3SCFA

Fe(ii)-hppe with s-hpp and no
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
193
structure length
193
Chain Sequence
TASTGFAELLKDRREQVKMDHAALASLLGETPETVAAWENGEGGELTLTQLGRIAHVLGTSIGALTPPAGNDLDDGVIIQMPDERPILKGVRDNVDYYVYNCLVRTKRAPSLVPLVVDVLTDNPDDAKFNSGHAGNEFLFVLEGEIHMKWGDKENPKEALLPTGASMFVEEHVPHAFTAAKGTGSAKLIAVNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of regiospecificity of a mononuclear iron enzyme in antibiotic fosfomycin biosynthesis.
pubmed doi rcsb
source organism Streptomyces wedmorensis
molecule tags Metal binding protein
molecule keywords Epoxidase
total genus 43
structure length 193
sequence length 193
chains with identical sequence B, C
ec nomenclature ec 1.11.1.23: (S)-2-hydroxypropylphosphonic acid epoxidase.
pdb deposition date 2011-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 3scfA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3scfA02
1R69A 1XWRA 1ZPQA 1GQGA 2BYVE 4I0BA 3LA3A 2WIUB 1J3QA 4YARA 3RNSA 1QPZA 1O3RA 3KZ3A 4JCYA 1CAXB 4Y42A 5I8YA 3OQMA 1OFNA 1FXZA 1L1MA 4HVRA 4MH0E 3WW3A 4PU8A 4IEUA 3FE5A 2JVLA 4MV2A 2O4AA 1SEFA 2GC1A 4L11A 4X4DA 3KXAA 3QQ6A 3S8QA 3LZZA 4J1XA 1QY4A 1LKNA 2E9QA 2IXLA 1YFXA 5I0SA 4R8HA 2QDRA 2OFYA 4JCXA 2KEIA 3C3VA 1WLTA 4E2QA 2EF8A 3IDCB 4IEPA 2BGCA 5K98B 2XSDC 3ETQA 2IVBA 1Q5OA 2D40A 3CROL 1YUDA 4Q0PA 3WW4A 5C6CA 4MGZE 3ELNA 1DWKA 1RUNA 3NW4A 3PVBB 4META 1RGSA 2CV6A 2I45A 4JVAA 2GZUA 5FLIA 3KSCA 2PUBA 5BPXA 2EAAA 1H1IA 1H1MA 1DW9A 2WFPA 2LYJA 2OR1L 4OLLA 1BDIA 2UYBA 2LYRA 1ZZBA 3OGJA 5I0TA 4MZUA 4NVPA 3OD0A 3EUSA 2ZKLA 3BPZA 2MPFA 2CAUA 4E2SA 2BJCA 1UXDA 1PERL 4QM9A 2H0VA 3H1MA 4Q0SA 1WH6A 3UKNA 3ZDSA 5KHGA 3OQNA 3JZVA 4OFGA 4QX5A 1FI2A 2PUGA 2GAUA 4ONUA 1OI6A 4HSJA 4AXOA 2CROA 2WUSR 2MEZA 4X6QB 2D93A 3FWEA 2PFWA 1X57A 2R1JL 2KEJA 3FX3A 3WW1A 1QXJA 1UIKA 3IWZA 1ZREA 2XGXA 3GBFA 2IXIA 3UKVA 1IC8A 2O38A 2HKXA 2PAKA 2VPVA 2IVQA 2XL9A 3U3WA 1UD1A 2QVSB 3RZZA 4JV4A 2PAMA 1CAUA 4NDWA 2PA7A 3O14A 1NEQA 3LOIA 2HINA 3UFDA 3G5GA 2OPKA 4UBHA 3LAGA 4LA3A 1X2LA 4BHPA 2C0ZA 3E5XA 3KCCA 2OA2A 3CEWA 5LEKA 2EA7A 1RPEL 2PUAA 4E2GA 4IEXA 4IWRA 2Z2SB 1ZRFA 3CLCA 3FJSA 4F8AA 4HBNA 1ZRDA 2LYSA 4Z5HA 3VK0A 2KPJA 2V09A 5FPXA 1VPWA 1NZCA 3DNVB 1PM7A 4QMAA 4FBFA 1HF0A 2H6CA 1JH9A 1LB2A 2K0GA 3KGLA 1ZVFA 3QF3A 3OCPA 1R63A 1HW5A 3SMHA 1Y7YA 2LCVA 4LA2A 2EBYA 3FYMA 1WH8A 5J3UA 3B7HA 4MUVA 1AU7A 1V70A 4PJYA 4KWJA 1YHFA 4BH9A 3E6DA 5FDBA 3ES1A 4P9GA 2XIUA 1LQCA 3BDNA 3E6CC 3OMTA 4IEQA 3SXWA 2IV1A 1ZVVA 1ZZCA 2Q1ZB 4QGLA 2R63A 4QXKA 4IEYA 3CJXA 1Q3EA 1YFUA 5KHIA 1WIZA 4XFAA 3FYAA 1X7NA 4B29A 2Y0OA 4AQ2A 2UY9A 4AVCA 2N7GA 2BNNA 1J3RA 2GH2A 1CAWA 3RYPA 1LCDA 2D5VA 1EP0A 4MGKE 4MX3A 1ZRRA 2A6CA 2PUCA 1RL3A 3JXDL 1LRHA 5KBFA 3IVPA 1CQTA 1CX4A 4XF0A 4F8DA 4R52A 1VR3A 3PXPA 1OMIA 3QYXA 5FPZA 1RTVA 1G6NA 5A7LA 1YWKA 1GT0C 4N9IA 1WGPA 3NKTA 4IVZA 2MQKA 1JFSA 4IEWA 4Z5DA 1QP0A 1ZX5A 1POUA 4QM8A 2KEKA 3FZ3A 5HI0A 4FBIA 2IXJA 3H50A 3QACA 4KU8A 3VHRA 1ZZ9A 3H3UA 3GYDA 2JCGA 2FJRA 3H9AA 4XFIA 1ZUGA 2AWIA 2Q30A 1UCXA 4BYYA 2CSFA 3GN5B 3MLFA 2LYQA 4O9EA 3BCWA 2H6BA 2PUDA 1CAVB 2BEOA 2AXVA 3BB6A 3SCHA 1J3PA 3DV8A 4UBGA 5FCCA 2GC2A 1ADRA 3R6SA 2MNGA 5E1RA 3JXBC 5FLJA 5BXXA 1SQ4A 2ETEA 5I0RA 3FHIB 1J58A 4WZCA 1L3JA 2B5HA 5D1IA 3SCGA 2B9UA 3E5QA 2PPXA 2XKPA 2KXLA 1BDHA 1OD5A 5KHKA 1IPKA 2DCTA 3BD1A 3EO6A 5I91A 3E6BA 4LUMA 1GQHA 5LEJA 3HT1A 2UY8A 4YG4A 1PNRA 3KJXA 3LISA 4KWKA 2H8RA 4AVAA 2L8NA 3S0MA 4I6TA 1QWRA 3OP9A 1ZAYA 5JCTA 4X4GA 2ET1A 4EV0A 4YRDA 5K8SA 5BV6A 1Y3TA 4LLOA 3DL3A 2PE5A 5LRRA 4D7SA 3H5TA 4X4CA 4GQMA 5J48A 2LYLA 1DZTA 2QNKA 4Q0UA 3L1PA 4Z58A 3D0JA 1YSEA 3D82A 1ZZ8A 1SQ8A 4XETA 3KMHA 3MPBA 1UW8A 2IC1A 1U12A 1DZRA 4IERA 5AVPA 4MCXA 1RC6A 2ZCWA 2XL7A 1O3TA 4DINB 3F52A 3L2HA 5KHJA 3IIAA 3F51A 3DN7A 2AW6A 1IPJA 4X4FA 3I54A 1LR5A 1RZRD 2QCSB 5C8WA 3I7DA 4OB4A 2CAVA 4IEVA 1WETA 3H3ZA 3IDBB 3F6WA 2PAEA 2Z69A 1NE6A 1UTXA 1QXRA 1QQAA 4KU7A 5I93A 1O3QA 2Q0AA 4AQ6A 2D5FA 3ROUA 4HVQA 2PQQA 3R1FA 4H7LA 5EZWA 2ET7A 4I2OA 4LTAA 1VP6A 2AXZA 2EVXA 3M3IA 2HJIA 1ZS4A 3CECA 3ZKCA 5FQ0A 2OZ6A 3OQOA 3I59B 2GRLA 2QJVA 2B5AA 3RPQA 5T3NA 3CL1A 5I0UA 3ACLA 1S7EA 1NYWA 1LCCA 2IVGA 1O5UA 4HVOA 4WVZA 3EHKA 4LULA 2HSGA 4IEOA 4Q0QA 4RD7A 4Z59A 4ZU4A 3O9XA 3NVCA 2P17A 4ZU5A 2FMYA 4KWLA 5JR7B 4L2NA 4PU7A 4PU3C 1NE4A 4CYDA 1RIOA 1O5LA 2XI8A 1O4XA 4JQDA 2PTMA 3I59A 3M70A 2BNMA 4XFGA 3H7YA 3U10A 1NXMA 3EQEA 1ZZ7A 1QP7A 2KZ8A 4FT8A 4I0AA 4J1WA 5E16A 2CGPA 1OCTC 1EPZA 4I8TA 5I8SA 1QQBA 1O7FA 4MCTA 3CO2A 4PIZA 3KGZA 3RDIA 3N4MA 3TNQA 2ICPA 4YG7B 3ZHMA 2XLFA 1O3SA 3UKTA 1UIJA 5JAXA 5CVRA 2XCJA 4FAHA 2D5HA 1E3OC 3NL1A 1JWLA 3E5UA 4EWAA 4X4HA 1ZRCA 4HLTA 3JXCL 3NSTA 4TLFA 3TRBA 5FLHA 4IETA 1I5ZA 1UXCA 2Q4SA 3LA7A 3BS3A 3HT2A 5JSPA 1O4TA 1CJGA 5EFUA 2BNOA 4I02A 5BUVA 4Q0VA 3HZIB 1ZNPA 2PIJA 4Q29A 3PLQA 1X82A 1CAWB 5F1RA 3RYRA 4A2UA 2OZJA 3H1WA 1VJ2A 2O8QA 2PYTA 4X4EA 3NJZA 1UPIA 2XKOA 1X8MA 4F7ZA 3S7EA 2LYPA 2GZWA 1PRVA 1SFNA 4Z07A 1NERA 1X8EA 4MGIE 4XFBA 3MZHA 4PIXA 2XLGA 1J59A 4XF4A 2AXUA 1JUHA 2PHDA 5CU1A 3H8UA 4XFFA 4XF1A 4JTNA 4I6RA 2IUOA 2K9ZA 1XE8A 4WBBA 5JSRA 1CAUB 