3SCFA

Fe(ii)-hppe with s-hpp and no
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
193
structure length
193
Chain Sequence
TASTGFAELLKDRREQVKMDHAALASLLGETPETVAAWENGEGGELTLTQLGRIAHVLGTSIGALTPPAGNDLDDGVIIQMPDERPILKGVRDNVDYYVYNCLVRTKRAPSLVPLVVDVLTDNPDDAKFNSGHAGNEFLFVLEGEIHMKWGDKENPKEALLPTGASMFVEEHVPHAFTAAKGTGSAKLIAVNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of regiospecificity of a mononuclear iron enzyme in antibiotic fosfomycin biosynthesis.
pubmed doi rcsb
source organism Streptomyces wedmorensis
molecule tags Metal binding protein
molecule keywords Epoxidase
total genus 43
structure length 193
sequence length 193
chains with identical sequence B, C
ec nomenclature ec 1.11.1.23: (S)-2-hydroxypropylphosphonic acid epoxidase.
pdb deposition date 2011-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 3scfA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3scfA02
4QM8A 1J3QA 1PNRA 2Q30A 1R69A 1B0NA 2BYVE 4MH0E 1WH6A 4X4EA 3NW4A 3OTFA 4A2UA 3TNPB 3LOIA 3G5GA 2OZ6A 4J1WA 4PIZA 2F4PA 3CECA 3O14A 4KU7A 5K8SA 3RNSA 4YNIA 3I59A 2KEIA 1OI6A 1RC6A 2KEKA 4QGNA 2AXVA 3MLFA 1J3RA 5JR7B 1EPZA 4YG7B 1DGRA 1ZRCA 3OP9A 2XI8A 1FXZA 2MQKA 2ETEA 2GC0A 2MHFA 1YLLA 1J59A 5I93A 1UIKA 3D82A 4AVCA 4META 2KPJA 2JCGA 1L3JA 3ZDSA 4IEQA 5BPXA 2DCTA 3DN7A 3FZ3A 3KJXA 1LMB3 1WGPA 1UCXA 3H3UA 5E1RA 2PUDA 4QXKA 4LUMA 4Q0QA 2VPVA 4X6RB 3BS3A 4Z07A 3EBRA 3EQEA 4MGYE 1UD1A 2BGCA 4LA2A 4FBFA 4XETA 4AXOA 5KHGA 3QWGA 1DGWA 3ZHIA 4XF4A 2B5HA 4BYYA 3QYXA 2MPFA 4X4FA 3FYAA 4I6TA 2EAAA 2XKOA 4XEZA 2PAMA 4X4IA 3TRBA 3E5XA 2XSDC 3CROL 4Q29A 1X2LA 2CROA 2KEJA 4JQDA 5LEKA 5I0TA 4UBGA 1CJGA 4EWEA 1LRHA 1O5LA 2BJCA 1RPEL 2XCJA 3CEWA 3RYPA 4AVAA 4IEOA 3RDIA 3L1PA 4HVQA 5KBFA 1PM7A 1G6NA 3CJXA 1VR3A 1Q3EA 3OQMA 2N7GA 1CX4A 1UIJA 1CQTA 3PVBB 4LA3A 4XFGA 4FT8A 2ICTA 4OB4A 1CAVB 1WH8A 2UYAA 1ADRA 3I7DA 2PQQA 1NEQA 4QGMA 1NXMA 2LYPA 3D1NI 2D93A 3DV8A 4KL1A 4I09A 1CAXA 3FYMA 2GRMA 4Z5CA 4GULA 3OQOA 3R1FA 2P17A 1ZUGA 2QJVA 1QQAA 4IEVA 1EYBA 4QGLA 3NSTA 2GH2A 3HIFA 4LTAA 2GC3A 1E3OC 3IIAA 3ZHMA 2EWTA 3PLQA 4XFHA 4O9GA 2B5AA 1U12A 3ZKCA 4H7LA 3OD0A 4QX5A 2LYRA 3E5QA 2IXJA 3EO6A 3FHIB 2OZJA 1OFNA 1L1MA 4IEPA 1SQ8A 2GC2A 2D5HA 4NVPA 5JAXA 1NZCA 3GN5B 1UTXA 1RTVA 1OMIA 2A6CA 1ZZ6A 3BPZA 3SMHA 4LLOA 5EZWA 2PUCA 2XGXA 3JXBC 2OA2A 1CAUA 1SFNA 4XF0A 5T3NA 4YBAA 2KXLA 3S7EA 3LZZA 3RPQA 3U3WA 3LISA 1O3RA 4X6QB 4N9HA 4WBBA 3FFQA 4HVOA 4Q0SA 1S7EA 5JSRA 4E2GA 3BDNA 3DKWA 1DW9A 5JCTA 3M70A 2IVQA 1O4TA 4O8BA 4AQ6A 1X57A 2HKXA 1ZZ9A 1I5ZA 3OMTA 3LA2A 4KU8A 2ET7A 3MDPA 2K9ZA 3QOPA 1ZVVA 1CAXB 3BB6A 5I8SA 5KHHA 2XHKA 2UY9A 4I6UA 2PUFA 4F7ZA 3FWEA 2FMYA 2BNMA 1JUHA 1YUDA 2IXCA 2WC2A 4IETA 3VHRA 1ZVFA 3KXAA 4MUVA 3JZVA 2IVBA 1PERL 3ST7A 4X4HA 1HW5A 4HVRA 4X4DA 1H1MA 4XFIA 4L2NA 3F6WA 2L8NA 4FAGA 1TQ5A 5C8WA 2H6CA 2BEOA 2PE5A 2QCSB 5J3UA 3RZZA 4FN3A 5K98B 4ORFA 2MNGA 1RUNA 1X8EA 1ZS4A 5I8YA 1IPKA 3GN5A 3ES4A 2BNOA 4D7SA 5I0SA 3MPBA 4UBHA 5FCCA 2CV6A 1RZSA 1JWLA 4LUKA 1O7FA 1X82A 3JXCL 3H7JA 3FE5A 5A7LA 1NE6A 4XF1A 3KSCA 4HMZA 5LEJA 4FBIA 4EWDA 4Z5HA 4R8HA 3PXPA 4XFBA 3SCHA 1ZZ7A 4Q0UA 3E6DA 4BHPA 1ZREA 3KCCA 2Q0AA 4I0BA 2KZ8A 1YFYA 2D40A 1WA4A 5BV6A 2OYZA 2OR1L 3EJKA 4ZU7A 3HQXA 2IXHA 3E6CC 3BU7A 4B29A 1YFWA 3ROUA 1O3SA 4TLFA 3PNAA 2EF8A 3E6BA 1V70A 1CAUB 5FLHA 1CAWB 3RYKA 5FQ0B 2ZCWA 2XIUA 1YFXA 3CF6E 3H1MA 4JTOA 4F8AA 3L2HA 4I2OA 4UXAA 5I8TA 5JSOA 4JCYA 5AVPA 3BD1A 4IEZA 4HN0A 4IWRA 2ZKLA 4YRDA 2GAUA 2CSFA 2PAKA 4HSJA 2Q1ZB 4PIXA 2PIJA 2LYKA 1Y3TA 2EBYA 1AU7A 3MYXA 4E2SA 2ICPA 1QP7A 2XL7A 1LQCA 3H5TA 5BXXA 1RGSA 3USSA 1O3TA 4WVZA 3U11A 2CGPA 2H8RA 1R63A 1PMIA 4MZUA 1FT9A 2PFWA 1XRUA 1OD5A 2PAEA 4KWLA 2PHLA 1O3QA 3OF1A 2LCVA 2LYSA 3N4MA 2IC1A 5I0UA 1I6XA 4I0AA 4D7TA 1X8MA 2O49A 3NVCA 2XKPA 3H50A 4MGZE 3KMHA 2O38A 3F51A 1O4XA 5FPZA 4JCXA 1ZX5A 4QMAA 1ZNPA 2XLFA 3HZIB 1CAVA 2GU9A 3LAGA 4J1XA 1GQGA 3RYRA 4Z59A 1UPIA 1LLIA 4PU8A 2QDRA 2B9UA 3EHKA 3OQNA 4YG1A 4XFCA 2IUOA 2MEZA 1QP4A 4L11A 3WW3A 3UKNA 3KGZA 4NDWA 1UXCA 3CLPA 4MCXA 3E5UA 4PU4C 3LA3A 2H6BA 1WIZA 3SCGA 1ZZ8A 4EWAA 4F8DA 2PYTA 5C6CA 4HN1A 3QQ6A 1J58A 4I6RA 5KHJA 2UYBA 4Z82A 3LA7A 4Z58A 4P9GA 1NERA 2LYLA 1QXJA 1Q5OA 4FAHA 2IXIA 4ZU4A 2Q4SA 1ZZCA 2D5FA 1JFTA 1WLTA 1QP0A 2VQAA 2Z2SB 4MGKE 1OSLA 5CADA 2BNNA 4MV2A 4XFAA 4AQ2A 2EA7A 4X4BA 3S8QA 1QQBA 2PHDA 3IDCB 3B02A 3OCPA 4I01A 4X4GA 1IC8A 2LYQA 3IVPA 1RUOA 4IEXA 1VJ2A 3TNQA 1GQHA 3SHRA 3O9XA 5I0RA 3ETQA 3HT1A 4XF3A 1XWRA 3NL1A 5LRRA 5BUVA 1JFSA 5KHKA 3IBMA 4I3PA 2C0ZA 3UKVA 4MX3A 1DZRA 2GRLA 1WETA 1UW8A 3D0JA 4LULA 5CU1A 1CGPA 1VP6A 2IVGA 2V09A 3E97A 3I54A 2PTMA 4HZFA 4O9EA 2PUBA 4JTNA 1EP0A 1DZTA 2PPXA 2L49A 2XLGA 4IVZA 2E9QA 4BIFA 4I8TA 4N9IA 3H3ZA 3FMYA 3VK0A 3U10A 1BDHA 3CL1A 4IA8A 3SXWA 5F1RA 2AXUA 1Y9QA 4Y42A 1YSEA 3GBFA 1RZRA 1RIOA 1OCTC 1LKNA 1QPZA 2QVSB 5FLIA 3F52A 4DINB 1EY2A 4XF9A 1PRVA 3MZHA 3CO2A 3DNVB 2EVXA 2ATFA 3ACLA 3R6SA 3OGJA 2WUSR 4YG4A 3M3IA 1PRUA 3FJSA 3KZ3A 1SQ4A 3S0MA 2GZWA 3LWCA 1ZAYA 2K0GA 2IU7A 2PA7A 3SCFA 2O4AA 2PUGA 3BCWA 2VECA 1YHFA 2HINA 1ZPQA 1ZRDA 2PUAA 1LR5A 1Q43A 2AXZA 3LFPA 2O1QA 2GC1A 