3SCFA

Fe(ii)-hppe with s-hpp and no
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
193
structure length
193
Chain Sequence
TASTGFAELLKDRREQVKMDHAALASLLGETPETVAAWENGEGGELTLTQLGRIAHVLGTSIGALTPPAGNDLDDGVIIQMPDERPILKGVRDNVDYYVYNCLVRTKRAPSLVPLVVDVLTDNPDDAKFNSGHAGNEFLFVLEGEIHMKWGDKENPKEALLPTGASMFVEEHVPHAFTAAKGTGSAKLIAVNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Epoxidase
publication title Structural basis of regiospecificity of a mononuclear iron enzyme in antibiotic fosfomycin biosynthesis.
pubmed doi rcsb
source organism Streptomyces wedmorensis
molecule tags Metal binding protein
total genus 43
structure length 193
sequence length 193
chains with identical sequence B, C
ec nomenclature ec 1.11.1.23: (S)-2-hydroxypropylphosphonic acid epoxidase.
pdb deposition date 2011-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 3scfA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3scfA02
2GU9A 1SFNA 3G5GA 2PE5A 2IXLA 3IDBB 1LR5A 4IEXA 5I0SA 2CGPA 1ZAYA 3KSCA 2XL9A 1Q3EA 3H3ZA 1LKNA 3FHIB 1QP7A 3VHRA 5KBFA 1O3TA 1J3PA 1YHFA 4HN1A 2IXJA 3HT2A 3SCFA 4KU8A 1EFAA 2ATFA 1J1LA 3E6DA 3EO6A 2PUFA 1OMIA 1ZRRA 2BYVE 2KXLA 3H1YA 5K98B 4N9HA 3E6CC 4HSJA 4MGKE 3H1MA 4F7ZA 4ZU7A 5BUVA 4IEWA 3JXDL 4YG4A 1ZVVA 2ETEA 4QGNA 2HKXA 1IC8A 1DW9A 1UPIA 1YFXA 3CLPA 4UBHA 1O3QA 2F4PA 2MEZA 4META 3EHKA 3E97A 5JSRA 1WH8A 1Y7YA 1RC6A 2CV6A 1RZSA 4IEVA 3ETQA 3SXWA 3WW1A 4JCYA 3CEWA 2XHKA 4ZU5A 1NE6A 3R6SA 1OCTC 2UYBA 2WC2A 3L2HA 1LQCA 1OFNA 3OTFA 2PUGA 1WIZA 2XL7A 2OPKA 1ZZ6A 2MQKA 3U0ZA 3VK0A 2QJVA 4UBGA 2O38A 2XSDC 1GQGA 2OR1L 3LA7A 4PU3C 3O14A 3H9AA 4I8TA 2ET7A 2HSGA 4I6UA 2VPVA 2Q30A 4YNIA 2D5FA 1WLTA 1LRHA 2CROA 1UIKA 2QVSB 3KXAA 4LUMA 1GT0C 3TNPB 2K9ZA 1LB2A 2Q1ZB 1CAVB 3ZDSA 4WBBA 4AQ6A 1X8EA 2IVQA 2D93A 1ZX5A 4LUKA 4XF4A 2H6CA 4J1WA 2PAEA 5J48A 3MZHA 4IESA 3RZZA 1QXJA 3M70A 4ONUA 5FQ0B 4Z59A 1CAXB 1J59A 3SHRA 2AW6A 2PIJA 4I09A 2BGCA 1PRUA 1J3QA 2O4AA 1LLIA 2UY8A 4IEQA 3D0SA 4LLOA 2LYPA 3G7DA 4BIFA 2D40A 4XFAA 3CLCA 3LISA 3I7DA 4AXOA 4Q0QA 3B7HA 2H6BA 1O4XA 1UTXA 3WW4A 5BY5A 1PRAA 4L11A 5KHJA 5I0TA 2DCTA 4OLLA 2IV1A 2CAUA 1SQ4A 3FYAA 1L3JA 5JSPA 5FCCA 4X6RB 3C3VA 5C6CA 2MNGA 1R69A 4IEYA 1SEFA 3S7EA 2N7GA 4XFHA 5I8TA 4I0AA 2L49A 2PUAA 2ZKLA 2OA2A 3IVPA 1J58A 1EY2A 3DN7A 5EFUA 3ROUA 4PIYA 3RDIA 5A7LA 3FWEA 1UCXA 2BEOA 3QYXA 3MYXA 2XLFA 1I5ZA 4YG7B 1LCDA 2GC1A 2Q4SA 1X57A 2JVLA 1JH9A 2EVXA 3U3WA 4HLTA 5F1RA 4XFCA 3E5UA 4PU8A 2P17A 2OZ6A 5FPXA 1NYWA 3FFQA 4KWLA 1XE8A 1POUA 4Z07A 4D7TA 4AVCA 4LEJA 2AWIA 3CO2A 2WFPA 4QMAA 4IEOA 4BH9A 4LA3A 2CAVA 3LA2A 3S0MA 1RGSA 3KZ3A 4ZU4A 4PU7A 2B5HA 4XF9A 3UKVA 1DZRA 2OYZA 5T3NA 3OMTA 3H7YA 1XWRA 4BHPA 4JTOA 3IBMA 4X4HA 2GC0A 3NL1A 2MPFA 3UKNA 1O3SA 1HF0A 4AQ2A 4KL1A 1UIJA 4L2NA 1CGPA 1ZREA 4Q29A 1H1IA 2PUCA 4YBAA 3HQXA 4KU7A 4X4EA 4PJYA 5I91A 1V70A 3QACA 4JTNA 2B8MA 3ZKCA 3LZZA 4IA8A 2UYAA 4Q0VA 3RYPA 3NSTA 4IEZA 3H7JA 5BPXA 2KPJA 2V09A 2GRMA 3PNAA 1CQTA 3BCWA 1O7FA 5CADA 3S7IA 1ZPQA 4AVAA 3FE5A 3H8UA 1CAWA 3ES1A 4MUVA 3GBFA 2LYSA 4FN3A 1R63A 3PLQA 1ADRA 2UY9A 3OGJA 1NZCA 1JFSA 3PVBB 3TRBA 2R1JL 1CAVA 2QNKA 4HMZA 4AVBA 5LRSA 1ZZ9A 3MLFA 4LTAA 5E1RA 2EA7A 2IVBA 1DGRA 1WA4A 4IWRA 1QY4A 1Y3TA 2Z69A 4KWKA 5FPZA 5FQ0A 3UKTA 2XKOA 4QX5A 3OP9A 3IDCB 1X82A 1E3OC 2HINA 4FBFA 2BNOA 3I59B 4Z5CA 4EV0A 1J3RA 2VQAA 2EAAA 3U10A 2FJRA 1QP4A 4XETA 5LEKA 4CYDA 2XLGA 4PIZA 4X4BA 1WETA 3CJXA 4X4IA 1TQ5A 3ELNA 1YWKA 2IXKA 3LA3A 1PNRA 4OFGA 3QQ6A 3BDNA 3EUSA 1QWRA 2PPXA 3GN5A 3OQMA 1QP0A 4O9GA 2XGXA 2XCJA 5JR7B 4FAHA 2FQPA 2XLAA 2AUWA 1ZRCA 4LA2A 5J7MA 4I01A 4XFIA 3OCPA 2AXZA 4MCXA 4YARA 2H8RA 2IVGA 4MV2A 1RUOA 5D1IA 1UXCA 2MHFA 2IXIA 3LOIA 2AXVA 2WIUB 1RPEL 1QQBA 1NXMA 2CSFA 3SCHA 3JXBC 1L1MA 4QM8A 3RNSA 5FDBA 2GRLA 1IPKA 2PAMA 1ZRFA 4I6TA 1PERL 1JFTA 3TNQA 2XKPA 1LMB3 4H7LA 4X4CA 3F52A 3D0JA 4O9EA 1ZZCA 4I2OA 1EP0A 4FAGA 3SCGA 4MGIE 3ZHMA 3FYMA 3BD1A 2ZCWA 5FLIA 1XRUA 2C0ZA 2KEIA 2PQQA 2LYKA 3F51A 1YUDA 2GC2A 1CJGA 1U12A 2GZWA 4NVPA 1DWKA 1QXRA 4YG1A 2HJIA 1HW5A 3QF3A 2FMYA 2PFWA 3PXPA 4XFGA 1GQHA 2PHDA 2ICTA 3H1WA 5JCTA 4J1XA 1PRVA 2D5HA 3JZVA 4MGZE 1G6NA 4WVZA 1VJ2A 2PUDA 4I6RA 5BXXA 2I45A 1NE4A 1FI2A 1Y9QA 1NERA 3KJXA 5E16A 4JCXA 3L1PA 4F8AA 5KHKA 4Z5DA 3H50A 1ZNPA 3EBRA 2GAUA 4XF3A 2XIUA 1RZRA 4HVOA 4MGYE 5CVRA 2PTMA 4R8HA 2GC3A 3EQEA 2KEKA 3IWZA 4KWJA 1RUNA 3NVCA 2B9UA 4K8FA 5I8YA 2LYQA 4HVRA 5I8SA 3OQNA 5LEJA 4LULA 1EYBA 3CF6E 1RL3A 3NW4A 1PMIA 4HSLA 1ZZ7A 3HIFA 3WW3A 3E5XA 5JSOA 3F6WA 1JWLA 3RPQA 2KZ8A 1IPJA 1VPWA 1QPZA 4XEZA 1S7EA 4BYYA 4NDWA 3KGZA 5I0RA 3LAGA 4R52A 2WUSR 5LRRA 4PIXA 1DZTA 1YSEA 3FZ3A 3BU7A 3OD0A 4YRDA 3CROL 1ZUGA 1O3RA 3ZHIA 2O1QA 3WW2A 3S8QA 4GHJA 3LWCA 4Z5HA 4PU4C 1BDIA 4JQDA 2IXCA 2R63A 2QCSB 1CX4A 1ZS4A 4TLFA 4QGMA 3BS3A 4EROA 1YFYA 4I3PA 3HZIB 4IERA 1ZZBA 4A2UA 4EWEA 3ST7A 3B02A 5EZWA 3BPZA 1X8MA 4I02A 2KEJA 4JV4A 1CAXA 1EPZA 1Q43A 3R1FA 4HN0A 1BDHA 5KHGA 2H0VA 4GULA 4QXKA 1OD5A 3JXCL 3I54A 3BALA 3CECA 1YFUA 3D82A 2XJ3A 1CAUB 3KGLA 4QM9A 1WH6A 1I6XA 1RTVA 2ICPA 1Q5OA 3N4MA 2A6CA 3ACLA 2Y0OA 4XF1A 5KHHA 3USSA 2BJCA 2L8NA 3MDPA 4Q0PA 1DGWA 