 2XMLA 2C6SA 3ZSMA 2VCCA 1QIQA 4KGQA 4DXZA 1NT0A 4K6BA 3WDWA 4NWVA 4CCMA 3BKZA 2XB6C 1W99A 3R0RA 5F3EA 1UU4A 2ZPXA 3ZKCA 1JFSA 4M0NA 2LYRA 5AC92 4Q4V2 1OVSA 4Y4RA 1HLCA 1ZBE1 1W0PA 1FAYA 2GNMA 1LCDA 1H4HA 3FBMA 3ABZA 2VMCA 3OCPA 3R4SA 4LKFA 4O9GA 4XEZA 3ZKYA 1G9CA 1RINA 3KLSA 4UYBA 5D21A 2HFZA 2V4VA 1O91A 1H9WA 2C1FA 1YI7A 4SBVA 3CNAA 2PXUA 1CAWB 1E57A 4TSVA 5DUXA 3VBSC 2PUDA 3OWQA 4QD2A 4YARA 4RN5A 3B7MA 3RYPA 3SKVA 3PUAA 2OZJA 4FSJA 2AEZA 3U1XA 4YZ5A 1ALYA 4AI9A 2WT1A 1RUI3 4YWAA 3AP7A 3AL6A 1H9PA 3IKWA 4H7LA 4OZXA 1VAVA 1GQHA 4BK5A 4UFHA 1CD3G 4RHV2 5GLUA 1DQ5A 1WLCA 3DPRA 2P37A 3NWKA 4QPIB 2VGDA 5DAVA 1BLZA 2XSDC 4HN0A 2P5BA 4LOTA 3WQ1A 3K77A 5BXXA 2VMGA 4JV4A 3DUIA 3T1MA 2X09A 2G9ZA 4X6QB 5FYSA 2WABA 3K48A 4OI4A 1OLMA 5DG2A 5JIAA 5C7GA 4GB31 4P08A 1BDIA 3OPZA 2B8MA 2R0HA 5CZKA 1JYNA 3KZ3A 1I9RA 1V9U3 4D3WA 2B9VA 1STMA 1UU6A 2YGLA 1OHFA 1YXWA 1AR92 3RJRA 5C5UA 3O0WA 2ZA9A 3CLCA 4Q1PA 3EYPA 3VL8A 4QPYA 4AGGA 2R063 4MHUA 3VBHC 2H8RA 1Q8PA 4MUVA 4LUKA 3WINE 2GMPA 3VKMA 3H8OA 2N7GA 4PQ9A 5FY9A 3U75A 3F51A 1COV2 3BALA 4Q4V1 5C4WC 3ACHA 1XU2A 3LEMA 1JOJA 5BNPC 4PU7A 3MLFA 3QH6A 2DURA 2RDNA 2V72A 5CEHA 2GC3A 1LHNA 2VR4A 4BA6A 5IFPA 3WF2A 1LODA 3O0VA 2ILMA 2AXUA 5JR2A 2R043 1N1VA 2ES3A 2QFEA 1QQP2 5BNOB 4BWOA 5DSXA 1K5MB 3O1RA 2BW8A 2Y0OA 1L1MA 4COUA 5I8TA 1W6OA 5IW0A 2CDOA 2FMYA 2NZ9A 2LYPA 1XE7A 1YSEA 5E88A 4CCDA 5HV0A 5JOYA 5BY5A 3B01A 5C3RA 4QXHA 2CY6A 4RHV1 1QJU3 5A1AA 2E7QA 2UY9A 4WZCA 2E6VA 2QUOA 4YYOA 5JZGC 3OQMA 1SLTA 3RMYA 1LCLA 3APBA 3UNPA 4N43A 1JOBA 4PU4C 1OD5A 3MEPA 4AFMA 4BOWA 1ZZ7A 1SPPA 4K21A 1X7NA 2DUOA 1AL0G 4PF1A 1OOPC 2ZGRA 1FNYA 4YGDA 2JECA 3PXPA 2IZWA 4G3YC 2PXFA 1ZUGA 1W39A 2Q1ZB 1YFYA 3P3PA 4IV1A 3TN93 3WW1A 3AVRA 3KT4A 4QDQA 1JH5A 3CHXA 4Y1UA 5A3TA 5AFBA 1AR91 1SZBA 4BQ1A 2B46X 2VUCA 2L49A 1BCXA 3MO4A 3TRSB 3U11A 1IQAA 5C8WA 3LIHA 5DMYA 4CDQC 3U78A 2WO7A 1PO23 4IE6A 5ACA3 4Y33A 4P02B 4BQ2A 5C3QA 1W8WA 3CZJA 3K4DA 4UXAA 5FMOS 5LATA 1RXGA 1COV1 1DIWA 1T6BX 2JG8B 3HWJA 5T5LA 1OSGA 4CP9A 4E4DX 4GHJA 3LPGA 1JU3A 2VUJA 4NPMA 5JSRA 1QH7A 5FPBA 4CDUA 1CZTA 1OI6A 5FZHA 2WZEA 2XVKA 1U5YA 2PXTA 3VKNA 4B7EA 5FK7A 3MPBA 