4PU7A 2AUWA 4MGIE 3H7YA 5BY5A 1J1LA 2R1JL 1LCDA 1HF0A 1YWKA 2R63A 4KWKA 3ES1A 5LRSA 2AWIA 1ZZBA 1Y7YA 4YYOA 1VPWA 1JH9A 3UFDA 1QY4A 1RZRD 2JVLA 1FI2A 3CLCA 2XL9A 1ZRRA 4Z5DA 1ZRFA 3KGLA 2GZUA 4IEWA 4ZU5A 3JXDL 3QF3A 5JSPA 3WW2A 5FQ0A 5KHIA 5FPXA 4K8FA 1LCCA 3U0ZA 3C3VA 1RL3A 4E2QA 4EROA 4OLLA 4GHJA 1YFUA 2CAUA 4X4CA 3UKTA 3D0SA 3HT2A 1EFAA 4OFGA 2B8MA 5HI0A 4Q0VA 3QACA 4YSFA 1X7NA 4GQMA 1NE4A 3H9AA 1UXDA 3IDBB 3I59B 3S7IA 2HJIA 3B7HA 2LYJA 3FX3A 4BH9A 4KWJA 4Q0PA 3H8UA 5J48A 4PU3C 2WIUB 4HBNA 1POUA 4LEJA 1QXRA 5FDBA 1H1IA 2O8QA 2OPKA 4IESA 4XFFA 2Y0OA 3ELNA 2XLAA 2Z69A 4IERA 1LB2A 3DL3A 2D5VA 4YARA 3IWZA 1PRAA 3NJZA 1IPJA 2IV1A 2H0VA 2XJ3A 3H1YA 2ET1A 4EV0A 2CAVA 4MCTA 4JVAA 5D1IA 1SEFA 2I45A 4HSLA 3WW4A 4IEUA 2UY8A 4PJYA 5J7MA 4R52A 4PIYA 5I91A 2IXKA 3BALA 3G7DA 1DWKA 1CAWA 1XE7A 4HLTA 4ONUA 2FQPA 4I02A 1GT0C 4JV4A 2FJRA 4IEYA 5CVRA 2QNKA 3H1WA 1QWRA 5E16A 2HSGA 3WW1A 5FLJA 5EFUA 1J3PA 1XE8A 2WFPA 4CYDA 1NYWA 1BDIA 3NKTA 4QM9A 3GYDA 3EUSA 2OFYA 1O5UA 4RD7A 2IXLA 2AW6A 4WZCA 4AVBA 2PUEA
chains in the Genus database with same CATH superfamily
4QM8A 1HXS3 1J3QA 1PNRA 2Q30A 1GMMA 4UOJA 1TME1 4MYEA 1UU6A 1WH6A 3W5NA 1KS5A 4XBQA 3V0AA 2PXVA 1PGW2 4KG0A 3VKMA 4A2UA 5JWPA 4TYSA 2DVAA 2OZ6A 4PIZA 3CECA 2R32A 1KJLA 4D6SA 4YG0A 2VMFA 5IT6A 1LOEA 1OQEA 1RC6A 1UYZA 3N9OA 4Q27A 4QHZA 3T2OA 4A4AA 3O5SA 5JR7B 1JXNA 5C4WC 3HR9A 4RSUA 4K6BA 4P00B 5L73A 1ZRCA 4UW3A 1ENSA 1FXZA 2MEV1 1UL9A 1QOTA 1TME3 2GC0A 4QKBA 1J59A 3IKWA 3LIGA 4W4ZA 5A1AA 4XIOA 1TMF1 5HCBA 2VW0A 2JCGA 3SKVA 5DZEA 1UMIA 2GMMA 5BPXA 3CBNA 1FATA 3DN7A 3WP4A 2RS13 2KM2A 3M1HA 1HQ1A 2VZOA 1RUH2 1WGPA 3AJYA 3NWKA 1GBGA 2PUDA 2VTXJ 3JXSA 5CIRA 5E1RA 4ZY9A 4E4ZA 3HQRA 3BS3A 1LOCA 4QX8A 1EV12 1UD1A 5C5TA 1JYIA 4QQHA 4YZ3A 1JU4A 4XDOA 3SX0A 4LA2A 2Q8CA 5A1LA 3GBGA 1WW6A 2VC9A 3OSDA 4XETA 4AXOA 5JZGC 1POV3 5IK4A 1QF3A 2W1WA 2WSVA 3MW3A 5HCAA 1VBE1 4I6TA 4CU6A 4PCRA 3Q8AA 3VKNA 2ZAAA 5IHRA 2VE1A 4G4FA 1NQDA 4XXPA 3RS6A 3FC0A 2XQXA 4BMBA 1I1EA 4Q29A 3IMMA 2KEJA 2CROA 1XQNA 4JQDA 5I0TA 2EICA 4UBGA 1WUVA 1CJGA 1N3OA 1T6GC 3VHPA 2ADDA 3VDAA 3O1RA 3I3MA 5A32B 3NAPC 3RZHA 2XCJA 5B2GB 1P8JA 1BYHA 3PMEA 4GKYA 2NMNA 4ARXA 3DYOA 2WNUC 4Q1PA 4W6WA 5FZ6A 2HWD3 2VOTA 3U1XA 5IVCA 3VD4A 2F6BA 3RDIA 3L1PA 4OULA 3C7OA 1PM7A 3VBFA 5KBFA 1JYXA 1VR3A 1YIFA 3K46A 3MW2A 4XMAA 5KXEA 4NHXA 1BMV2 2E7TA 2LW8A 1R092 3FN9A 5E8AA 4AEDC 3OWQA 1DULA 4PLNA 1C5HA 4JCKA 2ICTA 1ASJ3 1H30A 1RXFA 5FZHA 5IATA 1JTZX 3EB7A 1UZZA 4R9CA 4AFCA 2OUHA 2PQQA 4FTBA 5FPLA 3ZN6B 1LOAA 4NAOA 1AR93 5AC91 4BCUA 4KL1A 4P5HA 1CAXA 4A45A 3LQCA 4ER5A 2WT0A 5FUNA 3RVHA 1LHOA 1GOHA 3VKLA 3W59A 2P17A 1ZUGA 1H9PA 1IKPA 1R091 1QQAA 4URAA 1EYBA 1F4AA 1BMV1 3NSTA 4IUGA 4XYXA 2GC3A 1E3OC 1ACCA 3MF6A 3IIAA 1REEA 1K45A 4O9GA 2B5AA 4PDWB 1Q8QA 4UF0B 4JZRA 4PI0A 5C7GA 3OD0A 4QX5A 1VBA2 2WINB 2LYRA 3GCXA 4Q4W1 5D8AC 2R073 3AYAA 1W39A 1G86A 3EO6A 4QDSA 3OGRA 5C9AC 1OD3A 1SQ8A 4NVPA 5EYXA 3AP4A 2XMLA 4V2WA 1RTVA 1OMIA 4OQ9A 2A6CA 1JH5A 4C91A 3VBHC 3BPZA 1NXD1 3VZKA 5EQUA 3VB9A 1I9RA 2YBSA 3BGAA 3ZXKA 4DUWA 2VR4A 2AEZA 1AXYA 5ACA2 2JENA 4XF0A 5FIXA 2JDMA 1JZ7A 5T3NA 4EN6B 1EUTA 3I2OA 4DB5A 5T55A 2A1XA 5LBCA 4GZ9A 2YROA 3LZZA 3POEA 2WT2A 3VBOA 1RUD2 4YM2A 3RRDA 1O8SA 1OURA 3TFLA 5GLUA 5L7OB 3LB9A 3T0DA 5C8CB 2WLPA 4X6QB 4N9HA 4WBBA 5FZLA 5JXHA 2ARBA 1W28A 2VMIA 3K3OA 5HV0A 4N90A 3RZLA 4RHV1 4E2GA 4PDWA 1CZSA 3M70A 1MS5A 3HNMA 2RM22 2LM3A 3WXPA 1O4TA 4O8BA 1UKRA 3N3HA 2MEV2 1QOSA 3S5QA 2FDKA 3FLTA 1JYWA 4UI9L 1HB1A 3I2DA 4LHNA 3N9LA 2GH8A 3LA2A 3HD8B 3PUSA 4V2VA 4N43C 3ETPA 1ZVVA 2YV8A 2XHKA 2UY9A 4HETA 3JBG2 4QDQA 1SDWA 1XNDA 4Y33A 4AI2A 3MPPG 1VBB3 3AP5A 1ZVFA 5C33A 1Q56A 1JHNA 3NV4A 3HAGA 3N35A 4MUVA 1AYM2 3O1TA 2DFBA 4Q2FA 1XB9A 4OMDA 4QAWA 5FPVA 1HW5A 4HVRA 3M7AA 4X4DA 4BDVB 1PO22 2HEYF 3POFA 3THPA 4CU8A 1AR71 4LBQB 2YC0A 5GM0A 3ITQA 2DF7A 2IFWA 3MIEA 3WG2A 4Z92B 5F5AA 3NDBB 1TMF3 1OKOA 4EN8B 2PXBA 4YGDA 3MIDA 3PTRB 3IIIA 2QUOA 5CFDB 2HFZA 3GN5A 3ES4A 2CTVA 2XJPA 3CJIB 1A6CA 2E7QA 2BNOA 3NZLA 2RS31 3IDAA 4GAZA 1SHWB 4YVWC 5FZEA 4CZSA 5I0SA 4JKKA 4CUCA 4UBHA 2OVUA 3EXUA 5FCCA 5B4NA 4Y4RA 4LUKA 1HV1A 4GXLA 5FXWA 4LHKA 3MICA 5ERLA 1RUI1 2RJKA 3ZYPA 1W9SA 3VHOA 5FYIA 3HNBM 4UF0A 3E1F1 2AC1A 1W8FA 1RUC2 2VD7A 1CJPA 1QDCA 4FBIA 3LE0A 4XJ9A 2RM23 1RUJ3 3SCHA 3E6DA 3VD7A 4COZA 2WS91 2MEV3 2E51A 1ZREA 1PIV2 2Q0AA 3DF0A 1R082 3K3NA 3TYJA 1TE1B 4RR3A 5C71A 3OY8B 1DBNA 5DG1A 4P08A 3EJKA 5GZGA 1N47A 3HQXA 2Q8EA 1S2EA 3BU7A 3TEPA 2ZZQA 2YBKA 4KNCA 3WDVA 3H3LA 2IVJA 2IFRA 1OA2A 3LGRA 3LPGA 2OW4A 3RYKA 4RHV3 1YFXA 2NZ9A 5FJHA 2JDKA 2AENA 4I2OA 2DCJA 5JSOA 4JCYA 3K75B 1HRI1 4QPGC 4A3ZA 1AYM3 5A6ZA 5FOJB 4HN0A 4FFGA 2AREA 1YI7A 2A70A 4RQPC 1LGBA 1NQJA 4UFMA 1LESA 2CSFA 1FAYA 1NLSA 1K5MC 4DE8A 4AFDA 1WW7A 5A6YA 1N1YA 2WNUA 1YJLA 2B39A 2JJ6A 4AI0A 1I3HA 4WVZA 1K3IA 4YW7A 4CDUA 3WG3A 2A73B 2XONA 3A9YA 4NHLA 3VL9A 4MZUA 2NMOA 2ZGNA 4OHWA 3ZR5A 4D8MA 2PFWA 1D0HA 3A4UA 5F3GA 4Y5Z0 4QKNA 3CZUA 2PAEA 2L1PA 4KWLA 4CUGA 1SFPA 3N9PA 3O0WA 3AX4A 2LCVA 2LYSA 2YZ4A 2W08A 4DPNA 5LBFA 1G9CA 4I0AA 4XABA 2RE9A 3M3QA 1X8MA 3AVSA 2O49A 