4MX3A 3UFDA 3E6BA 4WZCA 5C8WA 3DL3A 2Q0AA 4FT8A 2IU7A 1X7NA 2Z2SB 3FJSA 4JVAA 2PAKA 4O8BA 2PUBA 1PM7A 1YFWA 2VECA 4XFFA 1VR3A 4XF0A 4N9IA 2PUEA 1QQAA 1YLLA 1RZRD 5I0UA 1SQ8A 1CAWB 2QDRA 5JAXA 2B5AA 2AXUA 4HVQA 3RYRA 4D7SA 4MH0E 1NEQA 4OB4A 2D5VA 4MZUA 3U11A 3KMHA 5KHIA 1LCCA 5CU1A 3LFPA 4X4GA 2E9QA 4I0BA 5K8SA 4Q0SA 4F8DA 3FMYA 4EWAA 1UXDA 2LYRA 1FT9A 2EF8A 3GYDA 5J3UA 1X2LA 2BNMA 4YSFA 1FXZA 4XFBA 3HT1A 3ES4A 1B0NA 1RIOA 2IUOA 3H3UA 1AU7A 3H5TA 3FX3A 1VP6A 5AVPA 5FLJA 2EWTA 1XE7A 4RD7A 4E2SA 4DINB 1O4TA 1H1MA 4P9GA 3BB6A 3OF1A 3IIAA 4X4FA 1UD1A 3EJKA 2BNNA 3MPBA 4IVZA 3M3IA 4ORFA 4Y42A 3GN5B 5I93A 2ET1A 4IETA 1OI6A 2LYLA 3DKWA 4GQMA 2O8QA 4B29A 1O5LA 1OSLA 2LYJA 4FBIA 3KCCA 3QWGA 2JCGA 3SMHA 2GZUA 3D1NI 3E5QA 3CL1A 1JUHA 1O5UA 4EWDA 3NJZA 5FLHA 4HZFA 2OFYA 1WGPA 4QGLA 5BV6A 4YYOA 3DV8A 2XI8A 5HI0A 1ZRDA 4E2GA 3OQOA 4UXAA 2K0GA 3RYKA 4E2QA 3O9XA 2OZJA 3I59A 3QOPA 2LCVA 4X4DA 4Z58A 3NKTA 2PYTA 4X6QB 2EBYA 1UW8A 2O49A 4IEUA 2PA7A 1CAUA 4Q0UA 2GH2A 4HBNA 3DNVB 2PHLA 4MCTA 1ZVFA 4IEPA 1ZZ8A 4Z82A 2IXHA 2IC1A
chains in the Genus database with same CATH superfamily
2Y64A 1SLBA 5FP8A 3G5GA 2PE5A 1UZWA 1ZRIA 4AI2A 4PLNA 1EV12 2CGPA 1ZAYA 2J1AA 1CONA 1KDMA 1UPSA 2IVJA 3H3ZA 4FSJA 3OYWA 4P9IA 1QOTA 3FHIB 1RUF2 4KBBA 4Y1UA 1J3PA 1GMMA 2OUJA 1EV13 2IXJA 2VBPA 2ZS6B 3HT2A 3SCFA 3LPFA 5CZKA 2VMHA 3RJ2X 2PUFA 1ZRRA 2LROA 3HR9A 4AFCA 1RUF3 2ZX3A 1AXKA 2ZOEB 4HSJA 1OF4A 2VOTA 3IPVA 3OEBA 3C7GA 5F7UA 3JXDL 1ZVVA 2XXPA 2ETEA 4QGNA 3O0XA 5B4XA 2WO2A 1JYXA 1HQLA 2F4PA 5L19A 5CG8A 1U5YA 1V6LA 2VNRA 3E97A 5F5AA 1WH8A 2PHTA 1RC6A 3AKTA 2XJTA 2XONA 1QJY1 3TN91 2YGMA 4P9JA 3GNEA 2ZA9A 4WV8A 4JCYA 1AYN2 2VBDA 4XXPA 2W95A 4XILA 5FK8A 2QQIA 4NIAA 2HBUA 5C8CA 2ZAAA 4QPGB 4PHZA 3VBHA 5D8AA 1HRV1 4FI9A 3U0ZA 2QJVA 1GQGA 4M3CE 4BQ4A 2OR1L 5FZHA 3KM5A 3H9AA 4I8TA 2ET7A 2VPVA 4DZGA 2Y6FA 3WXPA 1LRHA 1Q8PA 3HNYM 2QVSB 3WF4A 3USUB 1V6NA 5FZAA 4LK7A 5A32B 1GT0C 4C8DA 2VNGA 5FY7A 4DRRA 1LB2A 1RUC2 3T2OA 1GLHA 1JZ6A 1YYNA 3QCWA 4KG0A 1OVSA 2IVQA 3U78A 4RGKA 4LLFA 2H6CA 2ES3A 2PAEA 1UMZA 5T55A 3VL8A 3VD4A 3M70A 4ONUA 1PIV3 5FQ0B 1STMA 3WDVA 2KR2A 3DPRB 2XQXA 2W1UA 1RVF1 1KJRA 1VE0A 2WFF1 3AC0A 2Z4FA 4L99A 4B1LA 2ARCA 4RS5A 5FZ6A 1LLIA 2G19A 4DY5A 3G0TA 3HVDA 4OUSA 2D40A 4Q4V1 4XFAA 4Y5TA 4AXOA 1W2TA 2EALA 1V9U2 2QUOA 5IWFA 2W1WA 1O4XA 3J9SA 5BY5A 1NY72 3LIGA 1SCSA 4AK3A 4A7YA 4LOSA 2RMU1 2EXHA 5DUWA 5GM0A 4GH4A 2HWD2 4AE2A 3D4KA 2CAUA 1A3KA 1REDA 4FOWA 1C5HA 5JSPA 4S2GA 4X6RB 2KA3A 3HBZA 1LGBA 4JKKA 2YUEA 5EJ3A 3W5MA 3D3AA 1SEFA 1XE0A 1URXA 2A71A 3S7EA 1JU4A 1AYM1 3ECQA 4PDWC 1PK6B 3AMHA 1VIWB 1RHI2 4DOUA 2GMPA 4CCLA 3PURA 3AP4A 5CNAA 4CVUA 1Z7S3 3IVPA 3RDIA 2GALA 1UYYA 5BNPA 2WS91 2BWAA 3T09A 1B09A 2RVAA 3B69A 2BEOA 1R093 4ASLA 2XLFA 1I5ZA 2B42B 4YZ1A 1BVVA 1KQRA 1MS3A 2JVLA 2IFRA 1SPPA 1DBNA 3I2JA 3HN1A 3KT4A 1XSQA 5JUVA 1NYWA 3FFQA 2WYFA 3I2FA 4QT6A 1KD7A 4QMAA 2VOXA 4AZZA 4CDUC 4JQRA 4C0BA 1WMXA 4LA3A 4CDWB 3RZGA 5KXDA 4EZIA 1RGSA 4DRVA 3W21A 3A4UA 5D2AA 4URAA 4XABA 4XBNA 3KT7A 1WBLA 5T3NA 1VBA2 2BGOA 3KZ4C 4LXLA 4XDQA 3U1XA 3GCXA 5T50A 1DQ5A 4BHPA 5AVAA 4DS0A 4E4HA 4JTOA 1NG0A 1O3SA 2ZX2A 1PNGA 5KXBA 1OUSA 2WIIB 2ZTNA 3AL5A 1OHFA 3EXUA 3KQRA 1VBA3 2E32A 3NROA 1VAMA 2YBPA 4KL1A 1UIJA 4L2NA 3VDDB 3A9YA 1JMUB 3NJYA 3HQXA 4PJYA 4YBAA 5CG9A 5FO7B 4M4RA 3QACA 1QEXA 4Q4Y1 2B8MA 5FTTC 4F83A 3EB7A 2RDSA 1CPMA 2D6PA 2AEYA 3ALQA 2RDRA 1OQEA 2QQJA 3LDBA 4KH9A 4QPGA 5GLTA 1J1TA 2D6LX 4Q0VA 3RYPA 3VGIA 3FHAA 3NSTA 3VD9A 2A6ZA 2PN5A 3N7MA 1HXS2 4IEZA 3CJIB 2GRMA 1NA1B 2GP3A 1VBD3 5CADA 3U4XA 2RR12 4QDQA 5DRYA 1MZ6A 4ZS2A 4BK4A 4FFFA 1PO12 5E89A 1OKOA 1HXS3 4FN3A 1PX4A 4P08A 4WM8C 1S0DA 1R63A 2HWB2 1GP5A 1S0GA 1ADRA 1HDKA 3MHZA 3PLQA 4QB1A 2RR13 2UY9A 1JFSA 1ND2C 1PHMA 5FZ8A 4GWIA 1REFA 2VY0A 3PUAA 3PIJA 5E1RA 2VC9A 1F31A 1BYHA 1EV11 2C6SA 5FXVA 4CPBA 2IVBA 1DGRA 1LOCA 1OBNA 2WZ8A 3DEMA 5FPZA 4LIVA 5FQ0A 1IS6A 1WKYA 1RUF1 2XKOA 3I4IA 1NXD1 2YG0A 3NAPC 2D3RA 1YJKA 1X82A 3IDCB 2ZEYA 3DPRA 2RM22 4NN0A 1ULCA 4Z5CA 4Y1XA 4CUCA 4ZXKA 2VQAA 3ACHA 3MEPA 5FZ4A 5CFCB 4S2FA 3U10A 2RM23 3V0BB 3LOBA 3TB0A 4XETA 4DEQA 4CYDA 3R4UA 4HFSA 2PXVA 2XLGA 3AJYA 4ARYA 5FY8A 4JHZA 4BQ1A 3MF6A 2VCAA 3VZJA 1C4RA 2VGDA 2HCSA 3ELNA 4EKIA 1YWKA 1RUE2 3CIHA 3POBA 5C9AA 3QQ6A 1AYN1 4G9SB 5T5LA 1QGLA 1O59A 4WM7A 1UYPA 5IAXA 2PPXA 1RUE3 5HPOA 3OQMA 4MXVA 2XGXA 1JZ2A 4IV1B 4QX8A 1PZ8A 3AP5A 5AC92 4LA2A 1Y4WA 5ANQA 4I01A 5A3MA 2DUPA 1CJPA 3WQ0A 4QPIC 1RUH2 2IVGA 5JOYA 4XAEA 1VPHA 4XZPA 2OXBA 4UW3A 2BTVC 3FMGA 2MHFA 5AC93 4A7ZA 1SDDB 4NIGA 2EICA 3WUCA 4W65A 4XACA 1L1MA 2VW1A 4QM8A 3A7QA 5FZ9A 5FDBA 2C4XA 3AZWA 1RUC1 2R062 5CIRA 1RINA 4QQLA 3RGBA 5A80A 1ENQA 4AI3A 3FHQA 3GUUA 4CCNA 5DZEA 1C1LA 4CEWC 2L9LA 2XKPA 1MS4A 3ZXKA 3OSDA 4GD4A 4Y26A 3SC7X 3ZN6B 3Q8AA 3TBDA 2DYCA 3AJZA 5ABJC 1G9FA 2C1FA 4QXCA 3CHXA 3WQBA 3FYMA 3BD1A 3MI8A 3T30A 2DCJA 1DF0A 3TELA 2FCTA 2LYKA 3M9LA 1POV0 1RUJ2 1TNFA 1OOPA 2CY6A 2WQZC 4LE4A 3ZN5A 1QXRA 2ILMA 4AI8A 1W3XA 5FMBA 1GV9A 4HK9A 1V9U1 1RUJ3 2FMYA 3ORJA 1IKQA 5FZOB 1N3PA 1NY71 3LB9A 5TSWA 1EAH3 1J83A 5FKCA 2HWD1 4J1XA 1PRVA 3JZVA 1W6NB 