3SCFA

Fe(ii)-hppe with s-hpp and no
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
193
structure length
193
Chain Sequence
TASTGFAELLKDRREQVKMDHAALASLLGETPETVAAWENGEGGELTLTQLGRIAHVLGTSIGALTPPAGNDLDDGVIIQMPDERPILKGVRDNVDYYVYNCLVRTKRAPSLVPLVVDVLTDNPDDAKFNSGHAGNEFLFVLEGEIHMKWGDKENPKEALLPTGASMFVEEHVPHAFTAAKGTGSAKLIAVNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of regiospecificity of a mononuclear iron enzyme in antibiotic fosfomycin biosynthesis.
pubmed doi rcsb
source organism Streptomyces wedmorensis
molecule tags Metal binding protein
molecule keywords Epoxidase
total genus 43
structure length 193
sequence length 193
chains with identical sequence B, C
ec nomenclature ec 1.11.1.23: (S)-2-hydroxypropylphosphonic acid epoxidase.
pdb deposition date 2011-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 3scfA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3scfA02
4B29A 1ZUGA 2PA7A 3BALA 3U11A 4AQ6A 4HVQA 3D0JA 3EUSA 3I7DA 4YSFA 2CROA 3KJXA 3EO6A 1NEQA 4LEJA 4KU8A 2B5HA 2V09A 2BNNA 2QJVA 1ADRA 2L8NA 1Q3EA 3NJZA 4F8AA 1QY4A 3FMYA 2O1QA 4KWLA 1ZNPA 2EA7A 4NDWA 2IUOA 1CAUB 3HZIB 3L1PA 2BNMA 1CX4A 5KHGA 2H6CA 2E9QA 5FLIA 4N9IA 2BYVE 2MEZA 2H0VA 1ZZ6A 3FYAA 4MGKE 5I8TA 1DWKA 2XLFA 5I0RA 3H50A 4I01A 2D5FA 3H7JA 4XETA 4P9GA 1IPJA 3OTFA 3QACA 3G5GA 4Z5CA 1CAVB 3RNSA 5JSPA 2PHLA 2MPFA 4PIYA 1O4TA 4YRDA 5LEJA 1J3RA 3ES4A 4J1WA 4I09A 3H1WA 4R52A 3WW3A 5LEKA 3KGLA 2P17A 1WLTA 5LRRA 4EWEA 3SXWA 2ATFA 1UXDA 2GRLA 4Q29A 5C8WA 1EY2A 4Z59A 4L2NA 3BB6A 4IEXA 1HF0A 3H3ZA 3I54A 4I02A 4FBFA 2VQAA 4MGZE 2IU7A 1VR3A 3KMHA 4XF1A 4QMAA 3SCHA 1CAUA 3F6WA 3ES1A 2LYPA 4QX5A 4X4IA 2EBYA 4PIZA 2CSFA 3LZZA 3NL1A 2XKOA 2EVXA 3LA3A 2ETEA 1X2LA 2LYKA 2LYLA 1Y3TA 2QVSB 2EWTA 3CEWA 3EHKA 3E6CC 3JZVA 1YWKA 2D5VA 1ZRDA 2PIJA 1J3PA 3IDBB 5CVRA 3S7EA 3QWGA 2Z69A 1EYBA 2XHKA 3RPQA 3SCGA 5AVPA 2A6CA 3D82A 3FZ3A 1PERL 1SQ8A 4ZU5A 2HINA 1PRVA 2KEIA 1ZVFA 4HN1A 1OSLA 2H6BA 4K8FA 3H5TA 1ZZCA 2AXZA 1ZS4A 2BEOA 3NVCA 4I6UA 3CLCA 3ZDSA 2PFWA 5J3UA 3E97A 4IEOA 3BPZA 5I93A 1UXCA 4BYYA 4HBNA 4KWJA 4X4EA 5JSRA 4MZUA 4Q0UA 1RL3A 1XWRA 1WA4A 2PYTA 2UY9A 4HN0A 4E2GA 3O14A 2GZUA 3OQOA 2XCJA 1ZRRA 4X4HA 1IC8A 2BJCA 4JQDA 5KBFA 1XE7A 5I0TA 5KHIA 1ZX5A 3EJKA 3SMHA 4Y42A 4PU7A 4GQMA 1NYWA 1LQCA 2MNGA 4QXKA 4UBHA 2AWIA 4QGLA 4O9GA 2PTMA 3S0MA 4F8DA 1RTVA 1QXJA 1V70A 4EWDA 4BHPA 3F52A 2IXLA 2K9ZA 5KHHA 1WETA 4I6TA 3HQXA 3IIAA 4MGIE 1WH6A 1DGWA 2GH2A 3TNQA 4TLFA 3PXPA 2PHDA 1OFNA 4YNIA 2O49A 1CAWB 4HSJA 2IXJA 3U3WA 3H8UA 3KCCA 2UY8A 3IVPA 1ZPQA 3RZZA 4YYOA 4Z82A 3CJXA 1S7EA 5C6CA 4KWKA 3ST7A 1OMIA 3E5XA 4MH0E 4MGYE 2LYQA 3TNPB 4YBAA 2LYRA 1O5UA 3OQNA 4GULA 4MX3A 4L11A 2B8MA 2XI8A 1LR5A 3R1FA 3FHIB 4X4CA 2IV1A 4CYDA 3JXCL 4QGMA 5FDBA 4OLLA 2C0ZA 2UYBA 4PJYA 1NZCA 1QP4A 1ZVVA 2I45A 3FJSA 2EF8A 4YG7B 4EROA 3UFDA 2OZ6A 1R63A 1FT9A 2PUDA 2VPVA 4XF0A 3TRBA 3ZHMA 2WUSR 1EFAA 4HLTA 2PUBA 5JCTA 2KZ8A 1Q5OA 1J58A 4Q0PA 5FQ0A 4XEZA 1L1MA 1DZRA 4KU7A 2O38A 2D93A 4IEZA 4JCYA 3CLPA 3H1YA 1EP0A 4IESA 3RYRA 2ICPA 4XFGA 5F1RA 1UIKA 2QNKA 1HW5A 3CL1A 3NW4A 1E3OC 1CAVA 2OZJA 3WW4A 1ZZ9A 2CV6A 5J48A 1SEFA 1WH8A 2AW6A 4IEYA 4LULA 4XFIA 4XF3A 1X8MA 3B02A 1JH9A 1U12A 2XIUA 5LRSA 1LMB3 2QCSB 4IVZA 1YFXA 2ET1A 2MQKA 1CAXB 1DZTA 1J3QA 1FI2A 4LA2A 3B7HA 1QP7A 3LOIA 3EQEA 1O5LA 4IEVA 3U10A 5A7LA 4LA3A 1GQGA 2B5AA 1EPZA 5K8SA 4O8BA 4XFAA 2Y0OA 2Q4SA 2MHFA 2CGPA 4IEUA 4IWRA 2PUFA 5I91A 4NVPA 3FYMA 4MCTA 2KEJA 3BU7A 3E5UA 1ZRFA 1G6NA 4PU4C 1BDIA 1YUDA 3RYPA 4KL1A 3DNVB 4XFBA 4FAHA 5K98B 1CAXA 5JAXA 3GN5B 1QWRA 4UBGA 1XE8A 4Z5DA 2PAKA 4AQ2A 4D7TA 1LCCA 3M70A 1JWLA 2BGCA 4FT8A 4HMZA 2IXCA 3OP9A 4EV0A 1NE6A 3LISA 1JFTA 4ORFA 2XKPA 3BS3A 4I6RA 2H8RA 2PE5A 2KEKA 4I8TA 2CAUA 3E5QA 4MV2A 4IEPA 3KZ3A 3IWZA 4Q0SA 5EZWA 2ZCWA 4JTOA 1DGRA 3RDIA 2LYJA 1VPWA 1UW8A 4RD7A 2GC0A 4OFGA 1O3SA 2JVLA 1ZREA 2LCVA 1PRAA 1AU7A 1IPKA 4LTAA 3CECA 4OB4A 3VK0A 1ZZ7A 3MYXA 4Z58A 2KXLA 4F7ZA 4X4BA 2PUGA 3CO2A 5FLHA 1O4XA 1GT0C 1J59A 1LKNA 2OA2A 1UIJA 3L2HA 3ETQA 1YFWA 5KHKA 1CAWA 3HT1A 4JTNA 2IXKA 4QM9A 3KGZA 2DCTA 3C3VA 3FFQA 2WFPA 4META 3OMTA 4A2UA 3ZHIA 3M3IA 2BNOA 2GRMA 4WZCA 1JUHA 1GQHA 3E6DA 1NERA 3LAGA 2GAUA 4I2OA 1PRUA 1DW9A 2FMYA 3D1NI 3JXDL 4XF4A 5FPZA 3ROUA 1RUNA 1O7FA 5E16A 3BD1A 4AXOA 1PMIA 3DL3A 3CF6E 3PLQA 1Y7YA 3JXBC 2WIUB 1XRUA 3MPBA 5KHJA 4JCXA 4IERA 3SCFA 1QPZA 1QP0A 3UKVA 5BV6A 3LWCA 1LCDA 2AXVA 2IXIA 4YARA 2Q1ZB 1O3RA 3MDPA 1ZZBA 5FLJA 5CADA 3KSCA 5FCCA 2PUEA 3QF3A 1OD5A 4Z07A 4O9EA 1X7NA 2F4PA 3DV8A 4X4FA 3LFPA 2XL7A 4FAGA 4I0BA 2FJRA 2PUCA 2R63A 3I59A 4WBBA 1QXRA 5BPXA 3FX3A 4PU3C 2PUAA 3ACLA 1TQ5A 2VECA 4HSLA 5T3NA 1RIOA 2D5HA 3GYDA 4XF9A 3FWEA 2N7GA 1POUA 4FBIA 3WW2A 3O9XA 3NSTA 3U0ZA 4D7SA 3H1MA 1QQBA 5FPXA 2XL9A 1FXZA 2XLAA 1WIZA 3ELNA 4IETA 3PVBB 1UD1A 3VHRA 4PIXA 4UXAA 1L3JA 4AVAA 2XLGA 4LUKA 4XFHA 3MLFA 1ZAYA 1YFUA 2GC1A 1PM7A 2OFYA 3H9AA 4DINB 1RGSA 3PNAA 1BDHA 4J1XA 1YHFA 3QYXA 1LRHA 4XFFA 3DN7A 1RPEL 3I59B 5JSOA 5J7MA 4BH9A 2IVBA 4YG1A 1OI6A 4I0AA 4Q0VA 3UKNA 2HJIA 4N9HA 4HZFA 2WC2A 4MCXA 3OF1A 1X82A 2GC3A 2JCGA 3LA2A 3GN5A 4QGNA 3EBRA 2R1JL 