1EYBA 1JFTA 5KHHA 3EJKA 1EY2A 4GULA 1YFWA 3WW2A 3ST7A 4HN0A 1XRUA 3E97A 4PIYA 3LWCA 2LYKA 4XF3A 4HN1A 3OF1A 4YYOA 2MHFA 4HMZA 3HIFA 2GRMA 2PUEA 4IEZA 5CADA 1OSLA 1FT9A 4ZU7A 2XJ3A 4I6UA 4GHJA 2PHLA 4FN3A 4QGMA 1TQ5A 3ZHIA 3B02A 3ES4A 4LUKA 5J7MA 1Q43A 3FFQA 1ZZ6A 2F4PA 3SHRA 3H1YA 4BIFA 3U0ZA 2IXCA 3TNPB 4Z5CA 4KL1A 4D7TA 3D0SA 3G7DA 3MYXA 3S7IA 4JTOA 4N9HA 2UYAA 1PRAA 4I3PA 2GU9A 1RZSA 3LFPA 1CGPA 3U11A 4YNIA 2O49A 4XEZA 4I09A 1EFAA 4EROA 4QGNA 4FAGA 3MDPA 4IESA 2OYZA 2VECA 4I01A 2PUFA 5JSOA 1DGWA 5BY5A 3RYKA 1B0NA 3D1NI 1LMB3 1CAVA 4XFHA 3QWGA 4O9GA 3EBRA 3H7JA 1J1LA 2XHKA 1YFYA 2GC0A 4YSFA 1RZRA 1PMIA 1LLIA 3HQXA 4HZFA 1QP4A 2B8MA 1WA4A 3SCFA 4LEJA 4MGYE 4ORFA 4AVBA 4O8BA 3USSA 3OTFA 2EWTA 5FQ0B 1RUOA 2L49A 4PU4C 3BU7A 4XFCA 2IXHA 4X4BA 1DGRA 2WC2A 2IXKA 4EWDA 3CLPA 1Y9QA 3FMYA 2GC3A 4YBAA 3PNAA 4XF9A 2ATFA 3IBMA 2XLAA 4YG1A 1YLLA 2ICTA 2VQAA 4EWEA 4IA8A 2FQPA 1CAXA 3LA2A 2IU7A 3DKWA 3GN5A 5LRSA 3QOPA 4X4IA 3CF6E 3BALA 4UXAA 4K8FA 5I8TA 4Z82A 4HSLA 2O1QA 2AUWA 1PRUA 1XE7A 4X6RB 1I6XA
chains in the Genus database with same CATH superfamily
2CWSA 5FZCA 1PNFA 3T2OA 2WIUB 4AI9A 5F39A 2ZMNA 4AG4A 4XUNA 1AX1A 1O4YA 2W3JA 2Y6FA 3CJIA 3NAPC 2L9LA 3WOGA 2WQZC 1CAXB 3WXPA 3B5LB 4O61A 1H2KA 4QPIB 5L9BA 2TBVA 3CBNA 2HWE1 1FXZA 5DQ0A 1SG3A 3FE5A 2HWF3 2FHRA 4LKSA 2O4AA 2GC1A 3ITQA 4XJWA 3U14A 4CXXA 3KXAA 1C8M1 4QHBA 5DAQA 3LZZA 2BPA2 2E9QA 3BYWA 1LKNA 1CIWA 2VNOA 4FTSA 4A42A 2A75A 4OCTA 2ZHLA 2EXIA 2QDRA 2PHUA 1RB8G 1X50A 4HXCA 2KEIA 1TMF1 3C3VA 4RS5A 3PTYA 2HWD3 2Z5WA 5IVYA 3WNXA 5HV0A 1NAEA 1XB9A 3HWJA 3ETQA 2IVBA 1Q5OA 4LKFA 4I0WB 4XTMA 2R6QA 1SHWB 4P02B 3Q8BA 3NQHA 1F31A 1X36A 3M3OA 4Q0PA 3AP7A 3DF0A 2J7MA 1RUNA 3HNMA 4WZFA 2TNFA 3AP5A 2I45A 3VBRC 4AEKA 2GZUA 1LEMA 2DVDA 2O0OA 3A21A 3IPVA 4K3UA 4ASLA 4DOUA 2PUBA 1EUTA 1KJLA 2YMZA 1TMF3 2EAAA 1H1IA 1FX5A 3MLJA 1GNHA 2QQOA 2RS53 4GWMA 5C4WC 2OR1L 2JX9A 3ZFFA 2LYRA 5IT6A 3WHUA 1FPN2 4YG3A 3PURA 3WHTA 5I0TA 1AR91 1US2A 4MZUA 3EUSA 2X5IA 1AR62 2ZKNA 2R061 1PERL 4QM9A 2W68A 2YPDA 3JQWA 3K4DA 3WP5A 3KS7A 2R0FA 2VOKA 3IPVB 3ZN6A 2OUHA 3OQNA 4EQVA 4OI0A 2V5YA 2WDBA 3JZVA 4OFGA 4QQHA 4S2HA 1QDOA 4HSJA 5FP3A 4QKBA 4PLOA 4XDPA 2CROA 3ZIWA 4CEWB 1ENSA 4X6QB 2G1MA 1CVNA 1PX3A 4Y24A 2OVUA 1EV12 1X57A 2KEJA 1ZA7A 1KXGA 4XDOA 1LOGA 1K45A 3UK9A 1ZREA 3ILFA 1S0JA 1SFPA 3A22A 3LOBA 2ARCA 2LLVA 1ZBE3 1HJFA 2RS12 4TSVA 5FYBA 3TN93 1X33A 2Y64A 1C8M2 2NM1A 3KQRA 4RGGA 4NDWA 2PA7A 4JHTA 3VZMA 1ZBA1 2RE9A 1FNYA 2CDPA 2SBAA 4P5HA 2ENRA 3L2YA 4LHSA 3G5GA 1SBDA 3ZSJA 1CZTA 5EIYB 2W0XA 3WD5A 2VCMA 1RPEL 1XOYA 4IV1C 3QCWA 4IEXA 2GH8A 4E2GA 5C9AC 4F8AA 4HBNA 2IVIB 5E89A 3O7OA 2KPJA 3HR9A 4X6RB 4CDUB 4BXSV 3KT4A 4Y1YA 1YNAA 2D44A 1W2TA 5FPXA 3GZDC 1VPWA 1A78A 1XU2A 3MEPA 3NO8A 1MACA 2H6CA 3FLPA 4B7KA 1W28A 3S0MA 3KGLA 1RUC1 3V0BA 1VBD1 2WYFA 3JXSA 5J96B 1DHKB 1JW6A 3WF0A 1GANA 4JGZA 4LA2A 3WDWA 2DCYA 5FAXA 5LA2A 2VZ1A 3GZCA 4HK9A 1AU7A 1V70A 1SDDB 1DLCA 1W0PA 1GLHA 2D7FA 2KR2A 3LDRA 1YHFA 4H55A 5FK8A 5C4WB 1FMD1 5J1XA 1AL22 3CJIC 5FDBA 1HRI1 4XILA 2BV4A 3VKFC 4C91A 4OHYA 3OMTA 1YI9A 5FIXA 4EN0A 1EUUA 2R63A 1LHUA 1GWMA 1UPSA 5F3CA 1RYYA 3GZEA 5FPUA 1PGW1 2VTXJ 3ZPYA 1XXNA 1WIZA 2CYFA 3B7MA 5FV3A 3V0BB 1X7NA 2Y0OA 3VKLA 5GALA 2UY9A 4HL0A 3HOBA 4YW7A 2BNNA 2GH2A 3I3QA 3I2IA 1LCDA 2D5VA 4MGKE 4CEWC 1YQ6A 5FP7A 5FYHA 3BTYA 4X8PA 2BOIA 4LHNA 2RR13 2BFUL 4H14A 1QOSA 1H8VA 5HPOA 3AP4A 2DCJA 3IVPA 1CQTA 4UOJA 2CU5A 1R1A1 5LCWL 3JBG1 1S2BA 3AKTA 3TEPA 1CPMA 1DFQA 3GZTB 4XJAA 4BMBA 5EWSA 2HLEA 1AYM3 3ZXJA 3WQ0A 5A7SA 1SZBA 1RTVA 1G6NA 5F9TA 1JUIA 5LZ6A 3D6EA 1MVEA 3CJIB 4GXLA 3NKTA 2VMHA 5AC93 3JU9A 1JXNA 4TWTA 4IEWA 5JPMB 3FZ3A 3OY8B 1L7LA 1QMJA 4JX0A 3VL8A 3VD9A 3I2JA 1XSRA 1YJLA 3AM2A 1ZZ9A 2JCGA 2UWBA 1UKGA 4XFIA 2LNMA 2AWIA 1IGOA 2Q30A 3MIFA 5JZGC 1JZ8A 2CSFA 1C28A 3BGAA 4XXAA 2BZDA 3OYWB 4E4HA 4BQXA 2QQPA 4O9EA 4Y1ZA 3THTA 3ZM8A 2FZ1A 3LFIA 4XIKA 4HG6B 1QJY3 4L9BA 4RS5B 5FZLA 5AC91 5DTMA 2RS51 5LK5A 2VBBA 3I3MA 1H8TC 3W5MA 3BB6A 4P9LA 1JTZX 1YIPA 2ORZA 4UFHA 3R6SA 3VDDA 5E1RA 2VZPA 2D43A 3JXBC 4G9SB 5BXXA 2BP6A 5L73A 2ETEA 3FHIB 1BQPA 1Y4WA 3IIIA 1ULCA 2BWAA 1BDHA 1OD5A 2BBAA 3S30A 5F5CA 3BD1A 1D4M3 5BNOA 2W46A 2JECA 3N7JA 5I91A 3E6BA 1NOVA 2A73B 1VBA3 1OOPA 2PXTA 2RS32 3HT1A 2UY8A 3LISA 4Q4Y3 3A0KA 5JOWA 3VUOA 1N3PA 2YU2A 3VD5A 4AVAA 2BERA 4AYUA 1QWRA 2W9XA 4UW5A 5DDJ2 3QFIA 4X4GA 1W0OA 4XJUA 1HN1A 5FZ4A 4CA9A 4EV0A 5BYNA 2RG4A 5BV6A 5K8SA 4BE3A 4E4SA 2DYCA 4GB32 2WSVA 5J48A 3DECA 5FYUA 1DZTA 3A9XA 2VUAA 2RR11 1QNWA 1RHI2 2HWF2 2ZZJA 5EYXA 5GKAC 2QNKA 5A32B 3RJRA 2K46A 1ULEA 1VAVA 1LHNA 1OA3A 1W2UA 1AVBA 4AAPA 2QFEA 3D82A 2E26A 2WINB 1UXZA 1F4AA 3WQ1A 3KMHA 3ZXAC 2WFF1 1J84A 5AVPA 2ZCWA 4UFKA 2XL7A 3WLUA 5CKNA 4DUVA 1R081 1O3TA 2AUYA 3TEZA 2MEV2 5DZGA 2VUDA 4X4FA 2YROA 3PJQA 3NNGA 4PCRA 2X05A 4AAXA 4S2GA 5APAA 1WETA 2FDKA 1HB1A 2R0HA 3IDBB 1OQDA 2PAEA 2Z69A 5IAVA 1UTXA 4EZ4A 4KU7A 1QQAA 4LBQB 3RG0A 5I93A 1DGWX 2QQUA 2V3CC 1QJX2 2Q0AA 3A9ZA 4Y33A 4XXPA 4AQ6A 4CVUA 5IAXA 4R9AA 2VC9A 3AL6A 4UFJA 3WNKA 5LA1A 5JUWA 3R1FA 2C1FA 1UQXA 3MV11 5GZEA 4A7ZA 1VP6A 5G04L 4CXYA 