3NVCA 3OY8A 2YUEA 1QJFA 2P6HA 1XOYA 3KMHA 4JKLA 2QQMA 1FV2A 2PN5A 2ZMNA 5A7QA 4AL9A 1ZNPA 2GP3A 4BQ1A 4BA6A 1FPN2 1Y43B 3C7FA 3SNMA 3BN6A 4MLOA 2E63A 4NRMA 1PIV3 2H0BA 4CDQA 5A1FA 1UPIA 4GMP0 4QX3A 4RQPA 5EP9A 3USUA 2QDRA 4W8JA 2B9UA 2PXTA 3OQNA 2XJUA 3AZZA 2XJSA 4CTEA 1BCXA 3GZUC 1UY2A 1O91A 3WW3A 2YC2A 3NJYA 4DNYA 1UXCA 1H2NA 1NKGA 2J7MA 2VG9A 3BVCA 1WZXA 2H6BA 1ALYA 2VUDA 4F8DA 3BIWE 2ZBJA 5FOBB 4E8CA 4HN1A 5FREA 4BB3A 4I6RA 3Q8CA 4DY5A 3ZXDA 3GHMA 4WM7C 2LYLA 3OKZA 1Q5OA 3C7EA 1W8TA 1H2MA 1RUD1 2O14A 4L97A 2D5FA 1QP0A 1ZA7A 2R063 2Z4FA 1OSLA 4YVWB 4LT5A 3UK9A 5D2AA 4C8DA 2WLQA 2XQRA 1COV1 3AZYA 4XDQA 1YC61 2EA7A 3ZFFC 3S8QA 3JD71 5A3UA 4Q4Y2 5DG2A 3TBDA 1XYOA 1HLCA 2FCVA 1OHFA 1NA1B 5IVEA 1IC8A 4WM8B 2LYQA 1JBCA 1KEXA 2ZGSA 1VJ2A 2LS6A 3TNQA 4B4QA 5DUXA 1WW4A 4RYDA 4P9XA 3ETQA 5JXGA 4XF3A 5FYSA 3A0KA 3R09A 4D6RA 1PVXA 4XUQA 4Y22B 4NR1A 1JFSA 2X05A 3IBMA 4XAEA 5JMCA 1PZ8A 2C0ZA 3UKVA 4JRLA 1D2QA 2J1EA 2HEWF 4CDWC 2MXDA 3CMGA 5C3RA 2HWB1 2JIGA 2JDYA 4A44A 3MV11 2R043 4UW5A 4BQ4A 4DUVA 1FPN3 1WMEA 4SLIA 1UPSA 3E97A 2GNTA 3I54A 4O9EA 1TNRA 2VMCA 1AL22 2P3KA 5FYHA 2L49A 3UETA 5FFOC 1NCQA 1LOBA 1OLRA 1UZYA 5CKMA 2VOVA 4N9IA 3FMYA 1D4VB 3BIEA 4IA8A 2V5DA 3AFKA 2AXUA 3AKSA 4EKGA 4PLMA 1DYPA 1C57A 4IV1C 4JRAA 3VGIA 2QQOA 4CDUB 4D6QA 2QE3A 1YSEA 1RIOA 1RZRA 5FK8A 2BBVA 1VBC1 1EY2A 4XF9A 1APNA 1OXCA 5FAXA 5GLTA 5FY4A 3GDBA 4M4RA 3RSJA 1RUF2 3ZYFA 3N9MA 5K9YA 2W87A 1A78A 2ATFA 3R6SA 3KHCA 4NN0A 4AWDA 3ORJA 4KG8A 2ZGLA 4JGZB 4FPJA 4QDRA 3NAPA 5IVYA 1EAH1 3OD4A 3VDDA 1SLCA 3J7LA 2AH2A 5DSXA 2K0GA 2RJLA 5GAGi 2R6QA 4CDWA 4LR4A 3HN3A 3BI3A 1UY4A 2SLIA 1BQPA 4U36A 1BEV1 2PUAA 4ET7A 2V4AA 1C8M2 4BPZA 2VW2A 3LFPA 3AKTA 1JODA 2VY0A 2ZX1A 4QT6A 5GLZA 3RI8A 4CDQB 5FMBA 4COVA 2ZGKA 2LALA 1H9WA 4RFRB 3BTAA 4UWDA 2R0FA 1IS5A 3PURA 4QB1A 4XAAA 1RUC3 2OXBA 1VPWA 1JH9A 5CFCC 4UYBA 1OLQA 4AFMA 3APBA 2XL9A 1WCDJ 1ZRRA 1W8OA 2XG3A 4WZFA 4XJ8A 5A33A 1CR7A 1H2KA 5EJZB 4XDPA 4IEWA 5IVJA 3JXDL 2VMEA 3QF3A 3D8CA 4PBPA 2BVVA 1OH4A 2VQUA 2VZUA 5KHIA 2LLVA 1URXA 3DUIA 2HWE1 4HG6B 4HKLA 4XJUA 1LCCA 3U0ZA 5JOXA 4ER7A 3O7OA 3OG2A 2E53A 1GU3A 4OHXA 4E2QA 1MEC1 4EROA 2VOWA 1RUH3 1ULEA 4IE7A 5JPNB 3KHBA 1YFUA 1VB4A 4YZ2A 2J1VA 2WABA 2VZTA 1EFAA 3LCPA 2B8MA 1VRH3 4C0HA 1LHUA 4Q0VA 1PVC2 4M0NA 1RUF3 3S7IA 3AB0A 1E5SA 3FX3A 3S6PA 1W04A 2PHXA 5J48A 2W3JA 2QQWA 3M9LA 4Y1YA 2JWPA 1PX3A 4HBNA 4NRPA 5CNAA 4LO6B 5L36A 1J83A 1HDKA 2LLWA 1R1A2 1H1IA 4IESA 3BTZA 1COV3 1V00A 5F9TA 1YIPA 3UWPA 2JG9B 2Y0OA 3RQ0A 3LFIA 3MIGA 1LB2A 4P9JA 2ZS6B 4XC9A 4QXHA 2WNUB 2HCSA 3IWZA 2O0OA 3NJZA 4GWMA 1JI6A 2KR2A 4P9WA 2H0VA 1F8VA 3PHMA 2AACA 4FQ4A 2CAVA 5F39A 4GJYA 1CPNA 4EV0A 1Z7S2 2A3WA 1V9U1 1ZYBA 1OUXA 4JDNA 4JVAA 4Q5OA 4XZUG 1SEFA 4XIKA 3WQBA 4BOWA 5J7MA 2UY8A 4NWVA 4L99A 4I0WB 5IVFA 5I91A 1L7LA 2BJSA 4GD4A 3G7DA 3NNJA 1XSRA 1OBNA 2B7YA 1VBD2 3KF5A 2FQPA 4I02A 5GLVA 4HT1T 1CIWA 1MQTC 2VCBA 2CGNA 1VBA3 1OF4A 1ASJ2 4B7KA 2QQVA 3SR4A 2QNKA 4XUTA 2HSGA 3AFGA 4NWWA 5FV3A 1XNKA 1DFQA 1PO11 4BK4A 1XE8A 4BK5A 3ABZA 2OUJA 3WP5A 1FOD2 2NQYA 3NKTA 1QNYA 4N7IA 3GYDA 3BTXA 1REFA 2OFYA 2HWB2 3WX5A 2D44A 4RD7A 3AK0A 2EXHA 4ZONA 4AHXA 4AW7A 3WINE 4XQDA 2AW6A 3OB8A 1DU3D 4NROA 1VRH2 4ZS2A 3AL6A 5F5QA 4LHLA 3A9XA 3J7HA 2W91A 1PVC3 3VBUC 3ZSKA 4Z1VA 4ER3A 2R30A 4B4RA 2JX9A 2W47A 2VM9A 2GSYA 3LDRA 2PXPA 2KD7A 4HANA 4G3YC 1BBT1 3SISA 5DDJ3 1S0DA 3I3DA 3G5GA 1W6QB 1UU5A 3WF3A 2J1TA 5FY5A 2J1UA 3IPVB 4KU7A 5DUVA 2WNOA 1ZBE1 1KS4A 3AKPA 1HQNA 4PHZA 5FYVA 5IWFA 4M0HA 3U07A 4BQ5A 3WG1A 2Y60A 2GNDA 4W6YA 2JB8A 3PTYA 2KEKA 2JG8B 4FPOB 4QGNA 3AYDA 1JZ8A 1J3RA 2ZXQA 4AAXA 4YG7B 3OP9A 2XI8A 1W6NB 1ULGA 2WRAA 2Y6HA 3AL5A 5D21A 3MEJA 5C9AB 2MHFA 1YLLA 2VZVA 3MLKA 1QJX1 5FZ0A 5I93A 5FY0A 5F6KA 5FZGA 3CZJA 2KPJA 3ZDSA 3ZYBA 1U0AA 3FZ3A 2JDNA 1BZWA 3IAQA 2WSUA 1LMB3 2DVBA 3CJIA 3UT0A 2Q1MA 2WQ8A 1BJQA 2M4HA 2VL4A 4PBOA 3TAYA 4QXKA 5IVBA 4LUMA 4DIQA 2VPVA 4X6RB 2XVLA 1NA1C 3EBRA 5A3PA 2WO1A 2CWMA 4YFZA 3ZN4A 4IL7A 4O61A 3NQHA 4FBFA 5A6QA 1V0AA 5KHGA 2LUWA 3ZHIA 2WZPP 2B5HA 1DP0A 3QYXA 4LBQD 1PO23 2UU8A 3N7JA 5DAPA 1U2ZA 3ZFEB 2JB4A 2G4IA 2PAMA 4GWIA 4XEZA 3TRBA 4U2AA 5BNNC 2EALA 3OUHA 5LW9A 3PIGA 3IPVA 3NNGA 2C6SA 3QD6A 4BE3A 1A3KA 1WD4A 1X2LA 4GB31 4EN7B 1PZ7A 1BXHA 2X5IC 3A21A 1UXXX 1O5LA 2A7AA 5GZFA 4D7YA 4NIHA 3MIBA 2YBPA 2A6ZA 4I3GA 4LKDA 3ZIWA 1SBEA 3DPRB 2R1DA 2WIIB 2GMEA 2ZX3A 1SLIA 1RB8G 1V9U2 1QU0A 1G6NA 3ILFA 4LHSA 4MXVA 2ID4A 4WVMA 2WFF1 4RGKA 1X36A 2B46X 5FP9A 3ZFGB 3WF1A 4HKOA 1FX5A 3KV4A 4HL0A 3O1UA 3PVBB 2XBO1 4LA3A 3VBSC 2CNAA 3KCYA 5LATA 3I2KA 2RS53 1ENQA 4UFKA 3WQ1A 1WKYA 3TN92 4JQRA 5EYYA 4ZHNA 3I7DA 1HV0A 3WUCA 1NCRC 2ZOEB 1YCIA 4RL7A 1NXMA 4QX0A 1RHI1 2D93A 3DV8A 4Z2WA 5EJ1B 5T5OA 4I09A 1QHDA 2SBAA 1POV1 2DVDA 4NMIA 5JIUA 5LB6A 1PVC1 1AR73 4XVHA 4EQZA 1UOFA 1ST8A 5FY8A 4CP9B 3OQOA 3ZSMA 2QJVA 3GZDA 1WMDA 4LO4B 2GH2A 3HIFA 4LTAA 3A7QA 2KA3A 3VBRA 3ZHMA 2EWTA 4NIDA 4DXZA 2X53S 1U12A 3ZKCA 1DGLA 4QKDA 2WNEA 3RG0A 3DPRA 1DDLA 1MVEA 3FHIB 2OZJA 4P02B 1OFNA 2JG8A 1LENA 4IEPA 2D5HA 2OKXA 1FMD1 2ZGTA 1NZCA 4BIOA 3GN5B 4OI0A 1UWWA 2HYKA 3AKRA 4GWNA 4TLGA 