2PAMA 1UPIA 3F51A 1J1LA 3CROL 4BIFA 4X6RB 2GC2A 1RZRA 2GZWA 4QM8A 4X4GA 3BCWA 5I8SA 4X6QB 2L49A 5BUVA 1RZSA 1WGPA 3H7YA 2EAAA 5BY5A 3HIFA 2Q0AA 2CAVA 2D40A 1UCXA 2OYZA 3UKTA 2ICTA 3OD0A 2PAEA 2Q30A 1Q43A 2QDRA 4JV4A 1UTXA 4AVBA 4IA8A 4LUMA 2UYAA 3WW1A 1O3QA 4JVAA 4LLOA 4YG4A 1R69A 4I3PA 5I0SA 2PPXA 3OCPA 2K0GA 4X4DA 2OR1L 4HVOA 3KXAA 3R6SA 4PU8A 4HVRA 4IEWA 4GHJA 2XJ3A 3OGJA 3NKTA 1YSEA 4IEQA 5I8YA 3IDCB 1CGPA 3D0SA 3FE5A 1QQAA 3DKWA 4H7LA 1RC6A 1RZRD 2B9UA 1ZZ8A 4E2QA 4E2SA 2HSGA 1H1MA 3USSA 1H1IA 4ZU7A 2AXUA 4ONUA 1CQTA 5EFUA 5JR7B 1X8EA 1YFYA 2Z2SB 2ET7A 3H3UA 3SHRA 2XGXA 1CJGA 2O8QA 1RUOA 2LYSA 2IVGA 2AUWA 2OPKA 5D1IA 4AVCA 2HKXA 5E1RA 4Q0QA 3OQMA 2IC1A 3QQ6A 2FQPA 1I6XA 1NE4A 1OCTC 3QOPA 3HT2A 5CU1A 1JFSA 4ZU4A 1LLIA 1YLLA 5I0UA 3RYKA 1Y9QA 5HI0A 2KPJA 5BXXA 1O3TA 2IXHA 3GBFA 4R8HA 3BDNA 1SFNA 4MUVA 4WVZA 2GU9A 3N4MA 3ZKCA 2XSDC 3E6BA 1PNRA 1ZRCA 3LA7A 5FQ0B 1NXMA 1LB2A 1X57A 3G7DA 2O4AA 1VJ2A 1B0NA 4XFCA 2ZKLA 3MZHA 3S8QA 1VP6A 3S7IA 4FN3A 3IBMA 2IVQA 4Z5HA 1I5ZA 1SQ4A 2PQQA 4EWAA
chains in the Genus database with same CATH superfamily
4FXKB 4B29A 5L9VA 4AI9A 1ZUGA 5IUQA 1JZ4A 4AQ6A 3VBOC 1JYXA 3DXTA 4K21A 2UWBA 1ODMA 4D3WA 3KJXA 2RJKA 4UFHA 1IG0A 1AR93 2IFRA 1W2UA 1Z7S1 2PXPA 1QOSA 2ZGTA 2BNNA 4A7KA 3T08A 2R041 3AZVA 4DXRA 1REEA 4HPKB 3NJZA 1Z78A 1QY4A 3WUCA 2F6BA 1GNYA 1SFYA 4DMIA 5FMOS 2EA7A 2VQUA 3TRSB 3ZXKA 1YJLA 3AP6A 1HRV2 3RG0A 2BPA2 3HZIB 2E7AA 4TSVA 4ASMB 3L1PA 4Y1ZA 1BBT3 2VW1A 2RS12 3WV6A 4CDWA 1TNRA 3WDUA 3GBWA 5JZGC 5F39A 3LEIA 1C5IA 3DKQA 1COV3 3NO8A 4QDRA 3ZXGA 2NQYA 1JZ7A 1YQ8A 3FYAA 3NNMA 2EXHA 2ZBJA 5I8TA 1DWKA 1H6XA 2VUJA 4IQPA 4I01A 4JGZB 2G9FA 2D5FA 2RM21 4CXWA 1D0GA 1OHFA 4P9GA 2XJTA 3OTFA 3RNSA 4M0HA 2Q8DA 2VG9A 2UWCA 4PIYA 1O4TA 4QPIA 1MS1A 2V4AA 4QHOA 4I09A 5LEKA 1LHOA 5IK8A 2P17A 1JW6A 3LD8A 3PUAA 3SXWA 3ZN6A 3QOXA 1UXDA 5C8WA 3B9IA 5KXDA 5FZBA 1R1A1 1UY2A 4Z59A 4KGGA 4L2NA 4MXWB 5FOBB 1K5MB 3U4SA 1RUE1 5DPNA 1TVGA 4I02A 2Y6JA 5J36A 4MGZE 4AFCA 4QMAA 3SCHA 5CFCB 1C3HA 1W03A 4BQ1A 1UYZA 2O8OA 3W9AA 1BK0A 4S2FA 2EBYA 2WO3A 3AZZA 1XBFA 3LZZA 2R0HA 3PMSA 2QKDA 3PMEA 5T55A 2RR12 3LA3A 4V2VA 3FLPA 3ZFEB 1QJU2 2QVSB 1X2LA 2LYKA 3CEWA 1UYXA 2X5IC 4JHZA 1JZ3A 3JZVA 3ZYIB 1X33A 2D5VA 1GANA 2D6MA 4Q4Y2 3WP6A 1AR83 2PXEA 3WNOA 3RZLA 3ZN4A 5CVRA 3VB9A 4BQYA 3QWGA 2Y26A 2D6PA 3RPQA 3LSDA 4UFKA 5AVPA 2A6CA 2I07B 3D82A 1PERL 1SQ8A 4TLGA 2QQUA 4ZU5A 3WNXA 3IZOA 3S57A 3VV1A 3H3LA 1ZVFA 4HN1A 2RS52 3QH7A 4QD2A 5A32B 3JD73 3I2IA 5B4XA 3H5TA 1RMU3 4I6UA 1N1YA 5BNNC 1IHMA 3U75A 2JDHA 4LNVA 3UGGA 4IEOA 3H42B 1JBCA 1UXCA 1NOVA 1OPMA 2RS13 5EP9A 2WO2A 1W9YA 5IVFA 2IVIB 3T1LA 5H9RA 1SLIA 1DHKB 4X4EA 1WWYA 1YC61 3D6EA 4RQPC 4MZUA 1K5MC 1RXFA 3D3AA 2PXKA 4BE3A 2PYTA 1OD3A 4E4SA 1H8TA 5JPNB 1GQPA 1YO8A 1NY71 2Y6HA 5K0UA 4E9KA 2DFBA 3N9PA 2FDHA 3JBG2 4CEWA 4X8NA 3GF6A 4OCTA 4FQZA 5FZ7A 1OKQA 1ZRRA 5LK7B 4X4HA 1IC8A 3HNYM 2BJCA 3N3HA 2R043 3SKVA 1KS4A 4AI2A 3O1TA 1NCRA 3EJKA 4Y5Z0 5H9SA 1EV13 1UU5A 4Y42A 1ND2C 4OVEA 4RS5C 1S0JA 3N35A 2D3RA 3AMHA 3IT8A 1CJPA 3OPTA 3GGLA 2G9ZA 2YMZA 4O9GA 2PTMA 3VBUB 1HN0A 4F8DA 3WF1A 5IVVA 1LULA 3S0MA 1V70A 2XQRA 2YPDA 3LDRA 2IXLA 5BNPB 2WNUC 1ZBA1 3JXSA 1MZFA 5E89A 5FZDA 5JIUA 3LEMA 4MGIE 2XVGA 1DGWA 2ZA9A 4JDOA 4PF1A 4TLFA 1LHNA 3T1MA 1OFNA 1NQDA 1CAWB 2WRAA 1DQ6A 2IXJA 4HSJA 4NHLA 3VGIA 5C4WC 5C4WA 4DUXA 4C0HA 4JKLA 5EXOA 4LKDA 2CWMA 2Q8OA 2YUEA 5L19A 1WMFA 5KXBA 3OUJA 5C71A 1OLME 2J1AA 2MEV2 5FZOB 3AL6A 3ZSKA 2WT1A 2LM3A 4RA0A 5ABJB 4AEJA 3A4UA 1RUG3 1PVC1 4XDPA 1K3IA 1OMIA 3E5XA 3CHXA 2R16A 4YBAA 1O5UA 1KXGA 1RUE3 3OGRA 4NWVA 1LR5A 4KWUA 3FHIB 4XIOA 4X4CA 1AYM3 1VBA2 2VXRA 1NCRC 1QOTA 1JYWA 5ACA3 2BVBA 2DU0A 4PJYA 5FYVA 5LBEA 5FPLA 4IE7A 4YPJA 3ZFEA 4DNYA 1ZVVA 5LATA 5FPAA 4YG7B 4Q27A 4Y22A 3ZYBA 1R63A 2VPVA 3FBMA 2WUSR 1EFAA 2PUBA 1H8TC 2TBVA 4A6SA 1W6OB 5JCTA 4IV1B 4Q0PA 3ZPXA 4N7IA 4CCEA 2ZOEB 1K5MA 2D93A 3BOPA 1YI7A 1EP0A 3OPZA 5GLTA 1H4HA 3ZR6A 3U4XA 3RYRA 4XFGA 1C1FA 1UIKA 2OIIA 1FPN3 5DDJ2 3UYJA 4RS5A 1ND2A 1NQJA 2A75A 4Q4W1 1QQP1 1W8FA 3NW4A 4XABA 4JGYA 1QNWA 2VY0A 4XUQA 1R093 1MVEA 1UOJA 1UU4A 1E3OC 2I2SA 2W46A 3TOJA 3WD5A 4AAXA 4ER3A 2W1QA 4ZZ5A 5BNQA 3WW4A 3I2OA 3C8XA 1F5FA 1WH8A 4PF5A 4EE2A 5FYUA 1WCQA 2VEOA 1JH9A 1U12A 3IIIA 3MIFA 3VDDB 1LMB3 2RS31 4L92A 1AF9A 2NLRA 3J7NA 2ZHMA 3FBYA 4AWDA 1JZ2A 4LA2A 3VDAA 4XJ8A 1QP7A 4FCAA 5HXMA 3A21A 4UI9L 1GQGA 3AMNA 2B5AA 2VZPA 1TME3 5F6LB 4O8BA 4W4ZA 2F4LA 1MS9A 4XCAA 3DGTA 4IEUA 2EXJA 2PUFA 1KEXA 2HLEA 5I91A 3H8XA 4MCTA 2KEJA 1W9FA 1G6NA 4FOVA 2JDZA 3SR4A 1VIWB 4N43C 3RYPA 3VZOA 2RR13 4WM7B 5C3RA 3FUOA 4AQ2A 1LCCA 2PHXA 2Z5WA 1GU3A 3I4IA 4UFIA 4YZ2A 1GOHA 2D7FA 4TWTA 5FZIA 4N43A 3I3DA 2YC4A 3LKJA 1VBA3 2VTXJ 3BS3A 5DAVA 5A7NA 5JI9A 4GH4B 3VKLA 3H8OA 1ZBA3 1FNZA 3WOGA 4YVWB 1UMZA 3SEEA 2CAUA 1R1ZA 4URAA 1DLLA 4RHV2 2WZEA 2PXVA 1HQWA 2BW8A 4IEPA 3POIA 3KF5A 4JTOA 3O1MA 1RITA 2ZX0A 3ENRA 1UW8A 2J7MA 3M1HA 2R6QA 1KFUL 1AYN2 4XIKA 5F5QA 3J8F1 1LESA 1QF3A 2JVLA 3KD4A 3NJXA 2HWD2 5GZCA 5DAXA 4AI3A 3M3QA 3VK0A 1JI6A 2ID4A 1ZZ7A 4DEQA 1G9CA 4Z58A 4F7ZA 1S0EA 2XQXA 1JH5A 4X4BA 1QHDA 4YW2A 