4OVEA 2PXQA 1Z7S2 2OZ6A 4IE0A 1QQP1 4BLIA 1R092 3AMHA 4QXCA 3BIWE 3GJBA 3WF3A 2QBXA 1AZDA 3CL1A 3OD4A 5I0UA 1I9RA 3B93A 5T5OA 1PGL2 1NYWA 2Q8CA 5FUNA 2FDFA 1OA4A 1RUD2 2ZX4A 4L99A 2P6HA 4YW2A 3T4HB 2HSGA 4GMP3 1ZBE1 5IUQA 4IEOA 1PO13 1T2XA 4QX1A 1IQAA 3N7KA 4HONA 3OUHA 4C8DA 2P17A 1TE1B 2Q1MA 4ZU5A 3ZYRA 2ODRD 2HEWF 4CCCA 4PU3C 4BLJA 4K40A 2XI8A 3MBWA 2PTMA 1GBGA 4ES8A 1NY71 1UMZA 5FY7A 1AR83 3KHCA 2F17A 5FUIA 4QX0A 3EQEA 5GLUA 3JB8A 5T52A 4J1WA 1V6LA 2W52A 2CGPA 1QZXA 4UAPA 4URAA 1JZ7A 4FOYA 4ER7A 5I8SA 2WAOA 2FFHA 1QQBA 5C3RA 1SMVA 1Y9GA 1YJKA 2R072 4W6WA 5C8CA 4LO5B 3VKOA 5BNNA 3KWVA 3WDUA 3N4MA 3ZKYA 5C9AA 5FYMA 4YG7B 3M9LA 3ZHMA 2D3SA 5CBLA 2WLQA 2DVFA 1W3VA 4FAHA 4P08A 2D5HA 3QOWA 3K2OA 3TFLA 1AYN2 3AZZA 1JWLA 4XJZA 1V9U2 2JDNA 3UNPA 2PHFA 1H9PA 1LOBA 5DN2A 4EJRA 2FD8A 4HLTA 4TLFA 1AYN1 1DBNA 4DNYA 4IETA 3I2DA 3NJYA 5K9YA 1I5ZA 2WO2A 5EHDA 3ZSEA 1VE0A 3HT2A 1S0BA 3N35A 1CJGA 2OKXA 2BNOA 1W99A 2PHWA 4OYUA 1HB4A 1LGCA 4DY5A 3SC7X 1VLNA 5A6XA 1RJ8A 2XVLA 4D0QA 1B09A 4Q29A 1X82A 3WF2A 5H9SA 2B39A 1VBE3 1ZRIA 2YZ4A 3VHNA 1PGL1 4INDA 4KH9A 5HBAA 3SH4A 4F83A 3ALQA 4WM7C 3NJZA 1UPIA 3LE0A 1E5SA 1R091 1HKDA 1HV0A 1K3IA 3O1MA 4OMCA 1SFNA 2VZOA 1G86A 4OULA 3AKSA 4MGIE 4V2VA 4ZZ5A 1ZBA3 4XF4A 1QB2A 1D0GA 2Y6GA 4FQZA 3TAYA 4W4ZA 2VTXA 4XFFA 5HXVA 4BXFA 2XUEA 3POBA 4K7JA 1R64A 2WJSA 3JD71 4I6RA 2K9ZA 3LPGA 4CP2A 4OQ8A 2VW2A 4GKYA 4WBBA 4ER0A 2JXAA 3J26N 1RUD1 3EJKA 2RMU2 1EY2A 5CIRA 1LJ7A 4NR1A 2YGMA 3E97A 4WVMA 3LWCA 4BWOA 2LYKA 3S6PA 4CPBA 4Q27A 4XF3A 1AR71 4HN1A 4AVVA 3PMEA 5T5PA 4FPOB 3MIBA 1UOJA 2W92A 3J8F1 2PUEA 5CFCC 4YGEA 1HRI2 1OSLA 1SLAA 2YC4A 2XJ3A 4I6UA 5JWPA 2YC2A 3UWPA 4GIQA 4FO9A 3VBFA 1WUVA 2DUOA 4QGMA 1TQ5A 3CMGA 4JC1A 5FWEA 5J7MA 3J7MA 4PI0A 2P3YA 5FZMA 2R063 3TRSB 4CEYA 3KCYA 3SHRA 2XB6C 4IV3B 2BW8A 3NAPB 3TNPB 4Z5CA 5LW9A 5FY5A 3PJYA 2XDVA 4Z1VA 5FBZA 3VKNA 4QX8A 4DO0A 3PUSA 1OPOA 2W39A 3VZKA 3WG4A 3J8F3 2PHTA 4LE3A 2B7YA 1PIV2 5C3OA 4CUCA 1JZ2A 1QJU2 1W6MB 2GNBA 1PRAA 3PTRB 4KI5M 4OI4A 1NW3A 3M7AA 1DQ4A 4E8DA 4MXVA 1FNZA 3M3EA 4B4PA 3ZYBA 1QIQA 3I2KA 1W3XA 4YNIA 3GBWA 2O49A 4MGQA 3W9AA 1LHVA 4EROA 4Q8KA 4QGNA 2WABA 2ZX0A 2OYZA 2VECA 2VMFA 4IV3A 4HPKB 2BWCA 2XG3A 4KG8A 2A7AA 1LMB3 1CAVA 4Z2AA 2ZOEB 4YM3A 4O9GA 4GH4A 4M3CF 1WD3A 4HRAA 1Q8VA 1N3QA 2XHKA 2GC0A 1A34A 1YQ8A 3POEA 3V0AB 5IK7A 4FFGA 5DT2A 3DM5A 2XOMA 2ZEZA 1LLIA 1NQJA 1UX7A 2ARBA 5JOXA 3MV01 1QP4A 1GSLA 2B8MA 2CTVA 3ZLIA 4YZ5A 3OUJA 5LWBA 3I3DA 5DDJ1 5FXXA 1BVVA 4AVBA 4HKWA 4AFMA 3P6BA 1ND3C 2YC0A 4WVVA 3USSA 2EWTA 2R042 2P3JA 1BBT3 1RUOA 4CUGA 3RFRA 1I5PA 2V72A 5IFTA 3LD8A 1HX6A 4XOGA 1C57A 3I49A 4LT5A 3U75A 1IS5A 4EWDA 3CLPA 1Y9QA 3OYWA 1RUC3 3OJBA 2Y26A 1LOCA 1D2QA 5GJ6A 1DULA 3BOPA 3HVDA 2ICTA 3UJOA 1RXFA 2HWF1 3ZXFA 3WG3A 5FO8B 1YCIA 2YXSA 4IA8A 3DXUA 1CAXA 4G4FA 3V64A 2IU7A 4BJ0A 1LU2A 4QPIA 1AR72 4XBQA 3POJA 4RR3C 5L19A 5F3EA 3PUIA 5LRSA 4QU2A 3BALA 4UXAA 4Q4V2 4FOQA 2AZ5A 3ILRA 4HSLA 1MZFA 2EXJA 3WNLA 4C1WA 5JDBA 1ENXA 2C26A 4QKDA 3OPZA 2BYVE 1JYCA 4Y3OA 5F2SA 1F8VA 4IXLA 3I97A 4FPJA 2WL1A 3RNSA 1QPZA 1O3RA 3KZ3A 4TN7A 2GN7A 2ZGRA 1W04A 3ABZA 4NHKA 4R4ZA 5EQUA 3O1OA 4DMIA 2ILMA 4KGGA 2BVBA 4D7YA 1L1MA 4MH0E 5FPBA 2Q5TA 3MFCA 4COYA 4RHV2 4X4DA 5FBJA 3I2HA 5D21A 1ENQA 2IXLA 4MSVA 2VGDA 1YFXA 4K6BA 3UL2A 4Q8LA 5I0SA 1OPMA 3IB3A 2GMMA 4JCXA 4JDMA 3KQ4B 4K1YA 1N1YA 4QDSA 4BQ2A 2IWGB 2EF8A 1H6YA 3IDCB 1S0EA 4QX3A 5K98B 1HJGA 2ZGTA 4FXGB 4AI0A 1IZ3A 1M06G 4Q4W3 4JDNA 3QBQA 2VOTA 4L92A 4CP9A 3G0TA 1MZEA 1QF3A 5FWJA 2JDYA 3MICA 4MGZE 1AR81 2EIGA 4UT5A 1SLTA 4GWJA 4ARYA 4META 4Y22B 1RGSA 1UZ0A 1Z0HA 2FDJA 3ZMOA 3D3AA 2LTNA 3AKQA 4AEDB 4EN8B 4EYUA 2ORXA 1MS1A 5FLIA 5GAGi 2VUCA 2VQTA 3KSCA 3LCPA 1H2NA 5FZGA 3NJXA 3RI9A 4AFAA 1UX6A 4HKOA 5BPXA 1SPPB 2PXDA 2EXHA 2VO5A 1M4WA 1H1MA 3IMMA 2G9FA 1JU4A 1POV3 2WFPA 2JKXA 1BDIA 2A6WA 5FZ6A 1XYOA 1ZM1A 3K3OA 1QJY2 3OGJA 3OSDA 4NVPA 2ZKLA 3BPZA 2MPFA 1RUJ1 2CAUA 3CDZB 3JBG3 3R4SA 1GNZA 5FZDA 2CWMA 3ZKUA 1O8PA 1OA2A 2ZJCA 3H1MA 3WF1A 2VZTA 5C3PA 3VN4A 5KHGA 4QU1A 2VAUA 1W8ZA 1Q8PA 3T0AA 5JI9A 4QX5A 1FI2A 2PUGA 5C7GA 1OI6A 4OZXA 1AR63 2MEZA 1ZBE2 2Y6JA 1R1ZA 3B69A 3LIGA 5JXGA 3FWEA 1A8DA 1H8TA 1LOFA 3H8OA 3JQXA 1QXJA 1UIKA 2P37A 3LB9A 1GWKA 3H3LA 1IC8A 2VPVA 2PAKA 2WS92 2JJ6A 2RS33 2XL9A 1UKRA 2CNAA 2OIIA 2QVSB 3B00A 1S4CA 3PIGA 3WG2A 5CG9A 1CAUA 2JEMA 2PXVA 3FBMA 3HEIA 1D4VB 4RS5C 5JR2A 3I2GA 1ZBA2 4HKLA 4BQ3A 1PMJX 3LOIA 2NZ9A 5CKQA 3UFDA 2OPKA 4FCAA 4FFIA 1G9AA 2WZ8A 4HK8A 5FPLA 4LO6B 2OXBA 4U2AA 3KCCA 3E5XA 4P14A 4OHWA 3MGUA 1C8M3 2PUAA 4IWRA 4DE8A 2Z2SB 4PHZA 3FJSA 4LLFA 1FOD1 2VQ0A 3D8CA 4Z5HA 5CB7A 1RUH1 1O59A 1UYXA 2R30A 4AE2A 3IDAA 2MEV1 4CXWA 1PM7A 2AR6A 3R0RA 5FZFA 5C70A 1JH9A 2XWBB 2K0GA 1J1TA 1GZTA 1ZVFA 3SEPA 5F3GA 2ERFA 1UL9A 1Y7YA 2LCVA 2RMU1 3NRUA 4IL7A 5FZKA 5GZCA 2WT1A 1G9DA 3WVJA 4JKMA 5J3UA 4FOWA 3B7HA 3WQBA 5FP9A 1COV1 1H2MA 5AFEA 3E6DA 1JYTA 2R062 1FOD3 1IOAA 4DFSA 2F4LA 1U5IA 1RHI1 1LQCA 4WVWA 1UYZA 2YBKA 2YGLA 2FDIA 1S0GA 2CHHA 2IV1A 5A70A 2VULA 2Q1ZB 5KC6A 1PZ9A 3IZOA 3LSEA 3CJXA 5KC5A 1W8WA 3RVHA 3JB4C 1OKOA 2IVJA 1YFUA 1RMU2 2XVKA 5T5LA 