4XBLA 2PUDA 5BXXA 3OOXA 1YRZA 4ZS3A 5DQ0A 1T6GC 5CAZA 1X36A 5E16A 4JCXA 1RHI1 2XQRA 3B9IA 3KWVA 3O7OA 1MQTC 2Q1MA 5FUNA 3WQ1A 1I9RA 2Z5WA 3H50A 4XJWA 1ZNPA 1BMV2 2WNVC 4OHVA 4C90A 4XJAA 5JVVA 1XPWA 5FPAA 3EYPA 4UWDA 2XIUA 1RZRA 4Q5OA 4AFAA 1LODA 3EQEA 3QLQA 4KWJA 3HN3A 4K8FA 4YLZA 2A75A 3K48A 2VOWA 4UFJA 5JWPA 2RG4A 1H2LA 4CCJA 5K7PA 2JDHA 4GIQA 3GZDA 1VALA 3B3QE 3E5XA 1AUYA 1N1TA 4MVTA 4GB32 4HL0A 2B45X 3ACFA 2EIGA 4Y20A 3LEMA 1QPZA 4YG6A 4YVSB 1GOGA 4ISQA 1W2NA 4XURA 3ZFGB 4BYYA 1B35B 1Y9GA 5I0RA 1CESA 4GB33 5DT2A 4IUGA 2VE1A 3IKWA 1NQDA 1VBA1 5CFCA 3BI3A 5T5OA 2FDKA 3AK0A 1SBFA 3V0BA 5H9RA 1O8PA 1NUKA 4GHJA 2JQEA 4M00A 1BDIA 4FOVA 2IXCA 4LITA 1UWWA 2QCSB 1ZS4A 4JRLA 1VMFA 5LBBA 5CKQA 4EROA 1YFYA 3WLUA 2F4LA 3HZIB 2XXAA 1NCRB 3TYJA 2J1EA 1PZ9A 5EJ1B 2B4KA 3K4ZA 1XYPA 2HWE2 1H8VA 1X8MA 4UI9L 3T2TA 2AH2A 4IV1A 1CAXA 5F32A 1HXS1 1US3A 1QJU2 3KV9A 4JKLA 2XVGA 4V2VA 2HWE3 5DAWA 3VBFA 4EJRA 4AF9A 4ZZ8A 5JPMB 2RR11 3ABZA 1PO11 2VZTA 1RYYA 3RZHA 1OXCA 2HWB1 2XJ3A 4QM9A 4LKDA 1WH6A 2VZUA 3DUIA 2X10A 3S5AA 2WNUB 3OY8B 3ZYFA 1Q5OA 2Y0OA 1RMU2 3USSA 2W91A 4HK8A 4NHKA 3GZTB 3MDPA 4HG6B 3ZN6A 3WDXA 2X53S 3WQ7A 5GZGA 3E6BA 3N9LA 3DCQA 2W9XA 1OLRA 4WZCA 5DN2A 3DL3A 2Q0AA 4NRQA 3AKPA 2IU7A 3B9CA 4JDMA 1X7NA 2RM21 5JI7A 2JIJA 3N9MA 4UW4A 1JZ8A 3SH4A 4EQZA 2VECA 4XFFA 4XF0A 1L7QA 5F6LB 3SEPA 1YQ6A 3C7OA 5FZ1A 2JG9C 4C0HA 2QDRA 4ER3A 4IV3C 5EHDA 2B5AA 4OHWA 2WN2A 2P4EA 4L92A 3LCPA 5FZOA 2VNOA 1AL23 1F35A 1VBB2 4MZUA 3SKVA 3LD8A 2GNDA 5KHIA 1LCCA 5J09A 1FOD2 1RUE1 2K46A 5JXIA 5EJZB 1VBB3 5IVVA 4F8DA 3GYDA 1FT9A 2A3YA 4QPWA 5L7OA 1FOD3 5GAGi 1C1FA 2XHNA 3ZMOA 5LA9A 1W9SA 2JB8A 4LIUA 3JQWA 1D4VB 2PHRA 3AB0A 5AC91 4ZXEA 3A9XA 3H3UA 3GZCA 4NRPA 4P9WA 4LBNA 2CDPA 1MS9A 1RUH1 1SMVA 4CRQA 4BQXA 1CN1A 1NAEA 4QQPA 1WCSA 2A70A 1VAKA 1AR62 2ORXA 3JQXA 2RS53 3ENRA 1UZZA 3VBRC 4E2SA 1XE7A 3DKQA 3TFLA 4DINB 3VDCA 1WD3A 2R061 3P3PA 2XBO2 3N7KA 2P2KA 2TNFA 3EJKA 2VZOA 1F15A 1W9FA 4LBQB 5GZFA 3H3LA 2XBO3 4Y42A 2P6CA 3ZFGA 3BYWA 3I2GA 3AVRA 5BNQA 4UFIA 1S0CA 2AENA 4NPRA 1DQ6A 2ET1A 5FP4A 3GJAA 3T1LA 2WAOA 1ENXA 5FZ3A 3DKWA 1RUJ1 4GQMA 4YG0A 1FAYA 3OD4A 3ZFEC 1OSLA 2LYJA 3KCCA 3JCIA 5B4NA 2JCGA 2JE9A 3V64A 4WVMB 3SMHA 5BYNA 2QFEA 2ZKNA 3MIDA 4NOTA 5FP3A 4DFSA 3E5QA 3WDYA 5JZGA 1OA4A 4FFHA 3WZ1A 2DF7A 1QH6A 2RS32 3VZLA 1NCRA 3GHMA 3N7LA 3VHOA 2GN7A 1OLME 2WWUA 3UK9A 1J84A 5CFDC 1GWMA 1ZRDA 3WOGA 1WW7A 2P5BA 4B7KA 2K0GA 4KGQA 3OGSA 4G3YC 4E2QA 4PDWB 4GXLA 3O9XA 3U14A 4IE0A 1V6JA 3I59A 4CP1A 1BMV1 2NPIA 4Z58A 5F6KA 1LGCA 3NKTA 4QB6A 2PELA 5I0DA 3AKSA 1GP4A 4OYUA 4QWNA 1R1A2 2O49A 3Q8BA 2GMMA 2PA7A 5IAVA 2ZGQA 1GQPA 2GH2A 4XE9A 4MCTA 1ZVFA 5C3SA 1ZZ8A 4JCKA 4Y24A 1R1A3 5GLWA 2UURA 3KF5A 4IE4A 4NHXA 2J7WA 3U37A 2W68A 2IXLA 2E53A 4JGYA 4AGRA 2ZAHA 4OQ8A 4BXFA 2A5ZA 4P9XA 1A78A 2XL9A 1Q3EA 1W6QB 2X5IA 4GB31 4Q8LA 3ZXLA 1H4HA 3ON7A 4CDUB 1SBDA 1GKBA 1QP7A 5LASA 1O3TA 1F9KA 2WA4A 4CXXA 3WNNA 1QJY3 1EFAA 3JB8A 3E6DA 3EO6A 5JOZA 2BYVE 3URFA 5DUUA 2KXLA 2NN8A 4N9HA 4QU1A 4ZZ5A 3E6CC 1FYUA 3UJOA 4RQPC 2VMIA 1S0IA 2VQTA 3FC0A 4F7ZA 4NHMA 5ACA2 1UMHA 2JDAA 4MGTA 1HRV3 2VVDA 4CDXC 1ENSA 3CLPA 5G05L 3MUZ1 4N8MA 3X29B 4BE3A 3O0WA 5JSRA 1KS5A 1Y7YA 1C8NA 5C3PA 2CV6A 1XNBA 2PHWA 1RZSA 4BOWA 1DHKB 2DBIA 5FRAA 3LDKA 2XHKA 1ZYBA 2HWE1 4HPKB 1UO9A 1HB3A 1C28A 2G9FA 3H0OA 3POFA 1E57A 2UYBA 5CKNA 1LQCA 1OFNA 5FPLA 2PUGA 3B5LB 1QJZA 1W8WA 2OPKA 4LMFA 1D2QA 1QJU1 4R9CA 4Y1YA 5FUIA 3VK0A 1WBFA 2LLWA 2HCNA 2EAKA 2Y6KA 2ZHLA 2FDGA 4PU3C 3I2IA 4FCAA 4LKFA 4RN5A 5A7SA 3HJRA 4UYBA 3B00A 4I6UA 2D6NA 1YI9A 2Q30A 3NQHA 3ZR6A 1WLTA 4XUNA 1UIKA 5HCBA 1QZXA 4WM8B 1RVF3 3WP5A 4N43C 4S2HA 2K9ZA 1ND2B 1UF2C 3FUOA 3A22A 4UF0A 1RMU1 3MBWA 1VBE2 4WBBA 2JDKA 1SZBA 3FBMA 2D93A 4LUKA 1ZX5A 3ZXGA 3MZHA 4ES8A 2FDIA 3KL4A 4P9YA 3RZZA 1QXJA 4D0QA 3MGUA 2RMU3 2VTXJ 1VBE3 2OKXA 3WY6A 4Z59A 2D98A 1NCQC 2AW6A 3NAPB 4DXSA 2WQ4A 4BB3A 4QB2A 5IW0A 4DEVA 4ZPIA 2BGCA 4TWTA 1JYCA 1PRUA 1T2XA 4BIFA 4PI0A 4JZRA 5JPNB 4FPEA 2OS2A 4DQAA 4M3CB 2QQOA 3LISA 2PXQA 1RJ8A 3B7HA 4XIOA 1VBB1 5FXWA 1PRAA 3NJVA 4L11A 4AEMA 1H2KA 5I0TA 4XUOA 1JS9A 2WS93 1FOD1 2DCTA 5CFDA 1DULA 4CCOA 1UU4A 4LO5B 1L3JA 4ISRA 5FCCA 3C3VA 2CGOA 3PTYA 1R69A 3ME5A 3ZSKA 4IEYA 5C6CA 3FUQA 2WNEA 5GALA 5CISA 4XYXA 1UY0A 4PDWA 3VBOC 2LTNA 5GKAC 4XFHA 3AP9A 4B4PA 2OX0A 5I8TA 2L49A 4DE9A 2ZKLA 4AI1A 1VLNA 4WZFA 4AAXA 2AC1A 4XUPA 5E6HA 3A23A 4PIYA 3I2HA 3I49A 1WW5A 4QPIB 1V0AA 5A70A 4K1ZA 4D69A 3OPZA 2VZ3A 2DVBA 3KF3A 1UCXA 1AR61 3I2KA 3QYXA 2ZEWA 3MPPG 1IS4A 2BOJA 4GAZA 1PO22 2GC1A 3ZX7A 1SFYA 1JH9A 4Y3OA 3WF0A 3U3WA 1VRBA 3PJQA 4HLTA 2XBO1 5F1RA 1WLCA 1QB2A 3W58A 2P3JA 2P17A 3N36A 2R1DA 1W6PB 1PO23 1UOFA 2EXKA 1W6QA 1E5IA 4KWLA 1IS3A 2OQ7A 4LK6A 4LEJA 1YCIA 2ZGTA 3CO2A 1CR7A 1JOBA 4PBPA 4BH9A 2CAVA 3KCYA 4IL7A 4K9SA 3S0MA 1OKQA 2KM2A 4FFIA 4PU7A 3UKVA 4L8QA 4M3CF 5HCAA 1DZRA 1E5SA 4K7JA 3PVOA 2OYZA 5DTMA 1K5MA 2EXIA 1DZQA 3ZXFA 4E8DA 1YIPA 3H7YA 3ZYRA 4BIOA 3NNJA 1H30A 4DNYA 4X4HA 3HOBA 3NL1A 2YV8A 3GBGA 4SBVA 2NMNA 3O5SA 1DQ1A 2BU9A 4B8EA 1YO8A 2JJ6A 5FP9A 1LHVA 2RS31 1GSLA 2DV9A 4P02B 1N1YA 1W6MB 4KU7A 3AMNA 