5IT6A 3ZM8A 1LKNA 5FP4A 4JGYC 3POWA 2E33A 2OA2A 2W5FA 4QXHA 3WCRA 1POQA 2XJSA 4CPBA 5AC93 5KHKA 1ODNA 3HT1A 4CU8A 4JTNA 4GMP0 4OHVA 3KGZA 2DCTA 5GKAC 3ZSLA 1PMJX 5CAZA 3FFQA 4HKLA 4P9XA 1RVF2 2ZJCA 5FWJA 1HJGA 1JYCA 1L7QA 2DBIA 4A41A 2BNOA 2GRMA 4WZCA 1XYNA 1GQHA 4HKOA 3E6DA 4MXVA 1NCQC 2YXSA 3B7MA 2UURA 4QB6A 3AYAA 2CY6A 2WLPA 2YBDA 2GAUA 3HOBA 1PRUA 1WW4A 1OSGA 1W6NB 2K46A 4AF9A 4AYUA 3D1NI 4YW4A 3N36A 4IV1A 4NRQA 5A3WA 3TN91 1O7FA 5E16A 3BD1A 5FY7A 3LCPA 3CF6E 3PLQA 5KHJA 3JXBC 1ONAA 3WDYA 4IERA 1MEC1 4D8MA 4Z92B 2W68A 4HETA 1QP0A 1GOFA 5BV6A 2YGMA 4UW4A 1D4M3 3B93A 3ILNA 3MDPA 5CADA 5FCCA 3OSDA 4W50A 3IKWA 5FZCA 1H4GA 2A7AA 1QJZA 1X7NA 2CWSA 4I0BA 2FJRA 2RDSA 3I59A 4WBBA 1QXRA 3L2YA 4COUA 1GOGA 4N53B 5LBBA 4GH4A 5FZ6A 4HSLA 1C8M1 1RIOA 3CBNA 3H0OA 1ALYA 3GYDA 5D8AC 2BERA 4XBQA 2LW8A 3FWEA 3P5BA 4LQRA 1Y4WA 2N7GA 2V5YA 4QQPA 3VBOA 2ORXA 4DEVA 1OKOA 1I1EA 1IKPA 1TME1 3U0ZA 4KNCA 3Q9OA 2XOMA 2WA3A 4CEWB 3X29B 5CKNA 2WNVC 5FZAA 5FPXA 5K0UB 3ZXDA 2RV9A 1LENA 4IETA 4XURA 4AR2A 3NMBA 2JG9A 3PVBB 4ZS2A 4P08A 1W28A 2IZWA 5AFBA 2XJPA 1QXPA 1QZXA 4K9SA 2XLGA 1RUJ1 1R64A 1NX9A 5A6XA 2GC1A 3PVNA 2D6LX 2FHRA 1D7PM 3MIDA 4YVWA 4XOGA 2PHRA 2PLV2 1HRI2 3AB0A 2VD7A 1BDHA 1HXS1 3K4AA 4M3CB 5EJ3A 5JSOA 3O0VA 4JKMA 4BH9A 4ER5A 2IVBA 4YG1A 2W2IA 2JDYA 3KV9A 4KG8A 3VKFC 4HZFA 2PXUA 2WC2A 4AGRA 4SBVA 1AJOA 1QJY1 2VUCA 1A3KA 2JCGA 3ATGA 4MHUA 1AXZA 3M9LA 1UZVA 1QH6A 2BFUL 1S0FA 5JXJA 1UKGA 3AVRA 5CFDB 1UPIA 1RXGA 1E5SA 2JB4A 2MEV1 4LO7A 3I49A 3WSOA 2GC2A 4Q4V3 4BQ2A 4QM8A 1S2BA 2R042 1XNKA 2P3KA 4FPFA 5I8SA 3VDCA 4X6QB 2R1BA 5BUVA 3RS6A 5A3MA 1V0AA 3NAPA 4R4XA 2LUWA 3RWKX 1WGPA 3H7YA 5CFDC 2CAVA 1VBE1 1UN1A 1Z0HA 4QAWA 4BM8A 4L9BA 5A1LA 1E5HA 3T09A 2PAEA 3NV2A 1HV0A 2W94A 5JIAA 4JV4A 2WN2A 3LEGA 4IA8A 1ZRDA 2YDEA 5C9AB 1W8OA 1IGOA 4LUMA 1XYOA 4OZXA 4ISRA 3WW1A 1WCUA 4CXYA 2QQPA 3AFGA 1V00A 5A33A 2A6WA 3AVSA 5T5LA 2X09A 4FFGA 4WVLA 5AVAA 4V1PA 3BGAA 4EKIA 2RG4A 2X5IA 2HWC1 5A7QA 3ALQA 4JGYB 4X4DA 2OR1L 2E63A 1D2SA 5T5PA 2UU8A 1XOYA 5CZKA 5ANNA 3VKOA 3R6SA 3WF0A 4PU8A 4GHJA 4BQXA 4NAOA 1XU1A 3AMPA 3WNKA 4EN0A 5A3UA 1GKBA 1YSEA 4PI0A 4RR3C 3OPWA 1QJFA 4LBQB 5JXIA 4YW5A 1CGPA 3PU3A 1KRIA 3DM5A 2XJVA 2NM1A 1PO23 1RZRD 2A6XA 3B01A 5FMOL 5DRYA 4JKKA 3NXHA 4C8DA 4BQ4A 3N9MA 1H1MA 2X05A 4CZSA 2D3PA 2X10A 3USSA 2VMIA 1J84A 2AXUA 3UGHA 1F5JA 1YFYA 2YY1A 2VZOA 1WLCA 1VB2A 1ZBE2 2Z2SB 4N53C 3TYJA 4LT5A 3THPA 1UF2C 3MBWA 2O8QA 2E7TA 4QX1A 3KCYA 4ASKA 4UWDA 2ARAA 4AVCA 4HPKA 5EIYB 3I2GA 5FMCA 4Q0QA 4AGVA 1JTZX 5HCHA 1ASJ2 1C5HA 4I0WB 4G3YC 2EIBA 2EALA 4BMBA 4BA6A 5D2AA 1AR91 4NRMA 4ZU4A 1CONA 3OUHA 1RUC2 2V73A 1Y9QA 2ZTNA 4BU2A 2YROA 1AR72 4QX8A 3VHOA 5CG9A 2VZTA 3GBFA 1REFA 1SFNA 1TG7A 3LFMA 3OYWA 3CMGA 4JGZA 4AVTA 3E6BA 1PNRA 1ZA4A 2WINB 5FQ0B 4YGCA 4ARYA 1LB2A 2O4AA 2VZ1A 4KMQA 1SPPB 1VJ2A 4CDUA 3ITQA 3Q8FA 4XAAA 3ZFGA 4PDWC 1AYM2 1HXS3 5IVYA 3OGVA 2B39A 3SEPA 1W2TA 1I5ZA 2PQQA 2BOIA 3BOWA 1ND3C 4BPZA 2YC2A 2ZZJA 1VAMA 3I97A 3U11A 4FTBA 1VBC2 2RS53 3DCQA 3PUHA 4LHSA 1HQNA 2D6KA 1SBEA 4FPHA 1RUD1 2DWRA 1AYN1 2B7YA 4RS5B 1M4WA 3MUZ1 2W1SA 2VH9A 4BDVB 4CP1A 2ZGUA 3NV1A 2G4IA 3VBFC 4BMEA 4AI1A 3EO6A 1NEQA 2MEV3 2R49A 3PVEA 4KU8A 3PIJA 2WZPP 2JE8A 4BZ4A 2GP5A 2QJVA 3LF7A 4CDQB 2AACA 1JOBA 2JD9A 4YWAA 1OA4A 4F8AA 2JENA 3CZJA 1H8TB 2DV9A 2O1QA 4HXCA 3A23A 1W3XA 2HCNA 5FBZA 1ND3B 2CL2A 1NA1C 1CAUB 1SLCA 3PUQA 1FNYA 4QPWA 3RSJA 3LGRA 2AZ5A 5KHGA 4PDWB 5FP3A 1ZBA2 4DUWA 4E27A 5IK7A 2W39A 1IZ3A 5FIXA 5FY0A 5FO7B 4IV3C 3V0AB 2BYVE 4YGEA 3HNMA 5DTQA 1PK6A 1PZ7A 3AYEA 2NMNA 2ZX2A 4MGKE 2C5DA 2EXKA 2WWJA 3HBZA 2BUKA 1LHWA 3H50A 3LFIA 1EV12 2W08A 3R09A 2FDKA 5LY1A 1SMVA 4B7KA 5LW9A 2DBNA 1G9DA 5FY5A 2HWE1 3ASIA 4PLOA 3TN92 5JSPA 1OT5A 2W52A 2PHLA 4YRDA 3SX0A 4ER0A 3ES4A 3LQCA 3WW3A 2VBBA 4XDQA 1WLTA 4TXWA 3K3OA 4Q29A 1EY2A 4XVHA 3WQ1A 4COVA 2XWBB 3NNJA 2NN8A 2WZR2 1JS9A 4XXAA 5JUWA 2E53A 1VR3A 5FY8A 2XB6C 5HPOA 3F6WA 2LYPA 2WUHA 1ND3A 4UT5A 2J1RA 3KQ4B 3ZXEA 5APAA 2FDGA 3NAPB 2VNRA 3PURA 2ERFA 4LE4A 5DXDA 1EUTA 5CFCC 1V6NA 2LYLA 4IDZA 1Y3TA 1AX1A 1LGBA 4LBQA 3NJVA 4LORA 4QPYA 1PGW2 5IVJA 2AUYA 1U5IA 5DT2A 2RJ2A 1W05A 5HV0A 2Z69A 5F3CA 1EYBA 3KZ4C 1AXKA 3I2DA 1IQDC 2BP6A 1OQDA 1W06A 1U5ZA 2MXDA 2HINA 5DDJ1 4A7YA 4ISQA 2Y6LA 3JCIA 1PRVA 2KEIA 4KG0A 4K8FA 4LE3A 5FY1A 1JZ8A 2RHPA 1I9RA 2JIJA 1ZZCA 2AXZA 2BGOA 3VBHB 4DFSA 2BEOA 2VAUA 5AFEA 1H2NA 3CLCA 1UY3A 2PFWA 4QQLA 3E97A 4YW3A 2JDMA 3IN9A 2EXIA 1HRI1 3BPZA 1HLCA 4HBNA 4MG2A 3KHCA 4GZ9A 4KWJA 3P3NA 3OD4A 5JSRA 1DGRN 3VL9A 2DCYA 1N47A 1RL3A 4AI8A 1XWRA 1CN1A 4QPGC 5FYSA 1K42A 2JX9A 4IE0A 5A32A 2DURA 4HN0A 1NW3A 3AYDA 3C7GA 5JUVA 5F2SA 3O14A 2FZ1A 4RFT0 1DLCA 3GCXA 1WKYA 1IS6A 3N9LA 4PLMA 3WLUA 2BQPA 1A34A 3VD4A 1RUG1 1DDLA 3TWIA 5KBFA 1XE7A 5I0TA 1NLQA 1ZX5A 2VZRA 3DPRB 4QQHA 5FYYA 4AEMA 2FMDA 3TEYA 4GQMA 4LBJA 1U5XA 2BBAA 4LPLA 1LQCA 2MNGA 2V4VA 1O4ZA 5GZGA 1UNBA 3SH4A 4ITCA 1QXJA 4EWDA 4U36A 2K9ZA 3AZXA 2AR6A 3IIAA 4EN8B 1WH6A 2GH2A 1UZWA 4Y4YA 4FOWA 4D6SA 5IK4A 1RUH1 3N9QA 2PHDA 3CQOA 5FFOC 3ACGA 5A33B 2O49A 4ARXA 2Q8EA 1JZ6A 2WSVA 5DZFA 5F3GA 2M4HA 1RYYA 2WFF2 2UY8A 