4EE2A 2NLRA 1MS4A 3THTA 4XJZA 1ZA4A 3T4VA 2QZ2A 1YQ5A 1ZM1A 2WWUA 2XGXA 3M3CA 2J1AA 1CAUA 2CYFA 2RS51 3LSDA 2WQZC 1CZTA 4YBAA 3U78A 2KXLA 3S7EA 4MHUA 4CXWA 4D3WA 4AGVA 2VTFA 1ZBA1 3K4DA 3LISA 1O3RA 1GOGA 3ZKUA 3FFQA 4HVOA 3TN93 4TTGA 4UFIA 3RZKA 5GALA 2RDSA 3C8XA 3QFIA 1DW9A 4UW4A 1SLTA 2PHUA 4EZ4A 2XWJB 1XU1A 2D98A 3V0BB 4C1WA 4C1XA 3VD9A 1X57A 3ASIA 3WDUA 3I4IA 1I5ZA 5LK5A 3OMTA 1GZTA 4KU8A 2DVFA 3B9IA 2ET7A 2K9ZA 1POQA 1FOD3 3QOPA 5LA2A 4HONA 2CWSA 5KHHA 1SG3A 5A7SA 4I6UA 5FBZA 5FY1A 3B5LB 2IXCA 1JUHA 4LK7A 1U5YA 4JGZC 2XOMA 3VBRC 3JZVA 3R0RA 1NX9A 2ZGPA 4AFAA 2IVBA 3GM8A 1KD7A 3LDKA 4JGYB 4MADA 4X4HA 4RR3C 1NZIA 1H1MA 1ULDA 1WLDA 4FAGA 5A7NA 1TQ5A 2PE5A 2YFZA 4ORFA 4FN3A 5K98B 1SDDB 3O12A 4KWUA 3T2TA 2DBNA 5JOZA 1NCRA 5DAXA 2P3JA 4Q4V2 1ULCA 1VRBA 4A42A 5APAA 1NLRA 3MPBA 4OYUA 3GJAA 1LHWA 2R062 2W52A 3QOXA 1JWLA 1O7FA 2JD4A 2HWF2 1X33A 5K0UC 4RS5A 3T30A 3ZO0B 4ITCA 1NE6A 4LO7A 1SFYA 3KSCA 4BQYA 4DOUA 3VZNA 4CDUC 1GLHA 4EWDA 2W1QA 3PXPA 4Y20B 1ZBE2 2VCAA 3VKOA 5F7UA 4Q0UA 4Z2AA 1F2NA 4ZS3A 5T50A 4BHPA 3TEYA 3KCCA 4AEKA 2KZ8A 1GP5A 1YFYA 2D40A 3QH7A 1ODNA 2GMPA 4LBLA 1X9PA 4MXWB 5FZKA 3UGGA 1W6PA 1BBT2 3JQWA 3OOXA 4YW3A 4EN0A 2CDPA 4ZZ5A 2OYZA 4RN5A 4NPMA 2A3YA 4ASLA 4OBMA 2BERA 2DVGA 3DPRC 2WZ8A 2VVDA 1TZOA 2RR12 2BWCA 3PJQA 5DQ0A 4SBVA 2PXUA 1MZ6A 1W3XA 2NYYA 5F2SA 3PNAA 4Y5TA 2XHNA 4HK9A 1H1AA 2NP0A 1CAWB 1D4M3 2GNBA 2P37A 3CF6E 2XIUA 3OJBA 3POWA 4DZGA 4JTOA 2FFHA 4Q26A 5IAXA 1TNFA 1IPSA 3PUAA 1NCRB 2E32A 2P6CA 3RI9A 5I8TA 1SPPB 5FK7A 2V4VA 1M06G 3OBAA 1W06A 4IEZA 1DGWX 2ZGRA 4IWRA 2ZKLA 1W9TA 5G04L 2VU9A 1OVSA 3NXHA 4WV8A 3WF0A 1LHNA 2BFUS 3HMYA 2LYKA 4WVMB 2EBYA 1AU7A 5FZ7A 1B35B 4Q4W3 2E6VA 4AYUA 4MSVA 3ZYGA 4DE9A 1QDOA 1F31A 1UZ0A 2DCYA 1UMHA 3I8TA 3N9QA 3TRSB 4AEJA 2ZTNA 1FT9A 1VAKA 1A34A 1AXZA 3LEKA 4CDXB 1XRUA 3NNFA 1UN1A 2EIDA 3JB8A 3OF1A 4LIVA 2Y33A 1RUJ1 2RS52 4PQ9A 5I0UA 1I6XA 1XU2A 4MXWA 4XUNA 3ZLIA 4EQVA 3O1VA 3H50A 4LO8A 5T5LA 2B42B 3Q8FA 3F51A 4MOAA 1O4XA 2VZPA 4FOQA 4QMAA 3T08A 3ZDVA 4DRVA 1UKGA 3ME5A 3AXDA 3AC0A 4Y24A 1GQGA 1OFSA 5K4LA 2Y6JA 4HK8A 5FZIA 4Z59A 3KV6A 4AEDB 4OQ8A 5JXJA 2VUCA 3J7NA 4YG1A 1C4RA 2IUOA 3WLUA 5IFTA 3AMNA 3UNPA 1OT5A 1RUH1 4K1YA 2XWBB 4NDWA 2O8OA 3K77A 2YG0A 4IGQA 2IZWA 1RMU3 3FUQA 2RMU1 2DU1A 1WIZA 3SCGA 1ZZ8A 1RXGA 2PYTA 3NAPB 3NV2A 1TMF2 3VZLA 5A3MA 4N53B 3KB5A 1R081 3K48A 2UURA 4ZZ8A 2OX0A 3NMBA 4AQTA 3OBZA 2WS92 2PXFA 4Z82A 3LA7A 3POYA 3VD3A 3VBOB 5JMOA 4P9GA 3MEPA 3JCIA 4F83A 5SV5A 5KXCA 4PQQA 1AR83 1ZZCA 2Z42A 1JFTA 2QDNA 2YMZA 5C8CA 4MGKE 1GANA 4CCDA 4IV3C 5F8PA 4ES8A 4QPGA 4M3CB 4N8MA 2ZHNA 1F5JA 3TN91 2BNNA 2JE9A 4MV2A 5DTQA 1V6OA 3D3AA 3I3BA 4XFAA 4X4BA 2WJSA 2J22A 2YDEA 3OCPA 4I01A 4OI4A 1RUOA 1RITA 3K4AA 1VPHA 3N36A 1FNZA 1RUJ2 2GNMA 2WO3A 4O7XA 5I0RA 3HT1A 5DMYA 3WQ7A 1XWRA 3NL1A 4LO5B 3VD5A 4DXRA 5FMDA 3K2OA 3KV5A 2HLEA 3UL2A 3J8F1 2RHPA 1PK6A 3DYPA 2QTWB 5JPMB 1IG3A 2D6LX 1RJ7A 4KGQA 1NT0A 1CGPA 1W6MA 2V09A 1AYM1 2PTMA 1ODMA 4HZFA 4BM8A 5C4WB 2PUBA 1O59A 3B93A 1EP0A 2OT7A 4JTNA 1EV13 1RINA 4BIFA 2CHHA 1U5IA 4B1MA 3JBG1 1Z0HA 3RFRA 1NLQA 1SMVA 3CIHA 3SXWA 4B4PA 5ANQA 3SH4A 1Y9QA 3P3NA 2ADEA 4Y42A 2VMDA 3LIHA 5DDJ2 4CA9A 3RZJA 1N3QA 5EWSA 1QPZA 2ARCA 1GSLA 1W8HA 3F52A 1Q8PA 2GP5A 3GZTB 1SCSA 4IV1A 2YXSA 1CQ9A 1PRVA 3AMPA 3GHNA 1GUIA 3CO2A 2WN2A 2EVXA 3POJA 3ACLA 4LLFA 1YQ8A 4QHOA 4YG4A 2WUSR 1W05A 3KWVA 3M3IA 1PRUA 3KZ3A 3CJIC 4R4XA 1AL21 1DYOA 4RHV2 3S0MA 4QB6A 3VBRB 4LOSA 1O4YA 1U5XA 2PA7A 4N43B 2XXQA 1ND3A 4QB2A 4AHWA 3BCWA 1RUG2 5GLWA 4PDWC 3W21A 1GQPA 4G9SB 4H14A 2VECA 4EN9B 1ZRDA 1LR5A 4AI3A 1GZ9A 1OA4A 2AXZA 4YW6A 3VZJA 4AEMA 2AUWA 5FZ9A 2HWF1 2OQ6A 1DQ0A 2EXIA 3FHQA 1JHJA 3GJBA 4OUSA 2BBAA 1HF0A 5A3LA 5KC6A 3AMQA 1PGL2 1H2LA 3ES1A 2ARAA 4YYOA 1ZZBA 5LRSA 1CX1A 5EV7A 3ZPXA 2HBUA 3MUY1 4WM8A 1F4HA 3AJZA 1FI2A 1AR92 4FP2A 3T09A 4Z5DA 1UQXA 3H0OA 1Y9GA 2ZGQA 3RMXA 4CCOA 1DQ2A 2DDUA 4S2GA 3A0NA 4YGBA 3MLJA 3UYJA 3ACIA 4GIQA 2Z79A 1BBT3 3MFAA 3WW2A 4ER6A 5FQ0A 5FPXA 1VBB1 4Y20A 4WM7A 5FZ1A 4OHYA 4IQPA 3T2PA 4QU2A 1WCSA 1IHMA 1HN0A 4J25A 3C3VA 3PUIA 4KMQA 4YM1A 2BFUL 2YHJA 4GHJA 2L9LA 2VZRA 4JX0A 4X4CA 2ZMLA 1N1TA 5BNOC 3HEIA 1ND3B 2TNFA 4FOVA 2ERFA 1SACA 1VLNA 1HXS2 2RDQA 3V0BA 3T0BA 3WDWA 2PLV2 1X7NA 3KD4A 3ZR6A 2EIGA 4YVSB 1X50A 3FBMA 3UESA 2HJIA 3N7LA 4H2AA 4B1LA 3WY6A 1S0BA 2VCMA 4KWJA 4Q0PA 1MFQC 1OVPA 3H8UA 4WVLA 4PU3C 2ZHKA 5FRAA 2VBBA 4M3CF 3WZ1A 3ZFGC 4FOWA 1AUYA 5FXZA 4CEYB 1QXRA 1GNYA 2I2SA 1AX0A 2OPKA 3QLQA 4CP0A 5FDBA 4N7UA 1RHI3 3A23A 4CU9A 4L8QA 1MACA 1ND2B 3DL3A 4YW5A 2ARXA 2A6XA 3OUIA 3ZXGA 1IPJA 2IV1A 1O4ZA 5F2WA 2ET1A 3GZCA 2EF6A 1GR3A 1OLMA 4FFFA 5A3TA 1OLME 5C70A 1HRV1 1STMA 2BVBA 4CCJA 3H42B 3WW4A 1DLCA 3LEIA 4FPGA 4C90A 1H6YA 3M2MA 3J8F2 3ENRA 1GNHA 2W1SA 5FP4A 2HWC3 3UGHA 5F3IA 5BNNB 1O8PA 1WCKA 2ZACA 3NKGA 4HLTA 2D3PA 5GZDA 3VBFB 1DGRN 1TVGA 5A7WA 2YU2A 4AG4A 2YC4A 1PNFA 2ZMKA 5CVRA 1S0IA 4CSWA 4WM8C 3H1WA 5FZ4A 5JI9A 5E16A 1BHGA 3WW1A 4ARYA 1UX7A 2ZGMA 3DM5A 1J3PA 2WFPA 1OH3A 5F32A 1JZ5A 5GZCA 1BDIA 1A8DA 4UT5A 4QM9A 1OUSA 1O5UA 5KWRA 2FMDA 3KS7A 4JDMA 4BQ2A 4CVUA 2VUAA 3U4SA 1W03A 1DHKB 