2VZOA 2LLVA 1QQP1 3D0JA 2XLGA 3IIIA 2HYXA 4MX3A 3UFDA 3B9CA 1R64A 2OW4A 4FOVA 2CDPA 3WDVA 1XXNA 3N35A 1ND3C 1UIKA 2FBEA 2A6ZA 3I54A 5JAXA 2BOJA 1VE0A 1F15A 2XLAA 4Z07A 4JRLA 4QKDA 1GT0C 2UWCA 3KCYA 3ST7A 5C8CC 2WQZC 2R072 3MZHA 3MIEA 1CJGA 1FPN2 1W3VA 5DZEA 4LO6B 1W05A 1VBB2 4IV1B 3IIAA 5JPMB 3O1PA 3ZYGA 4R8HA 1HXS3 4CP1A 2LUWA 1JTZX 2SLIA 5A3PA 4LITA 2EXHA 4L92A 1S0GA 4GQ7A 5DAPA 2Y6GA 2PELA 2O8OA 2X5IA 2XXZA 4XACA 5I8YA 3FJSA 2PXQA 1N1TA 3C3VA 1S7EA 5GKAC 4OHXA 1MZEA 2XDVA 1NXMA 3TEPA 2OS2A 4QPGA 1H8TC 2B45X 4KWLA 3GHMA 5FJKA 4Y42A 4O61A 2D6PA 3OKZA 3CROL 1QJZA 5EP9A 4BXSV 4FAGA 5IVVA 2DUQA 4CDUB 3WQ0A 2WZ8A 1NA1C 4KBBA 2C4XA 4QB1A 3E1F1 1VAMA 3ZOIA 1ZAYA 1O3TA 3KZ4C 2Y64A 2WWSA 2VBPA 3PVEA 4MO3M 4I2OA 4Z5HA 1HQNA 4EROA 1AYN3 1JYXA 2W1UA 1RL3A 2DCKA 4GALA 5DZGA 1ZNPA 3MBWA 4MVTA 1W9SA 4S2FA 3LFPA 1DYPA 2B39A 3O7OA 2ORXA 4YLZA 4XTMA 1DWKA 2LROA 1ZVVA 3JB4C 3U07A 4LO8A 3BVCA 3OQOA 1ENSA 4L99A 3ZN5A 4QQHA 4GD4A 5FPXA 2O0OA 2X29A 5K0UC 2ZAHA 2H0BA 1LOGA 3L1PA 3FFZA 2R071 2GH8A 5IK5A 1UYYA 1FPN1 2PHWA 3A22A 3Q9OA 2P3IA 2W92A 2QDNA 5DRYA 4URAA 4TLGA 4P00B 4AAPA 4CUBA 1NLSA 3NVCA 2JB8A 3U3WA 1AR71 1RUF2 1NCQC 2WINB 3NNMA 2BNOA 1KS5A 2Y0IA 2VMDA 4Y5Z0 1R083 3ZPYA 4LKEA 2MEV3 3HBKA 3T1LA 1GOHA 4NIDA 1JN2P 3JUUA 1KGYA 1R63A 2LW8A 2XVLA 5T5OA 3VHNA 4A42A 2H0VA 4OULA 4O8BA 3TYJA 1LGCA 2WIUB 2RS52 4EWAA 3MUZ1 1RUE2 1JXNA 4RA0A 5FYZA 2ZGQA 1CZVA 3K46A 5LRRA 3N7LA 3JU9A 4GJYA 4JVAA 4BM8A 1OH4A 5L19A 1VBA2 5HV4A 1MS1A 1UNBA 3LCPA 2PXPA 4B8EA 2VZSA 1PRVA 2VCBA 3J26N 2YC0A 2IUWA 4NJ4A 3Q8AA 4P9GA 2OUHA 4Y1VA 3BU7A 2JD9A 3H1YA 3IWZA 4UBGA 4XFIA 4F8AA 3POJA 1CPMA 4Q4Y2 4AQTA 4AVVA 3NAPC 4YBAA 4Q4W2 2WFF2 3J9SA 1GU3A 1ZYBA 1YI9A 3QH7A 4H2AA 1SMVA 4D6QA 5BNNC 4HVQA 1V6NA 3LPFA 3KSCA 2RS33 2GNBA 2E63A 2YBDA 5J48A 4IVZA 5TSWA 3OBAA 3ZPOA 2CSFA 1LEDA 2WLQA 3QWGA 5IJRA 1IPSA 4CCNA 4I0AA 4YM2A 1PM7A 2KM2A 5F32A 3T4VA 3WNMA 3ME2A 2XJUA 1WBLA 2J1AA 1IPKA 2PUFA 4AOCA 2VULA 2XWJB 4LO7A 2EVXA 1LMB3 4XIKA 2JDZA 5DRTA 4KL1A 5JDBA 1TMF3 2DVDA 3POGA 1MS0A 1HN1A 3PVOA 3ZXEA 2VXRA 4XILA 1RUF1 4ZS3A 5CBLA 1RIRA 4CPBA 4N53C 4ET7A 4XUQA 3VBSB 4R4ZA 4ER0A 4WM8C 5EPAA 