3DUIA 3V65A 1OOPB 5GLVA 2IWGB 2HWD1 3LB9A 1GSLA 1WBFA 1UYYA 3MV01 2PXTA 2VQTA 4Z82A 1GBGA 2DTYA 5FZ4A 1YQCA 1SCRA 1FPN1 5IVEA 3ME2A 1YNAA 1NZIA 4MGYE 3R0RA 3TNPB 5IJRA 4GULA 5FXWA 2A70A 3T2TA 2PXDA 4DRRA 1AXYA 2VMEA 4YZ3A 5A3TA 1WW7A 2XI8A 2X53S 2XBO2 2ZEYA 3C7EA 4BQ3A 5K7PA 3THCA 1RVF1 2IV1A 3ILFA 2EICA 4RGKA 2WSUA 3U37A 1F15A 1ULDA 4OLLA 4DO0A 1OURA 3GHMA 3CNAA 4GWIA 1O8PA 2WNEA 1NZCA 1CPMA 5HCFA 4A3ZA 4BIOA 1JYTA 3N7KA 3ZOIA 4EROA 3UFDA 1RINA 4UF0B 4CA9A 3TRBA 1G9FA 3KWVA 1EAH3 2KD7A 4HLTA 1JODA 4LOSA 4PBOA 4XC9A 1Q5OA 2WR9A 2OQ6A 1J58A 3KF3A 4Q4Y1 4R9BA 4XEZA 4Y1XA 1DZRA 2LROA 2O38A 1RUC1 4IEZA 4JCYA 3H1YA 4UFMA 3QH6A 5FPBA 5C3SA 2GALA 2G19A 4JDMA 3FLTA 1UKRA 2HBUA 4XUOA 4LBOA 1V6LA 1N3PA 4O65A 4QT6A 3K4ZA 1LGCA 5D21A 3ZO0B 4ER7A 4O7XA 1E5RA 1KQRA 4QU2A 2OQ7A 3MF9A 3K51A 2PXQA 3J7HA 1ZZ9A 2CV6A 1E57A 3I2KA 4F3JA 2VCBA 1HRI3 2AW6A 3MFAA 1PIV2 4XFIA 1LOFA 2Z42A 2QCSB 3ZKYA 2W87A 1XXNA 1ULCA 4IVZA 1B09A 1YFXA 2ET1A 2C26A 2JG9B 4N7UA 1DZTA 1J3QA 1FI2A 2DVBA 1VBC1 3LOIA 4JDNA 4IEVA 1YIPA 1O5LA 5DUWA 5LA9A 1DQ4A 2A6YA 4H55A 4AE2A 4B4RA 4M00A 1PO13 4OI2A 3VBSA 4XFAA 2HYXA 2VZ3A 5A3NA 2DFCA 3ZMNA 1FAYA 2D98A 3FYMA 1S4CA 3BU7A 5B2GB 5F2WA 2ILMA 4GKYA 3BTAA 4PU4C 1QGLA 2KR2A 2QQVA 4XFBA 1HQ1A 5K98B 2JWPA 1QWRA 1XE8A 3EMRA 4ASLA 3AP9A 4IV1C 2DCZA 1RUJ2 4KH9A 2P4EA 4BQWA 1JWLA 4FT8A 3RMYA 1V6OA 3OP9A 3OBRA 2PN5A 4AK3A 1NE6A 3NZLA 2D44A 1JFTA 2ZHKA 2B9VA 4KI5M 3VZKA 3PU8A 1W6NA 4I6RA 5GLUA 2CSGA 2RDNA 4W6XA 4E8DA 2PE5A 4CDUC 4CVUA 3E1F1 4Q26A 1VBB3 3USUB 4WM7A 4NHMA 5LA0A 5CNAA 5FUNA 1W0PA 3R05A 4PI2A 2BGPA 3KZ3A 3IWZA 4Q0SA 4QQ2A 4QHBA 3T0BA 1DGRA 2Z4FA 1VPWA 4P9WA 3RDIA 1FMD3 3OG2A 3HN1A 4DUVA 5FJHA 2X29A 4GWJA 4GWMA 4XMIA 4OFGA 1WW6A 2J1UA 1N1TA 4QX2A 3W20A 3WP4A 1O3SA 5J96B 1FV2A 3O0XA 3ZYHA 2LCVA 1AU7A 4LTAA 1IPKA 1MEC3 4YM1A 4B4QA 3CJIB 3MYXA 2KXLA 3SH5A 4CCCA 2A5ZA 3K77A 3QFIA 5FLHA 4NHKA 5L7OC 1GT0C 1FOD3 1GZWA 4LK7A 2WABA 1US2A 2C9KA 2VUDA 3MICA 3ETQA 1C57A 1GR3A 3AK0A 5IFTA 3J9SA 4QM9A 2GNMA 3WG2A 3WDWA 1UMIA 2VTXA 1RVF3 4N53A 4A2UA 2HEWF 1S1AA 1OH4A 3ZHIA 2GN3A 3FHAA 2RMU1 3M3IA 2VMFA 4OUEA 3V0BB 1C8M3 3ZYPA 1KDMA 4DIQA 2W3JA 4AEDB 2ZMKA 3BI3A 3AJZA 2XH6A 3P1IA 5GAHi 1NERA 4LBNA 2HWC2 3VBUC 1PNFA 4AHXA 4E8CA 3M2MA 2BFUS 3A22A 4I2OA 2HH9A 3VD7A 1LEMA 1DW9A 4HRAA 2FMYA 5FZOA 4M0NA 3JXDL 5FPZA 3IDAA 1MQTA 2XBO3 3ROUA 4YM2A 5SV8A 3I3BA 4AW7A 2Q8CA 2XXAA 3JU9A 1PMIA 3DL3A 1Y7YA 2WNVB 3MPBA 4Y5TA 5DABA 4JCXA 3WQ0A 2R0FA 3SCFA 1QPZA 3BN6A 3UKVA 4JCKA 3GJBA 4FXGB 1W6MA 4YARA 5C5TA 2F17A 3ZKUA 2BVVA 4EQVA 2Q1MA 5FY4A 4NRPA 1QQP2 3KSCA 1ULOA 2PUEA 2RM23 3ZXAC 5LZ6A 1OD5A 2XDVA 4UF0A 4O9EA 2F4PA 1ZYBA 1SFPA 4CP2A 3NJYA 3LFPA 1DQ0A 2PUCA 2R63A 4C0BA 3OY8B 3NKGA 1ZBE1 4M3CA 4XMAA 2J22A 5FR3A 3ACLA 1GLHA 3NROA 2B45X 1OLQA 4G4FA 3KB5A 3WHUA 4Q4W3 4FP2A 1R1A3 4FBIA 1MPXA 3FN9A 3O9XA 1R091 3NSTA 4AAPA 3RZGA 4BXFA 5FMDA 3VZMA 4B1LA 3FFZA 4LR4A 4D7SA 4GA9A 3H1MA 5KC6A 1QQBA 4Q4V1 4D94A 5C3QA 2XL9A 2XLAA 1B35B 1WIZA 1RUG2 2ZAHA 2JG8B 4Y33A 3BIWE 1X50A 1DQ5A 1V6KA 4NN0A 3BIEA 2OVUA 2OUJA 5EWSA 2WZ8A 1V6JA 2A3XA 4H3WA 5A80A 4L8QA 2DDUA 4PQ9A 4UXAA 4LHNA 2XR4A 2BU9A 3MLFA 1ZAYA 1YFUA 2EF6A 3NRUA 4HFSA 4MLOA 4QHZA 5FWEA 5FYMA 1C28A 2B46X 4K3UA 3JBG3 3H9AA 1BYHA 5FZFA 1LOFC 4COZA 1PGL1 3ZDVA 2VXJA 3RZJA 2LLVA 1OFSA 3UESA 1RPEL 3I59B 4R9AA 4YVSB 3B9CA 5LWBA 3HMYA 5DTMA 4I0AA 3UKNA 2HJIA 5DZGA 2DUOA 5L73A 1R081 1REDA 4ES9A 3JQXA 2BZDA 4YZ1A 1X82A 2Y64A 1UL9A 5LBCA 1A6CA 5BNOA 1XU2A 3GN5A 2IVJA 4R9DA 3IMMA 4QGNA 1NY72 2CDOA 3EBRA 3WEZA 4CUAA 4C91A 3OOXA 2B42B 1A8MA 3AL5A 3AKQA 3CROL 4BIFA 3T2OA 1RZRA 4X4GA 1GZWB 4HANA 1W99A 2L49A 1QJX1 4OI1A 1LU2A 1S0CA 4FFHA 2DUPA 1RZSA 4AVVA 5J1XA 1QJU3 5BY5A 1ASJ3 4LO6B 1CZVA 1IPSA 5IW0A 1UO9A 1U5YA 2E7QA 2YZ4A 3UKTA 3C7FA 3IM0A 2WNOA 3KQRA 2Q30A 2YFZA 4P5YA 3J7LA 4GH4C 5FJKA 3ACIA 1O3QA 3O0WA 3MIHA 2RMU3 5IWFA 4PDWA 4MXWA 3MI8A 3ZFGC 4YG4A 1R69A 1RHI3 2WNUA 3NV4A 4I3PA 1VRH2 3HQRA 2CU5A 2QFEA 2A6VA 2K0GA 1EV11 1H1AA 2G1MA 2VOVA 3POGA 3NQHA 4I3GA 3VBHA 5AC91 1GNHA 2GNDA 2L9LA 2ZGPA 3AP7A 3EB7A 4S2GA 1DYOA 4WVMB 1QJEA 1APNA 3WNLA 3GZDA 3POJA 4XBNA 5EYXA 4IEWA 2XJ3A 2RE9A 3ZN5A 1VB4A 5BYNA 3NKTA 3HVDA 1G9AA 1HJFA 1MS0A 5EJZB 1RHI2 5FDBA 2XJUA 2JDUA 1JUIA 2V5DA 3D0SA 3FE5A 2PXFA 2B9UA 3VKMA 4E2QA 1NLSA 1JXNA 4U2AA 4NPMA 1WUVA 1LHUA 2P34A 1FX5A 1H1IA 2FCTA 2TEPA 3TN93 3VBSB 4EN6B 4MGQA 3WY6A 4ONUA 1CQTA 1H9WA 1XNDA 2W0XA 1PIV1 4J6GA 4RQPA 5LASA 2VVFA 2Z79A 3A0NA 3MW3A 3TFLA 1CJGA 3MIBA 4Y5SA 3WG1A 2IVGA 3O1PA 5D1IA 2HKXA 3OQMA 1PGW1 5LCWL 4GQ7A 3OYWB 3BYWA 1W90A 3FHQA 4IGQA 5GLZA 4ZZ8A 2D97A 5C8CC 1OCTC 4L99A 4K1ZA 5CU1A 1WBLA 3UK9A 3GNEA 2W92A 1W2AX 3SKJE 3BODA 1S0GA 5HI0A 2VOWA 4RR3A 3A9ZA 4MHRA 1CWPA 3V64A 2HEYF 2OX0A 1JOJA 1LCLA 3POEA 5FK8A 3BDNA 1KJLA 3VBFB 4MUVA 3QOWA 4AFBA 1HKDA 3OEAA 3D8CA 3N4MA 4FTSA 5F5AA 4XUPA 2XSDC 1V6MA 1AUYA 4QX3A 3LEKA 1NLRA 4RSUA 1ZRCA 1TMF3 1NXMA 1XYPA 1XE0A 2WWSA 3G7DA 5KXCA 3RZHA 2ZGOA 5JZGB 2WAAA 3MZHA 3WP3A 5HV4A 1V9U1 2HWB1 3S7IA 3ZR5A 2JDAA 1PGSA 2P3JA 1DGWX 2ZGKA 1AL0G 1DGLA 5BNOB 3BALA 2PA7A 1JZ5A 3SQOA 5IFPA 1LU1A 2O14A 1BCXA 