4IV3B 3THDA 4AF9A 1B35C 2D7FA 2DCZA 1W90A 2W92A 4LBQA 5L9BA 1ND2A 2JQEA 1W6OA 5FBJA 4GWJA 1QQP3 2ZZJA 4MH0E 1ZBA3 2P34A 4X4EA 3PU3A 3OTFA 1TEIA 2X5IB 4BQWA 4HPKB 4XBLA 3LOIA 2R16A 2XUMA 4N53C 2F4PA 2WO2A 1G8WA 3R05A 5FZDA 3O14A 4CDXC 5K7PA 5K8SA 4YNIA 3DEMA 2ORZA 3FUOA 2CSGA 5A3WA 2I07B 1RHI2 3GF6A 1OI6A 2C5DA 1AF9A 1QOOA 3O0VA 2VCCA 3MLFA 1C8M1 4M3CE 2XXPA 1EPZA 1BEV2 1WA6X 3I2JA 2ENRA 3ZIXA 3JQXA 2ETEA 3LFMA 3S30A 1CESA 2A6VA 4WM7B 4QPIB 3B00A 3WNPA 1LODA 1UIKA 1D2SA 3FL7A 3J8F3 2RS32 2XJTA 4E27A 3OPTA 4IEQA 2WL1A 1BLZA 1JOJA 2DCTA 4QPIC 3KJXA 5CKNA 4FPKA 3WNNA 2W0XA 2JIJA 2FCUA 4LORA 4UFJA 3UV9A 1RUF1 4PT6A 4Z07A 2DUQA 5L7OA 2BGCA 2VXRA 1DG6A 3KV9A 1ONAA 2ZEWA 4R4ZA 5F3CA 3QWGA 2Q5TA 4XF4A 4GB32 5FMOL 3SLIA 3ZOIA 2WKKA 3BKZA 3FYAA 2ORXA 2HWC1 2EAAA 2XKOA 4BZ4A 1XE0A 4X4IA 1UY0A 3PIJA 5CISA 1MS3A 1QH6A 4INDA 3J26N 4AE2A 1JS9A 5F3EA 3KVBA 4Q4V3 2RS11 2JDPA 3C7HA 5IUQA 3V64A 3JU9A 1QIQA 2G19A 2P4EA 4CP1A 3RYPA 4AVAA 5ACA3 5KC5A 5L19A 4IEOA 3L2YA 1NG0A 2YY1A 2J1SA 4FVVA 1V6MA 4HVQA 3CJXA 4MGSA 1H0BA 5LBEA 4CXYA 1L7QA 1K5JA 5FO7B 3TEXA 1CX4A 4QX2A 2AR6A 3HNYM 2VO5A 2X8KA 2Y8KA 3N9NA 1NCQB 1OC1A 4FT8A 5A3NA 1COV2 1CAVB 1WH8A 3AKQA 3C7GA 5JIAA 1UYYA 2UYAA 4YW2A 4EYUA 4ATEA 3S57A 1QXPA 4QGMA 3VWSA 1TG7A 3PVEA 1BKZA 4JHTA 2BZDA 2XJQA 4Y1ZA 1AZDA 4GKXA 5ACA1 1JZ3A 3FYMA 3OYWA 4NJ4A 2PXLA 2GRMA 2R061 4DS0A 5DTMA 3BU0A 4GULA 2LTNA 3PL0A 3NO8A 2WNVB 1ND2C 2ZEXA 1HN1A 4FFIA 4FFHA 4JGZA 1F15A 3L9JT 4Y1XA 2QKDA 3VDDB 3PLQA 4XFHA 4XQ4A 4YZ4A 4D69A 3KLSA 3DGTA 1WW5A 1ZBE3 4K1ZA 5A32A 4JDOA 3RWKX 1F35A 1US3A 1JYVA 1KFXL 2W94A 2XH6A 4FPFA 1KJRA 5C3PA 1AX2A 4A41A 4LJHA 3PVNA 4C0BA 4Y3OA 2GC2A 1FOD1 1RJ8A 4CEYA 3IZOA 4M01A 1CIYA 4YZ5A 1GICA 2DCKA 3I2FA 2F4LA 1QZXA 5T52A 5BYNA 3AMMA 3ZFEA 1CN1A 2HWB3 1C1LA 5B4XA 3WT3A 3ZXEA 4L92A 5C5UA 5FO9B 5DRYA 1GP6A 3ACHA 3HOBA 4GH4C 4NE9A 3WCRA 4DEQA 1Y4WA 4LLOA 5EZWA 2PUCA 2VXJA 3JXBC 1K5MA 1SFNA 3WVJA 3RJRA 2JECA 3ALQA 1SZBA 2VAUA 4LE4A 5IFPA 2FDGA 2P1BA 2J7WA 1IS3A 1S0FA 3G6JB 1KXGA 4RS5C 1LGCA 5FZOA 2CY6A 3WEZA 3U3WA 3DYMA 3VN4A 3VBFC 1Z7S1 3ZPYA 4XUOA 3P3PA 2TUNA 2VMGA 5DPNA 5FZCA 5A7WB 1GZWA 2BOJA 1S7EA 4QQ2A 2P5BA 4FCAA 5EXOA 3ILNA 3WCSA 4AVSA 1QJU1 3DKWA 1K42A 5K0UB 5JCTA 3WUDA 3VL8A 4LITA 2W95A 2IVQA 2Y0IA 4E4HA 4TN7A 5ABJC 5J09A 1HRI2 1JW6A 4GQ7A 3K4ZA 5FZMA 1OSGA 3D6EA 5LCWL 1UOJA 3MDPA 2Y6KA 2FDFA 1W2UA 1LTEA 4ZKTB 3KQ4B 2QBXA 3UGFA 3FWEA 4W65A 4YFWA 4CUBA 2XJVA 4TZDA 4IETA 2B4KA 2CDOA 3KVAA 3VHRA 4NHYA 5FYTA 3PUQA 2FZ2A 3INAA 1JYNA 3LEMA 1FMD2 1SLLA 1XNBA 1PERL 4AZZA 3J4UH 1FYUA 1IS4A 1V6NA 3IB3A 3OPZA 2IUWA 3MGUA 4XQWA 1HQWA 1C5IA 1G9FA 1IGOA 4FI9A 4L2NA 2A6YA 4QXCA 4XFIA 3BUCA 5FWJA 3QH6A 2BUKA 5C8WA 2RMU3 1VBE3 2BEOA 2QCSB 5J3UA 3RZZA 1N3PA 2WAOA 2D6NA 2MNGA 1OPOA 2EAKA 2Y6FA 4I30A 4IV1B 4ZPIA 1WCQA 3ZFEC 3ZSJA 2WYSA 3CHXA 1LEDA 3M3OA 5IK8A 2HWE3 1NAEA 4D7SA 1RUI3 4CE8A 1POV0 4K20A 5LZ6A 2CV6A 4OHZA 2XBO3 3JXCL 3FE5A 1BK0A 1YO8A 1KGYA 2WFF3 3MBWA 3U4XA 5LY2A 4BWOA 4HMZA 4OZXA 4NIIA 2DWRA 2J42A 3OGGA 4PLOA 5AFBA 4Z5HA 1GFF2 2WYFA 1SBFA 4R8HA 5LEJA 2Y64A 1HRV2 1ZZ7A 1X9TA 4WVVA 3VDDC 3OBTA 2EXJA 2ZX0A 3WNXA 1IZ3A 5BV6A 1YJKA 5F5CA 2FHRA 1JOPA 1CJDA 1YFWA 3LQXA 4B29A 5HBAA 2ZJCA 1OKQA 3BOPA 1VBC2 4TLFA 3E6BA 3VLBB 1V70A 3ZFFB 4CCCA 4D94A 5BNNA 2ZCWA 1EUUA 3Q8EA 3L2HA 1PNGA 2YFUA 3WR0A 1OF3A 3BD1A 1QJY2 2EIBA 1RUG3 5FZOB 4CDQC 1FMD3 2JEMA 1NCQC 5FZ3A 2XPJA 2BWAA 2RM21 2VZ1A 1HXS1 2GAUA 4YRDA 4HSJA 2PAKA 2Q1ZB 4PIXA 1W9WA 3B69A 4E2SA 1QP7A 2XL7A 1LQCA 3H5TA 2V3CC 3FBYA 5BXXA 3USSA 1N1SA 1ULPA 2BTVC 1HJGA 1R1A3 4DMIA 3ZXAC 3NJVA 5C3SA 1R63A 4JGYA 1AVBA 1PMIA 2D3RA 1NUKA 3QCWA 3VBUA 2RDNA 1UZWA 2ILMA 2EXKA 3B7MA 4ER0A 3POGA 1W6OB 2GN3A 3POIA 1QJX3 4COUA 2PHLA 4HXCA 4Y1VA 2TBVA 4PF5A 4FPHA 1U5ZA 2IC1A 2XR4A 4YVWA 4D7TA 3SH5A 2QQPA 5FYBA 1OA3A 2D43A 3GCWA 5CAZA 4MGZE 4XMIA 3ZFFA 4JCXA 1ZX5A 3HBZA 3LPFA 4OI2A 4S2DA 3KQRA 1CAVA 4TXWA 2GU9A 4AI8A 1PM4A 4BQXA 2PHWA 5LK7B 2ZPXA 3LAGA 5ISLA 4J1XA 3RYRA 4XE9A 1E5RA 5JR2A 1LLIA 2BPA2 1S2KA 3EHKA 1O3SA 1W0OA 1VBA1 1NOVA 1RUG1 3PMSA 2MEZA 3JD73 1QP4A 2D6OX 2R041 4L11A 5F6LB 2Y6GA 4UW6A 3KGZA 3LA3A 3CLPA 2WWSA 4MCXA 2VZQA 2E7AA 3E5UA 4FXGB 3P1IA 2A6WA 4OUEA 2QQJA 5D8AA 5FP8A 1GKBA 2DTWA 5CFDA 5FXXA 4EWAA 4QQLA 3QQ6A 1BK1A 1HKDA 1S55A 1S0GA 5FWEA 2UYBA 3HVDA 3TWIA 3CQOA 4LBOA 3M8LA 4Z58A 4LKEA 2YB7A 3ATGA 1NERA 1QXJA 4DFSA 5J96B 4FAHA 2IXIA 3T1LA 3VBUB 4AHZA 5AC92 3GXUA 1WLTA 1HJFA 1DF0A 1K12A 1W0NA 3LD8A 1AHSA 4AQ2A 3TEZA 1QQBA 1ENRA 2PHDA 4CXXA 3IDCB 3B02A 1QEXA 5GAHi 3WQ0A 3ZYJB 4X4GA 5LY1A 1RUD3 4CP9A 1WLCA 4Y5SA 2R7EB 1RUE3 1DYKA 3SHRA 3O9XA 4RQPB 3GZDC 2RVAA 2FBEA 4QWNA 3RJ2X 1XYNA 5HXMA 4XUPA 3TELA 4NIAA 5IK7A 4CPBA 3USUB 1JU3A 4OI1A 4MX3A 1VALA 3CNAA 4XHBA 3FFZA 1F9KA 4PI2A 4XTMA 5GZEA 4CRQA 1WETA 1UW8A 2RR13 3D0JA 4XJWA 4ATFA 5CU1A 5CEHA 4EZIA 1DLLA 3AYCA 4AK3A 1D4M2 3AP7A 2JDAA 2HWF3 4XTPA 1WCUA 2VQTA 3SKJE 2JG8C 1QH7A 5DAWA 3SQOA 3PDQA 2C9AA 4MHRA 1LHVA 4QU1A 2R071 4IVZA 2E9QA 2Y6LA 1N1VA 4BQ3A 1GWLA 4AVTA 1S0JA 4TWTA 3U10A 1DQ1A 1BDHA 4HKWA 3U37A 2ZKNA 1R1A1 3HN1A 1WLWA 4XXAA 1LKNA 5FLIA 4ISQA 