5FY8A 4DUVA 1WCSA 2JKXA 3NQHA 1XYOA 2C5DA 3N3HA 1IS6A 3POSA 1UY4A 2RS51 2J22A 3DKWA 1YFUA 2ZHMA 2KR2A 2XCJA 2NN8A 4NHXA 3WHUA 4RFRB 1F8VA 3VBUA 1QNYA 5G04L 2XJQA 3H5TA 2G9GA 3VZKA 2K46A 3FUOA 1VBA1 3AFKA 2UY8A 4XETA 4QWNA 1YJKA 3M3OA 3BTYA 3EBRA 1MVEA 4CDWC 2W08A 3M3EA 4Q29A 4H14A 2JEMA 4BLJA 3VBOA 4Q4Y1 4NDWA 3JB8A 5FP8A 4RGGA 1U5ZA 2WFF1 4Q4W1 4QQPA 2P1BA 4MADA 1VALA 3L2YA 5FZDA 3HT2A 1IQDC 1SFNA 2WO2A 4WVMA 4Y22B 5FZAA 2RMU2 3NDBB 3DCQA 2RR13 4CCOA 3AKTA 3O1SA 3VBHB 4ARXA 3IPVB 2DYCA 3AM2A 2WJSA 1D7PM 4LBKA 1LCCA 2ICPA 1MS3A 4L11A 4XBQA 3SITA 4C1XA 5BNQA 2YHJA 3TAYA 2A5ZA 3KT7A 3L2HA 4Z82A 4CEYC 5BNPB 5FO8B 4FQ4A 2B9UA 1H2NA 3TBDA 4YGEA 4NIGA 5KHJA 1URXA 3HAGA 2HWF2 2ZGTA 3ATGA 5E89A 1OPMA 1OF3A 1VBD1 1WETA 4JCXA 4B7KA 3I2GA 3KHBA 5FP4A 2WS92 4JHTA 1ZVFA 2Y60A 2XH6A 2QQPA 1C1LA 2WNVC 4B3NA 1CR7A 2OFYA 1RJ7A 4Q8LA 5F3CA 3I3EA 5A32B 2Z5WA 5FOJB 2CL2A 2B42B 5I8SA 1HX6A 5FBJA 2HINA 5I93A 3E5QA 3PLQA 5AVPA 1LECA 2BVVA 5F39A 5LEKA 5T5JA 2LYJA 3OPWA 5C9AA 2EWTA 4GKXA 3ZYJB 3W59A 5JZGB 1PIV2 4HT1T 3TB0A 3WY6A 5F3GA 3SH5A 1U5IA 2CWSA 2XJVA 1R1A3 4K8RB 4A41A 3Q8FA 4FPJA 4GMP1 2PHLA 1DCSA 3B00A 4LPLA 4TN7A 1AL23 2VD7A 3VDAA 4HBNA 5KXBA 3AP5A 4QX0A 4LORA 2MNGA 4LTAA 3SCGA 5DPNA 4FFIA 5C33A 3CJIC 5IFTA 2CGPA 2AACA 3USUA 4CCKA 2TNFA 2YFZA 2WO3A 4LJHA 4X4FA 2WAAA 2WL1A 4AVSA 2X10A 4AEJA 4DZGA 1CQ9A 3MIHA 4CDQB 4XJWA 2HWC3 4NAOA 1NXD1 1OKOA 3RZMA 4IXLA 5A7WA 1HRV2 4ONUA 3NKGA 1LU2A 2Z42A 1KJLA 2J1EA 3JD72 1H6XA 4NPRA 3JBG3 2BRTA 5SV8A 2FFHA 3H0OA 3O14A 2JCGA 1AX0A 2HWF1 2W46A 4E2SA 1GWKA 1HV0A 2R1BA 5DUWA 4AI2A 5L36A 5DT2A 4UAPA 3H3LA 1BBT3 2WS91 3AMMA 4TXWA 4AQ2A 1UY2A 2KXLA 2R1DA 3RNSA 3SLIA 2VTXA 4HK8A 1ND3B 4CZSA 5L7OA 1H30A 1E5IA 1X8EA 2JDUA 3ZR6A 1UOFA 3HJRA 1UKRA 4P5HA 4UFJA 5CIRA 1UZYA 1GZWA 2DBNA 1GLHA 2ZGPA 4QQOA 4B4QA 4E2GA 5C8CB 5FPVA 1GZTA 1VBE3 3LDRA 3M4FA 1L3JA 2HSGA 4YVWC 3CEWA 4HOOA 2E26A 1PIV1 4C90A 3WQBA 3K75B 3RZJA 2AUYA 3PURA 3FHIB 1MEC3 1RUI2 4KWKA 4MXVA 1REDA 2PAEA 1DLLA 3HNYM 3AYAA 3OY8A 4AXOA 5FR3A 2VMFA 4HLTA 5FBZA 4QKFA 1DW9A 3VB9A 2V4AA 3PNAA 3OGRA 2ZGLA 2HBTA 4FFHA 2ZJCA 1W8TA 3AX4A 1V6JA 3OG2A 5FYIA 4EKGA 1H8TB 2D6OX 