3D0JA 3I7DA 5L9BA 1PZ9A 2JEMA 4RYDA 5DTRA 4OULA 4LEJA 1HQLA 1T6GC 1AHSA 2B5HA 3WG3A 4BOWA 2YU2A 5A6YA 3IPVB 2HWF2 5FP9A 2FDIA 2L8NA 1Q3EA 1UAIA 1ENXA 4AHZA 3FMYA 5FZMA 4OMCA 1QJY3 4KWLA 3WF2A 1ZNPA 1DF0A 1QKQA 4NWWA 5J37A 1MZEA 2VNGA 1GP5A 2GMPA 4CUBA 1UWWA 2OUHA 1I5PA 2ZHNA 2PLV3 2WNUB 3KT1A 3W59A 5FK7A 1GZ9A 2H6CA 2E9QA 2RMU2 5FLIA 2FFHA 5DRTA 2QQLA 1S55A 3AXDA 3HAGA 2MEZA 2H0VA 4N9IA 1BZWA 2Y33A 1ZZ6A 5FUPA 4DZGA 4RN5A 5JZGA 3EYPA 1F9KA 2HYKA 3LE0A 1Q56A 2XONA 3U07A 5F5IA 3UL2A 4ES8A 5I0RA 4K1YA 2OPWA 3H7JA 4WZFA 4XETA 4DY3A 4EZ4A 1BMV1 1QDOA 3MW4A 1TZOA 2FCVA 5G05L 4W6WA 1IPJA 3QACA 2GN7A 3G5GA 1CAVB 4JRAA 3J8F2 2UWAA 5F3EA 2MPFA 3GCWA 5F5CA 5LEJA 1W9SA 4YW7A 2WAOA 5F32A 4CCKA 1GFF2 4AOCA 4J1WA 1OXCA 1HB3A 3CZUA 4Q4X1 1CESA 1FPN2 4K8RB 2Y34A 4QKFA 4R52A 4XJUA 5DDJ3 4EWEA 2ATFA 4TN7A 2PELA 2VO5A 1JU4A 5DZEA 3APBA 5TSWA 3VLBB 1LAJA 2XVLA 1HF0A 1PK6C 1MZ6A 3I54A 3LIGA 4XHBA 2GDFA 4LHKA 3KMHA 2WBKA 4IV3A 4XF1A 5FYHA 1CAUA 3A0KA 5DAQA 3ES1A 5A6ZA 4H7MA 2QQIA 4XBLA 4UOJA 4PIZA 3I8TA 3C2UA 3VBRB 4QKBA 2XKOA 2EVXA 3M7AA 4JX0A 2DCJA 1MS8A 2ETEA 3T4VA 4CDXC 2YBSA 5LK5A 1WCKA 1YWKA 3FLRA 4W65A 1J3PA 4YLZA 1RMU2 3WDTA 5EPAA 4MYEA 4EN7B 1AR92 5H9PA 2JQEA 4GMP3 3O7OA 2YV8A 4FTEA 4URTA 5C3PA 4LO5B 3RZMA 4XUTA 4K20A 4CDXB 5DUVA 2ARXA 5K4LA 2VL4A 4CEYA 1ZS4A 2BWAA 2WFF3 4ZXEA 1YQ5A 2JICA 3NVCA 3ZDSA 1D0HA 1SG3A 1TMF1 1NCQA 4P5HA 3KV5A 1QH7A 1BK1A 2VNOA 4MADA 2AGSA 3KT7A 4IGPA 4CDWB 1WZXA 5ACA2 4L97A 5DG1A 2HWB3 4AQTA 1AR62 1RUH3 1PK6B 4NR1A 3EXUA 1SBDA 3QBQA 4P9YA 4CPBD 5GZFA 1TME2 5JMOA 2JE7A 4E2GA 2HWD3 4Z8BA 3ETPA 1O59A 3IPVA 1DQ2A 3OQOA 5CKMA 5FZLA 2XCJA 5CISA 5IAXA 5IATA 4K40A 4PQQA 5FREA 4M01A 1WLWA 1DU3D 1MR5A 2YC0A 5FV3A 2FD8A 5K0UC 5KHIA 2ZEZA 2Y8KA 2ZGRA 1WW5A 2P5BA 2FCUA 4PU7A 1LECA 2YBPA 2DF7A 2R7EB 1UOBA 4I30A 4XACA 1NYWA 5FP7A 3WQ7A 4LKSA 4UBHA 4BLIA 2AWIA 3M4FA 5DUXA 1UU6A 4E4DX 4B4PA 2ZHLA 4CCDA 2AEZA 3DYOA 1RTVA 2PLV1 5JI7A 2VBPA 1KFXL 1COV2 5FZ9A 2BWCA 3TNQA 4AFAA 2JECA 1VRH1 1GWKA 4GKXA 4YW1A 3PXPA 3KL4A 4P9IA 3WF4A 2QQWA 1D4M2 3HEIA 5AC92 2VZUA 1QJY2 5C33A 2VOKA 3U3WA 2KM2A 3H8UA 1SDWA 2WIIB 2DVAA 4AI0A 3IVPA 1OH3A 2HWE2 1B35C 1RUC3 3MUY1 2VMGA 3PTYA 5CKQA 5DUUA 3RZZA 2JIGA 4GWNA 4Q1PA 4YYOA 3T2QA 5JVVA 4NIGA 3CJXA 1S7EA 1ENQA 2AREA 3HBKA 4NROA 1IQAA 4FPLA 4QPIB 3VZJA 3ZFFA 1ENSA 4FOYA 5K9YA 1OA2A 2LYRA 1E5IA 1LHVA 1OUSA 1FMD2 3WG4A 4AGGA 1O4YA 3W58A 4L11A 2VTFA 1H0BA 2WZR1 2HWE3 3IAQA 3R1FA 4CYDA 4OYUA 1CVNA 2D6OX 5EV7A 4ZKTB 2C9AA 4K7JA 2PXBA 2J1SA 3OY8A 1HV1A 2WWUA 3VBRA 2I45A 3FJSA 2EF8A 2P1BA 2TNFA 5F3IA 5FZ0A 4Y1VA 4OI4A 1FT9A 4XZPA 2PUDA 5C8CA 4XF0A 4IE6A 3LIHA 3ZHMA 4XTPA 1VBE3 3SNMA 1D4VB 3GUUA 1W2NA 5H9QA 3VHPA 3TEWA 1L1MA 3MFCA 4KU7A 3PTRB 4FFIA 1UPSA 4FPYA 5FKCA 4NPRA 2ICPA 3MO4A 5F1RA 1BQPA 2HCSA 4HK8A 4UFLA 2XWJB 3PJQA 5DAWA 2A73B 1HW5A 2J7UA 1POV3 3PUIA 1GZTA 3TB0A 4BK4A 1AR82 4DB5A 5FZHA 5FO8B 3ZMOA 1SEFA 1KS5A 3AMQA 1V9U2 3O1RA 3Q8CA 3ABZA 3B02A 4YVWC 5GLWA 1LOEA 4LBLA 2XIUA 3TAYA 1VBB1 1XNCA 3VD3A 3ZYFA 4XHXA 1W8ZA 3GZDC 4Y20B 3THTA 1VRBA 2Y6FA 3MEJA 5A7LA 1DYPA 4LA3A 3WCSA 5K8SA 1EPZA 3DPRC 5JPMB 4GJZA 4XPVA 1BBT1 1S0BA 2JDPA 2Y0OA 5CG8A 2NZ9A 1OOPA 4Q4V2 1ST8A 1IS3A 2WNVA 4NVPA 5A1AA 2XVKA 1I3HA 3M3OA 1ZRFA 1AX2A 2HWF1 1BDIA 3D4KA 1AL21 2WS91 4KL1A 4ZY9A 3M8LA 1N1SA 1CAXA 4Y4RA 4UBGA 1LOGA 1PNGA 3OWQA 2PAKA 3QD6A 4CUGA 1PM4A 1YEWA 2BGCA 4Y26A 4B3NA 2Y6GA 2IXCA 1XJAA 4DS0A 2VOXA 3HN3A 3J7MA 2RDQA 4NMIA 4WVMA 1AZDA 4ORFA 3UGFA 5I0DA 5DSXA 2VR4A 2XKPA 2VM9A 2H8RA 4F83A 1FATA 1XB9A 4I8TA 5FBJA 1G9BA 5FXVA 3A9XA 3DPRA 4NHYA 4MV2A 4CP0A 3MPPG 2HBTA 3OBAA 2ZCWA 4UYBA 3SLIA 4YFWA 2LYJA 3T2PA 5BNOC 3LPGA 1W9TA 4RD7A 5E8AA 1OPOA 4NIAA 1XNAA 1KDKA 1QMJA 1RUI1 2GC0A 5LA1A 4LKFA 2E26A 2P3IA 3RFRA 3N9OA 5CYYA 1ZREA 3W21A 5FMBA 3MGUA 1PRAA 4Q4X2 4OB4A 3I2JA 4FOQA 3OJBA 4UFJA 4XZUG 1OC1A 3CU7A 4XAEA 3ON7A 4CEWC 1R1A2 1O4XA 1OLMA 1DULA 1J59A 1UIJA 3GXUA 1BKZA 2ZXQA 1YFWA 3DECA 1L7RA 5FZGA 4A3XA 1CAWA 2QUOA 2GSYA 2IXKA 2WZR3 4DY5A 3WNNA 3S6PA 3C3VA 2WFPA 4YGBA 2Q5TA 1LOAA 2DU1A 3OMTA 1ZBE3 2WQZC 2DTWA 2DYCA 2OS2A 3AP5A 5FZ1A 3DF0A 3WINE 3MHZA 4BWOA 2R063 3AX4A 5BNNA 1ENRA 3JD71 4XILA 3IDEA 1JMUB 3KHBA 3MLJA 5A70A 3RGBA 4PBPA 2WYSA 1BVVA 1UX6A 1W39A 5JXHA 1Q8PA 4A6OA 1RUNA 2WL1A 4A42A 3AKTA 2IFWA 3MF6A 4KGQA 1SCSA 2R062 2VVEA 1WCSA 3WF3A 1LCDA 2AXVA 2P2KA 3UNPA 2Q1ZB 2VU9A 1PHMA 2I74A 2ZEWA 4OZOA 5FLJA 1EAH1 1PO12 2X8KA 3MLKA 4P14A 1XSRA 3OEBA 4Z07A 1HRV3 3DV8A 4G9SB 1MQTB 4X4FA 5A7PA 5C70A 2XL7A 3NWKA 4IV3B 4FAGA 1IS4A 1G7YA 4MGTA 5DQ0A 1PMHX 1ZM1A 3V0BA 4PU3C 1KD7A 3BTZA 3ZIWA 1F4AA 3G6JB 2VECA 3FUQA 2D5HA 2VMDA 4XF9A 1C4RA 4QXCA 1GUIA 4HONA 1OUXA 4JQTA 1POUA 1NAEA 4RGAA 5FYCA 3WW2A 5GALA 5JOZA 2ZGLA 2ZX4A 1Y7BA 2VNVA 1CIWA 1GICA 3ZSMA 3ZIXA 2WT0A 2PXLA 3UJQA 4XW3A 2J1VA 4JRLA 4YG0A 1M06G 4IXLA 3KM5A 3S30A 5B4NA 3IMNA 2GNTA 1FXZA 2E6VA 3ELNA 4Q5OA 4OHYA 4A4AA 3AP4A 2CGNA 3VHRA 2ZACA 4PIXA 3QLQA 4CCNA 5FYTA 4AVAA 4LUKA 4XFHA 3KLSA 4LK6A 2VZQA 1PM7A 2OFYA 3NNGA 4QDSA 5GZDA 3AKPA 3K2OA 4M4RA 5L7OA 3PNAA 4QDQA 4J1XA 5T5JA 3WUDA 1LRHA 3ACFA 3DN7A 4AHWA 5C7GA 3DXUA 