3C8XA 3CIHA 4Y20A 1MPXA 1WMFA 5FYYA 4AVCA 2XJPA 3MI8A 2JD4A 3ME5A 1UYYA 2QQLA 3KV5A 3RYPA 4XQDA 3KF5A 1K5JA 4MX3A 1NXD1 3RSJA 4E4DX 3EMRA 4UW4A 4UWDA 1NA1B 2FBEA 5FMOL 2VZVA 1CZSA 3JXDL 4LIVA 4IE7A 1LHOA 1H0BA 1CJDA 1CX4A 2H0BA 3AFKA 1UOGA 4IDZA 4R52A 4HT1T 1VR3A 3PXPA 4CZSA 4D94A 2HWC2 3DYOA 2VOXA 5BNPB 5LK7B 4ZXEA 3BUCA 4Y20B 4XQWA 1YWKA 2BVVA 4CCMA 3S5QA 1JHJA 5K0UB 4IVZA 4IV1A 1JFSA 1Q8QA 1VALA 4JQTA 2HYKA 3MW2A 4FOVA 4R9CA 1DDLA 2BFUS 2KEKA 4P9JA 4NIDA 2G9GA 2HH9A 4XCAA 1I3HA 3BTZA 1QH7A 1R1A3 4R9BA 1UCXA 3MLFA 3MW4A 5GLTA 4D6QA 2NMOA 4UFIA 3MIHA 3THCA 3WZ1A 3BCWA 2IFRA 4QDRA 4XVHA 5FKCA 1NA1C 4RFRB 4RL7A 4CDWA 4Y4RA 1BZWA 4CEYB 5IVVA 2AXVA 2XVGA 2ZX2A 1BEV2 1F9KA 1W9YA 3VBOC 1PK6C 1PVC3 1UZYA 3ZX7A 2FZ2A 1IG0A 4UBGA 5FCCA 1AYN3 1ADRA 4FPKA 2JG9C 2WNUA 2MNGA 3HQUA 4CDQC 2WAAA 1S55A 4A44A 1O91A 5FLJA 3ZYGA 4B4QA 1SQ4A 4COVA 5I0RA 1VRBA 1J58A 2QQMA 2J7WA 1SFYA 1VAKA 2AGSA 3SCGA 2JIJA 3NAPA 1YEWA 4XJ8A 5FXZA 4IE6A 5GZFA 4ASMB 4NIHA 3CNAA 4CDQA 3F2ZA 4P00B 1RUJ3 1TEIA 1W9TA 3ME2A 4JGZB 3D5OA 4LUMA 1GQHA 3VBUC 2WFF3 5LBCA 1DGLA 4QKNA 5CEHA 5FYSA 4GB33 4WV8A 4QPYA 3USUB 1WD4A 1AJOA 1HN0A 4A6OA 3RQ0A 3GGLA 1XPWA 3OP9A 5FO9B 5FYTA 2ET1A 2EAKA 4YRDA 4XUPA 1VBD2 1JYXA 3KV4A 1DQ5A 1MS0A 5IW0A 2XQXA 4ET7A 1Y3TA 4LLOA 2QE3A 1IKQA 1YQCA 4KG0A 4X4CA 4GH4B 3ATGA 1LESA 1CD3G 5FMCA 4YGDA 4Q4W1 4AI2A 1TZOA 4AQTA 4M00A 4Z2WA 4A7KA 3L1PA 2QUOA 4XUTA 4WM7A 1YSEA 3WSOA 4FI9A 5JI7A 1D2SA 4XZPA 3USUA 5EJ1B 4AW7A 3H8RA 4N43C 4OBMA 4QKFA 3S5AA 1V0AA 3MPBA 3C7FA 1A8MA 1UW8A 2IC1A 3NJVA 4FPHA 4NHMA 2VL4A 4PBPA 3VBHC 3W58A 1RC6A 5FY9A 4A3ZA 3A7QA 4RFT0 4DINB 3F52A 4Q1RA 3IIAA 1REFA 2AW6A 3VBSB 2VNVA 1LR5A 1L7QA 3VDDC 5CISA 3VZOA 2QCSB 2DVAA 3HPNA 4OB4A 1WA6X 2VY0A 1PIV1 3BIEA 4YVWA 1OH3A 3H3ZA 1CX1A 3VLBB 5FP4A 3F6WA 2ZX1A 4QD2A 1NE6A 3HD8B 2CGNA 3Q8EA 1GP4A 5F32A 5SV8A 2RMU3 5IVJA 1AL0G 4BK5A 4AWDA 4K21A 1QGLA 2PQQA 2RHPA 3Q8CA 3LEKA 5EZWA 5EXOA 3TWIA 4I2OA 4LTAA 5GM0A 1FMD3 1QJFA 2HWD2 2RS11 5T54A 3ZKCA 1IG3A 4YM1A 1MR5A 2GRLA 1TG7A 3VBUA 4CU7A 4K9SA 3UESA 4AGRA 3DUIA 5F5IA 2WNOA 2YV8A 3VBRB 1OFSA 3T4VA 3T0BA 2EIDA 4RYDA 3ZFGA 1LCCA 4E8CA 2IVGA 3WINE 1OUXA 2B46X 4LULA 4Y5TA 4XUQA 1RUF1 4LR4A 4RD7A 4QX7A 3POFA 4CDUC 4KBZA 2OQ7A 3VDCA 3O9XA 1CZVA 1NCRA 3NVCA 4NHXA 4D8MA 1W8UA 4L2NA 1NE4A 3QLQA 1WMEA 1RIOA 2RS52 5AC92 1UY1A 1AXKA 4ES9A 4V2WA 2P3KA 4GWIA 1LOAA 1K5MC 2JG9A 3M70A 5JVVA 1SLLA 2ZTNA 2GALA 1WWYA 4Y22A 2L1PA 3NNLA 4NRPA 4TTGA 1TNRA 2Y6LA 2KZ8A 4I0AA 1NKGA 3UT0A 1CWPA 1FPN1 4CPBD 1OCTC 1RUH3 2D98A 1NA1A 4CDWC 3GZDA 4CP9B 1YYNA 3MPPG 3OB8A 1AR93 1OLME 4RSUA 4XYXA 4MCTA 2E31A 1ASJ2 1DQ0A 1TMF2 5FPVA 5LBFA 3KGZA 4QB2A 3U37A 2A6XA 1G8WA 2VXRA 3RDIA 1RUE3 2QQKA 4PDWB 4UW3A 5G05L 3UKTA 5JAXA 1DQ1A 5L7OA 5CVRA 5A1AA 4OI1A 4BOWA 1SPPA 3BVCA 2K2SA 2W2IA 2VEOA 4EWAA 2HEYF 2JDKA 3KV9A 5DZEA 4LK6A 5A7QA 2RV9A 2WO7A 4QXHA 1ZRCA 1MZ5A 3JXCL 3NSTA 1GFF2 1ND2C 2VMDA 4EN9B 1CONA 4RQPA 1UXCA 2Q4SA 3MIGA 3QH7A 4LORA 3K51A 3PE5A 5F8PA 2AEZA 3GZAA 1O4TA 3I3BA 4DB5A 1H30A 3TBDA 1PVC1 1LOEA 4Q0VA 1NLRA 4N53A 2GN3A 5J98B 1N1TA 2VG9A 5KWRA 3AKRA 4Q4X3 2PIJA 2ZHMA 3OEAA 1CAWB 4D3WA 4LE4A 5FOJB 4A2UA 5FZ0A 4D6SA 5JZGA 2G4IA 1JZ6A 4X4EA 2WT2A 2XKOA 3GDBA 2XXZA 5ABJC 5FOBB 2WYSA 3S7EA 1RUG1 2NP0A 2GZWA 2WNUB 1W6QB 3J7LA 2VMIA 1MZ6A 5T55A 4QHZA 2XLGA 4CCEA 2AXUA 4LBQA 5T5JA 1MS8A 3ACGA 3H8UA 2VUJA 2ZGLA 1G9FA 4P9XA 2IUOA 1MEC1 2BDRA 1DLLA 3NNFA 1Q8SA 4B7EA 5KXBA 2VNGA 1CAUB 1EYBA 1GZWB 1OVSA 3ENRA 3PU3A 4PDWC 2O8OA 1YFWA 3OG2A 1UZWA 3UJQA 3WW2A 4HN0A 3LGRA 5FZ7A 4AEJA 5IVEA 1DYKA 1HQNA 5E6HA 1BHGA 1OH4A 2MHFA 1HQ1A 2ZGMA 2GRMA 2BTVC 3HIFA 3FC0A 2OUJA 2HWC3 1UY3A 3CU7A 4Y5SA 3SEEA 4DPNA 2WT0A 4AZZA 4FN3A 2XMLA 1RUG2 1WMDA 3B01A 3POIA 1KFXL 1ZZ6A 2F4PA 3P3NA 3H1YA 2HWB1 1F5JA 2RVAA 3MUY1 4KL1A 2WWUA 4FQ4A 3GALA 3D0SA 4OUSA 3G7DA 3POWA 5LBEA 3WF4A 3MYXA 2BGOA 3NV4A 3S7IA 3VBOA 4BU2A 5LASA 3WR0A 4N9HA 1HQWA 2UYAA 3OY8A 3I2OA 3J7HA 2WNUC 1JBCA 2DWRA 4I3PA 2KM2A 2ZABA 3H42B 2GU9A 3LFPA 5J36A 1ULFA 1DG6A 2XJTA 3WY6A 1JZ4A 1W06A 4I09A 4EZHA 3SH3A 1OLQA 3TYJA 1US3A 2DURA 1N1VA 2OS2A 2VVEA 1W0NA 2WFF2 5JSOA 4CUAA 2LW8A 3DGTA 1B0NA 4XAEA 4YVWB 3OKZA 4XFHA 2HBUA 3EBRA 2R043 1J1LA 1LULA 2XBO2 3ZFEB 5C8CC 4XC9A 3PHMA 1NCQB 2J1SA 1JYNA 1PMIA 1QXPA 1RUF3 5A80A 4HZFA 1ASJ1 5JPNB 3SCFA 1N47A 1AX2A 2A3WA 2A3XA 4MGYE 2VOWA 5JIAA 5JIUA 4AI8A 2WRAA 3NKGA 3M2MA 1UXXX 3GUUA 4MXWA 5FXVA 1OUSA 1WCUA 4PU4C 1A6CA 2VH9A 3GHMA 1DQ2A 3BU7A 4M3CB 3T1LA 4CCKA 4DXSA 1WW6A 2PQSA 4XFCA 5LA9A 4GJZA 5BNOB 1DGRA 2WC2A 2IXKA 1PX4A 5E8AA 3OWQA 3FMYA 1B35B 4YBAA 2GC3A 2WQ8A 2VBPA 4M01A 5IWFA 2WLPA 2XWJB 3WP6A 3ZFEA 4A3XA 1OOPB 4YG1A 2B4KA 1BVP1 2WNVC 2XLAA 3D4KA 4CDWB 3Q8FA 4IE4A 4NROA 1ODNA 4N43A 1RUE1 4I3GA 1IS4A 1YQ5A 2AEYA 1SACA 2DDUA 4A4AA 1DGRN 3CF6E 4ASKA 3ZXDA 1S0CA 1G9CA 2ZBJA 2JDUA 4GWNA 4K8FA 3NV1A 2VW1A 2AUWA 1RVF3 2WZPP 1I6XA 2CAVA 2PMWB 3BOWA 5ERLA 1R69A 1XWRA 1BKZA 3IMNA 3SR4A 3LA3A 2PXUA 1J3QA 2ZS6B 4AR2A 4B8EA 1QJZA 4GZ9A 1ND2B 1OBNA 4YARA 4AQSA 3N9QA 2RJKA 4QXBA 2VM9A 1QHDA 1VBB2 3B3QE 4JCYA 1W6PB 4PF5A 2WBKA 3WDTA 1KS5A 4Y42A 5I8YA 2X5IB 3U4SA 