1JYVA 1J3RA 4LHKA 5FYBA 3O1VA 1SLLA 2WT0A 4M3CA 2EF8A 1QKQA 3I97A 4GJZA 5FZ1A 1FNZA 1NA1B 5EYYA 3HQUA 2XJ3A 4J1XA 4AHZA 1OLRA 4JKMA 4M3CF 1YIFA 3AZYA 5D1IA 2DCYA 1V9U2 1XYPA 3JD71 2HCNA 1AX2A 1WMFA 1RUD3 3QQ6A 2IC1A 2B4KA 3QLQA 4D6SA 2JDHA 4OI2A 1O4XA 5L9VA 2R062 1DYOA 4JC1A 1CX1A 4FOWA 3RI8A 1SBDA 2HKXA 4UFLA 5FP9A 4FI9A 2PHTA 4RQPC 1NE4A 4F8DA 4QQLA 1XNKA 2VU9A 3PTRB 1P8JA 3CBNA 3OTFA 4DS0A 3J7NA 2WBKA 3M3IA 2DFCA 5K0UB 4NE9A 5A3WA 4QM8A 5LY2A 3AXEA 2OPWA 5FZ6A 4ZU5A 2IWGB 3QCWA 4ZXKA 1UOGA 1LU1A 3ETQA 2AWIA 5HCFA 4BIFA 4AVCA 4JGYA 1DGRN 3O1OA 1JMUB 1QJX3 5GLZA 5IHRA 4XUOA 1UTXA 4FN3A 1X8MA 5IK8A 4JQDA 3NV3A 4Q4X3 4A7KA 5E1RA 1NCQB 2DUPA 4XXPA 2W87A 3IM0A 1QJU2 2AENA 4Y20B 1C5IA 4QU2A 4XXAA 3U4XA 2VBBA 3HD8B 2LM3A 3I3BA 5FXVA 1AR81 1QDCA 1NOVA 4IGQA 2PXVA 5F6KA 1ZZ8A 1IS4A 1KS4A 3FBYA 1OLME 1BVP1 3DYPA 3RMXA 1UXXX 1UIJA 5ANNA 4I6RA 2ID4A 1OCTC 3TN92 2WNOA 3ZDSA 4MG2A 2EIBA 1V9U1 3M7AA 4IEYA 5LK7B 3THDA 2WNUA 3A21A 2AC1A 4CDXC 3MV11 1W2NA 5I0TA 2R061 3R4DB 1IG3A 1SLIA 3MF9A 4EZIA 1Q8VA 4EK9A 1SQ4A 5ACA2 2GAUA 3POBA 1AR62 3I59A 4RD7A 3NAPB 3VBRA 3VL9A 1UPIA 1WMEA 2VZRA 5BNNB 2WAOA 4YZ3A 3ZFFC 1HB4A 4YVSC 1GQGA 3BUCA 4RS5C 4CYDA 4EN8B 4PI0A 2DTWA 2ZKNA 3PVNA 3S57A 4BMEA 5B4XA 2Y34A 1XNDA 2W91A 5CFDA 1RMU3 4K1ZA 4QQ2A 2EXJA 1Y7BA 2B5AA 3D6EA 3GCXA 2WN2A 4R9DA 5F5CA 5GJ6A 4B4PA 4XBNA 4BQXA 3IMMA 1PK6A 2Z69A 5C6CA 1YFXA 3N4MA 3F52A 2DCTA 3AB0A 4FO9A 3VDDA 3LFIA 4YRDA 5ISLA 4Z1VA 4N53B 3W5NA 4UW4A 1SFYA 2FDHA 1R69A 2J1SA 4WM8B 2W1SA 3IDCB 5FUPA 2DVGA 3VD3A 5D8AC 1IKQA 1E5RA 1N1YA 1QOSA 3CLPA 1SFPA 2R32A 4Z2WA 3OBZA 5C5TA 2CAVA 3A9ZA 2CV6A 3KD4A 3K3NA 2YC2A 2PHFA 3LDKA 2D3PA 4A7ZA 2A73B 4WM7C 1DGLA 3SISA 3CF6E 4ZZ5A 5LRSA 1YWKA 1BEV3 2E32A 4D6RA 3H8XA 1ZRIA 1VMJA 1GZ9A 1HQWA 4Y1YA 3DYMA 1BKZA 4CDWB 3LOBA 1X2LA 1NCRA 3KVAA 2VCMA 3AMQA 1HRI1 3EB7A 3HPNA 3MGUA 3N36A 5ACA1 2PPXA 3T0DA 1AR61 2ZZJA 4QX3A 4I0WB 3BCWA 4WV8A 3VBFC 3CDZB 1SLBA 3MLJA 1AYN2 4IE0A 3OB8A 1H1MA 1NKGA 2W2IA 1AJKA 3SH4A 1RPEL 3ME5A 1TVGA 2NP0A 2A71A 2ET7A 3N7KA 1O7FA 1ADRA 1JHNA 2IVIB 1ZRFA 3SH3A 4YW5A 4CEYB 3OMTA 3CL1A 4C0HA 4CEWC 3H8RA 4KMQA 4FOYA 5FZ9A 2R0FA 2LCVA 