3B69A 5CEHA 5J7MA 4CDWC 2ZMLA 1AJKA 1OI6A 4AEDA 4D69A 3J26N 2P37A 4X8PA 4MCXA 3LA2A 5F8PA 3B00A 1ULEA 1TNFA 2KA3A 4WM8C 5FTTC 2XG3A 3OB8A 1Q8QA 2R1JL 1GP6A 2AYHA 3ZPOA 3F51A 1Y9MA 4WM7C 4X6RB 3JQWA 3SH3A 3GM8A 4D7YA 3KVBA 3BCWA 4ET7A 1UZ0A 4GJYA 4BK5A 2LTNA 4QWNA 1RUF1 3DYMA 1MVQA 2LRPA 1WD4A 2EAAA 1BJQA 4CEYC 3HIFA 2FDFA 1FMD1 1N3QA 2Q0AA 4TZDA 1CD3G 2W9XA 4ZXKA 2VW2A 1UCXA 3RVHA 5A3PA 2OT7A 4H14A 2ZAAA 1NCQB 4OUMA 2WQ4A 3I2FA 1SPPA 2GP3A 1Q43A 3ZFEC 4CDUB 1UTXA 1WD3A 1PIV3 1JHNA 4DPNA 2ENRA 4P02B 1NKGA 2UYAA 3I3QA 4HK9A 4JVAA 1W8NA 4KBZA 1GMMA 1US3A 2LNMA 4LLOA 1UOFA 5I0SA 2ZGNA 3FMGA 4BCUA 3VBHC 3OCPA 1Q8OA 4CCLA 2C6SA 1NA1B 2PHTA 2RM22 3VUOA 1W8WA 4CDXA 5A1FA 3TEPA 4HVOA 3KXAA 1JYNA 4HVRA 1HX6A 1XQNA 4W6YA 5FZ8A 2JKBA 1W6QB 4XYXA 4CDQA 1SZBA 4IEQA 2CYFA 3B94A 1YRZA 2AENA 3AMMA 2XPJA 1QQAA 1UQXA 4H7LA 1RC6A 1WMEA 1ZZ8A 1WMXA 4E2SA 1GWMA 3AKRA 4PCRA 1SACA 4DE8A 1AR81 2XBO1 5LBFA 4ZU7A 5HBAA 3RMXA 3AKSA 2D6NA 1V9U3 3QCWA 4Q2FA 3U14A 1X8EA 5IK5A 1L7LA 4OQ9A 5C9AC 1VBB2 3AJYA 2RS32 3SHRA 1NCRB 1F2NA 2RR11 2XGXA 3OBTA 1K5JA 3MLLA 3OUIA 2OPKA 2AUWA 4Q1RA 2WN3A 4AEKA 4YZ5A 4TTGA 5FZEA 3QQ6A 3ZX7A 2FQPA 1JN2P 1R092 1RMU1 3I3EA 4LMFA 2R30A 1BBT2 1HB2A 1NE4A 1UMHA 1DIWA 1W0NA 3HT2A 2A71A 4N90A 3C7OA 2QZ2A 4INDA 5G04L 2YBKA 3MV11 1YLLA 5I0UA 3RYKA 5ABJC 4FPKA 3ORJA 4CU9A 1AL22 2WS92 1O3TA 4XJZA 3A7QA 1GYKA 2NPIA 3R4UA 4IW3A 3CJIA 3F95A 2ZEXA 5A3OA 4R8HA 2OKXA 1H2LA 2QQOA 2YFUA 3CIHA 1GNZA 3TBDA 4AFDA 3ZKCA 3ZSEA 4WV8A 2J7WA 3NDBB 4PLNA 1ZRIA 1OBNA 2JDNA 3RJ2X 3LA7A 4GAZA 2R1DA 4NJ4A 1YQ2A 2DVGA 2JDKA 2JXAA 1IG3A 1VBD2 2V72A 5A7WB 5JXGA 4AL9A 1VP6A 1D2QA 1YJKA 3IBMA 5BNPC 3HWJA 1F31A 4Z5HA 1CJDA 1WA6X 4OHZA 3B3QE 2BOJA 1UOGA 5FYBA 1R082 3WHTA 1OVPA 1HN1A 1VAKA 3KV6A 4HVQA 5LB6A 4LIVA 3EUSA 3LPFA 5FXXA 4YSFA 2CROA 2VW0A 3JBG1 1WMDA 3WNPA 2IUWA 4MGSA 2BJSA 4COYA 3VBUA 1VAVA 2ES3A 5C5UA 1SDDB 4Q4X3 2V09A 1F4HA 2XUEA 1ADRA 1QJX2 1JHJA 5A7OA 3UETA 2HFZA 3OGSA 2YGLA 4E4ZA 4R4ZA 4NDWA 5C8CB 4C1XA 2H0BA 2IUOA 1SLBA 1BEV1 3TEXA 3RJRA 4FVVA 1G86A 3VDBA 2ZGQA 3T0DA 1OVSA 2BNMA 1CX4A 4COWA 1LTEA 5CBLA 2VBDA 5JOWA 1QJX3 2EAKA 2PHWA 2YG0A 2ZGSA 4K6BA 3ZN6B 5HCBA 2YU1A 1D4M1 2K2SA 3JD72 4IE5A 2P6CA 2XLFA 5FYIA 4CXXA 1BLZA 4HL0A 4AG4A 3TELA 4ER6A 4GXLA 4CCMA 2R32A 1W6QA 4Z2AA 3I3MA 3OKZA 2ODRD 4Z5CA 4EZHA 3ZSJA 3ILRA 4NAMA 4FFFA 4BISA 4DXTA 1W0OA 1XNBA 4QPIC 1OQEA 1ULGA 4GMP1 1J3RA 3AC0A 2FZ2A 3H1WA 1J83A 5FZKA 4AFMA 4A7ZA 3KGLA 1RHI1 4OUSA 4XDOA 4LBMA 4LITA 5LRRA 4M4PA 1ACCA 1QEXA 2GRLA 5E88A 3PUSA 4J25A 3VL8A 4AVSA 4OI0A 2VE1A 3BB6A 4IEXA 4D6QA 4Z1VA 5IVBA 4ZHNA 3H3ZA 5IYYA 3N7JA 1RJ8A 1JU3A 2WT2A 4JAAA 2VQAA 4FBFA 2IU7A 2VZSA 1HB1A 4QX5A 5FZ3A 4NE9A 2J42A 1TEIA 1DYKA 3ZFGB 4X4IA 1H9PA 3BTYA 4MO3M 2CSFA 5JLVA 1AVBA 1DG6A 3IAPA 1W3VA 3NL1A 4EK9A 3FC0A 3MW2A 4L0PA 3Q8AA 1FOD1 3AZYA 2EWTA 2EIGA 1QQP3 2AH2A 3EHKA 3LDKA 3VHNA 1WCDJ 4QU1A 3E6CC 4P00B 2PIJA 3IDBB 1UY4A 2XXZA 5CFCA 1YIFA 4FQ4A 3S7EA 2XHKA 3SCGA 3R4DB 4UW5A 2QBXA 5DAPA 3A9YA 3FZ3A 5JDBA 4FPJA 2GMMA 2XUMA 3KV4A 3O5SA 4DXSA 4EN9B 4RGGA 3O1SA 3GZUC 3VZLA 1YXWA 2RS33 3MIGA 5EHDA 1N3OA 1ULPA 1OSLA 2H6BA 3K75B 4M3CF 3GZTB 4IL7A 3ZYRA 3W5MA 3BPSA 4GB33 3UWPA 1Q8VA 2W1UA 5J3UA 2EIEA 4XE9A 5I93A 1VBD3 4BYYA 4FPEA 5EQUA 4Y1YA 4YVSC 2XJRA 3CKHA 1XNTA 4A45A 1AR63 2HWB2 5EJ1B 5FAXA 5C9AA 3T30A 4Q0UA 1P8JA 2J1TA 2Y0IA 5CIRA 2AEYA 2VOTA 4OHWA 2NMOA 1DP0A 5EYYA 4YM3A 2OXBA 1WA4A 4CEYB 3HJRA 2UY9A 3NNFA 2WO7A 1H6YA 2W1WA 3I2HA 3Q8BA 3GZCA 5T5OA 2W47A 2ZMNA 2GZUA 5FRAA 4EYUA 3K48A 1U2ZA 1VE0A 1QU0A 4SLIA 4UAPA 4EJRA 4JQDA 1IKQA 2CTVA 2E32A 1RUF2 4MOAA 5LA2A 2R071 4N8MA 5GM0A 1XSQA 2HWC3 4LJHA 3SMHA 4QX7A 1W9WA 2NP0A 3N9NA 2L1PA 1S2EA 3GBGA 1JOPA 4QXKA 4Q8KA 1XC6A 1PZ8A 4QGLA 1T6BX 3P6BA 1BEV3 5FYZA 5F9TA 3POBA 1UYPA 4YVSA 4BHPA 1DBNA 2VGDA 1PGL2 3F52A 2RS11 4EQZA 5KHHA 1WETA 3PL0A 4I6TA 2OW4A 3HQXA 4Y3OA 4QQOA 5HXVA 4BLJA 1F8VA 4ZPIA 3BKZA 1PO21 4Q2JA 5HCAA 3DEMA 4YNIA 2JD4A 4R9CA 3SISA 1SLAA 1SLTA 2P3YA 2E51A 5FP8A 1RUI2 3KCCA 5T50A 3WVJA 4ATEA 4CSWA 1MZ5A 5L9RA 3WQBA 3GZAA 4XJAA 2VMHA 4B8EA 4YZ4A 1W04A 1ZPQA 2A1XA 2P6HA 4HOOA 5KXEA 4LO4B 2ARBA 2J1EA 4OQ8A 5C6CA 4KWKA 3WDVA 5CA6A 3ST7A 4QKDA 4FO9A 4CU6A 4JHTA 1TE1B 4MH0E 2C1FA 1POV1 3GJAA 3SITA 2LYQA 1R083 3N7LA 4DXZA 4H2AA 4JGZC 3OQNA 2BBVA 1O8SA 4DQAA 1S0IA 2VVDA 2B8MA 4MX3A 1RUE2 2YYOA 5D8AB 5LY2A 4MSVA 3MIEA 1W8TA 3U1XA 4AQSA 2XXPA 3JXCL 4FP3A 4RQPB 5FXZA 3VD5A 1H2KA 4QGMA 3WP5A 4AEDC 1YI9A 1ULFA 2C0ZA 2UYBA 3RZKA 4HG6B 4PHZA 3WX5A 1MQTC 1W6MB 4FI9A 3RI8A 1QP4A 2LLWA 3PIGA 3RQ0A 5IHRA 2ZS6B 3HNBM 3M3CA 2OZ6A 1QJU1 1W6PB 3OBZA 1ASJ1 4YFZA 1CQ9A 4OBMA 3M3EA 3INAA 2KZ8A 4YM0A 5FQ0A 4QPGA 3VN4A 5L7OB 4LO8A 3P3PA 3CLPA 4KQ7A 1PVXA 1MEC2 4IESA 2HWF3 1K45A 2QNKA 2CNAA 2PXJA 1PVC3 4C1WA 4FSJA 2JKXA 4IGOA 2RS51 1VMJA 3CL1A 1EAH2 2BDRA 2BTVC 1RUD3 5T54A 1AYN3 4KBBA 2ZX1A 2X5IB 2QZ3A 2DCKA 1CAVA 2OZJA 4GB31 2XXQA 3O1UA 1J1TA 1YYNA 4XQDA 5J48A 1DCSA 3K46A 1VBD1 1K12A 4EKGA 1AYM1 2ZGMA 4IEYA 4LULA 4P9LA 4XF3A 1X8MA 1POV0 2QQMA 2VJXA 3HD8B 4QX0A 3ZXLA 5A7WA 1C8M2 1V6IA 3URFA 4OHXA 5ACA1 5LRSA 1AR61 1YCIA 2MQKA 1CAXB 