1SLBA 1RMU1 4DINB 2WQ4A 1EV11 3T2QA 4JGYC 3MZHA 2WT1A 4LBJA 2J7UA 3CDZB 1GNZA 3DNVB 5E6HA 3M3EA 1WWYA 4EK9A 1KDMA 3AMHA 5A7OA 3FJSA 1SQ4A 3POSA 5DAVA 4XBNA 5AC93 2YPJA 2JG9C 2RMU2 1UY1A 4GMP3 4RS5B 3DECA 1ZAYA 3ACFA 1JMUB 3LWCA 3SCFA 4QQOA 1PHMA 2O4AA 1XNCA 3WNKA 2VOXA 3C2UA 3P5BA 5FP3A 3URFA 2NPIA 1MR5A 2VNGA 4Q4Y3 1RUC1 2HWE2 3RZMA 1YHFA 4CEYC 1ZPQA 5EHDA 4IDZA 1UYPA 2RS12 2GC1A 3T4HB 4OZOA 4QPGB 2HBTA 5KR7A 4MGIE 3H7YA 4KI5M 2K46A 5A3OA 3W20A 3ZM8A 1CVNA 1SCRA 1LCDA 1YWKA 4IGPA 4PF1A 1W6QA 5FXVA 4XPVA 4BJ0A 1W8UA 4M4PA 3UFDA 1XPWA 3R4SA 5D8AB 1RZRD 4V1PA 3N7MA 5BNOB 1LOFA 3CLCA 1E5IA 1PGW1 1QMJA 1SLAA 4QX7A 5DAQA 5CG8A 3KGLA 2WA3A 4IE4A 2TEPA 3QBQA 2BV4A 2GZUA 1TME2 5HV4A 4ZU5A 5FKCA 3LDBA 1AR72 3MIFA 3T3YA 4YW1A 4MG2A 1LECA 2QQIA 3DKQA 2VGDA 2VBPA 2WWJA 2RS33 1MQTB 3WF4A 5T5PA 1PK6B 1XSQA 1W0PA 1OOPC 4MO3M 4EJRA 1DQ6A 5L9RA 2XXAA 1AR82 4LKFA 5DABA 2VZ3A 1OOPA 2FCTA 2FDJA 2CAUA 1JN2P 4X8NA 4QD2A 2WUHA 5H9PA 4CDWB 3HT2A 3V65A 1NA1A 4LPLA 5FYYA 5JUWA 4YSFA 2B45X 1QJY3 1NE4A 3OUJA 3H9AA 4NO4A 2VVFA 4IE6A 2AUYA 4NHMA 5EPAA 1BVVA 5LA9A 1LAJA 2LYJA 4FPEA 4Y4YA 3NV1A 5FJKA 4AQSA 2WIUB 1E5HA 4UFHA 1Z78A 4K3UA 3WNLA 3QOWA 4ZXEA 4A6OA 4LMFA 3WV6A 2YU1A 2RR11 4AFBA 3ME2A 1LOFC 3DCQA 5JOWA 2XLAA 5GJ6A 3IT8A 3RZGA 4IERA 2D5VA 1S2BA 4D0QA 5LASA 2D6KA 4QKFA 3UJOA 3KT1A 5LA1A 1QJZA 4NRQA 4GA9A 1C8M3 2XJ3A 1L7RA 1YRZA 5FPBA 4NIGA 3H1YA 3CKHA 4QHBA 2WNVC 2NM1A 4MCTA 2ZX4A 2X09A 4QXBA 1AL0G 4DQAA 5D1IA 2AZ5A 1Q8VA 5J36A 1LGNA 4R52A 1XC6A 3BALA 3SH3A 4GMP1 2V72A 5IYYA 1MQTA 1CAWA 2ZHLA 3IMNA 3WNMA 5A70A 4XOGA 1GT0C 1PGSA 3AM2A 2I74A 1QQP1 4XHXA 1XNTA 4W50A 4WVWA 4A3XA 4YGEA 2R072 3D5OA 3BYWA 3OGVA 3PVOA 2IWGB 4Q4V1 4AGRA 5ABJB 3OEBA 5EFUA 3ACGA 3AZXA 3NROA 1D4M1 1NYWA 2P3YA 3JD72 2CL2A 2BQPA 4CCLA 2OIIA 4R9AA 1YYNA 3HWJA 5E89A 2WN3A 4F3JA 3BODA 4DXTA 5L9VA 1QJU3 2VZSA 4AVBA 1GWMA 4LIUA 2E31A 1YQ6A 3LOBA 1GZCA 1UY3A 1OQ1A 3AP6A 1R69A 2JG9A 1B0NA 1VIWB 2BYVE 3SITA 4LBMA 3NW4A 2PQSA 3TNPB 5HCFA 2YGMA 2C4XA 3R4DB 4FPCA 4J1WA 1LULA 5JXIA 2JD9A 2IVIB 2P2KA 2VW1A 2QQNA 3Q8BA 3RNSA 2YYOA 4NHKA 3I59A 3W9AA 2KEIA 2D3SA 1YNAA 4MGTA 1VMFA 2FD8A 2UWAA 4CEWA 3FMGA 4EZHA 4COYA 3ZKYA 2AXVA 3KCXA 4FO9A 3Q9OA 1S0CA 1DGRA 2CU5A 4CEWC 5J1XA 2MQKA 1UNBA 3JB4C 5C4WA 2Q8DA 3OYWB 3VZOA 3A9ZA 3VBOC 2DUPA 2PLV1 2W2IA 2Y26A 4NPLA 3VV1A 4URTA 3D82A 4AVCA 5FR3A 4META 2AEYA 1L3JA 1OPMA 3HBKA 4AGGA 2VNVA 1O6UA 1DZQA 1US2A 1WMFA 2BU9A 2VNOA 3IDEA 4Q4X3 4AI9A 2F17A 1LEMA 2UWCA 4DUXA 1GOFA 3H3UA 1UCXA 4Y22A 5LWBA 3JBG3 4Q0QA 5EIYB 2YBDA 1RUE1 2WAAA 1QB2A 2ZA9A 4A7YA 1VBB2 1AL23 2HH9A 1W8WA 3EQEA 3OPWA 4MGYE 4TSVA 5E88A 2G9FA 5A6XA 1DGWA 5FMCA 4BYYA 5C3OA 1C28A 5DRTA 1S1AA 2MPFA 4X4FA 4CCKA 2JE7A 3KL4A 5FZ8A 5A80A 4N43A 5IVVA 1MVQA 1VBE2 3E5XA 4XACA 3TOJA 4B7EA 2C26A 2XSDC 3CROL 1K5MB 5LEKA 4CEWB 3JUUA 3VZMA 2HCNA 3HQUA 4MGQA 4EWEA 1LRHA 5JUVA 1S4CA 2K2SA 2BJCA 1RPEL 3CEWA 2X29A 3DXTA 3WG4A 3FLPA 2C24A 4UAPA 3ZYIB 4YM3A 5HCHA 2PXEA 1QKQA 3B3QE 2PLV3 4FTSA 2QZ3A 1E57A 1WMXA 4R9DA 2WO7A 4H3WA 1UF2C 2DYCA 1Q3EA 3OQMA 4HPKA 1W6MB 2N7GA 4K40A 1C1FA 3I2IA 3IN9A 3CU7A 1UIJA 1VAMA 1IOAA 1CQTA 3NNMA 5BNOA 2JXAA 2R0HA 4XFGA 4ZXKA 4OB4A 5BNPC 3U14A 5JDBA 2HEVF 1ADRA 1WBFA 5FPUA 1NEQA 2JDHA 1DQ4A 3RMYA 2LYPA 3D1NI 5DDJ1 1RUI2 5LA0A 2XXZA 1KITA 3WNOA 4Z8BA 3W5MA 1AYN2 5FY9A 2V5YA 1HQLA 2DV9A 2PHRA 2XBO2 4CPBD 4Z5CA 1PMHX 4JAAA 2ZABA 2WA4A 2ZX2A 3R1FA 4KQ7A 5FUIA 4IEVA 3SC7X 2WFF2 4QGLA 3NV3A 1UZVA 4P14A 2XJRA 5A33B 4NPRA 1IG0A 2DBIA 2NN8A 4S2FA 2VMHA 4AHYA 1Y7BA 2ZAHA 4R9BA 2HYXA 4DY3A 3AP9A 4H7LA 5JAXA 3ZVXA 1JZ2A 3E5QA 2IXJA 3KM5A 1PO21 2VH9A 4K21A 5J37A 4HOOA 1L1MA 4P9IA 1IKQA 2WS93 1VMHA 5FO8B 3U75A 2YGLA 1R1ZA 1UTXA 3B94A 4LXLA 2Q8OA 1ZZ6A 2VEOA 4KBBA 3ZFGA 2VULA 1BEV3 1GV9A 5J98B 3SMHA 4E9KA 2W68A 4BLIA 3GNEA 5FPAA 1MZEA 1W9FA 2OA2A 2PHTA 2W5FA 3ON7A 3ZN5A 3ZX7A 2DUOA 2E26A 4ASKA 2LNMA 1V9U3 4BMEA 2Z5WA 3KZ4C 3GGLA 3ZSEA 1YEWA 4B8EA 1SPPA 3F2ZA 3MHZA 3ZYHA 3KT4A 5IAVA 4YLZA 3RPQA 4LK6A 5SV8A 2AYHA 4FTEA 5AFEA 2W39A 4XCAA 1V6IA 3MI8A 2G9ZA 1W8ZA 4LE3A 3MV01 4J6GA 4Q0SA 1W2AX 4LNVA 1LU1A 1W9YA 3WP6A 5JSRA 2G1MA 3BDNA 1VBD3 2JICA 5ABJA 3O1SA 1MS8A 1QJX2 1I5PA 5DTRA 1LOGA 1PK6C 2WZR1 3OEAA 1T2XA 5LBBA 4CDXA 4IV3A 4AQ6A 1JYCA 4HRAA 2HKXA 1ZZ9A 1UO9A 4YW4A 5FYUA 4OMCA 3B9CA 5CKQA 3WDYA 4ASMB 1KQRA 3EMRA 1CAXB 3BB6A 2GALA 4JC1A 5I8SA 1HB4A 4A7ZA 2PUFA 1UU4A 4QX1A 4F7ZA 5CBLA 2FMYA 1RVF2 1R64A 2BNMA 1YUDA 2AGSA 2WC2A 1BVP1 3WDXA 3KXAA 2ES3A 1H8TC 5C3QA 3I2HA 4NOTA 1CWPA 3ST7A 5EJ3A 4GB33 2R49A 1R093 1REDA 1XXNA 3F6WA 2L8NA 3K51A 4Q4W2 1GYKA 5TSWA 1RUE2 3GALA 2H6CA 3AZWA 3T1MA 3LF7A 3KF3A 2PMWB 1G9BA 1OOPB 3BTYA 1X8EA 1RUNA 1ZS4A 2HWD1 4GH4B 5I8YA 3H8OA 1IPKA 1VB2A 1V6KA 3PUHA 4NAMA 2Q1FA 3MF9A 4GJZA 4Q8LA 5BNPA 4E8DA 1Y9MA 1F5FA 3MO4A 4LOTA 4YVSC 4MVTA 1ASJ1 3V56A 3EYPA 1RZSA 5DT2A 1W2NA 1X82A 5FY7A 2PXKA 2RJ2A 3H7JA 2HWD2 4RGGA 3X29B 5A7LA 5CFCB 4FQZA 2A3XA 2BP6A 3KT7A 4XF1A 1JOBA 1LU2A 1LCLA 3ILRA 4CCEA 4OUMA 3J9SA 2BOIA 1W6NA 2Y34A 4YPJA 3VUOA 4XFBA 4BLJA 2PHFA 1HIXA 2RG4A 4IW3A 1Q8OA 5AVAA 1PZ9A 2VVEA 4I0BA 1W2OA 1GZWB 4ISRA 4YG6A 1WA4A 