3WNXA 4ISQA 3C8XA 3V0BB 3GUUA 1IPJA 4FPFA 5CKMA 1WA6X 4YM3A 2YDEA 1ZBA1 3NJVA 4FTBA 1F5FA 1WD4A 2XQRA 2VOVA 3I2OA 1PNRA 2WNVB 3AXDA 1PRAA 4JGZC 4IWRA 4S2GA 1LOFA 4A3XA 2CYFA 4D7TA 4BJ0A 3EUSA 1Q8QA 5JPNB 4O65A 4YG0A 2ETEA 1WIZA 4TYSA 5EXOA 4GQMA 3THCA 1LHVA 1R082 2WC2A 2MEV2 2E7AA 4LO5B 2Q1MA 4OHZA 1QQBA 5JOZA 4XF3A 2A6CA 3AP6A 4XUPA 1SQ8A 2IXHA 5CISA 2XBO3 2ZMNA 4AEDC 2P17A 2PHRA 3DN7A 4UFKA 3KGZA 5B4NA 2AEYA 3FLPA 2OIIA 4E2QA 4OQ8A 3CJIB 1CJPA 4COWA 5LCWL 1NYWA 1OLQA 1EV13 2IVBA 4XFAA 3ILRA 4R4XA 1RUC3 4JZRA 5L9RA 1W8OA 2GZUA 4RGKA 4OQ9A 2FCVA 1AYN1 2WT2A 3MFAA 3ZFEC 4IE7A 3NO8A 4B29A 1TZOA 5LA1A 1TNRA 3ZN6B 2I74A 3FYMA 4X4BA 3FMYA 1EP0A 3PMEA 4CP0A 5FZEA 5CKQA 1UD1A 4PBOA 4P9IA 1O6UA 2RS32 4FP3A 3OGGA 3INAA 4JQTA 1ND2C 4NRQA 3S7EA 1LGBA 4N7IA 1YJLA 2HWD3 3AZZA 4XFHA 1AU7A 4X8PA 1JZ8A 1O3RA 2MEZA 1CAXB 2IU7A 1O8PA 1EFAA 2VC9A 4AFDA 5J09A 2A3YA 2PYTA 5FY1A 3PIGA 4ZONA 2KA3A 3RYKA 1XU1A 4DRRA 5BNOA 4QX2A 1K5MA 1TMF2 2AUWA 1BQPA 2VPVA 1GUIA 2J42A 5H9PA 4BK4A 2VZPA 1R081 4HKOA 2MEV1 5AFEA 4YVWB 1U12A 2G19A 4YZ1A 4PJYA 2CTVA 4AVBA 3GZDA 1GZCA 3N7JA 4YSFA 1J1TA 3RZGA 4P9LA 3KQRA 1XWRA 2WA4A 1UQXA 4NHMA 2E9QA 4B4RA 1JBCA 1OA3A 1RUJ3 2Q1FA 4CPBD 4DUXA 5HPOA 3NROA 2XR4A 4LHNA 3GN5B 1JS9A 1JZ4A 4AGRA 4IV3C 4XJUA 5FYTA 5FDBA 4CXYA 4NROA 4MGZE 4EN7B 3H9AA 3RI9A 4Z2AA 5JXHA 3WCRA 2Y33A 1PO13 2YC4A 4JCKA 1J59A 3GNEA 5IVJA 1OH3A 5F7UA 3BDNA 1GKBA 1VP6A 1W6QB 1J1LA 2L1PA 4OB4A 1BMV2 4Q0PA 1W9YA 2RHPA 3CZUA 4ZZ8A 3WF4A 3EXUA 1US3A 1MVQA 1U5XA 2RS31 5A33B 1DDLA 1GNYA 5KHIA 2ZGOA 5FY4A 4B1LA 1QB2A 2JG8A 4Q2FA 3TEXA 2RR12 2R16A 5JWPA 3KS7A 4X8NA 1DQ0A 1H8VA 1L7RA 1O59A 1XNBA 2DTYA 2Q30A 5A7OA 5IAXA 5EJZB 1IS5A 4X4GA 2NMOA 1MQTA 4UF0B 2E51A 1J58A 2VUAA 5GM0A 5IVCA 1LB2A 3GYDA 1X9PA 4RQPB 2WR9A 3PIJA 4X4EA 4KNCA 5ERLA 4BQWA 1ULEA 5CAZA 5LBBA 5JXGA 1ONAA 1TMF1 5LK5A 4S2DA 3UT0A 3QOXA 4DO0A 4Q8KA 4OZOA 3N9PA 3O1MA 1XSRA 1W6MB 3GZUC 5HCAA 1UMHA 4NIIA 1SCSA 4LXLA 4Y26A 1MZ5A 2PLV2 4JDOA 1RZRD 1KRIA 3ON7A 4Z5DA 5KXCA 3TFLA 4PT6A 4GMP0 1KITA 1W8ZA 2VG9A 2D6MA 2YB7A 3PL0A 2XI8A 4IQPA 4MHRA 4PLNA 3JCIA 4M00A 4AGVA 1GYKA 2K0GA 5EQUA 3DM5A 1H2LA 1VR3A 5FJHA 4NWWA 5C3OA 5LW9A 3Q8CA 1ULPA 1CX4A