3B7HA 3AZWA 3EQEA 3U10A 4NUBA 3VZNA 1OF4A 1RUD2 3RRDA 4GALA 1LODA 1RUJ3 1VMHA 1O91A 4FPCA 4IE4A 2Q4SA 2MHFA 3C7HA 2CGPA 4IWRA 4CRQA 5JOYA 4RR3B 1MFQC 2JG8A 4D0QA 3E5UA 4WVVA 1AR73 2ZKNA 2VUAA 3ECQA 4YGDA 4FAHA 1YUDA 5JAXA 3DNVB 4Y20A 1W2OA 3GN5B 1Y9GA 4GIQA 4Z5DA 2DVDA 1W6OA 2AC1A 1A78A 2R073 2BV4A 2WYFA 3GZEA 4ZONA 1LOBA 5FKBA 4D7TA 3M70A 1QDCA 2G9GA 2VQ0A 4QB1A 4HMZA 5KWRA 2WKKA 5ERLA 4EV0A 2C4XA 3LISA 1OF3A 3OGGA 4LLFA 2YHJA 5CFDA 5GZEA 5KR7A 3JB4C 2QDNA 4BXSV 5J98B 4FPOB 2KEKA 3E5QA 4PT6A 5BNNB 5GJ6A 4NIIA 1S0DA 2QE3A 2CHHA 4RHV3 3VBSC 1SLLA 5EZWA 4W8JA 2XMLA 2E31A 3GDBA 1OQ1A 4CP9B 1JYIA 4DE9A 3PDQA 2GH8A 4ZS3A 3R4SA 2FDJA 2RVAA 2PHUA 1VLNA 1RIRA 3RI9A 1Z7S2 5DMYA 1FYUA 3CECA 2XHNA 3N7MA 5A7SA 5FPUA 2PQSA 1Y43B 4WM8B 1PVC2 3RWNA 3DYPA 3POYA 2Q1FA 2PUGA 3CO2A 2V3CC 2SLIA 1A8DA 1VBE2 3AYCA 3L2HA 2QQJA 1NA1A 2EIDA 1CX1A 1VALA 1HRV1 3VBOB 4YG3A 3VDDC 1GP4A 5KC5A 1U0AA 4META 1CPNA 1VBA1 2QQNA 3UT0A 5F37A 4NPLA 3VDDA 5GAGi 1DQ1A 3ZXJA 1JUHA 4LIUA 1X36A 1LOCA 2QQKA 1WLDA 1UZYA 2WLQA 3LAGA 1H2MA 1FOD2 2VCAA 4XCBA 3IB3A 1IOAA 4QXBA 4RFRB 1G8WA 1ND2B 3HQUA 4NIDA 5ANQA 3LDBA 5SV5A 4XF4A 2ARCA 2B4KA 1H8VA 3J8F3 5F6KA 2PHFA 1HDKA 4AXOA 1IS5A 2ZZQA 2WIUB 1XRUA 2VULA 3WDXA 2VCCA 4BB3A 2D43A 1X9TA 1C8NA 4XJ9A 3LWCA 4CCOA 2IXIA 1OOPC 2BRTA 2VC9A 1O3RA 1MACA 3KS7A 1ZZBA 4Q4W2 5IAVA 5C3OA 2ORZA 1GZCA 3QF3A 1W6PA 1VPHA 1QNYA 1AX0A 3PE5A 1OA3A 3POSA 1BHGA 1CZTA 5A3LA 3PHMA 5BPXA 3FX3A 2PUAA 2QTWB 1ZA7A 2ZPXA 1T2XA 4LKEA 1TQ5A 4TYSA 4WVWA 3VKNA 5T3NA 1QIQA 1RUOA 3ZVXA 4CCJA 1UX7A 4OMDA 4QB2A 1UY1A 4LHLA 4RL7A 2WJSA 3THDA 3V56A 4LXLA 3U78A 2LS6A 4MVTA 2DVFA 5JWPA 3F2ZA 2W95A 3HPNA 1DZQA 2JG8C 4HKWA 1O6UA 4Q8LA 1MS5A 2XJQA 3AXEA 5CB7A 3WXPA 1AR71 2WQ8A 1JYVA 1UD1A 1RUF3 2GMEA 3JB8A 3KCXA 1NXD1 2R072 3NV3A 4WM8A 3V0AA 5C4WB 5L36A 4JC1A 4XTMA 1L3JA 2Y38A 2JJ6A 4DRVA 1VMFA 2ADDA 1GV9A 4QPGB 5FO9B 4DINB 1RGSA 3HR9A 1Q8SA 1TMF2 4LBQD 3D5OA 3USUA 3ZXFA 3VBRC 3AM2A 1YHFA 3QYXA 1KJRA 3B5LB 4XFFA 4B1MA 1CIYA 4CP9A 4UW3A 1AL23 2WS93 3ZYGA 4NIHA 4Q0VA 1PO22 4XQ4A 4Y1UA 1RUH2 1BVP1 4N9HA 4RHV1 4NO4A 4NOTA 5DG2A 4AZZA 3OF1A 1NT0A 2GC3A 4Y24A 4A44A 2LALA 3ZYJB 3LOBA 4C90A 5FY9A 2WFF1 1KGYA 4CU7A 2ZABA 2PAMA 2PMWB 3JUUA 5F7UA 1J1LA 1Z7S3 2GZWA 5JOXA 2YPJA 3VD9A 3T3YA 1LJ7A 3O12A 3WZ1A 3J4UH 1SBFA 4LBKA 3WT3A 3ZFFC 3W5NA 3BUCA 3ACHA 3PVOA 2A3YA 4B7EA 2JE9A 3KT4A 1B35A 3S5QA 5FOJB 1KITA 2C24A 4GD4A 2HEVF 5JMCA 1URXA 3POFA 2D40A 4FPGA 1BEV2 4Q4Y3 1RUI3 2ICTA 3OD0A 2DUQA 1EPWA 5FUIA 2OYZA 5ISLA 4LOTA 3K4DA 5M0TA 4EZIA 2QDRA 4AVBA 3WNMA 3TEZA 3WR0A 1CR7A 3NAPC 3T0AA 2RJLA 5BNPA 2CDPA 1W8UA 4NHXA 5DN2A 1HIXA 4XQWA 1COV1 4ATFA 1N1VA 3ZPYA 2PPXA 5E6HA 1PX3A 3AFKA 4BQ5A 2A3WA 4XUNA 1XPWA 2JB8A 4YG6A 4HT1T 2CGOA 2SBAA 2WA4A 1BXHA 4CE8A 3PJYA 4N43B 5JR2A 3GALA 3L9JT 4S2HA 3CJIC 3FL7A 1QOOA 3OGJA 1CZSA 2FBEA 5J09A 1EUUA 3BU0A 4D6RA 4UW6A 5ABJA 5I8YA 3IDCB 3O1VA 3SC7X 5A6QA 3S5AA 1X9PA 2R061 1NG0A 1VRH3 1VBC3 3DKWA 3CDZB 1RJ7A 2YB7A 2ADEA 4XXPA 2HSGA 5IVCA 1PO11 2NYYA 4GB32 3BTXA 1NUKA 1W8HA 4JQRA 4P9JA 1LEDA 3MEPA 2VMCA 1PX4A 3T4HB 5EFUA 5JR7B 3VWSA 3H8RA 3LQXA 5T52A 1RB8G 1F35A 3KVAA 3H3UA 2ET7A 2VZVA 1QB2A 3UV9A 2LYSA 3BVCA 1MS3A 4S2DA 2GNBA 4JZRA 1HB4A 5E1RA 2ZX3A 4V2WA 1LGNA 2TUNA 2IC1A 4M3CE 1GWLA 2WO1A 3NNLA 4Z2WA 4O61A 3O1OA 1I6XA 1OLRA 2RDRA 3G0TA 3QOPA 1FV3A 1H30A 2Y6KA 4QKNA 3GHNA 3ZFFB 4CUCA 1JFSA 1BMV2 5D8AA 1LLIA 2O0OA 4CDQC 2KPJA 1DFQA 1LNSA 3K3NA 3ME5A 2IXHA 5BXXA 4DOUA 4E4HA 3Q8EA 1UXZA 2Y60A 4WVZA 2GU9A 3LSEA 3ZLIA 4IUGA 4XJWA 1UY0A 1MS4A 2W91A 1YQ6A 2JG9C 4YW6A 2A6ZA 5FPVA 2VCMA 4BJ0A 1X57A 4AHYA 2D3SA 4CTEA 1B0NA 4XFCA 2ZKLA 1S2KA 1UZZA 3S8QA 1SHWB 1HXS2 1UXXX 1STMA 4FN3A 4Y22B 3UJOA 2IVQA 2WDBA 3VBFA 1SQ4A 1C1LA 4EWAA
chains in the Genus database with same CATH topology
4FXKB 4B29A 1ZUGA 5IUQA 4AQ6A 3VBOC 4K21A 2UWBA 4D3WA 3KJXA 2RJKA 2IFRA 1AR93 1W2UA 1Z7S1 1QOSA 2ZGTA 2BNNA 4A7KA 2R041 3AZVA 1REEA 4HPKB 3NJZA 1Z78A 1QY4A 3WUCA 2F6BA 1SFYA 4DMIA 5FMOS 2EA7A 3TRSB 3ZXKA 1YJLA 3AP6A 1HRV2 3RG0A 2BPA2 3HZIB 2E7AA 4TSVA 4ASMB 3L1PA 4Y1ZA 1BBT3 2VW1A 2RS12 3WV6A 4CDWA 1TNRA 3WDUA 3GBWA 5JZGC 1C5IA 3NO8A 1COV3 3ZXGA 2NQYA 3FYAA 2EXHA 2ZBJA 5I8TA 1DWKA 2VUJA 4IQPA 4I01A 4JGZB 2G9FA 2D5FA 2RM21 1D0GA 1OHFA 4P9GA 2XJTA 3OTFA 3RNSA 4M0HA 2VG9A 2UWCA 4PIYA 1O4TA 4QPIA 1MS1A 4I09A 5LEKA 1LHOA 5IK8A 2P17A 1JW6A 3ZN6A 3SXWA 5C8WA 1UXDA 3B9IA 5KXDA 1R1A1 4Z59A 4KGGA 4L2NA 4MXWB 5FOBB 1K5MB 1RUE1 5J36A 4I02A 4MGZE 4AFCA 4QMAA 3SCHA 5CFCB 1C3HA 4BQ1A 2O8OA 3W9AA 4S2FA 2EBYA 3AZZA 3LZZA 2R0HA 3PMSA 2QKDA 3PMEA 5T55A 2RR12 3LA3A 3FLPA 3ZFEB 1QJU2 2QVSB 1X2LA 2LYKA 3CEWA 2X5IC 3JZVA 3ZYIB 1X33A 2D5VA 1GANA 2D6MA 4Q4Y2 3WP6A 1AR83 1ZRDA 3ZN4A 5CVRA 3QWGA 2Y26A 2D6PA 3RPQA 3LSDA 5AVPA 2A6CA 2I07B 3D82A 1PERL 1SQ8A 4ZU5A 3WNXA 3VV1A 1ZVFA 4HN1A 2RS52 3QH7A 4QD2A 5A32B 3JD73 3H5TA 1RMU3 4I6UA 1N1YA 5BNNC 1IHMA 4LNVA 4IEOA 1JBCA 1UXCA 1NOVA 1OPMA 2RS13 3T1LA 5H9RA 1SLIA 1DHKB 4X4EA 4RQPC 3D6EA 4MZUA 1K5MC 5JPNB 4BE3A 2PYTA 4E4SA 1H8TA 1YO8A 1NY71 5K0UA 4E9KA 2DFBA 3JBG2 4CEWA 4X8NA 3GF6A 4FQZA 5LK7B 1OKQA 1ZRRA 4X4HA 