3MUZ1 4LQRA 2OR1L 4HFSA 1W99A 4ZU7A 2XDVA 2IXHA 3E6CC 5DZFA 4XURA 3AVRA 3B01A 4K9SA 1EPWA 1J84A 5FKBA 4E4DX 2R042 2EF8A 5FLHA 1CAUB 1GP4A 2PXDA 1H6XA 5FQ0B 5FYCA 3VBSA 1NY71 2ZEZA 3H1MA 4BXSV 4F8AA 2BDRA 2VQ0A 4UXAA 4AR2A 4W6XA 3PE5A 5AVPA 1XJAA 2OS2A 4GH4A 1G9AA 5BNPB 4YG3A 1AR63 5T54A 3O1PA 1IQDC 1HB2A 3VHNA 1YXWA 2PIJA 3MYXA 1Y3TA 5CYYA 2ICPA 2B9VA 1DCSA 1RGSA 4QPYA 1O3TA 1MEC2 3U11A 2CGPA 4FPLA 5BNQA 4B3NA 2H8RA 3UJQA 4L0PA 4FOYA 2JE8A 4P5YA 5FYZA 1D7PM 2DURA 2G9GA 4UFLA 3GZEA 1OD5A 4XW3A 4YGCA 3TEWA 2A71A 1O3QA 5M0TA 4LKSA 2WBKA 5FYMA 1HRI3 2BRTA 2D6PA 2WNVA 3N7KA 4KBZA 3N4MA 3ZXFA 1UMZA 4YWAA 3BPSA 1CZVA 2RV9A 1QGLA 2XKPA 1AJKA 2HWC2 2YPDA 3D4KA 4IE0A 2O38A 2XUEA 5FZBA 4CP2A 3VDBA 5FPZA 1UOGA 3WSOA 3ZSLA 3GZAA 2XLFA 3HZIB 1DQ5A 1OQDA 4Y1UA 2JDUA 2JDZA 4O65A 1JZ4A 3VKFC 4PU8A 3ZMOA 3PU8A 3AYEA 2C9KA 4XFCA 4IXLA 2W46A 4E4SA 3UKNA 1RYYA 5CFDC 4PU4C 2LROA 3DXUA 4OVEA 4CCMA 1EAH2 2WR9A 2ODRD 3ZXJA 2PXQA 5C6CA 1V6JA 3IAPA 1ZRIA 1CONA 1H8VA 1AR81 1HX6A 2JKBA 4L9BA 3O1OA 1J58A 5FZFA 5KHJA 5DN2A 1YQ2A 2VNRA 3MW4A 4LBNA 3BOWA 3RWNA 1AYN1 1ZBA2 3NJXA 1MS9A 2C1FA 3I3EA 4XJAA 4ZU4A 2Q4SA 2BW8A 1G9DA 1Q8SA 2VQAA 2Z2SB 4H7MA 1ULFA 5CADA 3HPNA 5IW0A 4AAPA 4BU2A 1MEC3 5CG9A 3ZMNA 5JZGB 2WDBA 4FP3A 5FTTC 1W3VA 1UAIA 1W8NA 4K8RB 3IVPA 4BXFA 4IEXA 2P3IA 1GQHA 1HRV3 2PELA 2UWBA 1PX4A 4LBKA 4GALA 3WHTA 4FSJA 1JZ6A 5LRRA 1PMJX 1R083 5BUVA 5DUWA 4JKMA 5JVVA 3O0XA 5KHKA 3OBRA 2BGPA 4I3PA 1H4GA 4Q2JA 1B09A 1IS6A 2FDIA 4JHZA 3S5AA 1DZRA 3THCA 1ND3C 2GRLA 1G7YA 5DZGA 5JOYA 5FUPA 1C3HA 4LULA 4QPIA 3I49A 1VP6A 2IVGA 1Z7S3 4FPYA 2J1RA 5ANNA 4N53A 4AVVA 1LNSA 4YZ1A 5C9AA 3MFCA 3ZYRA 1CPMA 2GN7A 4Y26A 1JYTA 5IJRA 1DZTA 2PPXA 4DO0A 2XLGA 3ZPOA 4I8TA 4Q4Y1 3FLRA 3H3ZA 4Q1RA 3VK0A 5F1RA 3CL1A 3SEPA 2GDFA 5FZAA 2DU0A 3WDTA 4M00A 4H55A 1RVF3 1VAVA 4M3CA 1RMU2 5KXDA 3GBFA 1QJEA 5FMOS 1OCTC 1EAH3 1NY72 2QVSB 3T0AA 3A22A 1KRIA 1AR61 1ENXA 3I2GA 2VBDA 3OGJA 2ZEYA 1UYXA 3POBA 4P9LA 1VBC3 2X10A 4XILA 1QJU2 4KGGA 3VDCA 1XYPA 3RGBA 2GZWA 1M4WA 2WZR3 3MIHA 2IU7A 1HB3A 4RGAA 1AJOA 3WP3A 2BGOA 5CB7A 2ZHMA 4K7JA 1D0GA 2PUGA 2W9XA 1FNYA 3HJRA 3LSEA 2VJXA 4Q4X1 3W58A 2D97A 1W2TA 5DUUA 2ZGOA 5IK5A 2HINA 2DFCA 4YVSA 3M4FA 1Q43A 2O1QA 2QFEA 4XZPA 4AEDA 4PU7A 4AI1A 1SBDA 1FPN1 1J1LA 3J7MA 3FHAA 4RR3B 5BY5A 3GUUA 2R1JL 2R63A 1AX1A 4KWKA 1LJ7A 2A5ZA 2AWIA 3SEEA 1Y7YA 4KH9A 1QNWA 3O1MA 2OPWA 1GWKA 5HPOA 1A8MA 3AZVA 1QY4A 2JVLA 4DRRA 3ECQA 1WBLA 5T5JA 3OGSA 1ZRFA 1IQAA 5I0DA 5CFCA 2E33A 4RA0A 1XNAA 2DTYA 3WD5A 5CA6A 1H8TA 1PO13 4S2HA 5JSPA 4JQTA 4OHVA 1NW3A 5H9SA 4K8FA 3P6BA 4BISA 1MS0A 1CD3G 1JUIA 4Q4X2 1S0EA 2LRPA 1V6LA 1RL3A 2FZ1A 4OLLA 2QQKA 4NUBA 3MLLA 1AR91 2RDRA 1FV3A 1W6PB 4AOCA 5JZGA 4CCNA 2XVKA 3VBHB 1C8NA 1RVF1 2VOKA 3D0SA 1VE0A 4OFGA 2XB6C 3UKTA 5HI0A 1KDKA 3QACA 5L7OC 4ES9A 4GQMA 1DIWA 3I97A 2FDHA 1PGL1 1UXDA 1VMJA 3IDBB 1QQP2 3I59B 3I3QA 4Q8KA 1AR62 2VUJA 3VBSB 3B7HA 1UX6A 2EIEA 4BH9A 5A7PA 2W1UA 1MPXA 4COWA 3H8XA 3WHUA 1POUA 2R1BA 4LEJA 2WZR2 2O8QA 3IM0A 2PXJA 1J1TA 1MZ5A 4QPWA 5H9RA 4XFFA 3F95A 3WOGA 3ELNA 2WZEA 5GKAC 4DXSA 2Z69A 1MZFA 2Y38A 2X5IA 4IE5A 1B35A 4YARA 3GBWA 1PRAA 2QQUA 1UXZA 3NRUA 2CGOA 1H4HA 2ZGUA 2A75A 4EKIA 3V0AB 1KFUL 1AYN3 1PIV1 4P9YA 5HXVA 1H8TB 5JI7A 1ULOA 3NNLA 3LKJA 3PJYA 3R4UA 2I45A 4HSLA 5DXDA 1MS1A 3H8RA 4IEUA 4A7KA 1VRH1 4PJYA 4PIYA 2JKXA 1UOBA 2IXKA 2OQ7A 4FXKB 3ZXLA 2QQLA 5F5IA 1DWKA 5G05L 1XBFA 5KXBA 1XE7A 4YM0A 3WF2A 4RFT0 4ONUA 5FP7A 4QQPA 5CZKA 4JV4A 4CUAA 5C8CC 3VBHA 4A6SA 5F37A 3AXEA 3LEGA 2FJRA 1T6BX 4IEYA 1AXKA 5H9QA 1PO12 1QWRA 5FLJA 5K0UA 4DEVA 1WD3A 4OCTA 3ROUA 3G0TA 4CYDA 4XCBA 4X8PA 5JLVA 1QJY1 2D6MA 3EUSA 1YQCA 2VTXA 1YI9A 3ZN6A 1VBD1 2XVGA 3TB0A 1RIRA 4IGOA 2IXLA 4WZCA 2V73A 2PUEA 4CU7A
chains in the Genus database with same CATH topology
4QM8A 1HXS3 1J3QA 1PNRA 2Q30A 1TME1 4MYEA 1UU6A 1WH6A 1KS5A 4XBQA 3V0AA 1PGW2 4KG0A 3VKMA 4A2UA 5JWPA 4TYSA 2DVAA 2OZ6A 4PIZA 3CECA 2R32A 1KJLA 4YG0A 5IT6A 1LOEA 1OQEA 1RC6A 4Q27A 5C4WC 3O5SA 5JR7B 1JXNA 3HR9A 4RSUA 4K6BA 1ZRCA 5L73A 4UW3A 1ENSA 1FXZA 2MEV1 1UL9A 1QOTA 1TME3 2GC0A 1J59A 3IKWA 4XIOA 1TMF1 5HCBA 2VW0A 2JCGA 5DZEA 2GMMA 5BPXA 1FATA 3DN7A 3WP4A 2RS13 2KM2A 3M1HA 3AJYA 1RUH2 1WGPA 5CIRA 3NWKA 1GBGA 2PUDA 5E1RA 4AEMA 4E4ZA 3BS3A 1LOCA 1EV12 1UD1A 1JYIA 4QQHA 4YZ3A 4LA2A 3GBGA 1WW6A 4XETA 4AXOA 5JZGC 1POV3 5IK4A 1QF3A 2WSVA 3MW3A 5HCAA 1VBE1 4I6TA 4PCRA 3VKNA 2ZAAA 4G4FA 1NQDA 4XXPA 3RS6A 3FC0A 4BMBA 1I1EA 4Q29A 2KEJA 2CROA 1XQNA 4JQDA 5I0TA 4UBGA 1WUVA 1CJGA 1N3OA 1T6GC 3VHPA 5A32B 3NAPC 2XCJA 5B2GB 1BYHA 3PMEA 4GKYA 2NMNA 2WNUC 4Q1PA 4W6WA 2HWD3 2F6BA 3RDIA 3L1PA 4OULA 5KBFA 1PM7A 3VBFA 1VR3A 1YIFA 3MW2A 4XMAA 5KXEA 1BMV2 2E7TA 4AEDC 1R092 5E8AA 4PLNA 1C5HA 4JCKA 2ICTA 1ASJ3 1H30A 1JTZX 4R9CA 1UZZA 4AFCA 2OUHA 2PQQA 4FTBA 3ZN6B 1LOAA 1AR93 5AC91 4BCUA 4KL1A 4P5HA 1CAXA 2WT0A 1LHOA 3VKLA 3W59A 2P17A 1ZUGA 1H9PA 1IKPA 1R091 1QQAA 1EYBA 1BMV1 3NSTA 4XYXA 2GC3A 1E3OC 3MF6A 3IIAA 1REEA 4O9GA 4PDWB 2B5AA 1Q8QA 3OD0A 4QX5A 1VBA2 2WINB 2LYRA 4Q4W1 5D8AC 2R073 3AYAA 1W39A 1G86A 3EO6A 5C9AC 1SQ8A 4NVPA 5EYXA 3AP4A 1RTVA 1OMIA 