chains in the Genus database with same CATH topology
2XUMA 3NJZA 4AVAA 2I2SA 2VH9A 2PUBA 3TWIA 2HWB3 1R1A2 2VY0A 1UAIA 1Q8SA 1Q8OA 4XHXA 3POWA 1ZRCA 1DF0A 2VNOA 4JDNA 2E53A 1PRUA 3JXCL 1Q3EA 2WFPA 3D0SA 1GBGA 1MQTB 4FPOB 4WVZA 4HSLA 2LTNA 2XJTA 4CDXB 2RR11 3FMGA 3HMYA 2MHFA 3M2MA 1POV3 3LSDA 4HFSA 2D3RA 1POUA 2HWC2 3KM5A 2YGMA 4I30A 3VZLA 3RJ2X 4KWJA 2ZX1A 2KPJA 5CFCC 3ZFFB 4YVSB 4RS5B 3M3CA 4D69A 4FTEA 1EY2A 3JBG2 2YZ4A 3VLBB 3LISA 1KXGA 1Z7S3 1G86A 1UF2C 4LBLA 4LBQD 5GALA 3J8F3 1QH6A 4NHKA 3TNPB 1YUDA 1BBT2 1G9BA 2PLV1 2ENRA 4DFSA 4E4SA 4AG4A 1KDKA 2ZX4A 3BTAA 1DQ1A 5KC5A 1A8DA 1NLRA 2ZGSA 1HW5A 4XQDA 4R9AA 3ZYRA 1A8MA 4MGIE 4IEQA 1VBE2 4HVRA 4QMAA 4U36A 5D8AB 4IEZA 1F2NA 4K20A 1OQEA 1LRHA 4LEJA 4QHBA 4PLOA 4Q0VA 5A7LA 1R1A1 2W68A 2UWBA 2L8NA 3MLKA 2VQ0A 4IA8A 5FFOC 4WM7B 1OSLA 3WT3A 2Y26A 3VKLA 4FAHA 2PIJA 2AYHA 2DU0A 2EIGA 3VKFC 1FOD3 3EJKA 5GLVA 3WVJA 1WLDA 1QXJA 1CAVA 3V0AB 3IVPA 2HWC1 4ATEA 3H3UA 1PGSA 3C2UA 3VBFB 2QCSB 2YY1A 1RUD2 1TEIA 3JBG1 3VHOA 1VB4A 4WVWA 1Y43B 2V5YA 3OD0A 4C1WA 4HSJA 2WLPA 1BBT1 3SHRA 2VECA 4CTEA 1C8M2 1VBB1 3FX3A 1G9DA 2YMZA 1GANA 1D0GA 4FT8A 4JTNA 2WUSR 4CEWB 1UW8A 1RB8G 2Q0AA 2NYYA 2BJCA 2XL7A 4AWDA 2BWAA 5DUVA 1KQRA 1VBE1 3MF6A 1Q56A 3H3ZA 1RIOA 4LT5A 1LR5A 4JGZB 4X4DA 1QJX2 1AZDA 3VBSA 2A6XA 1I5ZA 2BFUL 4N90A 2K2SA 2XGXA 4Q4X2 4WBBA 5T3NA 4QX5A 1MR5A 1OQ1A 5E16A 1CAVB 4MCTA 3K51A 3WP4A 3POYA 3AFGA 3EHKA 3CU7A 3RPQA 4N9IA 2DVBA 2TEPA 4AEDB 4AI0A 1CIWA 1TME3 1LOEA 3D1NI 4BIOA 5J7MA 3MIDA 1BK1A 5I91A 2PA7A 1C4RA 4P9JA 1WW7A 1WW5A 4EN6B 1B35C 2TBVA 4NO4A 1W0OA 2QNKA 3ZFEB 2H6CA 1O3QA 2AXVA 4Y22A 2NLRA 3ZFGC 1HQLA 2RJLA 3AZWA 1PERL 5H9SA 4PDWC 4D7SA 4YG1A 1C8M1 4DQAA 2PN5A 3VBHA 3IPVA 1BJQA 1DZQA 2GMMA 3HN1A 3ECQA 4Q4V3 2ATFA 2XJSA 3KMHA 4I09A 1ND2B 1WW6A 5EV7A 5C4WA 5IK4A 2AZ5A 1YCIA 5BNPA 1FV3A 3O12A 4S2HA 1JW6A 1RMU2 2D7FA 5KC6A 1ENXA 3URFA 1ZPQA 4OVEA 2O4AA 4UW6A 1QDOA 1R093 5DXDA 3A4UA 2B5HA 5AC92 1PVC3 5BYNA 2GN7A 1RUE1 1QJX1 3QOPA 4XMAA 4BYYA 4RR3C 2GU9A 3RG0A 4FXGB 4I3PA 4Q4X1 1W6NB 1RUH3 2Z79A 5A32A 1MS8A 1RUNA 5F9TA 1VLNA 1OA2A 5FPZA 2F6BA 1S1AA 4YZ2A 