5HXMA 1OFNA 3I4IA 2W1QA 3K77A 1JU3A 4JAAA 3T30A 2E63A 4IEUA 3BI3A 2JVLA 4MV2A 4AHZA 4M0NA 2V73A 4OMDA 5JMCA 1HLCA 4Y1UA 5CFDA 3ASIA 1FOD2 2M4HA 3AYCA 4R8HA 2R1BA 2JICA 4RN5A 3TEXA 2XBO1 3ZFGC 4E2QA 4IEPA 4PT6A 2XSDC 1RHI3 1YUDA 4M0HA 4PQQA 1MEC3 2HWB2 5FREA 5A7WA 3WW4A 5C6CA 3VDBA 1XC6A 1R083 1RIRA 2JB8A 1DWKA 2BOJA 3ELNA 1X9PA 3PVBB 4SBVA 2ZGPA 1YI7A 3J7NA 4P5YA 2RDQA 3TELA 5T50A 5IVCA 1JYWA 3P1IA 3TB0A 1RITA 4MHRA 1W2OA 1W9WA 2NPIA 1U5ZA 5DDJ3 2ZX3A 1OXCA 3UETA 3ZYPA 2LYJA 3VGIA 3TEWA 2UYBA 1LNSA 2ZGSA 1LGNA 4KQ7A 4WM8A 4HFSA 1KQRA 3K4AA 2PXEA 5DSXA 4ZZ8A 2GMEA 1BEV3 1S1AA 5A33A 5A1LA 2BJCA 1AUYA 5DUXA 2XJUA 4KGQA 2LROA 4JGYC 1PO21 1WH6A 4Q0SA 3UKNA 4OI2A 3ZDSA 2BU9A 2HCNA 3J4UH 1FV2A 2JE8A 2OPWA 5ABJB 2GAUA 4AXOA 1O4ZA 2R32A 5C4WA 2WUSR 3QH6A 2OT7A 2I74A 1JZ5A 2J1EA 4I30A 4EE2A 1XU1A 4RQPC 2W47A 1RXGA 3VBRA 5FZ1A 2MEV3 4AI3A 4AVSA 2R1JL 1AF9A 1RUC2 3FX3A 4LK7A 4UF0B 2DCKA 3VB9A 5HCHA 2DBIA 4CP0A 2P1BA 1GP5A 3GBFA 2XGXA 3LPFA 2HKXA 2O38A 2SLIA 4ZY9A 3UKVA 3WNPA 3FHAA 1UD1A 1PO12 1PVC2 4JV4A 4ZHNA 3T09A 2PAMA 5D8AC 3OOXA 5A7PA 3K46A 1GUIA 1NQDA 3O1UA 4DXRA 1KJRA 1WCKA 2JG9B 3N9LA 3SNMA 5IK5A 1X2LA 2XH6A 4LBMA 3CEWA 4PLMA 1ULOA 1Z7S3 1E5RA 5D2AA 4UF0A 5DPNA 5B4XA 3FN9A 4DRRA 2CDOA 1EPWA 3OGSA 2A6ZA 2A71A 1EAH1 1JZ3A 3DNVB 3KZ4C 4PDWA 1KDMA 4FBFA 1HF0A 2NYYA 1LB2A 5EJZB 1W8OA 3QF3A 2HWC1 1R63A 3SMHA 1EV11 2EIBA 5C5TA 1FAYA 4JRAA 3FYMA 1ZRDA 1NY72 1AXZA 2P34A 3RJ2X 2CL2A 5A6ZA 4MUVA 4J25A 1OURA 1V6IA 3THDA 2HWD1 4CEWA 4BH9A 1O6UA 1WCQA 3O0VA 3ES1A 4M4RA 1AYM1 5FZHA 4ATEA 3MIDA 3E6CC 5L7OB 1CJPA 4IEQA 5FTTC 1ZZCA 4QXKA 2VZRA 1Y9MA 5CG8A 1UMIA 1NLSA 2X53S 2D6MA 3SKJE 1NLQA 1QH6A 3AXEA 3Q8AA 4QQPA 5KHIA 5C3SA 3O1SA 1RMU1 2E7AA 4NJ4A 5K0UC 2Y34A 4B29A 4YWAA 5ACA3 2WUHA 4AQ2A 2EXKA 3AZWA 4FTBA 1D0HA 1CAWA 1UNBA 5SV5A 3KD4A 4RHV3 1PGSA 2A6CA 1X9TA 5AFBA 4EKIA 3U4XA 1GOFA 1LRHA 4V1PA 5IVBA 1DQ6A 1MQTB 1WLCA 1XYPA 2W91A 4ZS2A 2UURA 2QTWB 5A7NA 4YPJA 4JCKA 1WLDA 4XF0A 1T6BX 1AL23 1OMIA 2WA3A 1HRI3 2DCZA 4N90A 1UU6A 5FPZA 3I3EA 1QOOA 1ND2A 2YDEA 1GT0C 1W6QA 1WGPA 4N9IA 1ND3A 4PLNA 4Q4W2 2MXDA 4XW3A 4Y4YA 1W03A 4M4PA 3SQOA 4BIOA 1PM4A 2QDNA 4Z5DA 4GA9A 1QP0A 4QM8A 1POUA 1RVF2 2JDPA 2RM22 1W6NB 5FMOS 1QNYA 3QACA 5FZ8A 3VBFC 2F6BA 4KU8A 4N53C 4OHXA 2D97A 2QQWA 2FDHA 4U36A 4ZPIA 2FJRA 3H9AA 1MQTA 1J83A 3ZXKA 4NPRA 3WP4A 3ZPXA 3C7HA 4Y1VA 4WM8C 1XNDA 4LBOA 5A6QA 3AVSA 1UMHA 3AZXA 4KBBA 3T2QA 2A5ZA 1CAVB 3VBSC 2E6VA 4XAAA 1VMHA 2GP3A 3MF9A 1FV3A 4CCNA 2WWJA 3SCHA 1J3PA 4AL9A 1KDKA 2YUEA 1S2KA 2GC2A 3W20A 1Q56A 4YVSB 5FYCA 1OOPC 4JHZA 2KA3A 1H9WA 4P9YA 1JYVA 3M4FA 1C1FA 2IUWA 1QDCA 3BPSA 1ENRA 1Q8OA 1QJU3 1ACCA 2RM23 3DPRA 5D1IA 2QZ2A 2B9UA 2PPXA 1JOPA 1MS5A 2BRTA 2KXLA 2VZSA 2XKPA 3ETPA 2JB4A 5KHKA 4A45A 2DCTA 2Y33A 3EO6A 3SISA 1OSGA 2PHRA 4GH4C 3GXUA 4ER5A 3PU8A 5LEJA 3O1PA 4WM8B 4YG4A 1PNRA 2ZMLA 1AX0A 4KWKA 5FY0A 3ZVXA 2L8NA 4NPLA 4NHYA 1ZAYA 4LPLA 2JDZA 3I2FA 4AOCA 4JZRA 3ACIA 3MUZ1 1KS4A 2W5FA 1PIV3 2B45X 4NO4A 5K7PA 3C7OA 2PE5A 3FL7A 1WW7A 3H5TA 2DBNA 1U5XA 4MXWB 4XHXA 4D7SA 5IATA 2ZACA 4LQRA 2A70A 4LXLA 4YW4A 2P6CA 2LYLA 2Y6HA 4E27A 4QQOA 5FZOB 4C90A 3GCXA 2QQVA 5FY8A 4QQ2A 4C0BA 3D0JA 2VD7A 1ZZ8A 2P2KA 4COWA 1MQTC 4B1MA 1SLBA 1V6OA 3ZSMA 2I2SA 2B42B 2QQIA 4IERA 1AJKA 1DZRA 2V4AA 4M3CA 4YVSC 5FZAA 1K12A 3WG1A 1UO9A 4CDQB 2WNVA 1SDWA 2HEVF 2JD9A 2GNMA 3R4UA 1DCSA 2DVBA 3EB7A 3L2HA 1VIWB 3T3YA 3VDAA 2XONA 1VRH1 2QQJA 3DN7A 4QPGA 5DUWA 1VPHA 5JXJA 1RZRD 2FCVA 3LIHA 3B94A 3AMPA 1RUG3 1SLCA 2AREA 2JENA 3I7DA 3IAPA 3MF6A 3AK0A 4GQ7A 5DUUA 1BEV1 1DYPA 5C8CB 1ULPA 1UZVA 4XBLA 2J1TA 4C0HA 3ZFGB 4DUWA 5F2WA 1O3QA 1SCSA 4Y1XA 2D5FA 3LQCA 2YPJA 1W6PA 4HVQA 2Q8EA 4MADA 4DS0A 5F37A 1BYHA 2PELA 2ET7A 2ZZQA 3FUQA 3ZDVA 4AHXA 2EVXA 4RGAA 5FO7B 2HJIA 4X8NA 5FYVA 1FPN3 2LRPA 2QQNA 5FQ0A 1APNA 3AZYA 3OQOA 1WKYA 2WA4A 3E1F1 3I59B 4FFFA 4XHBA 4AEMA 2QJVA 1HRV3 1AR73 4OUMA 4XJ9A 5H9PA 3KLSA 3RPQA 2IFWA 2Z42A 4Q4V1 2LALA 4AGVA 3ACLA 4BB3A 1WLWA 1S7EA 5IVFA 2R041 1O5UA 5IYYA 1ODMA 1V6KA 3A23A 1S2EA 3HQRA 2YBSA 3M3CA 4NOTA 1BMV2 4DRVA 5FMBA 4K8RB 1XE0A 1UY0A 2XBO3 4AEDC 2FMYA 1TME2 1NG0A 2XXPA 3ACFA 1BXHA 4KWLA 4A6SA 2Q8DA 4DZGA 4PU7A 3LQXA 2WWSA 5H9RA 3KT7A 2ARXA 1O5LA 1CN1A 3AXDA 3GCWA 5DRYA 1AHSA 5A7WB 2YHJA 2Y60A 4MVTA 3I59A 5DG1A 4ISRA 1MFQC 5F6KA 3PVOA 4XFGA 3H7YA 2CSGA 1COV2 5F3IA 1ZZ7A 5D8AB 1JODA 4Y26A 5E16A 5ANNA 4NE9A 2QZ3A 4R9DA 2Y6KA 1EPZA 3FFZA 4OHVA 4W8JA 3PUQA 1POQA 4GMP0 1E5IA 1TVGA 1O7FA 3OGRA 4XQ4A 4ZXKA 5HI0A 5KXDA 3CO2A 5ACA2 1B35C 1JN2P 4G3YC 3L9JT 1YC61 3PUAA 1H4GA 3TEYA 1VBE1 3AZVA 1QQP2 1VBE2 2ES3A 2ICPA 2O14A 3CHXA 3OUIA 1C3HA 4Y5Z0 4YW6A 1O3SA 3HN3A 1AXYA 1UIJA 1WZXA 4N7IA 1ULGA 5DABA 3WDXA 5A3UA 4LKEA 1RUH2 2JKBA 2Z79A 3RWNA 3MHZA 5L36A 1XQNA 5B2GB 2YFZA 5EV7A 1ND3B 2G9ZA 2WZR1 2D6PA 3E5UA 3NMBA 2D6OX 4X4HA 1VBD3 3C7EA 4QPIC 5A3OA 1XBFA 5A3TA 2FMDA 5ABJA 1OQEA 4BDVB 1IS6A 4WM7B 3ZFEC 5I0DA 1COV3 3WCRA 1H6XA 4HOOA 4N8MA 2VW0A 4OHZA 1QJU1 3VZLA 1RUJ2 1H2LA 1N1SA 3GZUC 3J9SA 5ACA1 3J8F2 4YLZA 2DVGA 5FY1A 3HZIB 1ZNPA 3N9PA 3IN9A 3OBZA 3PLQA 3RYRA 2R16A 3POSA 4L0PA 1VJ2A 2PYTA 4EQZA 