5HCFA 5FYYA 1SHWB 4JTNA 5J1XA 3LZZA 4MSVA 4HANA 1XU1A 2D6MA 3M3EA 4XTPA 2UYAA 5FV3A 3PIGA 4CU6A 2OUHA 1JXNA 3ZYJB 5BPXA 3CDZB 4V1PA 1MQTB 2KPJA 2V09A 5G04L 4DPNA 1D7PM 4JGZC 1OUXA 1KS4A 1BCXA 1O7FA 1SLCA 2WNVB 4M0NA 2JDPA 3AMPA 2JD4A 3N9PA 1ZPQA 1C8M2 1R1A1 4B3NA 4BMEA 1CAWA 2QQKA 3ES1A 3HPNA 1RUD2 1BEV2 4Z92B 1HB2A 3OGJA 3VHPA 1NZCA 1C8M3 3PVBB 3UL2A 3JB4C 1GZWB 2ENRA 1BEV3 1C57A 3ZSJA 1LOAA 3MLFA 2HH9A 4LTAA 4Y5Z0 1G7YA 4UFMA 1AJOA 2WKKA 4IWRA 5GZEA 3T2QA 4AEDA 1RB8G 5FYHA 4AFBA 4GZ9A 5HBAA 3MEJA 2JEMA 5EWSA 1EUTA 3W9AA 1W9TA 5T5PA 3OP9A 1W6OB 5A7PA 1E3OC 1C5IA 1ASJ2 5FZLA 4EV0A 5LWBA 2VO5A 1AYN3 1J3RA 4GQ7A 3RS6A 5JOXA 3PUQA 2EAAA 2DVDA 5ACA1 4EZ4A 4M3CA 3T0AA 1ASJ3 1MZEA 2E6VA 3T4VA 3H8OA 3DYMA 4XMIA 3V56A 4YW5A 4PIZA 1A6CA 5A3TA 1Q8VA 1UXZA 2QDNA 3CJXA 5DZGA 4K40A 5DAQA 3RVHA 3IDAA 1U5XA 4ATFA 1PNRA 4OFGA 3D8CA 3O1MA 1UX7A 1XNAA 2XG3A 3BDNA 3EUSA 2WNOA 2VW2A 5FYSA 2PHUA 5LA2A 1V6KA 1RUC3 2ZEXA 2BOIA 2CHHA 2XCJA 1QNWA 4O9GA 1XNTA 3TRSB 2XLAA 3ZSMA 2RDNA 4KMQA 2DU1A 4XFIA 2PXKA 1PMJX 3T0BA 3WG2A 4QPIA 4AR2A 2PXLA 3WG1A 5FOBB 1DYPA 1W03A 3NV3A 1UXCA 2J1RA 3NRUA 4MXWB 4XUQA 1MS8A 2WN3A 2AACA 1RPEL 2JIGA 3SCHA 1NXMA 2P3IA 3RQ0A 4ASMB 4HXCA 4R4XA 1AR72 2P6HA 2FZ1A 2PAMA 4QXHA 2XJSA 1VBE1 1W39A 1W6PA 2Z79A 5F5IA 3ZFFC 1ZRFA 4YVWC 1V9U3 3PMSA 4AI9A 5JXGA 1JYVA 4AQTA 3D0JA 4O9EA 4FTSA 1PVXA 1DU3D 3KVBA 4FAGA 3SCGA 2HWD3 3HEIA 3ZHMA 2F17A 4CDQA 4OZXA 3SEEA 5ABJB 4ZKTB 5FLIA 4ZHNA 3RMXA 2ZGUA 3F51A 1YUDA 2GC2A 1U12A 1K5JA 2OIIA 3POEA 2RE9A 1DWKA 1RHI3 2JG9B 4B4QA 1HQWA 5DRTA 4IV3B 4YG1A 4RA0A 1HW5A 4E9KA 3QF3A 1WWYA 2PFWA 4UOJA 1UKRA 2PXFA 3NV1A 4XFGA 4CUBA 3H8RA 2W1QA 3LFMA 5JCTA 1F4AA 2D5HA 4CPBD 1W0OA 1GR3A 3AKRA 4NUBA 4WVZA 5A6ZA 5JDBA 3WCRA 4FP2A 4UFKA 4I6RA 4QKFA 1DLCA 2R32A 1WZXA 2XMLA 3C7FA 5GAHi 3J7HA 3INAA 5DUVA 4JX0A 1UZYA 3MLLA 1SLAA 1NERA 3QH6A 4NMIA 5FZ0A 3L1PA 4OUEA 2LALA 2W5FA 3M3QA 4Z5DA 2WNVA 3K77A 3EBRA 1X33A 1GNZA 1UYXA 3ST7A 4HVOA 4QXBA 1AX1A 1SLLA 3BTZA 2R6QA 2BVBA 1PO21 2BFUL 4HVRA 5I8SA 3OQNA 3VBRB 4LULA 2GDFA 1IQDC 4DXTA 4LKSA 1GZWA 4DB5A 3CF6E 2QQLA 3MF9A 3NNFA 3BOPA 1APNA 2D3SA 1PMIA 3QBQA 1GWKA 1ZZ7A 1Y7BA 4YW4A 5IHRA 5IFPA 2VZVA 1WUVA 4NIHA 2Y26A 5JSOA 1ULFA 4D6RA 4INDA 3LIHA 4UW5A 5K0UC 3O1TA 4RR3C 1JHJA 3I97A 1XXNA 1ALYA 1VPWA 5LBFA 4XEZA 1W6OA 3VZOA 1S7EA 4FOYA 4NDWA 1LHNA 3KGZA 3KQ4B 3ACGA 3MIGA 5LRRA 1LOFC 3ZPXA 1JUIA 4PI2A 3NO8A 1YQ8A 5GLZA 3ZFEB 1QJX2 3OD0A 1ZUGA 1YEWA 4EN7B 3ZHIA 4X8PA 1W2AX 2UWCA 5EIYB 4IE5A 3LWCA 3USUA 4CU7A 5A32A 4PU4C 3HMYA 4QKBA 4Y1ZA 5A7OA 5A3PA 5CA6A 3VD3A 1MZ5A 1QJX3 2R042 4N90A 3ZYGA 1SLTA 1PO13 4YFWA 4I3PA 5EXOA 3VDAA 1H1AA 2HWB3 2VCBA 1BK0A 3AYCA 4AHYA 4BQYA 5EZWA 2AUYA 3K51A 2ARXA 5FZBA 3A0KA 4F3JA 1AR82 2JE7A 3IN9A 1V6IA 5DPNA 2KEJA 5FZIA 3WCSA 4BLIA 3AM2A 3ILRA 3PMEA 1PGW2 4JV4A 4YM3A 4UW6A 3T4HB 2VCCA 4XXAA 4A6SA 3R1FA 5A3LA 2QTWB 4HONA 4GULA 5KHGA 1LOBA 4BISA 1C8M1 3NNMA 2A3WA 3I54A 4FO9A 4LQRA 1RUD1 1BEV1 3CECA 1YFUA 3NNLA 4IGOA 1CAUB 4KNCA 4A3ZA 1GWLA 2VZSA 5FPBA 3ZYBA 4QHZA 3C7EA 1JZ7A 5FP7A 1OQ1A 2OPWA 2QZ2A 4XF1A 2BJCA 2Y33A 4A4AA 2I07B 4U2AA 4FPYA 5BNOC 1OH3A 3UFDA 3OUIA 4PQQA 3ZXDA 5C8CC 2HLEA 2Y60A 1TE1B 3BPSA 4FT8A 4URTA 5E8AA 3VBHC 3ZR5A 4EN9B 5ABJA 1PK6A 3J26N 2VD7A 1ASJ1 1BQPA 3WVJA 2JENA 1PM7A 1YFWA 3R4SA 2Y38A 1VR3A 2XJVA 1HLCA 1QQAA 4OI2A 4CU9A 1RZRD 1QF3A 2JG9A 1QKQA 1I5PA 3N3HA 3CZJA 4LBOA 4RQPB 4IV3A 3I3DA 4OULA 4H55A 2AXUA 5IVEA 4D8MA 4BK5A 2G1MA 1FPN2 2F6BA 1HX6A 4YW1A 4L9BA 4AVSA 4MH0E 3U11A 4CDXB 3KMHA 3FLPA 1RUH3 1YQ5A 2CGNA 3PUSA 3LFPA 2IZWA 4X4GA 1V00A 4ZY9A 5A6YA 3AMMA 1FPN3 5K8SA 4X8NA 3T3YA 4Q0SA 4D7YA 1CZSA 3SH5A 4M4PA 4YW7A 2VZPA 2LYRA 3APBA 1G9DA 3A9ZA 1WMEA 1X2LA 5JR2A 2R063 1UN1A 2BNMA 2ZMKA 4YPJA 4CDWA 4DXZA 4BA6A 4YSFA 5M0TA 2VVFA 1FXZA 4CEWB 3HT1A 4AGGA 4RS5C 1RIOA 3KD4A 4FOQA 3TOJA 4QX2A 2UU8A 4XVHA 2YBSA 3H5TA 3FX3A 1L7LA 1W8ZA 4I3GA 4NJ4A 1QNYA 3A0NA 4I0WB 2DCZA 3BN6A 5LK7B 5FLJA 2J1VA 2VMCA 3VBRA 4JAAA 4E4SA 4N43B 1AR71 2VQUA 3BB6A 4QKNA 5DAXA 4LE3A 3UJQA 3VDDA 3WDWA 1QIQA 3AZXA 3IIAA 4XMAA 4LT5A 3PTRB 3Q9OA 1H9PA 4RFT0 2BNNA 3MPBA 1KXGA 5L36A 2L1PA 4IVZA 3SX0A 3THCA 3C2UA 5DAVA 1YQCA 3GN5B 2ZABA 4WVVA 2P3KA 4COYA 4FTEA 4L97A 1Y9MA 2QQNA 2W92A 1NCQB 3BGAA 3CJIA 1MR5A 1NA1A 3MV01 2CU5A 5BNPC 2WRAA 4B29A 4CP9B 1F5FA 4DUXA 4ES9A 4G4FA 3OGRA 4PCRA 2UWAA 4N53C 2JB4A 2XJRA 4FQZA 5FXXA 3VDBA 3CL1A 4QHBA 1O5UA 1R64A 1W8OA 3M3OA 3RI9A 2QZ3A 5IVYA 4EWDA 2V72A 2QBXA 1US2A 2OFYA 4HZFA 4GWNA 4AEKA 1Q56A 3DV8A 2WJSA 4AWDA 1O6UA 1XNDA 1G86A 4XC9A 2Q8EA 3LFIA 2WBKA 4Y22B 5FYMA 3RYKA 1VRH2 3VBOB 3THDA 1MS0A 1HN1A 3POWA 3QOPA 4M01A 3HNBM 1HB4A 2PYTA 3O1UA 1U2ZA 2EBYA 1W90A 3QH7A 1VRH3 4FPHA 4YZ5A 3N9NA 4EK9A 1CAUA 2ZXQA 4AYUA 4HBNA 3DNVB 2WA3A 1CPNA 3P1IA 3CZUA 3M2MA 4BLJA 1JW6A 2IXHA 3ZYIB 2GU9A 2WT2A 1T6BX 3IDBB 1ST8A 3UGFA 4XQWA 3RSJA 1CVNA 3GF6A 5I0SA 2VEOA 4MGSA 2ADEA 3KSCA 3LSDA 3WD5A 3HNMA 5SV8A 5AFBA 2C24A 4KQ7A 2HYXA 2TBVA 5FMOL 4HN1A 2M4HA 2I2SA 2VH9A 3AP6A 3ACIA 4KU8A 3VBUC 4RL7A 2P3YA 2ATFA 1J1LA 2J1SA 5BNNC 1OMIA 5F5CA 1H2NA 3H1YA 4XPVA 5K98B 2YPJA 3WG4A 1IG0A 2W46A 3VHNA 1QJX1 