5JZGA 2RJKA 4ORFA 1LHUA 1V6KA 3WCSA 5HBAA 4KG8A 1OOPA 2JG9C 4M0HA 2ZGNA 4IV3B 1BEV2 2I07B 3GBWA 3WW3A 4XE9A 2ZOEB 4FVVA 4K3UA 1ASJ3 1QXPA 2Z2SB 3WQ7A 2WZR2 1U0AA 3WG4A 5ABJC 1S55A 2JE9A 5C4WB 1FMD3 1M4WA 3WZ1A 4LUMA 4OHYA 4CDQA 4YG6A 4E9KA 4YGCA 3SCFA 5KWRA 2GALA 1S0BA 2D97A 2O1QA 1I3HA 2ZAAA 4SLIA 3MPPG 3RYRA 2IFWA 2NPIA 1RMU1 4GH4C 2PUGA 2XJPA 3WLUA 4YM1A 5FQ0B 2YPJA 5F1RA 2ARBA 3LB9A 5AC91 3MW3A 4FPGA 4XBLA 1AF9A 3THTA 3AMHA 5EFUA 2AR6A 4XF0A 1ND3A 3ZXAC 3QF3A 3WUCA 2JENA 4JTOA 3E6BA 2ZS6B 1MS5A 5EJ3A 5C8CA 5I0RA 1ZZBA 3M3QA 1OOPB 1WCDJ 5CU1A 5GLTA 2QJVA 4RFT0 5JSOA 4YFWA 1WBFA 1WA4A 3H8UA 5DDJ3 3TNQA 3HR9A 2EBYA 1CPNA 4FP2A 5BUVA 2RMU1 1BEV1 3AJZA 4PBPA 4R52A 4XFBA 3ZXJA 4X4HA 2OA2A 3LSEA 4QT6A 4XJAA 2WZR1 1RHI3 3OBRA 4C0BA 1D4VB 1IGOA 2XBO2 4I0BA 1ZX5A 3WG1A 2JVLA 3AZXA 1H8TA 2PUEA 1EV12 1OKQA 1RVF3 5GLWA 5H9RA 2D98A 2ZX0A 1NA1A 1VBC3 4COYA 2KEKA 1RJ8A 1UU5A 2BEOA 3MFCA 5GZEA 5CFCB 4H3WA 3IN9A 2ZABA 2PFWA 3BIWE 3PHMA 1DZTA 3WP6A 2KEJA 1F31A 1RUG3 3QBQA 2G4IA 1BVVA 1VRH3 4DOUA 3VZOA 5K7PA 2JJ6A 1W2UA 5K0UA 4NOTA 3FZ3A 2R073 5I0UA 5KHKA 4OHWA 3WV6A 1HV1A 4AFAA 5FO7B 5CG9A 4U2AA 4XF9A 2C9AA 4Z5CA 4PIZA 2OYZA 3MW2A 1AR73 1Y7YA 1C3HA 4GKYA 2DCJA 2XLFA 4QPIC 1NCQA 4Y20A 1DYKA 2BBVA 4BE3A 3D8CA 1UZZA 5JR7B 1APNA 2IV1A 2FZ1A 5CB7A 1HRV1 2AGSA 4FPEA 2XBO1 1AXKA 1CQTA 1RUJ2 2NM1A 2ZZQA 2IXKA 2MPFA 3ZN4A 3RRDA 1A78A 2IFRA 1EV11 3LGRA 4LBQB 2XHKA 2RM23 1QOOA 3H50A 5DZFA 3ZYIB 1PO12 4AHYA 2XJRA 2LYLA 2WSUA 1B09A 3ASIA 4MV2A 4BZ4A 4Q0QA 2HJIA 1ENQA 3SCHA 3B3QE 5JOWA 4I8TA 5FOBB 1DG6A 2A6WA 4IETA 2C0ZA 2D6NA 1WLTA 2HWE3 4PIYA 4YGBA 4DNYA 3NAPA 2NQYA 4L2NA 2VVEA 3AKSA 3AZVA 5BNNA 2R042 4Q26A 3S8QA 2PE5A 1WLWA 1RUOA 4LA2A 2E7TA 1RUI1 4LLFA 3FUQA 3DPRC 3BD1A 2ICTA 1DQ2A 1AVBA 1DGWX 4LE4A 3GBFA 1LLIA 3MIFA 4N9HA 1V6MA 4ZKTB 4N53A 1N1SA 2ZMLA 1FT9A 2UYAA 4WM8A 2O49A 4P9XA 1REEA 2QVSB 1IHMA 2EXIA 1FV2A 1TQ5A 3LAGA 5CG8A 1RUJ1 1AYM3 2BFUS 1PGW2 3S30A 2ZGKA 3MW4A 3QYXA 4AI3A 1G9FA 5DG1A 1VBA3 1I6XA 4G9SB 2HWB2 1PO22 1PO11 4DPNA 2D5HA 2FQPA 4CDWA 3X29B 1JH9A 1QP4A 1C5HA 4Q4Y3 2ZX3A 4Q4W3 2WFF3 3VZMA 4LE3A 1B35B 3H1MA 4CP2A 2R041 2PHDA 3ZFGB 2AH2A 2PHUA 