2A6CA 1JH5A 4C91A 3VBHC 3BPZA 1NXD1 3VZKA 1I9RA 3ZXKA 1AXYA 5ACA2 2JENA 4XF0A 5T3NA 4EN6B 4DB5A 5T55A 2YROA 3LZZA 3VBOA 2WT2A 1RUD2 4YM2A 3RRDA 5GLUA 5L7OB 3LB9A 5C8CB 2WLPA 4X6QB 4N9HA 4WBBA 2ARBA 2VMIA 4N90A 4RHV1 4E2GA 4PDWA 3M70A 1MS5A 2RM22 2LM3A 3WXPA 1O4TA 4O8BA 1UKRA 3N3HA 2MEV2 1QOSA 3FLTA 3I2DA 4LHNA 2GH8A 3LA2A 3HD8B 4N43C 1ZVVA 2YV8A 2XHKA 2UY9A 4HETA 3JBG2 1SDWA 1XNDA 4AI2A 3MPPG 1VBB3 3AP5A 1ZVFA 5C33A 1Q56A 1JHNA 3NV4A 3HAGA 3N35A 4MUVA 1AYM2 2DFBA 4Q2FA 1HW5A 4HVRA 3M7AA 4X4DA 1PO22 2HEYF 3THPA 1AR71 4LBQB 2YC0A 5GM0A 2DF7A 2IFWA 3MIEA 3WG2A 4Z92B 1TMF3 4EN8B 4YGDA 3MIDA 2QUOA 5CFDB 3GN5A 3ES4A 2CTVA 2XJPA 3CJIB 1A6CA 2E7QA 2BNOA 2RS31 4YVWC 4CZSA 5I0SA 4UBHA 2OVUA 3EXUA 5FCCA 4LUKA 1HV1A 4GXLA 4LHKA 3MICA 1RUI1 2RJKA 3ZYPA 3VHOA 1RUC2 1CJPA 1QDCA 4FBIA 4XJ9A 2RM23 1RUJ3 3SCHA 3E6DA 4COZA 2WS91 2MEV3 2E51A 1ZREA 1PIV2 2Q0AA 3DF0A 1R082 3TYJA 1TE1B 4RR3A 3OY8B 1DBNA 5DG1A 3EJKA 5GZGA 1N47A 3HQXA 3BU7A 3WDVA 2ZZQA 4KNCA 2IFRA 1OA2A 3LGRA 2OW4A 3RYKA 4RHV3 1YFXA 2NZ9A 2AENA 4I2OA 2DCJA 5JSOA 4JCYA 1HRI1 4QPGC 1AYM3 5FOJB 4HN0A 4RQPC 2AREA 1YI7A 2A70A 1LGBA 1NQJA 1LESA 2CSFA 1FAYA 1NLSA 1K5MC 4AFDA 1WW7A 1N1YA 2WNUA 1YJLA 2B39A 2JJ6A 4AI0A 1I3HA 4WVZA 4CDUA 3WG3A 2A73B 4NHLA 3VL9A 4MZUA 2NMOA 2ZGNA 4OHWA 2PFWA 1D0HA 3A4UA 4Y5Z0 2PAEA 4KWLA 3O0WA 3AX4A 2LCVA 2LYSA 2YZ4A 2W08A 4DPNA 1G9CA 4I0AA 2RE9A 3M3QA 1X8MA 2O49A 3NVCA 3OY8A 2YUEA 3KMHA 2PN5A 1FV2A 2ZMNA 1ZNPA 4BQ1A 4BA6A 1FPN2 1Y43B 3SNMA 4MLOA 2E63A 1PIV3 2H0BA 4CDQA 1UPIA 4GMP0 3USUA 4RQPA 2QDRA 2B9UA 3OQNA 2XJUA 3AZZA 2XJSA 4CTEA 1BCXA 3GZUC 1O91A 3WW3A 4DNYA 1UXCA 1H2NA 2VG9A 2H6BA 1ALYA 4F8DA 3BIWE 2ZBJA 5FOBB 4HN1A 5FREA 4I6RA 4DY5A 3ZXDA 3GHMA 4WM7C 2LYLA 1Q5OA 1H2MA 1RUD1 4L97A 2D5FA 1QP0A 2R063 1OSLA 4YVWB 4LT5A 3UK9A 2WLQA 1COV1 3AZYA 4XDQA 2EA7A 3ZFFC 3S8QA 3JD71 4Q4Y2 5DG2A 3TBDA 1XYOA 1HLCA 1OHFA 1NA1B 1IC8A 4WM8B 2LYQA 1JBCA 2ZGSA 1VJ2A 3TNQA 4B4QA 5DUXA 1WW4A 4P9XA 3ETQA 4XF3A 3A0KA 1PVXA 4Y22B 4NR1A 1JFSA 3IBMA 5JMCA 1PZ8A 2C0ZA 3UKVA 4JRLA 1D2QA 2HEWF 4CDWC 2HWB1 4UW5A 2R043 1FPN3 1WMEA 4SLIA 1UPSA 3E97A 2GNTA 3I54A 4O9EA 1TNRA 1AL22 2P3KA 2L49A 5FFOC 1NCQA 1LOBA 1OLRA 1UZYA 2VOVA 4N9IA 3FMYA 1D4VB 4IA8A 3AKSA 3AFKA 2AXUA 4PLMA 3VGIA 4CDUB 1DYPA 1C57A 4IV1C 4JRAA 2QE3A 1YSEA 1RIOA 1RZRA 2BBVA 1VBC1 1EY2A 4XF9A 1APNA 5GLTA 5FAXA 3RSJA 1RUF2 5K9YA 1A78A 2ATFA 3R6SA 4NN0A 4AWDA 4KG8A 2ZGLA 4JGZB 4FPJA 3NAPA 1EAH1 3OD4A 3VDDA 1SLCA 2AH2A 2K0GA 2RJLA 2R6QA 4CDWA 4LR4A 2SLIA 1BQPA 4U36A 1BEV1 2PUAA 1C8M2 4BPZA 2VW2A 3LFPA 3AKTA 2VY0A 2ZX1A 4QT6A 4CDQB 5GLZA 3RI8A 4COVA 2ZGKA 2LALA 1H9WA 3BTAA 2R0FA 1IS5A 1RUC3 1VPWA 1JH9A 5CFCC 4AFMA 1OLQA 3APBA 2XL9A 1WCDJ 1ZRRA 2XG3A 4WZFA 4XJ8A 5A33A 1CR7A 1H2KA 4IEWA 3JXDL 4PBPA 3QF3A 3D8CA 2BVVA 5KHIA 3DUIA 1URXA 2HWE1 4HKLA 4XJUA 1LCCA 3U0ZA 5JOXA 3O7OA 4OHXA 2E53A 4E2QA 4EROA 1MEC1 2VOWA 1RUH3 1ULEA 5JPNB 4YZ2A 1YFUA 1VB4A 1EFAA 3LCPA 2B8MA 1VRH3 4C0HA 1LHUA 4Q0VA 1PVC2 4M0NA 1RUF3 3S7IA 3AB0A 3FX3A 3S6PA 2PHXA 5J48A 5CNAA 4Y1YA 4HBNA 4LO6B 5L36A 1HDKA 1R1A2 1H1IA 4IESA 1COV3 1V00A 5F9TA 1YIPA 2JG9B 2Y0OA 3RQ0A 3MIGA 1LB2A 4P9JA 2ZS6B 2WNUB 3IWZA 2O0OA 3NJZA 4GWMA 4P9WA 2H0VA 1F8VA 3PHMA 4EV0A 4FQ4A 2CAVA 1CPNA 1Z7S2 1V9U1 2A3WA 1ZYBA 4JDNA 4JVAA 4BOWA 1SEFA 4XIKA 5J7MA 2UY8A 4NWVA 4L99A 4I0WB 5I91A 3G7DA 2B7YA 1VBD2 2FQPA 4I02A 5GLVA 4HT1T 1CIWA 1MQTC 2CGNA 1VBA3 1ASJ2 4B7KA 2QNKA 2HSGA 3AFGA 4NWWA 1XNKA 1DFQA 1PO11 1XE8A 2OUJA 3WP5A 1FOD2 2NQYA 3NKTA 1QNYA 4N7IA 3GYDA 1REFA 2OFYA 2HWB2 3WX5A 2D44A 4RD7A 3AK0A 2EXHA 4AHXA 4AW7A 3WINE 4XQDA 2AW6A 1DU3D 1VRH2 5F5QA 4LHLA 3VBUC 3ZSKA 1PVC3 2R30A 4B4RA 2JX9A 3SISA 2GSYA 4HANA 4G3YC 1BBT1 5DDJ3 1S0DA 3G5GA 1W6QB 1UU5A 3IPVB 4KU7A 5DUVA 1ZBE1 1KS4A 3AKPA 1HQNA 3U07A 4M0HA 3WG1A 4W6YA 2GNDA 4FPOB 3PTYA 2KEKA 2JG8B 4QGNA 3AYDA 1J3RA 4YG7B 3OP9A 2XI8A 1W6NB 1ULGA 5C9AB 2MHFA 1YLLA 3MLKA 1QJX1 5I93A 5F6KA 2KPJA 3ZDSA 1U0AA 3FZ3A 1BZWA 2WSUA 1LMB3 2DVBA 3CJIA 2Q1MA 1BJQA 4PBOA 3TAYA 4QXKA 4LUMA 2VPVA 4X6RB 2XVLA 1NA1C 3EBRA 2CWMA 4YFZA 3ZN4A 4IL7A 4FBFA 5KHGA 2LUWA 3ZHIA 2WZPP 2B5HA 3QYXA 4LBQD 1PO23 2UU8A 3N7JA 3ZFEB 4XEZA 2G4IA 2PAMA 5BNNC 3TRBA 4U2AA 2EALA 3QD6A 3IPVA 4BE3A 1A3KA 1WD4A 1X2LA 4GB31 4EN7B 1PZ7A 1BXHA 2X5IC 1O5LA 2A7AA 5GZFA 4D7YA 3MIBA 4I3GA 2A6ZA 3ZIWA 1SBEA 3DPRB 2R1DA 2WIIB 2GMEA 2ZX3A 1SLIA 1RB8G 1V9U2 1QU0A 1G6NA 3ILFA 4MXVA 4WVMA 2WFF1 1X36A 2B46X 3ZFGB 4HKOA 1FX5A 4HL0A 3PVBB 2XBO1 4LA3A 3VBSC 2CNAA 3KCYA 2RS53 1ENQA 3WQ1A 3TN92 4JQRA 5EYYA 3I7DA 1HV0A 3WUCA 1NCRC 2ZOEB 1YCIA 4RL7A 1NXMA 4Z2WA 1RHI1 2D93A 3DV8A 5T5OA 4I09A 2SBAA 1QHDA 1POV1 2DVDA 5JIUA 1PVC1 1AR73 3OQOA 3ZSMA 2QJVA 1WMDA 4LO4B 2GH2A 3HIFA 4LTAA 2KA3A 3VBRA 3ZHMA 2EWTA 4DXZA 2X53S 1U12A 3ZKCA 1DGLA 2WNEA 3RG0A 3DPRA 1DDLA 1MVEA 3FHIB 2OZJA 1OFNA 2JG8A 1LENA 4IEPA 2D5HA 1FMD1 2ZGTA 1NZCA 4BIOA 3GN5B 4OI0A 2HYKA 3AKRA 4GWNA 2NLRA 1MS4A 3THTA 4XJZA 1ZA4A 2QZ2A 1ZM1A 2XGXA 3M3CA 1CAUA 2CYFA 2RS51 3LSDA 2WQZC 4YBAA 2KXLA 3S7EA 4D3WA 4AGVA 1ZBA1 3LISA 1O3RA 3FFQA 4HVOA 3TN93 5GALA 1DW9A 4UW4A 1SLTA 2PHUA 2XWJB 1XU1A 2D98A 3V0BB 4C1WA