2VU9A 4RQPA 4YFZA 5FY1A 5L73A 4HKWA 5F39A 3IB3A 4IEWA 5C4WC 3MIBA 1QJU3 4YG4A 2HEYF 2PMWB 4E8CA 1IC8A 1A8MA 1LECA 1YFXA 5IVFA 4CDXA 2CL2A 3THTA 2BERA 2YU1A 4HKLA 2R041 5EPAA 1O3QA 4XBQA 2MEZA 4XJZA 3EHKA 3MICA 1W8HA 4E4DX 3T08A 1HB1A 2XXQA 3WP4A 3VZMA 1DFQA 4EN6B 2YFZA 4IEVA 4OUMA 4CU8A 3WW1A 2MEV2 4LKEA 1DCSA 3R6SA 1NE6A 5B2GB 1AR81 2UWBA 1OCTC 1GYKA 1VMJA 1PGW1 1RMU3 2YY1A 3OUJA 1MFQC 2MEV3 3P3NA 5IFTA 2V3CC 1ULEA 2EIBA 4PF1A 4UBGA 3AYDA 2O38A 5IK7A 3I3MA 5DSXA 3LA7A 2Q5TA 2ZHNA 3O14A 4JGZB 5JOWA 5FBZA 4CEYC 2E33A 4LR4A 3S57A 4LUMA 5FREA 5IYYA 3OPWA 3N9QA 3TNPB 3FLTA 4N43A 3K75B 2RS12 2ZMNA 5DDJ2 4MHRA 4D6QA 5C3OA 4EZHA 4FPLA 5C9AC 1CAVB 4DY3A 2XDVA 1GUIA 2Q1FA 2R072 1W6NA 4AQ6A 3OEAA 4R4ZA 3BTAA 4WM7C 5J48A 4J1WA 2BFUS 3MLJA 2JDUA 5I0UA 4TXWA 5F3CA 2B9VA 1H8TC 2R073 3SHRA 1NCQA 2PIJA 1G9BA 4AG4A 3ZSEA 4PLMA 4CP9A 4E4ZA 2E7AA 3MUY1 5FYTA 5FR3A 2O4AA 4IEQA 3FFZA 3OKZA 1WA6X 1ZA7A 2AR6A 2WQ8A 5KC5A 2VXRA 4OQ9A 3I7DA 1FPN1 4GMP0 2B7YA 4A3XA 1IZ3A 2DTYA 1XBFA 3RWKX 2QQVA 3ZDVA 3JXSA 2VW0A 2DUOA 4GKYA 2IV1A 1R082 4W6WA 2JKXA 3FYAA 1AR63 2NMOA 1I3HA 3HBKA 1W04A 4Q8KA 3SH3A 2AYHA 1GZTA 3ITQA 2VM9A 4YVSA 3C8XA 2N7GA 3VBOA 2D44A 5J36A 4PT6A 1B35A 1JH5A 4I0AA 2OA2A 1OOPC 3CU7A 3ROUA 4IW3A 1XC6A 5FXZA 1NW3A 1Q8QA 1GFF2 1F5JA 4IE6A 2Q8DA 1ZBA2 3VBSC 3O1RA 1OA3A 2VUAA 3FWEA 4TYSA 5L9VA 2ZZQA 1VAVA 2Q4SA 1X57A 1ZM1A 1DQ0A 2B46X 3MW4A 5DAPA 3V0AB 4Q2JA 5ANNA 4BMBA 3E5UA 1JHNA 2ZX4A 4J6GA 3ZFFB 3R4DB 4YVWB 4D7TA 2PXEA 3M3CA 3H42B 3MW3A 2HYKA 1DDLA 3AXDA 3LA2A 2PLV2 2JICA 1YXWA 1VBC2 2RS33 4XJ9A 3I8TA 3KZ3A 4ZU4A 3SNMA 2B5HA 4XF9A 4YM1A 2JG8C 4NPMA 2XWBB 4QX0A 5F3IA 1VBC3 3OMTA 2NM1A 3J7NA 3IBMA 5LBEA 1YNAA 3MIFA 2EIEA 3B01A 3WINE 2LNMA 4LJHA 2ZGOA 2WNUA 3OY8A 4FPKA 1ZREA 4YM0A 4Q29A 4AFDA 4TN7A 1PMHX 2WSUA 3K2OA 3WNXA 3GZDC 2PUCA 5I91A 1QU0A 4X4EA 5C3RA 3D6EA 4QKDA 3WNPA 3ZKCA 1JBCA 1W8TA 2DU0A 4AQSA 4IA8A 4NAOA 3IAPA 4R9DA 1S55A 5H9PA 1POV3 1U5IA 1UU6A 3PUHA 1VRH1 4H2AA 4JDOA 4CCDA 1BBT2 2FHRA 1CQTA 2O8OA 3BCWA 3PNAA 4JGZA 3WSOA 4LO8A 3PE5A 3S7IA 3FE5A 1NLSA 3TEXA 3RZKA 3GBFA 3POIA 1BBT3 1GNYA 5FBJA 3NDBB 1HRI2 4CXYA 2PXUA 4EYUA 5F2SA 5FWEA 1G9AA 3TRBA 3THPA 1CAVA 1OC1A 1H4GA 5ACA3 5A33B 4LPLA 1RUG2 5LRSA 1DLLA 1ZZ9A 5GLVA 2EA7A 2YDEA 3EMRA 2CDOA 3MFCA 3OBRA 1QY4A 1SFPA 3K46A 1ULGA 1WLDA 5FYUA 1LEMA 5FYZA 1QOSA 2XVLA 3UKTA 1RUG3 4RR3B 5K0UB 4XAAA 3OG2A 2HINA 2BNOA 3VBFC 1DGWX 2JDZA 1MZFA 2J1TA 1CJDA 2R1BA 1JODA 4HT1T 1UY4A 2WZR2 3I3EA 2FJRA 2WZPP 3WF3A 1QP4A 3OGVA 5LEKA 1NT0A 4DE8A 4X4BA 3TEYA 3CNAA 2VG9A 1LNSA 1TQ5A 2ZZJA 2PHXA 2R0HA 2YFUA 2IXKA 1D0GA 2WT1A 2MEV1 4XDPA 4PBOA 5C5TA 4LBQA 3JD72 3N9OA 1MVEA 2VTXA 5KXCA 3QFIA 2VZ1A 2HWF2 2RDQA 4LNVA 4BQ2A 1QP0A 2B39A 4TTGA 2FDFA 1SLIA 2DCKA 2DDUA 1AVBA 2FQPA 5JR7B 4FAHA 5FO9B 2AUWA 3TEZA 1ZRCA 1DGRN 2WZEA 3JD73 2RJLA 2JE8A 4FFGA 4COWA 3GM8A 2HWF3 3M4FA 1W99A 3OCPA 2GNBA 2AXZA 4MCXA 4YARA 1KDKA 4MV2A 3IPVB 3ILNA 3NWKA 1DIWA 4UFLA 4EKGA 4WVMA 2Z42A 3LOIA 2AXVA 3TEPA 2WIUB 3ZSLA 1QQBA 1UQXA 3JXBC 3V0AA 3RNSA 5DDJ1 2RS11 2GRLA 4FPOB 4BZ4A 4A6OA 2CYFA 4I6TA 1PERL 3O12A 2QKDA 2R071 2TEPA 1QJFA 1CIWA 2HEWF 3L9JT 3TNQA 3ZFFA 3BIEA 1LMB3 4H7LA 4M0HA 4X4CA 1NLRA 5L7OC 3F52A 5A6QA 2D6KA 3WDTA 5BNOB 5FYBA 2FCUA 1XNCA 5C8CB 1WW4A 3VBHB 5E88A 2W39A 5C5UA 4WVLA 3DYPA 4XHXA 3VWSA 1XRUA 2C0ZA 2KEIA 1OD3A 5J96B 2PQQA 3QOXA 1OSGA 1K12A 3MV11 4EN8B 2FFHA 1QQP2 1W05A 2GZWA 2WT0A 2NYYA 4XW3A 2VL4A 5FMOS 5IJRA 1W8NA 3MFAA 5A1FA 3PXPA 3GGLA 1GQHA 1K45A 4NHYA 5JMOA 3VD7A 2W87A 2PXBA 3Q8EA 1R081 2BGPA 5EP9A 2H0BA 1S0FA 1EUUA 4BXSV 2YPDA 1VJ2A 3LE0A 1VB4A 1XOYA 3U07A 2I45A 4P9LA 1NE4A 1FI2A 1Y9QA 3SLIA 4IDZA 1E5RA 1ONAA 4CDUA 1F2NA 1LHUA 3WX5A 1JYNA 2BBVA 5F8PA 2XJUA 2DVGA 2JX9A 5KHKA 1JU3A 1AL0G 5DZFA 3IDEA 2P34A 4RS5B 3RMYA 3WNLA 5CB7A 4AHXA 1ZBA1 4FXGB 3BVCA 5CVRA 5A1AA 2PTMA 1RUNA 2GC3A 2XJQA 3IWZA 4Q2FA 1W06A 2B9UA 4OHZA 5I8YA 2LYQA 5JZGC 2ARBA 2E63A 2EXJA 2BRTA 2V73A 4Q4W2 5A33A 3PVEA 4EN0A 4BQ5A 3T0DA 4HSLA 3HIFA 4LBJA 4AVVA 2P37A 4QX3A 3AVSA 2VMGA 1LOEA 3F6WA 3RZLA 2Y6JA 4HPKA 2AEZA 4IGPA 5K0UA 2KZ8A 4RR3A 3RPQA 1IPJA 4KGGA 2PLV1 2E26A 1VBC1 5FAXA 2J1UA 3MW2A 5FZEA 3RG0A 1REEA 2W1SA 4ER7A 2WYSA 4R52A 2WUSR 4PIXA 1LOFA 1DZTA 1YSEA 3FZ3A 3J8F2 3I3BA 3ZOIA 5BNPB 3ZM8A 1RJ7A 5DG2A 4YRDA 1U0AA 3PUIA 4W6XA 2O1QA 3R05A 3WW2A 5LY1A 4N53B 4WM8A 4Z5HA 2C5DA 1JZ5A 2VULA 2QQUA 2R63A 1SPPB 1CX4A 3IIIA 5A7QA 2FDJA 1ND2A 1QMJA 1PGL2 4JGYC 1QDCA 4YWAA 3B7MA 4YGEA 2A6VA 2WDBA 5KR7A 1RUD3 1POV1 1CQ9A 4IERA 1ZZBA 4A44A 3WG3A 4A2UA 2X5IC 2J7MA 2ODRD 3LKJA 5LATA 4EWEA 3B02A 3UYJA 3NV2A 5FIXA 1LEDA 3BPZA 4I02A 1OF3A 2VBBA 4ITCA 4XJUA 2HFZA 1S1AA 4K3UA 2W2IA 1OLQA 1EPZA 1UZVA 3NAPA 4A45A 5K9YA 1BBT1 3J7MA 4OI0A 4YZ4A 5FY9A 1PGSA 1YC61 1AJKA 3GJBA 1JTZX 1OD5A 3JXCL 2D3PA 2ZPXA 1TME2 3BALA 4CTEA 3D82A 3GZEA 4GJZA 3KGLA 1HRI1 3S5QA 4CSWA 1MACA 3DECA 4B1MA 4YZ2A 5HV4A 3KCXA 3LGRA 1RTVA 4RYDA 2YXSA 3KT1A 1JZ4A 5APAA 5CBLA 2YC4A 3N4MA 1FNYA 1TME3 2NP0A 5IUQA 1RUG1 3D5OA 4LORA 4QQHA 1IPSA 1S0BA 4RGGA 2W08A 1ZBE2 2NLRA 5T5JA 5BNOA 4MX3A 3UT0A 5C8WA 3BOWA 3KVAA 3WNOA 3K3OA 3WV6A 4GALA 2Z2SB 