4PDWB 5J36A 1OFNA 1W6PA 4PF5A 4EWEA 1MZFA 3WD5A 3VN4A 1QJU1 4I02A 1ZA4A 1Z7S2 4MSVA 4CEYA 4AFBA 2Q8OA 2LALA 2IXCA 3J8F2 4R9BA 1VBD3 3E97A 4N43C 3JZVA 3WP5A 4E2QA 4RL7A 1FI2A 4BCUA 3V0BA 1NQDA 4HKLA 1HXS2 4MXWB 4RR3B 3P3NA 1HF0A 3AYCA 4IEUA 4IV1C 2WNVA 4XJ9A 2GSYA 3TN91 1G6NA 1AX1A 1WGPA 2YXSA 3KT1A 1IC8A 5FLIA 3ROUA 2VOWA 4MH0E 2JX9A 2ZX2A 1JWLA 1PGW1 4GXLA 4AQ6A 2H6BA 3AK0A 3IT8A 3BOWA 3FWEA 1PO21 1EPZA 3GALA 2GNDA 2ZGMA 4ES9A 1Q43A 5KXDA 3WUDA 4XFGA 2LYKA 1C57A 2BTVC 1J3PA 3OYWB 4LBMA 1UX6A 2JG9B 2VW2A 1EAH3 4CDUC 1BYHA 3MLLA 3CJIA 1W6PB 2MQKA 4BHPA 1QGLA 1MACA 4KGGA 2GC1A 2P34A 4JQRA 2ZBJA 3LA2A 3ZN6A 1YIPA 2JKBA 4GWMA 4OUSA 2D40A 3ES1A 5IT6A 2ZHLA 2HWF3 2UWAA 1UKGA 4NR1A 3B69A 4W6YA 3J8F1 4GH4B 3OBTA 1B0NA 3OJBA 3PJQA 2P2KA 4HK9A 4YW4A 5FAXA 1CAXA 3WDYA 1HXS1 1S0CA 5GZCA 2XKPA 3ZXFA 1D4M3 2X5IC 2AXZA 2RS13 5HI0A 3AP9A 1NEQA 3JXDL 4FBFA 4L97A 1M06G 4QPGC 3AKPA 4NHLA 3U10A 2FJRA 1E3OC 2ZCWA 4TWTA 2O8QA 4YVWA 4C91A 3A0KA 3UV9A 2FHRA 2KZ8A 4HPKB 4A2UA 3ZSJA 3JXBC 1IZ3A 2EAAA 2SBAA 4MGKE 4BLIA 4AHXA 3G6JB 5T50A 3EQEA 1DGRA 5CADA 2GNTA 4LNVA 4LLOA 5BV6A 3NSTA 2ERFA 1FATA 1V6OA 4J6GA 4EWDA 2D44A 2R1JL 3M1HA 3GN5A 3HT1A 1S2KA 4ASMB 5LEJA 1TME2 1SBEA 3UK9A 1BXHA 1QWRA 2Q5TA 3DNVB 3I8TA 4LBOA 1W6QA 1WH8A 4E4ZA 1JFTA 4E27A 3AMPA 3LA3A 5A33A 4EN0A 1YLLA 1HKDA 3OP9A 3RSJA 2DFBA 2BQPA 5BPXA 1DQ4A 3WW4A 3WG3A 1LOBA 3HQXA 3KCXA 4UBHA 2A3XA 4KH9A 4I6UA 4MYEA 2D5FA 2BGCA 4RQPA 4K9SA 4I3GA 4F83A 2B7YA 5JI9A 2VMIA 2JICA 3MDPA 2YUEA 3F6WA 1R092 1RITA 1REFA 1D2SA 1QP7A 1PVC2 1W6MA 1ULDA 4A7YA 3E5XA 2GRLA 4OHVA 1PZ7A 5HXVA 3S7IA 1RUH2 3M8LA 1S0FA 2R49A 2CROA 3ZHMA 1YO8A 3OD4A 3BS3A 1NZCA 2DU1A 4FPLA 3R6SA 1AR83 5T52A 1X50A 4HZFA 1AJOA 4D94A 3WDUA 2VQAA 1TME1 5JLVA 1G9AA 5K9YA 3PVBB 4L8QA 2KEIA 1YNAA 1DBNA 3DF0A 1IS3A 4OI0A 3NV1A 1ASJ2 1LOCA 2OZ6A 1WH6A 4G4FA 1D0HA 2DVAA 3M70A 5T5PA 2DCZA 2EALA 1LHOA 3UL2A 2WQ4A 1FMD2 4CDXA 3LA7A 4PLMA 1GICA 4Z58A 2WSVA 3MYXA 3T2TA 1LENA 3FLRA 2PQQA 3VKOA 3ZO0B 2VOKA 3ZFFA 2V09A 5K8SA 4YVSA 5IUQA 4RS5A 1F5JA 3PJYA 3ZXDA 1IKPA 1ZREA 5H9QA 1R091 1H4GA 3LWCA 1NY72 1PVC1 3VBUC 3DPRB 4JAAA 1QJY3 3GBGA 3I2DA 5KHGA 1CJDA