5FKBA 1X8MA 4O65A 4F7ZA 3AMQA 2HCSA 2JDMA 2LYPA 1IS3A 3AVRA 1IKPA 1PRVA 4A7YA 4BQ4A 1XNTA 2JDHA 5L9RA 1NERA 3DYPA 3WP3A 4FP2A 4H3WA 1W8NA 4PIXA 2WZR2 4YG0A 3T08A 3R05A 4YZ1A 5CAZA 3RZMA 3N9MA 1AR82 3DPRB 5FMDA 4DY3A 4B1LA 4JRLA 4FPFA 1W90A 4JTNA 5F5QA 1LCLA 2WS91 4NRMA 1XE8A 2GP5A 3GF6A 4HPKA 4GB31 4MGSA 4FPEA 3U78A 4YZ2A 2ZGUA 5BNNB 5JXHA 4QAWA 4GULA 3POYA 1C4RA 4S2DA 3ST7A 1BK0A 3WNNA 1XRUA 4PIYA 5FY4A 3V0AA 3A9YA 1QQP3 1JYIA 4AFBA 4CCJA 3HJRA 3BTXA 2E7QA 3OGGA 4CU9A 3O1RA 4IEZA 1AYM2 4L97A 4HETA 2D6NA 4CP1A 2WO3A 5BNNC 2PHLA 3ZHIA 2DU1A 5A3LA 1WCSA 2D3RA 3ES4A 5A1FA 1NCRB 2WKKA 4CTEA 4N7UA 2TEPA 4LUKA 3FFQA 3MLLA 5FZ9A 2DV9A 2ZAAA 3RRDA 5JOYA 2FCTA 2IXCA 2VZQA 3AMNA 3U0ZA 1BCXA 2X09A 1BMV1 4JKLA 4D7TA 1CQ9A 3OPWA 4GALA 5K0UA 1PZ7A 1QJEA 3ON7A 2VMCA 5HCBA 1Z78A 2ADEA 1UAIA 4JTOA 1VRH2 2XPJA 1RUI1 1XJAA 1CESA 1NCRC 3ZN4A 4BCUA 4J6GA 5FJKA 1RZSA 2PHXA 2KD7A 4GAZA 3LEIA 1UF2C 1EFAA 2HWE2 4RHV1 4LKDA 3M8LA 1JS9A 4I01A 3VBHA 2PUFA 1E57A 2BBVA 2YY1A 4DQAA 4BQWA 1DGWA 4YFZA 5BY5A 3D1NI 2Q8OA 2TUNA 2UWCA 3MIEA 3KT1A 4FPYA 5BNOC 3KVBA 1F4HA 2RS13 4WVMB 4YSFA 1F15A 1RZRA 3NDBB 1UY4A 2A3YA 2Q1FA 3CQOA 4GJYA 4JKKA 3HQXA 4UI9L 5EPAA 5IK4A 4Q4V3 2C6SA 2VCCA 4KNCA 4ORFA 1ZYBA 3OPTA 5E88A 4O8BA 5A3PA 4XZUG 1NT0A 5FZEA 5FQ0B 1PO23 1S0DA 1OC1A 3O1VA 4OZOA 5L9VA 1CR7A 2V4VA 2ZAHA 1UYPA 4FTEA 1H4HA 2ID4A 5FZ3A 2IXHA 1VBC2 1R1A2 3RGBA 2IZWA 2A1XA 1MS4A 2JG8A 2VNRA 3RMYA 3PDQA 2ATFA 3IBMA 5DAPA 3U1XA 3ZR6A 3I8TA 2VBDA 2DFBA 2VTFA 2EICA 4LO4B 1UU5A 4YZ4A 4EWEA 5KXEA 2PLV3 1W8HA 2NMNA 3N36A 2JE9A 2FQPA 3LA2A 4JGYA 4NHLA 4RR3B 4XIOA 4AI1A 1W6MA 4B3NA 1H1AA 2WZEA 3DEMA 1GR3A 2I07B 2JIGA 4YVSA 4X4IA 3VD3A 5CKMA 2ZGKA 3VWSA 3VHOA 4XCBA 3KL4A 4EN6B 1PGW2 5I8TA 4Z82A 1QOTA 2O1QA 1UWWA 1PRUA 4QX2A 4XACA 1GQPA 3VL9A 5B4NA 1ZPQA 1GQGA 4I0BA 4MG2A 2DTWA 2R7EB 1W9SA 1UZZA 5IHRA 3HBKA 4MYEA 2J1UA 5J37A 4MGTA 2ARAA 3VD7A 4F3JA 3A4UA 3N9NA 5LBBA 3O12A 3OQMA 3PIJA 4CRQA 1L7RA 3S57A 2LLWA 2P4EA 2VU9A 1RJ7A 4HVRA 3ILNA 4LO8A 3WW3A 4TXWA 4PU8A 4BZ4A 4DUXA 1GOGA 2GDFA 1HB2A 3OBRA 3V65A 1SEFA 1BLZA 3CKHA 4L11A 5DXDA 4BISA 3QQ6A 3S8QA 1RVF1 5FR3A 2OX0A 2RR12 4J1XA 1QY4A 3VBSA 1ULDA 5KXCA 1WW5A 3IDEA 1K42A 2OFYA 5HV4A 1R082 1WLTA 1H8TB 3VBOB 4LMFA 1PHMA 2C9AA 2BGCA 1W8TA 3ORJA 2E33A 2XJVA 3MFAA 4DE9A 3AFGA 2D40A 3CROL 1CPNA 1LECA 3DPRC 5IFPA 3ZYIB 3W21A 4ZKTB 4ER6A 1IQDC 3X29B 3ZYFA 2DUQA 2VOVA 3NW4A 5A33B 5CFCA 3OBAA 2CV6A 4IW3A 1GNYA 2XJSA 3PL0A 3UGHA 5C33A 4JVAA 2VVFA 4FSJA 4XBNA 3GHNA 4P9WA 5DAWA 1YIFA 2A6VA 1VBC1 2NLRA 4PI2A 1U0AA 1VB4A 1TME3 2ZGQA 1DZQA 1OKQA 5H9QA 4QPGB 1DW9A 3FBYA 4OLLA 1NCQA 5FZIA 2YG0A 3CZJA 2DU0A 4YW5A 2DUPA 1ZZBA 3SH5A 5BNPC 3OD0A 3RZKA 1GICA 4YFWA 4TZDA 1FYUA 4E2SA 5CFCB 1UXDA 5IJRA 1MS9A 2H0VA 3BODA 3DKQA 2PXFA 1REEA 3UGFA 2R073 1ALYA 2J1VA 4LBJA 3V56A 1TME1 4DIQA 3C7GA 4ONUA 2J1RA 2WQ4A 4DEVA 4RA0A 3WUCA 1V9U1 2Y38A 3ZXGA 2DTYA 3TN92 3AYEA 2VJXA 2D93A 3ZXEA 3ZFFC 1PO11 2PFWA 2RJLA 3LFMA 1GMMA 2LM3A 2X10A 2JWPA 2ZEXA 5GZDA 4LBLA 3WW1A 4N43B 5A7OA 3IWZA 2IXIA 4AVTA 1RUI3 4YW1A 3AC0A 2IVQA 3HMYA 3ZR5A 3U3WA 2R071 4O7XA 3ZN6B 3RZGA 3RZZA 1OF4A 3NROA 2BUKA 3U07A 3UYJA 1JHNA 3RMXA 2CGOA 1GP6A 3VKMA 4HANA 3O14A 4XMAA 3W5NA 1NEQA 4AEDA 3FUOA 4CU8A 1RINA 1KFUL 4YM0A 2HINA 1C5IA 2W1SA 4UBHA 3LAGA 4RQPB 4LA3A 4BHPA 3RZJA 2C0ZA 5LEKA 1PK6B 2OA2A 3IKWA 2VVDA 4DXZA 2EA7A 3VD4A 4NWVA 1ZRFA 3CLCA 2VMGA 2EALA 2PXBA 2W1UA 1RMU3 4EKGA 4JQRA 2LYSA 3JUUA 5FYIA 3VK0A 2V09A 3K4ZA 4N53B 5FZBA 3WCSA 3T2PA 1VAMA 1ASJ3 1NZCA 2W94A 3CZUA 1JI6A 4QMAA 5JZGB 1LAJA 5JMOA 5D8AA 3OCPA 1GV9A 1HW5A 4IV1B 5A6YA 5C71A 3DYMA 1GKBA 2EBYA 3JBG2 1WH8A 3TN91 3ECQA 3KCXA 4H7MA 2GSYA 2AACA 2W95A 4PJYA 1Z7S1 3WDYA 4KWJA 1LTEA 4Q26A 1PK6A 5EYYA 1AL21 4IQPA 4P9GA 2XIUA 4IGOA 3BDNA 5CZKA 5JUVA 4QB1A 4Z92B 4LNVA 3SXWA 1ZVVA 4URTA 4QGLA 1DP0A 4KMQA 1OLMA 3MO4A 4IEYA 3KVAA 1WMXA 5GAHi 2QKDA 2W08A 1JOJA 2OW4A 3LEMA 1Q3EA 4IUGA 2AC1A 4XFAA 2R1DA 5A3MA 2HWB3 3FYAA 4LHLA 5DTQA 2XR4A 5A32A 3SKVA 5LA0A 1ST8A 2N7GA 4B4RA 1J3RA 1GZCA 1NUKA 3K3NA 1W6OB 1EP0A 4IE5A 1MVQA 1WCDJ 1ZRRA 2HWE3 2LS6A 2PUCA 1E5HA 1NX9A 1POV1 3Q9OA 5DUVA 2P5BA 1RL3A 4FPLA 4NPMA 4ZONA 2ADDA 3FHQA 3UV9A 2GNTA 5DMYA 3JD73 1WW4A 2YYOA 2EIEA 5DRTA 3VBFB 5KBFA 4QHOA 4ARXA 3OGVA 3WDVA 2E51A 1PZ8A 1RUD3 2D6LX 4FFHA 1VRH3 3VV1A 3ZPOA 4F8DA 4LJHA 3QYXA 1OLRA 4CCLA 5A7LA 1QJX3 3ZYJB 5C5UA 4XUOA 4QQLA 2PXJA 4QPWA 2VCBA 4YM2A 5LATA 4Q5OA 2MQKA 2PXKA 4LHKA 2YB7A 3T1MA 1W8FA 2C4XA 1ZX5A 2RM21 1HIXA 3AKPA 4Q2FA 4Q4X2 1OHFA 4FBIA 2IXJA 3H50A 4QT6A 4PQ9A 3VHRA 4CE8A 2PN5A 4YG6A 2ZHKA 3H3UA 3GYDA 4D6RA 2ZHNA 1W05A 5FPAA 1ZUGA 3ZN5A 4BYYA 4ER3A 1K5MA 3OEBA 3GN5B 1PVXA 2LYQA 1YRZA 1OT5A 3AP9A 4QB6A 4NUBA 4COZA 2RS31 3QOXA 2ZEWA 2C24A 2H6BA 1QJX1 1UOFA 1Y43B 2AH2A 2NN8A 2PUDA 4FPGA 4YGCA 4E9KA 2BEOA 3O5SA 3PMSA 1YXWA 5ANQA 1V6MA 3DV8A 5A3WA 3DXTA 1GYKA 1VBA1 2P3IA 1EAH3 4FXKB 1VBC3 3ZO0B 5L7OC 3ZMNA 1V6NA 1GU3A 2VE1A 2OQ6A 4A41A 4WZCA 1L3JA 1OVPA 2B5HA 2DFCA 1REDA 2NQYA 4GKXA 3E5QA 3AJYA 3VZJA 3IT8A 1VMJA 3MEJA 3GBGA 3R4DB 3SLIA 2RJ2A 1IPKA 2ZGNA 3AMMA 1GWLA 1WBLA 3NNMA 4NN0A 1OF3A 3JD72 3WEZA 