1IC8A 2BJCA 3N3HA 2R043 1KS4A 4AI2A 1NCRA 3EJKA 4Y5Z0 5H9SA 1EV13 1UU5A 4Y42A 1ND2C 4OVEA 4RS5C 1S0JA 3N35A 2D3RA 3AMHA 3IT8A 1CJPA 3VBUB 2YMZA 4O9GA 2PTMA 3S0MA 4F8DA 1LULA 1V70A 2IXLA 5BNPB 2WNUC 1ZBA1 1MZFA 5E89A 5JIUA 4MGIE 2XVGA 1DGWA 2ZA9A 4JDOA 4TLFA 1LHNA 3T1MA 1OFNA 1NQDA 1CAWB 4HSJA 1DQ6A 2IXJA 4NHLA 5C4WC 5C4WA 5L19A 4C0HA 5EXOA 2Q8OA 2CWMA 2YUEA 1WMFA 5KXBA 2MEV2 3ZSKA 2WT1A 2LM3A 4RA0A 5ABJB 4AEJA 3A4UA 1RUG3 1PVC1 1OMIA 3E5XA 2R16A 4YBAA 1O5UA 1KXGA 1RUE3 4NWVA 1LR5A 3FHIB 4XIOA 4X4CA 1AYM3 1VBA2 2VXRA 1NCRC 1QOTA 5ACA3 2BVBA 2DU0A 4PJYA 3ZFEA 5FDBA 4DNYA 1ZVVA 4YG7B 4Q27A 4Y22A 1R63A 2VPVA 3FBMA 2WUSR 1EFAA 2PUBA 1H8TC 2TBVA 5JCTA 1W6OB 4IV1B 4Q0PA 4N7IA 2ZOEB 1K5MA 2D93A 3BOPA 1YI7A 1EP0A 3OPZA 5GLTA 1H4HA 3U4XA 3RYRA 4XFGA 1C1FA 1UIKA 2OIIA 1FPN3 5DDJ2 4RS5A 1ND2A 1NQJA 2A75A 4Q4W1 1QQP1 3NW4A 4JGYA 1QNWA 2VY0A 1R093 1MVEA 2I2SA 1UU4A 1E3OC 3TOJA 3WD5A 5BNQA 3WW4A 1F5FA 1WH8A 4PF5A 1JH9A 1U12A 3MIFA 3VDDB 1LMB3 2RS31 4L92A 1AF9A 2NLRA 4AWDA 2ZHMA 3FBYA 4LA2A 4XJ8A 1QP7A 4FCAA 1GQGA 3AMNA 2B5AA 5F6LB 1TME3 4O8BA 1MS9A 3DGTA 4IEUA 2EXJA 2PUFA 5I91A 4MCTA 2KEJA 1G6NA 4FOVA 2JDZA 1VIWB 4N43C 3RYPA 3VZOA 2RR13 4WM7B 3FUOA 4AQ2A 1LCCA 2PHXA 2Z5WA 3I4IA 4YZ2A 2D7FA 4TWTA 4N43A 3LKJA 1VBA3 3BS3A 5JI9A 4GH4B 3VKLA 1ZBA3 1FNZA 3WOGA 4YVWB 1UMZA 2CAUA 1R1ZA 1DLLA 4RHV2 2BW8A 1HQWA 4IEPA 4JTOA 1RITA 2ZX0A 3ENRA 1UW8A 3M1HA 4XIKA 2R6QA 1KFUL 1AYN2 5F5QA 3J8F1 1LESA 1QF3A 2JVLA 3KD4A 2HWD2 5GZCA 4AI3A 3M3QA 3VK0A 1ZZ7A 1G9CA 4Z58A 4F7ZA 1S0EA 4YW2A 1JH5A 4X4BA 1QHDA 5IT6A 1LKNA 4JGYC 3POWA 2OA2A 3WCRA 2XJSA 5AC93 5KHKA 3HT1A 4JTNA 4GMP0 4OHVA 3KGZA 2DCTA 5GKAC 3ZSLA 5CAZA 3FFQA 4HKLA 4P9XA 1RVF2 2ZJCA 1JYCA 2BNOA 2GRMA 4WZCA 1XYNA 1GQHA 4HKOA 3E6DA 4MXVA 1NCQC 2YXSA 3B7MA 2UURA 3AYAA 2CY6A 2WLPA 2GAUA 1PRUA 1WW4A 1OSGA 1W6NB 4AF9A 4AYUA 3D1NI 4YW4A 3N36A 4IV1A 3TN91 1O7FA 5E16A 3BD1A 3LCPA 3CF6E 3PLQA 5KHJA 3JXBC 1ONAA 3WDYA 4IERA 1MEC1 4Z92B 2W68A 4HETA 1QP0A 5BV6A 2YGMA 4UW4A 1D4M3 3B93A 3ILNA 3MDPA 5CADA 5FCCA 3IKWA 1H4GA 2A7AA 1QJZA 1X7NA 2CWSA 4I0BA 2FJRA 3I59A 4WBBA 1QXRA 3L2YA 4COUA 4N53B 4GH4A 4HSLA 1C8M1 1RIOA 3H0OA 1ALYA 3GYDA 5D8AC 4XBQA 3FWEA 4QQPA 3VBOA 2N7GA 2V5YA 1I1EA 1IKPA 1TME1 3U0ZA 4KNCA 3Q9OA 2WA3A 4CEWB 3X29B 2WNVC 5FPXA 5K0UB 3ZXDA 1LENA 4IETA 2JG9A 3PVBB 2IZWA 5AFBA 2XJPA 1QXPA 4K9SA 2XLGA 1RUJ1 2GC1A 3PVNA 2D6LX 2FHRA 3MIDA 4YVWA 4XOGA 2PHRA 2PLV2 1HRI2 3AB0A 1BDHA 1HXS1 4M3CB 5EJ3A 5JSOA 3O0VA 4BH9A 2IVBA 4YG1A 4KG8A 3VKFC 4HZFA 2WC2A 4AGRA 4SBVA 1AJOA 1QJY1 3ATGA 1A3KA 2JCGA 1AXZA 1QH6A 2BFUL 1S0FA 1UKGA 5CFDB 1UPIA 4LO7A 2MEV1 2GC2A 4Q4V3 4QM8A 1S2BA 2R042 1XNKA 2P3KA 4FPFA 5I8SA 4X6QB 2R1BA 5BUVA 3RS6A 5A3MA 3NAPA 4R4XA 2LUWA 5CFDC 1WGPA 3H7YA 2CAVA 1VBE1 1UN1A 1Z0HA 4BM8A 4L9BA 2PAEA 3NV2A 1HV0A 5JIAA 4JV4A 4IA8A 2YDEA 5C9AB 1IGOA 4LUMA 1XYOA 4OZXA 4ISRA 3WW1A 2QQPA 3AFGA 1V00A 5A33A 2A6WA 5T5LA 5AVAA 4V1PA 2X5IA 2HWC1 3ALQA 4JGYB 4X4DA 2OR1L 2E63A 1D2SA 5T5PA 2UU8A 3VKOA 3R6SA 4PU8A 4GHJA 1XU1A 3AMPA 4EN0A 1GKBA 1YSEA 4RR3C 4LBQB 4YW5A 1CGPA 1KRIA 2XJVA 2NM1A 1PO23 1RZRD 2A6XA 3B01A 5FMOL 1H1MA 4CZSA 2D3PA 3USSA 2VMIA 2AXUA 1F5JA 1YFYA 2YY1A 3TYJA 1WLCA 1VB2A 1ZBE2 2Z2SB 4N53C 4LT5A 3THPA 1UF2C 2O8QA 2E7TA 3KCYA 4AVCA 4HPKA 4Q0QA 4AGVA 1JTZX 1ASJ2 1C5HA 4I0WB 4G3YC 2EALA 4BMBA 4BA6A 1AR91 4ZU4A 1CONA 1RUC2 2V73A 1Y9QA 2ZTNA 2YROA 1AR72 3VHOA 5CG9A 3GBFA 1REFA 1SFNA 3OYWA 4JGZA 4AVTA 3E6BA 1PNRA 1ZA4A 2WINB 5FQ0B 4YGCA 1LB2A 2O4AA 4CDUA 1VJ2A 3ZFGA 4PDWC 1AYM2 1HXS3 2B39A 1I5ZA 2PQQA 3BOWA 1ND3C 4BPZA 2ZZJA 1VAMA 3U11A 4FTBA 1VBC2 2RS53 1HQNA 2D6KA 1SBEA 4FPHA 1RUD1 2DWRA 1AYN1 2B7YA 4RS5B 1M4WA 2VH9A 4CP1A 2ZGUA 3NV1A 2G4IA 3VBFC 4BMEA 3EO6A 1NEQA 2MEV3 2R49A 3PVEA 4KU8A 2WZPP 4BZ4A 2QJVA 4CDQB 1OA4A 4F8AA 2JENA 1H8TB 2DV9A 2O1QA 5FBZA 1ND3B 2CL2A 1NA1C 1CAUB 1SLCA 1FNYA 3RSJA 3LGRA 2AZ5A 5KHGA 4PDWB 1ZBA2 5IK7A 4E27A 2W39A 1IZ3A 5FO7B 4IV3C 2BYVE 4YGEA 1PZ7A 1PK6A 3AYEA 2NMNA 2ZX2A 4MGKE 2C5DA 2EXKA 3HBZA 2BUKA 1LHWA 3H50A 1EV12 2W08A 1SMVA 4B7KA 1G9DA 2HWE1 3ASIA 4PLOA 3TN92 5JSPA 2W52A 2PHLA 4YRDA 3ES4A 3WW3A 4XDQA 1WLTA 4Q29A 1EY2A 3WQ1A 4COVA 2XWBB 2NN8A 2WZR2 4XXAA 2E53A 1VR3A 2XB6C 3F6WA 2LYPA 1ND3A 3ZXEA 3NAPB 2VNRA 4LE4A 2ERFA 5DXDA 5CFCC 1V6NA 2LYLA 4LBQA 1Y3TA 1AX1A 1LGBA 4QPYA 1PGW2 2AUYA 1U5IA 2Z69A 1EYBA 3KZ4C 1AXKA 3I2DA 1OQDA 1U5ZA 2HINA 5DDJ1 4A7YA 4ISQA 3JCIA 1PRVA 2KEIA 4KG0A 4K8FA 4LE3A 2RHPA 1I9RA 1ZZCA 2AXZA 3VBHB 4DFSA 2BEOA 5AFEA 1H2NA 3CLCA 2PFWA 4QQLA 3E97A 4YW3A 3IN9A 2EXIA 1HRI1 3BPZA 1HLCA 4HBNA 4KWJA 3P3NA 3OD4A 5JSRA 1DGRN 3VL9A 2DCYA 1N47A 1RL3A 4AI8A 1XWRA 1CN1A 4QPGC 2JX9A 5A32A 2DURA 4HN0A 3AYDA 3O14A 2FZ1A 4RFT0 1IS6A 4PLMA 3WLUA 2BQPA 1RUG1 1DDLA 3TWIA 5KBFA 1XE7A 5I0TA 1ZX5A 3DPRB 4QQHA 4AEMA 2FMDA 4GQMA 4LBJA 1U5XA 1LQCA 2MNGA 1O4ZA 5GZGA 3SH4A 4ITCA 1QXJA 4EWDA 4U36A 2K9ZA 3AZXA 2AR6A 3IIAA 4EN8B 1WH6A 2GH2A 4Y4YA 4FOWA 5IK4A 3V0AB 1RUH1 5FFOC 2PHDA 5A33B 2O49A 2WSVA 5DZFA 2WFF2 2UY8A 3DUIA 3V65A 1OOPB 5GLVA 2IWGB 2HWD1 3LB9A 1GSLA 1WBFA 4Z82A 1GBGA 2DTYA 1SCRA 1FPN1 3ME2A 1YNAA 4MGYE 3R0RA 3TNPB 4GULA