3FJSA 2Y6LA 1ZBE3 1GBGA 2PAKA 1AX0A 3OBAA 4JKMA 3VBUB 1D4M2 2Y34A 3AKQA 1LU1A 3GALA 4K21A 5BNNB 4N9IA 4AHZA 1GZCA 2PUEA 1DG6A 1MEC2 3BTXA 2WZR1 1HV1A 1SQ8A 2R0FA 5JMCA 1PVC2 3PHMA 4NPLA 4XCBA 3POGA 1D4M3 3ZN4A 4HVQA 5C4WB 1NOVA 5F37A 1MS5A 3VKMA 1MEC3 4D7SA 4LBLA 1NEQA 4OB4A 4Q27A 1GICA 3DM5A 4GWMA 1PVC3 4OI4A 1PIV2 1Q8SA 4DUWA 1NQJA 1XYOA 1LCLA 4K1YA 1SG3A 2G9ZA 1XYNA 3HAGA 1BHGA 4QPYA 5LK5A 4CEWA 1RUI2 1BVP1 4EWAA 1UXDA 1X9TA 2D97A 3JD71 5J3UA 1RITA 1AR73 2HWF1 5LBCA 5FYCA 4L0PA 2V4AA 4B7EA 2W52A 3KLSA 1RUI3 1LTEA 2V5YA 1B0NA 1O4YA 5FZFA 5J98B 5K4LA 2YU2A 3GCWA 1XQNA 1VB2A 3POSA 1TNRA 4PF5A 3ZXJA 4CEYB 5HV0A 3NMBA 1W0NA 3P5BA 2EWTA 2Y6HA 4RD7A 1O91A 1O4TA 1X50A 1H1MA 1FMD2 1RXFA 4P9GA 4Q4X2 4AAPA 5C9AB 2ZGPA 4GWJA 4OCTA 1AX2A 4AL9A 1IQAA 4LO6B 1W6MA 4X4FA 2VR4A 3OBTA 1UD1A 3O1OA 4D94A 3VZKA 1Z7S2 3U4SA 3WNMA 1FMD3 3M3IA 1S0JA 2D43A 4ORFA 2E7TA 4Q4X3 4WM7B 4YZ3A 5FK7A 5A7WB 3WT3A 3LPGA 2ERFA 1H8TB 4FQ4A 5I93A 1R092 2EIDA 3GDBA 1MQTA 5JUWA 4YGBA 1OI6A 5GZDA 2CWSA 3Q8FA 1NZIA 1TZOA 3KHBA 1QQP1 2ZGMA 5L9BA 1H9WA 5H9QA 3QWGA 5JIUA 4EQVA 2XXZA 1QDOA 4FPCA 3VKFC 1CZTA 3VL9A 4DXRA 3B93A 4N53A 5A3NA 2XUMA 3AZVA 4P5YA 3D1NI 2D6OX 4E27A 1C3HA 2ID4A 4YW2A 5JIAA 5FO8B 2A6YA 1CWPA 4P5HA 3AFKA 3P6BA 1ND3C 4MHUA 4AHWA 2A7AA 4ARXA 2HBTA 4JDNA 5GJ6A 4BQWA 1N47A 4YYOA 2XI8A 4PQ9A 4MGQA 4E2GA 1JOPA 3DXUA 2R7EB 5GLUA 3VLBB 4JQTA 2J7UA 1W2OA 1CX1A 2OW4A 3T2PA 3TAYA 3ZVXA 1M4WA 2LCVA 1K5MC 4X4DA 2LRPA 2BV4A 4UFHA 1MPXA 1OOPB 2G9GA 2BQPA 1XNKA 3DXTA 4R9AA 1D0HA 1UW8A 4X6QB 3SQOA 3VBSB 5C71A 1EPWA 3WF2A 1AHSA 2PHLA 4BDVB 4P14A 4OHYA 2LLVA 4Q4W1 2AZ5A 4Y1VA 2IC1A 2YZ4A 4XFBA 1SFNA 3M7AA 2X05A 4EE2A 1AR92 1LR5A 3M8LA 5LCWL 3Q8CA 4IEXA 4LOTA 1LKNA 1VBD2 3VKOA 2R043 3JBG2 2A3XA 4QU2A 3AXEA 4GMP1 5FUPA 5FOJB 3VHRA 5LZ6A 5KBFA 1AR93 2JDMA 4AW7A 1YHFA 3VBUA 1KRIA 1QH7A 3JBG3 2JG8B 5BNNA 5IVBA 3J8F1 1W3VA 1AR83 2WINB 5H9SA 4MOAA 1W9WA 4MGKE 3H1MA 3DF0A 4W8JA 1LOGA 4ZU7A 5BUVA 2QQWA 5C4WA 2IUWA 2YHJA 4MXWA 4A7KA 2PXDA 4DMIA 5EYXA 2ZHMA 2HKXA 1DW9A 1UPIA 4HETA 2XPJA 4UBHA 3T1MA 2DWRA 3PL0A 4META 1PGL1 2LW8A 3IAQA 4RFRB 2YYOA 4N7UA 2ZACA 1GOHA 3H8XA 3ETQA 3SXWA 1R1ZA 2ZGKA 4AEDC 5FZGA 1OURA 2FCVA 3CEWA 4ZU5A 4Y20B 3NZLA 3ZPOA 1KGYA 4ATEA 2WC2A 3L2HA 5IK8A 3OTFA 1WIZA 2XL7A 4FPGA 4OHXA 5D8AC 5LA0A 1ZZ6A 2MQKA 3ME2A 4CCCA 2XSDC 2ZGNA 4TSVA 1Z78A 1W9YA 3BKZA 2JKBA 3N35A 3O1PA 4YNIA 2HSGA 3PDQA 2C26A 4Y5SA 1WMFA 1TME1 2D5FA 2GH8A 4CEYA 2CROA 4CP0A 4RGAA 2C9KA 3KXAA 2VCMA 3HWJA 2DURA 5EYYA 2BW8A 1UU5A 1SCRA 1POQA 1KFXL 1N3QA 2RJ2A 5IT6A 3LEIA 1HJFA 2Q1ZB 1FATA 5KWRA 3ZDSA 1ULDA 5T54A 2BJSA 4D6SA 4KWUA 2R30A 2XUEA 1X8EA 1ZBE1 2YB7A 4XF4A 4CUGA 4GA9A 2R49A 5C7GA 5A7WA 2GP5A 4IESA 4DUVA 3PVNA 4UT5A 5DABA 2PHFA 1HQ1A 1H8TA 1CAXB 1NLQA 1J59A 4OVEA 1CIYA 1S2BA 2VOVA 4I09A 4MO3M 5FKBA 1D4M1 4K20A 3VBFB 2XR4A 4N7IA 1MEC1 2SBAA 1J3QA 3PU3A 2P1BA 2UY8A 2A73B 3D0SA 4LLOA 2LYPA 3G7DA 1PVC1 3CMGA 1JN2P 4NO4A 2ADDA 3VN4A 3E1F1 5C70A 2E7QA 3CLCA 3LF7A 2WUHA 4Q0QA 3F2ZA 4NWVA 2H6BA 3KHCA 1UTXA 2VMDA 3PJYA 3WW4A 5KHJA 2CTVA 4QDRA 3S30A 1PIV1 5FMCA 4GH4C 4OLLA 4NIIA 5CKMA 1SQ4A 4S2DA 3KS7A 1TVGA 4FPJA 3K4DA 3O1VA 2MNGA 1RUI1 1IG3A 4JC1A 2YROA 4OZOA 1OA2A 3GZUC 3OB8A 4H7MA 1SBEA 4CA9A 4CDQC 4CCKA 3ZIWA 4V2WA 1QXPA 4XQ4A 1WCKA 2DBNA 4OBMA 4YG3A 2JECA 3J4UH 5FZ7A 4NROA 2BBAA 4CE8A 2PUAA 4ZONA 5EFUA 1H6YA 1J58A 1EY2A 1WD4A 3DN7A 4TLGA 1BZWA 3W20A 5A7LA 1EAH2 3VBSA 1L7RA 1PZ7A 3ZFEA 3FBYA 2VMFA 2VVEA 2Q8CA 2BP6A 3MYXA 1HKDA 4YG7B 1LCDA 2V4VA 3UGGA 3LEKA 1UAIA 4OMDA 3ZYPA 1UZ0A 2EVXA 1FMD1 1ULOA 4I30A 4Q4X1 1UOBA 2X8KA 2XJPA 4XFCA 4PU8A 1WW6A 4QQ2A 2OZ6A 5FPXA 5FWJA 2DUQA 3SR4A 4YGCA 1XE8A 1POUA 3B94A 1Z7S1 3DGTA 3ZYHA 4AVCA 5IK5A 2AWIA 2WFPA 2YC2A 5L7OB 2WAAA 3HQUA 4IEOA 4QHOA 4IE7A 2QE3A 4IQPA 4XUTA 3ZKUA 2BWCA 1R091 1KJLA 2GN3A 4OMCA 5JI9A 2JG8A 1H2MA 1LESA 4B4RA 2K2SA 3MIEA 1BLZA 1N1VA 3O0VA 4W6YA 1XWRA 4ASKA 1F8VA 2PXPA 3UKNA 2GC0A 2MPFA 2QQMA 1HF0A 2VQ0A 3QD6A 4AQ2A 2G4IA 1D2SA 5IVCA 5J7MA 3VKLA 1GZ9A 4HOOA 1O4ZA 4LHNA 4XDOA 5FFOC 1IKPA 2W47A 1CGPA 4P00B 1DP0A 1HQNA 1H1IA 1H0BA 3CBNA 1DGLA 2ARAA 3ZMNA 1V70A 3WHTA 4FP3A 3DYOA 1K42A 1ODNA 3K3NA 4QPGC 1NKGA 3BIWE 3WHUA 1A34A 3H7JA 2YBDA 1LULA 1YQ2A 3OJBA 4IXLA 3WEZA 1UNBA 1DYOA 4A41A 1UYZA 1BKZA 4KI5M 4Z2AA 4AVAA 3H8UA 4MUVA 1XSRA 1OH4A 1P8JA 2IWGB 2LYSA 3ATGA 2VZQA 1UL9A 3L2YA 1XU2A 1N1SA 2ZHKA 4QX1A 5FPVA 3LSEA 5JZGB 5FYVA 5IATA 2BPA2 2R1JL 1GP6A 2QNKA 1AZDA 1WCDJ 4FXKB 1KFUL 3I3QA 4HMZA 4AVBA 4ER6A 3AL6A 1AR91 4Q1RA 5T52A 4C1WA 5LW9A 3UGHA 2LUWA 3UNPA 3BTYA 1WA4A 1Y3TA 2VMEA 1VBD1 2Z69A 3JBG1 4JRAA 2D7FA 4KWKA 3WR0A 1QHDA 4QX5A 4YW3A 3BU0A 3NV4A 1Y43B 2Q8OA 3DPRC 2FMDA 4FBFA 1DQ4A 3I59B 4QD2A 3POJA 5IVJA 3UETA 1IHMA 2O14A 2QQPA 4COUA 4KG8A 3IMMA 2J42A 4XZUG 3LQXA 1W8FA 1YI7A 4CCMA 2Y0IA 4CXWA 3AP7A 2BZDA 4W50A 3UESA 1BXHA 1WETA 3AX4A 5KXEA 4X4IA 4CZSA 1W28A 5JXJA 5F5QA 5JLVA 1V6OA 3RRDA 1IGOA 4JGYB 3LA3A 3ZKYA 5A3OA 2JDNA 5FY5A 5DMYA 2XB6C 2X5IB 1QWRA 3VUOA 2X29A 4XIKA 4LO7A 1XJAA 2RS13 1U5ZA 2W94A 5DDJ3 3WNKA 5A3WA 1PK6C 5FYIA 3GN5A 1AXZA 1SDWA 2ZGRA 3ILFA 3J7LA 3OPTA 4MLOA 