3ZYHA 4AFDA 4E4ZA 5BNPA 3URFA 1CIYA 2X8KA 4CSWA 3FMGA 3O1TA 2J42A 4D69A 3KJXA 2XJQA 4IGQA 3WT3A 2H8RA 4LOSA 2J22A 5C3QA 5K4LA 3GM8A 4ISQA 4I6TA 4K1ZA 1YO8A 4C1XA 2E53A 1V9U3 1YQ2A 1C5HA 3QD6A 5GLZA 1C8NA 4NIAA 5JCTA 2ZGOA 3AJZA 4CCDA 5JLVA 1S0FA 3ZXLA 3BN6A 2B9VA 1VBA2 3HAGA 3N9OA 1JMUB 4JGZC 2YU1A 3DL3A 5LRRA 3VBUB 3WX5A 3BTAA 1LGBA 4FP3A 4GQMA 1OQ1A 4QPGC 3AB0A 3P5BA 2PXLA 4QDQA 1QEXA 1W39A 4XDQA 3WQ7A 1ZA4A 3B9CA 1LENA 4Q0UA 1UOBA 4Z58A 1P8JA 4JDOA 5F5AA 4BK4A 1A3KA 2HBTA 1SQ8A 4XETA 5TSWA 4BPZA 2BGPA 5FK7A 3SX0A 1U12A 2UU8A 5ISLA 1W2AX 2LUWA 5GLVA 4MCXA 2J7UA 2PLV1 1VMFA 3H8XA 4IV3C 4XE9A 4Q4X1 4W6XA 2GMPA 1I1EA 5KHJA 1KITA 1VBB3 2FCUA 5FJHA 3F51A 3W59A 1EAH2 1IPJA 4AK3A 4H2AA 3I54A 3SITA 4AFCA 5DAVA 1BK1A 4COUA 3RZLA 4UYBA 3ZFFB 3RWKX 2UWAA 2VCAA 1RUI2 5C8WA 5J09A 4IEVA 4OUEA 5EP9A 2BQPA 4JGYB 5LB6A 5KR7A 2G19A 2XQRA 1U2ZA 4SLIA 3K75B 1LU1A 1QXRA 4RGKA 4EZIA 1O8SA 3EXUA 1R093 3HNYM 2PXPA 4KWUA 3ROUA 4CDXA 1DYOA 3M1HA 5HCAA 1GOHA 3ZSKA 5F7UA 4H7LA 1PNGA 4QWNA 3M3IA 2AXZA 1STMA 1ZS4A 3CECA 2JQEA 2ZMKA 1SCRA 1T6GC 1XYNA 5BNQA 5AVAA 1W9FA 3NWKA 4UFMA 3WUDA 2BJSA 2B5AA 4NIIA 3MW3A 4UW6A 5T3NA 2C9KA 1HXS2 4ITCA 1XNCA 4HVOA 4WVZA 3EHKA 4NAMA 3HBZA 4Q0QA 4NMIA 2WN3A 3N3HA 3HNBM 4Z59A 3B9IA 3AYDA 4ZU4A 1HRV2 4ATFA 3T0DA 5JR7B 1URXA 4CYDA 4BMEA 5EJ3A 4YZ3A 1GZ9A 1UY2A 1O4XA 1D7PM 4OQ9A 4JQDA 1V6JA 3LDBA 2DF7A 2RDSA 4K20A 4W6YA 2RDRA 2BNMA 4DXTA 3JCIA 2D6KA 4XURA 5JOZA 2XJRA 4CU6A 2D3PA 1NXMA 1BBT2 1OD3A 1QP7A 2GNDA 4FT8A 3U10A 2WSUA 2C5DA 5FFOC 2W87A 1F35A 4I8TA 3INAA 1WBFA 1W2NA 4CDUA 4L8QA 4GD4A 4LIUA 4PIZA 4YGBA 1VB2A 1XNKA 3EYPA 1GZWA 2X5IC 3TNQA 3APBA 4EK9A 2XLFA 3ZOIA 3PVNA 1SBFA 1UU4A 3FLRA 3KHBA 4PF1A 4R4XA 3DCQA 2XCJA 4Q4Y2 1NCQC 4YW3A 3POGA 1E3OC 3NL1A 5HCFA 1LEDA 4CDXC 1F2NA 1HV1A 1UN1A 4MO3M 4MOAA 1POV0 4YVWC 1JOBA 4NWWA 3FLTA 5FZOA 3AL5A 2X29A 3TRBA 5FLHA 3GJAA 1NZIA 3LEGA 2JG8C 2VMEA 3LA7A 1VBB1 1DF0A 3BS3A 5C9AB 2VR4A 5EFUA 3TOJA 4I02A 1K5MB 4UFLA 1G7YA 5BUVA 2XXAA 1AR92 1V00A 2VXJA 2WNEA 2WNVB 3KV6A 4AGGA 4LOTA 4MLOA 3KM5A 2WZR3 4NAOA 5F1RA 2PLV2 2OZJA 1HQLA 1ONAA 4AHWA 3H1WA 2O8QA 1FATA 2XUMA 5LY2A 4BM8A 5LY1A 1XSQA 1QU0A 5CA6A 4CCOA 3NV3A 5FRAA 4Z07A 3NZLA 1QKQA 1X8EA 3MZHA 4XFBA 4IGPA 1J59A 3O0WA 1JUHA 1DU3D 1KGYA 2PHDA 2Y8KA 4S2FA 5CU1A 5JXIA 3BKZA 1XNAA 4XF1A 5GZGA 3ZSLA 1LHWA 2AYHA 4LBQD 5CFDC 3G6JB 3A0NA 3IAQA 5JSRA 2V5DA 1JFTA 1Y7BA 1JH5A 5KHHA 4ZS3A 4FVVA 5DTRA 2E7TA 1EV13 4NIGA 1SBEA 3OBTA 3VHPA 5FXWA 5DAXA 2HYXA 1HDKA 3AP6A 1RUE2 3H0OA 3OF1A 4YYOA 4EN7B 1IHMA 4XMIA 4NRQA 4HMZA 5CADA 5FYZA 1FT9A 4ZU7A 1PMHX 3IM0A 3LF7A 4GMP1 4GHJA 1XNBA 3VDDB 1N3OA 4Z8BA 1BJQA 4LBKA 3B02A 4MHUA 4XTPA 2EF6A 3KB5A 1Q43A 1C1LA 1AR61 3N7LA 3HN1A 5GLWA 1B35A 4BIFA 1RUF2 3VBHB 2HFZA 2Y0IA 3C2UA 2ZEYA 3KF3A 3LKJA 4TLGA 1LODA 1KD7A 3R09A 3ACHA 2J1AA 4PBOA 5FP8A 1W6NA 2WO1A 5DZFA 3P3PA 4XPVA 3RZHA 1HB3A 2Z4FA 3AYAA 2YBPA 4AHYA 1CGPA 1S0IA 3M3QA 4LO7A 3RS6A 3U11A 4XABA 5CNAA 1D4M1 4XEZA 5DG2A 1F5FA 1IPSA 3NXHA 2CY6A 3T2TA 2FDGA 4BQ5A 4FAGA 3MDPA 4IESA 3ZIXA 2XXQA 1BBT1 3N7MA 3WNOA 4Q1PA 5CYYA 3BU0A 2YFUA 3RYKA 3RI8A 1W6OA 4Q4Y1 3UGGA 3QWGA 2ZXQA 1PO22 2WR9A 2A6YA 3H7JA 2YBDA 1YFYA 2JG8B 3MLKA 5M0TA 1HRV1 5FUPA 1WA4A 2JDAA 1TNFA 3WNMA 4LEJA 2VZUA 4LITA 2WN2A 3PVEA 4RR3A 3O0XA 4W50A 4CDXB 2E32A 3OTFA 4AF9A 5A3NA 3NV2A 2ZPXA 1LOFC 3AX4A 2L49A 2AENA 1HXS1 5CFDB 1KRIA 1U5YA 3F95A 3WV6A 4BA6A 4X4BA 5IK8A 1KEXA 2RDNA 4Q2JA 1MEC2 2W1WA 2XHNA 4WVLA 4P9IA 1G9BA 4W65A 2ZA9A 3PNAA 3PUHA 4XF9A 1MS3A 3K48A 1YLLA 4CUBA 2VQAA 1FMD2 2R49A 3VZNA 2WS93 1DIWA 3GNEA 2JE7A 1QJY1 4BQ1A 2WIIB 4M3CE 3DKWA 4BQYA 4CEYC 1D4M2 3GN5A 2VZ3A 4LBNA 3THPA 3LSDA 3NNJA 1HXS3 3QOPA 3LDKA 2VQUA 5F6LB 4DEQA 4TYSA 5JSPA 1XE7A 4FPCA 1SLIA
chains in the Genus database with same CATH topology
2CWSA 1PNFA 2WIUB 2ZMNA 4AG4A 1AX1A 1O4YA 3NAPC 3CJIA 3WOGA 2WQZC 1CAXB 3WXPA 3B5LB 1H2KA 4QPIB 2TBVA 2HWE1 1FXZA 3FE5A 2HWF3 2FHRA 2O4AA 2GC1A 4XJWA 3KXAA 1C8M1 4QHBA 3LZZA 2BPA2 2E9QA 4FTSA 1LKNA 1CIWA 2VNOA 2A75A 2ZHLA 2EXIA 2QDRA 2PHUA 1RB8G 1X50A 2KEIA 1TMF1 3C3VA 4RS5A 3PTYA 2HWD3 2Z5WA 3WNXA 3HWJA 3ETQA 2IVBA 1Q5OA 4XTMA 4I0WB 2R6QA 1F31A 1X36A 3M3OA 4Q0PA 3AP7A 3DF0A 1RUNA 4WZFA 2TNFA 3AP5A 2I45A 3VBRC 4AEKA 2GZUA 1LEMA 2DVDA 2O0OA 3IPVA 4K3UA 4ASLA 4DOUA 2PUBA 1KJLA 2YMZA 1TMF3 2EAAA 1H1IA 1FX5A 3MLJA 1GNHA 2RS53 4GWMA 5C4WC 2OR1L 2JX9A 3ZFFA 2LYRA 5IT6A 3WHUA 1FPN2 4YG3A 3WHTA 5I0TA 1AR91 4MZUA 3EUSA 2X5IA 1AR62 2ZKNA 2R061 1PERL 4QM9A 2W68A 3JQWA 3WP5A 3KS7A 2R0FA 2VOKA 3IPVB 3ZN6A 2OUHA 3OQNA 4OI0A 2V5YA 4QQHA 3JZVA 4OFGA 4S2HA 1QDOA 4HSJA 3ZIWA 4PLOA 2CROA 4CEWB 1ENSA 4X6QB 1CVNA 4Y24A 2OVUA 1EV12 1X57A 2KEJA 1KXGA 1LOGA 3UK9A 1ZREA 3ILFA 1S0JA 3LOBA 1ZBE3 2RS12 4TSVA 3TN93 1X33A 1C8M2 2NM1A 3KQRA 4RGGA 4NDWA 2PA7A 3VZMA 1ZBA1 2RE9A 1FNYA 2SBAA 4P5HA 2ENRA 3L2YA 3G5GA 1SBDA 3ZSJA 2W0XA 3WD5A 1RPEL 4IV1C 3QCWA 4IEXA 2GH8A 4E2GA 5C9AC 4F8AA 4HBNA 4CDUB 5E89A 3O7OA 2KPJA 3HR9A 4X6RB 3KT4A 4Y1YA 1YNAA 2D44A 5FPXA 1VPWA 1A78A 1XU2A 3MEPA 3NO8A 1MACA 2H6CA 3FLPA 4B7KA 3KGLA 1RUC1 3V0BA 1VBD1 5J96B 1DHKB 1JW6A 1GANA 4JGZA 