3VV1A 5FZCA 5FY0A 1OQDA 3FLRA 3RZMA 2GMEA 1AL22 3VB9A 2H8RA 4CCEA 1UXXX 2WLPA 2O0OA 1JZ3A 5D1IA 1RUOA 2PXTA 2X09A 2ZX1A 2IXIA 2E31A 2CSFA 3BODA 5FMDA 1CD3G 1HIXA 1PM4A 1A8DA 5A3UA 3S6PA 4NIDA 1IPKA 1JI6A 1FX5A 3HQRA 3W5NA 2XOMA 2GSYA 5LB6A 1OPOA 1TMF2 1JFTA 2BUKA 4LHLA 2J22A 2HWC2 3ETPA 5LA1A 2CWMA 2FDHA 5FJHA 4JHTA 3RZJA 2JDYA 1ZZCA 2OT7A 1EP0A 3WUDA 3GHNA 4CDWC 2ZEZA 1TMF3 4MGIE 3VD5A 4I2OA 4LO4B 1R083 2HWC3 4Y22A 4NWWA 3PU8A 2ZCWA 2SLIA 2WABA 5CEHA 2KD7A 3LQCA 1Z0HA 5LY2A 2RS52 2VJXA 5DUXA 1CJGA 5ISLA 4NVPA 3GZAA 3ZXAC 2AGSA 5A7NA 3I2OA 1LJ7A 1Q8OA 2HJIA 2JD9A 3UV9A 1AXYA 1K3IA 4J25A 3CQOA 2PHDA 2ICTA 4SLIA 3VDDC 3ZXEA 1ENRA 4AVTA 4Y4RA 1MS1A 1NX9A 5DTRA 1RIRA 1ZBA3 3H1WA 4NHLA 4UF0B 4AGVA 1LAJA 4MGZE 5F2WA 5C3QA 1G6NA 1JOJA 2WR9A 5SV5A 2IVIB 4AFMA 1S2KA 1UY2A 1GANA 1O8SA 4U36A 1S2EA 2LM3A 3OUHA 4QAWA 3KJXA 1OLMA 2YMZA 1COV2 4RHV2 4F8AA 4BU2A 1BJQA 1QJEA 3CJIC 5FPUA 1NA1C 2VUCA 3A21A 2TUNA 4IGQA 1EAH1 1OVPA 2GAUA 2PLV3 1COV3 3N7JA 4MGYE 3NXHA 4RHV3 1OFSA 2W0XA 4R8HA 4XF3A 2KEKA 3NVCA 1LHWA 1LENA 4XCAA 2CSGA 3RFRA 2AREA 5LEJA 2VOKA 5CYYA 1EYBA 5CFDB 3WF1A 2WWJA 1RL3A 3ASIA 3NW4A 3UWPA 2XH6A 1OPMA 3WW3A 3SISA 2DVFA 4LBQD 1JWLA 3W59A 1FV2A 1KEXA 2RV9A 3WDUA 1TG7A 2DFCA 3MIHA 2R16A 1AF9A 5EV7A 1FNZA 1WCUA 3LAGA 3I2DA 1ULPA 1W0PA 4H14A 2VZRA 2ZBJA 3GXUA 5DG1A 3JUUA 5CFCC 4XJ8A 3SKJE 3BU7A 3CROL 1MVQA 2EF6A 3OGGA 5F9TA 3G6JB 2NZ9A 1G8WA 4RSUA 5IK4A 1O3RA 3BUCA 3S8QA 1LHOA 2I74A 3NKGA 4JQDA 1ZA4A 2VAUA 4MADA 1G9CA 1OT5A 4TLFA 4QGMA 3BS3A 3AFGA 4FPFA 3TWIA 1HJGA 3NNGA 5HCHA 1ND3B 1HRI3 1QJY2 3TN92 3VKNA 1JYIA 3KV5A 4YW6A 3POYA 1UY1A 4O7XA 4O61A 4XHBA 2OQ6A 3FN9A 4IV1C 5KC6A 3TN93 4Z2WA 4WVWA 4Q26A 1Q43A 4DIQA 5HXMA 1HRV2 4YGDA 1KITA 4K6BA 4HN0A 1BDHA 1K5MB 1W2UA 2H0VA 4QXKA 5ERLA 2VTFA 2WWSA 3NJXA 4LHKA 5J37A 5FZKA 3RWNA 3KB5A 4PLOA 2OVUA 4LHSA 1PX3A 4NE9A 4FTBA 1I6XA 1DYKA 1YJLA 2ICPA 1X9PA 2PQSA 2WZR3 3AZYA 2A6CA 3ACLA 5JXHA 1UOGA 5KHHA 2ZMLA 2L8NA 1IS5A 3WP3A 4Q0PA 1YIFA 3KV6A 1PNFA 2A1XA 2VXJA 2WLQA 3FL7A 1DGWA 3M1HA 2JXAA 3V65A 2V5DA 1JYWA 1TEIA 3OYWB 2PXJA 1XB9A 3IMNA 4K8RB 1UKGA 3GBWA 4JVAA 4OI1A 4O8BA 2PUBA 1UX6A 2YC0A 2ZJCA 2WFF2 1RVF2 1UOJA 5F3GA 4YM2A 2NQYA 2VUDA 1YLLA 3HD8B 1CAWB 2IFWA 5JAXA 4Q4V2 2BDRA 2WO7A 2WFF3 2WO3A 3SITA 4DO0A 4O65A 4ET7A 2MXDA 5AFEA 5FY4A 1GU3A 3RYRA 1WCQA 3TEWA 2D5VA 4QX7A 4LBKA 1WMDA 1ACCA 1IOAA 2RMU2 4Q4V3 5CU1A 2E9QA 4XTMA 4R9BA 4W4ZA 4I0BA 2DTWA 3AYAA 3C7HA 4NR1A 3FMYA 2XVKA 4Q1PA 4YVWA 2WL1A 4AEDB 4BCUA 3CKHA 4COZA 2EF8A 1F4HA 3U75A 4C91A 1DQ2A 1I1EA 1LU2A 1AYM2 2C9AA 1HV0A 4Z1VA 1VMHA 2GNTA 2LS6A 3AMQA 3RJRA 4CP2A 1H6XA 3ES4A 5D8AB 3KV4A 4BM8A 2IUOA 4C1XA 5D21A 1AU7A 2VNVA 1AL21 5C33A 4TZDA 4XQDA 1AYM3 1VP6A 2FD8A 2WS92 4BWOA 1GOFA 4QDSA 5EQUA 5L9RA 2A6XA 4AOCA 2DCYA 5AVPA 2BVVA 2RJKA 2YGLA 3OBZA 5GZCA 3F95A 4NAMA 3AZZA 1GNHA 2W3JA 2XWJB 1QQP3 1M06G 2ZGSA 3OF1A 4BPZA 1FV3A 1TMF1 2JWPA 4HRAA 4D3WA 3WP6A 2HWC1 1S0EA 5HXVA 4BJ0A 4GKXA 5FZDA 5F3EA 4XOGA 3R09A 2FZ2A 1QOOA 5DXDA 4YVSC 1LGNA 3ZFGC 3ZO0B 1B35C 2HEVF 2ORZA 4KBZA 3ZPYA 4MG2A 1UY3A 2RHPA 3MO4A 4IETA 2RS51 2LYLA 2Y6GA 2O8QA 1O5LA 4AEJA 4Z8BA 2ZGLA 4FBIA 4Y4YA 3O1SA 5A6XA 2WSVA 5A1LA 2GZUA 3AYEA 1S4CA 1E5HA 3LDRA 4ER5A 3IT8A 2WO1A 3IZOA 4Y33A 1JUHA 3QOWA 3LEGA 5FJKA 4QQOA 1ND3A 4GH4B 3ZIXA 2YBKA 3NJZA 1NCRC 4FVVA 4MYEA 5FLHA 1JYTA 3OWQA 2Y8KA 1W8UA 1UMIA 1WGPA 3R0RA 4Q4Y2 4QGLA 4HKOA 1SACA 4NRMA 4AI0A 5BV6A 4GJYA 2DFBA 4BQ3A 3JU9A 5HI0A 3OQOA 4UXAA 4Q4W3 4A42A 4CUAA 4CDQB 4Z07A 1COV1 2VUJA 4RHV1 1ODMA 2OZJA 4Q4Y3 2ZX0A 2A6WA 2CNAA 1BK1A 1HN0A 4LBMA 1V6MA 3ZLIA 2FBEA 4H3WA 4UAPA 3RI8A 4GMP3 1RXGA 5DTQA 4IEUA 4ER0A 1WLWA 3K4AA 4Q0UA 4COVA 1N3OA 3VZNA 4IEPA 2WNUC 2GNMA 5FZMA 2E51A 3J8F3 4Z82A 1CZVA 3MLKA 2DVAA 3IM0A
chains in the Genus database with same CATH topology
1SLBA 3G5GA 2PE5A 4AI2A 4PLNA 1EV12 2CGPA 1ZAYA 1CONA 1KDMA 1UPSA 3H3ZA 4FSJA 3OYWA 4P9IA 1QOTA 3FHIB 1RUF2 4KBBA 4Y1UA 1J3PA 2OUJA 2ZS6B 1EV13 2IXJA 3HT2A 3SCFA 2VMHA 3RJ2X 2PUFA 1ZRRA 3HR9A 4AFCA 1RUF3 2ZX3A 1AXKA 2ZOEB 4HSJA 3IPVA 3JXDL 1ZVVA 2ETEA 4QGNA 3O0XA 1HQLA 2F4PA 5L19A 5CG8A 1U5YA 1V6LA 2VNRA 3E97A 1WH8A 2PHTA 1RC6A 3AKTA 2XJTA 1QJY1 3TN91 2YGMA 4P9JA 3GNEA 2ZA9A 4WV8A 4JCYA 1AYN2 4XXPA 4XILA 5C8CA 2ZAAA 4QPGB 3VBHA 5D8AA 1HRV1 3U0ZA 2QJVA 1GQGA 4M3CE 2OR1L 3KM5A 3H9AA 4I8TA 2ET7A 2VPVA 4DZGA 3WXPA 1LRHA 1Q8PA 2QVSB 3USUB 1V6NA 5A32B 1GT0C 2VNGA 4DRRA 1LB2A 1RUC2 1GLHA 1YYNA 3QCWA 4KG0A 2IVQA 4LLFA 2H6CA 2ES3A 2PAEA 1UMZA 5T55A 3VL8A 3M70A 4ONUA 1PIV3 5FQ0B 3WDVA 3DPRB 2WFF1 1RVF1 1KJRA 4L99A 4RS5A 1LLIA 4DY5A 4OUSA 2D40A 4Q4V1 4XFAA 4AXOA 2EALA 2QUOA 1V9U2 1O4XA 3J9SA 5BY5A 1NY72 1SCSA 4A7YA 5DUWA 2RMU1 2EXHA 5GM0A 4AE2A 4GH4A 2HWD2 3D4KA 2CAUA 1A3KA 1REDA 4FOWA 1C5HA 5JSPA 4S2GA 4X6RB 2KA3A 3HBZA 1LGBA 5EJ3A 2YUEA 1SEFA 1URXA 2A71A 3S7EA 3ECQA 1AYM1 4PDWC 4DOUA 1PK6B 3AMHA 1VIWB 1RHI2 2GMPA 3AP4A 5CNAA 1Z7S3 3IVPA 3RDIA 2GALA 5BNPA 2WS91 2BWAA 1B09A 3B69A 2BEOA 1R093 4ASLA 2XLFA 1I5ZA 2B42B 4YZ1A 1BVVA 1KQRA 1MS3A 2JVLA 2IFRA 1DBNA 3HN1A 3KT4A 1NYWA 3FFQA 4QT6A 1KD7A 4QMAA 2VOXA 4CDUC 4JQRA 4C0BA 4LA3A 4CDWB 5KXDA 1RGSA 4DRVA 3A4UA 4XBNA 3KT7A 1WBLA 5T3NA 1VBA2 3KZ4C 4XDQA 5T50A 1DQ5A 4BHPA 5AVAA 4DS0A 4JTOA 1NG0A 1O3SA 2ZX2A 1PNGA 5KXBA 2WIIB 3EXUA 2ZTNA 3KQRA 1OHFA 4KL1A 1VBA3 1VAMA 1UIJA 4L2NA 3VDDB 3HQXA 4PJYA 4YBAA 5CG9A 5FO7B 3QACA 4Q4Y1 2B8MA 5FTTC 4F83A 1CPMA 2D6PA 3ALQA 1OQEA 4KH9A 4QPGA 5GLTA 1J1TA 2D6LX 4Q0VA 3RYPA 3VGIA 3NSTA 2A6ZA 2PN5A 3N7MA 1HXS2 4IEZA 3CJIB 2GRMA 1NA1B 1VBD3 5CADA 3U4XA 2RR12 1MZ6A 1PO12 5E89A 1HXS3 4FN3A 4WM8C 1S0DA 1R63A 2HWB2 1S0GA 3PLQA 1ADRA 1HDKA 3WG3A 2RR13 2UY9A 1JFSA 1ND2C 1PHMA 1REFA 2VY0A 5E1RA 1F31A 1BYHA 1EV11 2IVBA 1DGRA 1LOCA 5FPZA 5FQ0A 1IS6A 2XKOA 1RUF1 3I4IA 1NXD1 3NAPC 2D3RA 1YJKA 1X82A 3IDCB 3DPRA 4NN0A 2RM22 1ULCA 4Z5CA 4Y1XA 4ZXKA 2VQAA 3MEPA 5CFCB 4S2FA 3U10A 2RM23 3V0BB 3LOBA 3TB0A 4XETA 4CYDA 3R4UA 4HFSA 2XLGA 3AJYA 4BQ1A 3MF6A 3VZJA 1C4RA 2VGDA 3ELNA 5C9AA 1YWKA 1RUE2 3QQ6A 1AYN1 4G9SB 5T5LA 1QGLA 4WM7A 2PPXA 1RUE3 3OQMA 4MXVA 2XGXA 4IV1B 1PZ8A 3AP5A 5AC92 4LA2A 4I01A 5A3MA 2DUPA 1CJPA 3WQ0A 4QPIC 1RUH2 2IVGA 5JOYA 4XZPA 4UW3A 2BTVC 3FMGA 2MHFA 5AC93 4A7ZA 3WUCA 4W65A 5FDBA 1L1MA 2VW1A 4QM8A 3AZWA 1RUC1 2R062 5CIRA 1RINA 4QQLA 1ENQA 4AI3A 5DZEA 1C1LA 4CEWC 2XKPA 1MS4A 3ZXKA 4Y26A 3ZN6B 3TBDA 2DYCA 3AJZA 1G9FA 2C1FA 3FYMA 3BD1A 3MI8A 2DCJA 1DF0A 2LYKA 1POV0 1RUJ2 1TNFA 1OOPA 2CY6A 2WQZC 4LE4A 3ZN5A 1QXRA 2ILMA 4AI8A 1GV9A 4HK9A 1V9U1 1RUJ3 2FMYA 1IKQA 1N3PA 1NY71 3LB9A 5TSWA 1EAH3 2HWD1 4J1XA 1PRVA 3JZVA 1W6NB 4XBLA 2PUDA 5BXXA 1YRZA 1T6GC 5CAZA 1X36A 5E16A 4JCXA 1RHI1 3O7OA 3B9IA 1MQTC 2Q1MA 3WQ1A 1I9RA 2Z5WA 3H50A 4XJWA 1ZNPA 1BMV2 2WNVC 4OHVA 4C90A 4XJAA 5JVVA 2XIUA 1RZRA 4AFAA 1LODA 3EQEA 3QLQA 4KWJA 4K8FA 4YLZA 2A75A 3K48A 2VOWA 5JWPA 1H2LA 5K7PA 4GIQA 1VALA 3B3QE 3E5XA 1AUYA 1N1TA 4MVTA 4GB32 4HL0A 2B45X 2EIGA 4Y20A 1QPZA 4YG6A 4YVSB 4ISQA 3ZFGB 4BYYA 1B35B 5I0RA 1CESA 4GB33 3IKWA 1NQDA 1VBA1 5CFCA 5T5OA 3AK0A 1SBFA 3V0BA 5H9RA 4GHJA 4M00A 1BDIA 4FOVA 2IXCA 2QCSB 1ZS4A 4JRLA 4EROA 1YFYA 3WLUA 3HZIB 1NCRB 3TYJA 1PZ9A 1XYPA 2HWE2 1H8VA 1X8MA 3T2TA 2AH2A 4IV1A 1CAXA 1HXS1 1QJU2 2XVGA 2HWE3 3VBFA 4EJRA 4AF9A 5JPMB 2RR11 1PO11 2HWB1 2XJ3A 4QM9A 1WH6A 3DUIA 2WNUB 3OY8B 1Q5OA 2Y0OA 1RMU2 3USSA 4NHKA 4HK8A 3GZTB 3MDPA 3ZN6A 3WDXA 2X53S 3WQ7A 5GZGA 3E6BA 4WZCA 1OLRA 3DL3A 2Q0AA 3AKPA 2IU7A 3B9CA 4JDMA 1X7NA 2RM21 5JI7A 5ABJC 4UW4A 3SH4A 2VECA 4XFFA 4XF0A 5F6LB 2JG9C 4C0HA 2QDRA 4IV3C 2B5AA 4OHWA 4L92A 3LCPA 2VNOA 1AL23 1VBB2 4MZUA 5KHIA 2GNDA 1LCCA 5J09A 1FOD2 1RUE1 1VBB3 4F8DA 3GYDA 1FT9A 2A3YA 5L7OA 1FOD3 1C1FA 3ZMOA 3JQWA 1D4VB 2PHRA 3AB0A 5AC91 3H3UA 4P9WA 4LBNA 1MS9A 1RUH1 1SMVA 4CRQA 1CN1A 4QQPA 1WCSA 2A70A 1VAKA 1AR62 3JQXA 2RS53 3ENRA 1UZZA 3VBRC 4E2SA 1XE7A 4DINB 1WD3A 2R061 3P3PA 2XBO2 3N7KA 2P2KA 2TNFA 3EJKA 4LBQB 5GZFA 2XBO3 4Y42A 3ZFGA 5BNQA 1S0CA 2AENA 4NPRA 1DQ6A 2ET1A 3T1LA 1ENXA 3DKWA 1RUJ1 4GQMA 4YG0A 1FAYA 3OD4A 3ZFEC 1OSLA 2LYJA 3KCCA 3JCIA 2JCGA 2JE9A 3V64A 4WVMB 3SMHA 5BYNA 2QFEA 2ZKNA 3MIDA 4NOTA 4DFSA 3E5QA 3WDYA 5JZGA 1OA4A 3WZ1A 2DF7A 1QH6A 2RS32 3VZLA 1NCRA 3GHMA 3N7LA 3VHOA 2GN7A 3UK9A 1ZRDA 3WOGA 1WW7A 4B7KA 2K0GA 4KGQA 4G3YC 4E2QA 4PDWB 4GXLA 3O9XA 1V6JA 3I59A 4CP1A 1BMV1 2NPIA 4Z58A 5F6KA 1LGCA 3NKTA 2PELA 3AKSA 1R1A2 2O49A 2GMMA 2PA7A 2ZGQA 2GH2A 4XE9A 4MCTA 1ZVFA 1ZZ8A 4JCKA 4Y24A 1R1A3 5GLWA 2UURA 2W68A 2IXLA 2E53A 4JGYA 4AGRA 2ZAHA 2A5ZA 4P9XA 1A78A 2XL9A 1Q3EA 1W6QB 2X5IA 4GB31 4Q8LA 3ZXLA 1H4HA 4CDUB 1SBDA 1GKBA 1QP7A 1O3TA 1F9KA 2WA4A 1QJY3 1EFAA 3JB8A 3E6DA 3EO6A 5JOZA 2BYVE 3URFA 5DUUA 2KXLA 2NN8A 4N9HA 3E6CC 1FYUA 3UJOA 4RQPC 2VMIA 1S0IA 3FC0A 4F7ZA 5ACA2 4NHMA 1HRV3 2VVDA 4CDXC 1ENSA 3CLPA 4BE3A 3X29B 3O0WA 5JSRA 1KS5A 1Y7YA 1C8NA 2CV6A 1XNBA 2PHWA 1RZSA 4BOWA 1DHKB 5FRAA 2XHKA 1ZYBA 2HWE1 4HPKB 3H0OA 1C28A 2G9FA 1E57A 2UYBA 1LQCA 1OFNA 2PUGA 3B5LB 1QJZA 2OPKA 1D2QA 1QJU1 4R9CA 4Y1YA 3VK0A 1WBFA 2EAKA 2ZHLA 4PU3C 4FCAA 3B00A 4I6UA 2D6NA 1YI9A 2Q30A 1WLTA 1UIKA 5HCBA 4WM8B 1RVF3 3WP5A 4N43C 4S2HA 2K9ZA 1ND2B 1UF2C 3FUOA 1RMU1 1VBE2 4WBBA 3FBMA 2D93A 4LUKA 1ZX5A 3ZXGA 3MZHA 4ES8A 4P9YA 3RZZA 1QXJA 3MGUA 2RMU3 1VBE3 3WY6A 4Z59A 2D98A 1NCQC 2AW6A 3NAPB 2WQ4A 2BGCA 4TWTA 1JYCA 1PRUA 4BIFA 5JPNB 4FPEA 4DQAA 4M3CB 3LISA 1RJ8A 3B7HA 4XIOA 1VBB1 1PRAA 4L11A 4AEMA 1H2KA 5I0TA 2WS93 1FOD1 2DCTA 5CFDA 1UU4A 4LO5B 1L3JA 4ISRA 5FCCA 3C3VA 2CGOA 3PTYA 1R69A 3ZSKA 5C6CA 4IEYA 3FUQA 2WNEA 5GALA 4XYXA 4PDWA 3VBOC 2LTNA 5GKAC 4XFHA 3AP9A 4B4PA 5I8TA 2L49A 4AI1A 2ZKLA 1VLNA 4WZFA 4PIYA 1WW5A 4QPIB 4K1ZA 4D69A 3OPZA 2DVBA 1UCXA 1AR61 3QYXA 3MPPG 1IS4A 1PO22 2GC1A 3ZX7A 1SFYA 1JH9A 3U3WA 4HLTA 3PJQA 2XBO1 5F1RA 1WLCA 3W58A 2P3JA 2P17A 3N36A 2R1DA 1W6PB 1PO23 4KWLA 2EXKA 1W6QA 4Z07A 4CEWB 1IS3A 4LEJA 1YCIA 2ZGTA 3CO2A 1CR7A 4PBPA 4BH9A 2CAVA 3KCYA 4IL7A 4K9SA 3S0MA 1OKQA 2KM2A 4PU7A 3UKVA 4L8QA 4M3CF 5HCAA 1DZRA 4K7JA 3PVOA 2OYZA 1K5MA 3ZXFA 2EXIA 1DZQA 1YIPA 3H7YA 3ZYRA 4BIOA 1H30A 4DNYA 4X4HA 3NL1A 2YV8A 3GBGA 4SBVA 2NMNA 3O5SA 1DQ1A 4B8EA 1YO8A 2JJ6A 1LHVA 2RS31 1GSLA 2DV9A 1N1YA 1W6MB 4KU7A 3AMNA 5HCFA 4JTNA 3LZZA 4MSVA 4HANA 1XU1A 2D6MA 3M3EA 4XTPA 2UYAA 2OUHA 1JXNA 3ZYJB 5BPXA 4V1PA 1MQTB 2KPJA 2V09A