4LA2A 3WDWA 2DCYA 5FAXA 4HK9A 1AU7A 1V70A 1W0PA 2D7FA 1GLHA 4H55A 5C4WB 1YHFA 1FMD1 1AL22 3CJIC 5FDBA 1HRI1 4XILA 4C91A 3VKFC 4OHYA 3OMTA 1YI9A 4EN0A 2R63A 1LHUA 1UPSA 1PGW1 3ZPYA 1XXNA 1WIZA 2CYFA 3B7MA 3V0BB 1X7NA 2Y0OA 5GALA 2UY9A 4HL0A 2BNNA 2GH2A 1LCDA 2D5VA 4MGKE 4CEWC 4X8PA 4LHNA 2RR13 2BFUL 4H14A 1QOSA 1H8VA 3AP4A 2DCJA 3IVPA 1CQTA 1R1A1 3JBG1 1S2BA 3AKTA 1CPMA 3GZTB 1DFQA 4XJAA 4BMBA 5EWSA 1AYM3 3ZXJA 3WQ0A 1RTVA 1G6NA 5F9TA 1JUIA 3D6EA 1MVEA 3CJIB 4GXLA 3NKTA 2VMHA 5AC93 3JU9A 1JXNA 4TWTA 4IEWA 5JPMB 3FZ3A 3OY8B 3VL8A 1QMJA 1YJLA 3AM2A 1ZZ9A 2JCGA 2UWBA 1UKGA 4XFIA 2AWIA 1IGOA 2Q30A 3MIFA 5JZGC 2CSFA 1C28A 4XXAA 3OYWB 2QQPA 4O9EA 4Y1ZA 3THTA 2FZ1A 4XIKA 4L9BA 1QJY3 4RS5B 5AC91 5LK5A 2RS51 1H8TC 3BB6A 4P9LA 1JTZX 1YIPA 3VDDA 3R6SA 5E1RA 2D43A 3JXBC 4G9SB 5BXXA 5L73A 2ETEA 3FHIB 1BQPA 1ULCA 2BWAA 1BDHA 1OD5A 3S30A 3BD1A 1D4M3 5BNOA 2JECA 3N7JA 5I91A 3E6BA 1NOVA 2A73B 1VBA3 1OOPA 2RS32 3HT1A 2UY8A 3LISA 4Q4Y3 3A0KA 5JOWA 3VUOA 1N3PA 4AVAA 4AYUA 1QWRA 4UW5A 5DDJ2 4X4GA 1W0OA 4XJUA 4EV0A 5BYNA 5K8SA 5BV6A 4BE3A 4E4SA 2DYCA 4GB32 2WSVA 5J48A 1DZTA 5GKAC 2VUAA 2RR11 1QNWA 1RHI2 2HWF2 2ZZJA 5EYXA 5A32B 2QNKA 3RJRA 3ZMNA 1ULEA 1VAVA 1LHNA 1OA3A 1W2UA 1AVBA 2QFEA 3D82A 2WINB 3WQ1A 3KMHA 3ZXAC 2WFF1 5AVPA 2ZCWA 3WLUA 2XL7A 1O3TA 1R081 2AUYA 2MEV2 5DZGA 4X4FA 2YROA 3PJQA 4PCRA 4S2GA 1WETA 2R0HA 3IDBB 1OQDA 2PAEA 2Z69A 1UTXA 4KU7A 1QQAA 4LBQB 3RG0A 5I93A 1DGWX 5ABJC 1QJX2 2Q0AA 4AQ6A 1G9DA 4XXPA 4R9AA 3R1FA 2C1FA 5GZEA 4A7ZA 1VP6A 4OVEA 1Z7S2 2OZ6A 1QQP1 4BLIA 1R092 3AMHA 3BIWE 1AZDA 3CL1A 3OD4A 5I0UA 1I9RA 3B93A 5T5OA 1PGL2 1NYWA 1OA4A 1RUD2 2ZX4A 4L99A 4YW2A 2HSGA 4GMP3 1ZBE1 5IUQA 4IEOA 1PO13 1IQAA 3N7KA 2P17A 1TE1B 2Q1MA 4ZU5A 3ZYRA 2HEWF 4PU3C 4BLJA 4K40A 2XI8A 2PTMA 1GBGA 4ES8A 1NY71 1UMZA 1AR83 3EQEA 5GLUA 3JB8A 5T52A 4J1WA 1V6LA 2W52A 2CGPA 4FOYA 5I8SA 1QQBA 1SMVA 1YJKA 2R072 4W6WA 5C8CA 4LO5B 3VKOA 5BNNA 3WDUA 3N4MA 5C9AA 4YG7B 3ZHMA 2D3SA 5CBLA 2WLQA 2DVFA 4FAHA 2D5HA 4XJZA 1AYN2 3AZZA 1JWLA 1V9U2 2PHFA 1H9PA 1LOBA 4EJRA 4HLTA 4TLFA 1AYN1 1DBNA 4DNYA 4IETA 3I2DA 5K9YA 1I5ZA 3ZSEA 3HT2A 1S0BA 3N35A 1CJGA 2BNOA 2PHWA 1LGCA 4DY5A 1VLNA 1RJ8A 2XVLA 1B09A 4Q29A 1X82A 5H9SA 2B39A 1VBE3 2YZ4A 3VHNA 1PGL1 4INDA 4KH9A 5HBAA 3SH4A 4F83A 3ALQA 4WM7C 3NJZA 1UPIA 1R091 1HKDA 1HV0A 1SFNA 1G86A 4OULA 3AKSA 4MGIE 1ZBA3 4XF4A 4FQZA 1D0GA 3TAYA 4XFFA 5HXVA 4K7JA 2WJSA 3JD71 4I6RA 2K9ZA 4CP2A 2VW2A 4GKYA 4WBBA 2JXAA 3J26N 1RUD1 3EJKA 2RMU2 1EY2A 5CIRA 1LJ7A 4NR1A 2YGMA 3E97A 4WVMA 3LWCA 4BWOA 2LYKA 3S6PA 4Q27A 4XF3A 1AR71 4HN1A 4AVVA 3PMEA 5T5PA 4FPOB 3MIBA 3J8F1 2PUEA 5CFCC 4YGEA 1HRI2 1OSLA 1SLAA 2XJ3A 4I6UA 5JWPA 4GIQA 4FO9A 3VBFA 1WUVA 2DUOA 4QGMA 1TQ5A 4JC1A 5J7MA 3TRSB 2R063 4CEYA 3KCYA 3SHRA 2XB6C 4IV3B 2BW8A 3NAPB 3TNPB 4Z5CA 3PJYA 4Z1VA 5FBZA 3VKNA 1OPOA 2W39A 3VZKA 3WG4A 3J8F3 2PHTA 4LE3A 1PIV2 2B7YA 1QJU2 1W6MB 2GNBA 1PRAA 4OI4A 3M7AA 1DQ4A 4MXVA 1FNZA 3M3EA 4B4PA 4YNIA 3GBWA 2O49A 1LHVA 4EROA 4Q8KA 4QGNA 2ZX0A 2OYZA 2VECA 4IV3A 4HPKB 2BWCA 2XG3A 4KG8A 2A7AA 1LMB3 1CAVA 2ZOEB 4YM3A 4O9GA 4GH4A 4M3CF 1WD3A 1Q8VA 2XHKA 1N3QA 2GC0A 3V0AB 5IK7A 1LLIA 1NQJA 2ARBA 5JOXA 2CTVA 1QP4A 1GSLA 2B8MA 4YZ5A 5DDJ1 4AVBA 1BVVA 4HKWA 4AFMA 4WVVA 1ND3C 2YC0A 3USSA 2EWTA 2R042 2P3JA 1BBT3 1RUOA 1HX6A 4XOGA 1C57A 4LT5A 1IS5A 4EWDA 3CLPA 1Y9QA 3OYWA 1RUC3 3OJBA 2Y26A 1LOCA 1D2QA 5GJ6A 3BOPA 3UJOA 2ICTA 2HWF1 3ZXFA 3WG3A 5FO8B 1YCIA 2YXSA 4IA8A 1CAXA 4G4FA 3V64A 2IU7A 1LU2A 4QPIA 1AR72 4XBQA 4RR3C 5L19A 5LRSA 4QU2A 3BALA 4UXAA 4Q4V2 4FOQA 2AZ5A 3ILRA 4HSLA 1MZFA 2EXJA 4C1WA 5JDBA 1ENXA 3OPZA 2BYVE 1JYCA 1F8VA 4IXLA 4FPJA 2WL1A 3RNSA 1QPZA 1O3RA 3KZ3A 2GN7A 2ZGRA 4NHKA 4R4ZA 4DMIA 2ILMA 4KGGA 2BVBA 4D7YA 1L1MA 4MH0E 2Q5TA 3MFCA 4COYA 4RHV2 4X4DA 1ENQA 2IXLA 4MSVA 2VGDA 1YFXA 4K6BA 3UL2A 4Q8LA 5I0SA 1OPMA 2GMMA 4JCXA 4JDMA 4K1YA 1N1YA 2IWGB 2EF8A 3IDCB 1S0EA 5K98B 2ZGTA 4FXGB 4AI0A 1IZ3A 1M06G 4Q4W3 4JDNA 3QBQA 4L92A 1MZEA 1QF3A 3MICA 4MGZE 1AR81 2EIGA 1SLTA 4META 4Y22B 1RGSA 1Z0HA 3ZMOA 4EN8B 2LTNA 3AKQA 4AEDB 1MS1A 5FLIA 3KSCA 3LCPA 1H2NA 3RI9A 4AFAA 1UX6A 4HKOA 5BPXA 2EXHA 1M4WA 1H1MA 2G9FA 1POV3 2WFPA 1BDIA 2A6WA 1XYOA 1ZM1A 1QJY2 3OGJA 4NVPA 2ZKLA 3BPZA 2MPFA 1RUJ1 2CAUA 3JBG3 3R4SA 1GNZA 2CWMA 1OA2A 2ZJCA 3H1MA 3VN4A 5KHGA 1Q8PA 5JI9A 4QX5A 1FI2A 2PUGA 1OI6A 4OZXA 1AR63 2MEZA 1ZBE2 1R1ZA 3B69A 3FWEA 1A8DA 1H8TA 1LOFA 3JQXA 1QXJA 1UIKA 2P37A 3LB9A 1IC8A 2VPVA 2PAKA 2WS92 2JJ6A 2RS33 2XL9A 1UKRA 2CNAA 2OIIA 2QVSB 3B00A 3WG2A 5CG9A 1CAUA 2JEMA 3FBMA 1D4VB 4RS5C 1ZBA2 4HKLA 1G9AA 3LOIA 2NZ9A 3UFDA 2OPKA 4FCAA 4HK8A 4LO6B 4U2AA 3KCCA 3E5XA 4P14A 4OHWA 3MGUA 1C8M3 2PUAA 4IWRA 2Z2SB 3FJSA 4LLFA 1FOD1 2VQ0A 3D8CA 4Z5HA 5CB7A 1RUH1 2R30A 4AE2A 2MEV1 1PM7A 2AR6A 3R0RA 1JH9A 2XWBB 2K0GA 1J1TA 1ZVFA 2ERFA 1UL9A 1Y7YA 2LCVA 2RMU1 4IL7A 5GZCA 2WT1A 3WVJA 5J3UA 4FOWA 3B7HA 1COV1 1H2MA 5AFEA 3E6DA 2R062 1FOD3 1IOAA 4DFSA 1U5IA 1RHI1 1LQCA 4WVWA 2YGLA 1S0GA 5KC6A 2IV1A 2VULA 2Q1ZB 1PZ9A 5KC5A 3LSEA 3CJXA 3JB4C 1YFUA 1RMU2 2XVKA 5T5LA 4Y20A 1WMFA 4AVCA 2XJPA 3MI8A 2JD4A 3RYPA 4XQDA 4MX3A 3RSJA 4E4DX 1NXD1 4UW4A