2LYJA

Noe-based 3d structure of the cylr2 homodimer at 298k
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
66
structure length
66
Chain Sequence
MIINNLKLIREKKKISQSELAALLEVSRQTINGIEKNKYNPSLQLALKIAYYLNTPLEDIFQWQPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cold denaturation of a protein dimer monitored at atomic resolution.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Dna binding protein
molecule keywords CylR2
total genus 23
structure length 66
sequence length 66
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2lyjA00
2LYKA 3CECA 3BS3A 4IVZA 1JH9A 2O49A 3QF3A 3SCGA 1DWKA 2IU7A 3JXBC 3RZZA 2LYQA 2R1JL 1LCCA 2PPXA 2KEIA 2IUOA 4Z58A 2HSGA 3GN5B 3BDNA 3H5TA 4I6RA 3QYXA 3GBFA 2KEKA 3S8QA 1PRVA 1LLIA 1VPWA 1ZVVA 4I8TA 3BD1A 1QPZA 1O4XA 2HINA 2PUEA 2AW6A 4YG1A 3SCHA 1LQCA 4MCXA 3KZ3A 1POUA 3KJXA 4PU4C 1R63A 1XWRA 1CJGA 2WUSR 2OR1L 1E3OC 3CLCA 2LYLA 4X4BA 1RPEL 2KZ8A 1UXCA 4PU7A 2AUWA 2IVBA 1L1MA 2JVLA 3F6WA 4Z5HA 3OP9A 1RZRD 1QP0A 4PU3C 3DNVB 1ZZ7A 4X4IA 1AU7A 1PNRA 3G5GA 1DW9A 1PRUA 1EFAA 3OQNA 2BNNA 4PU8A 3ZKCA 2MEZA 2O4AA 3F52A 2BNOA 4Y42A 3VK0A 1CQTA 1B0NA 4YARA 3QQ6A 2KPJA 4Z5CA 1QQBA 2GRMA 3ZHMA 2H8RA 3FMYA 2BNMA 2EWTA 4F8DA 2R63A 2PUFA 4JQDA 2LYRA 3LISA 4Z5DA 1UTXA 2PE5A 4X4FA 1PERL 1RIOA 2XIUA 3UFDA 1RZRA 4YG7B 2OFYA 2ICPA 4GQMA 2PUCA 1ZZ9A 2O38A 2PUDA 5A7LA 1RZSA 1ZZ6A 2L49A 3U3WA 1WETA 2PUBA 1LCDA 4Z59A 3PXPA 3CROL 2KEJA 3IVPA 3G7DA 4X4GA 1HF0A 2IVGA 2EBYA 2A6CA 2CROA 1GT0C 1WH8A 4I6TA 2LYSA 3FYMA 3HZIB 4JCXA 4X4HA 2XCJA 3OQOA 4O8BA 1ZUGA 2AXZA 1JFTA 1JWLA 3EUSA 4IA8A 2FJRA 2IVQA 1OSLA 1Y7YA 2GZUA 2AXVA 1ZAYA 1OCTC 2LCVA 3LFPA 3L1PA 2B5AA 1WIZA 1ZPQA 2PUGA 4GHJA 3D1NI 3GN5A 1NERA 2MQKA 4J1WA 1UXDA 1R69A 1QQAA 1Y9QA 1SQ8A 2XSDC 1ZZBA 2XI8A 3QWGA 4FN3A 4I6UA 1WH6A 2PIJA 3R1FA 1ADRA 2PUAA 1LMB3 1QP4A 2ICTA 4YBAA 3TRBA 4FBIA 1X2LA 1S7EA 1PRAA 4X4EA 2BJCA 2AXUA 4YG4A 1BDHA 4MCTA 3F51A 2LYPA 2LYJA 1JFSA 3OQMA 2AWIA 2EF8A 3KXAA 3MLFA 4NDWA 2GRLA 3FYAA 4IWRA 2IV1A 4X4CA 1X57A 1ZS4A 2CSFA 1ZZCA 4OB4A 2WIUB 1QP7A 1IC8A 3OMTA 4J1XA 1ZZ8A 2JCGA 1YSEA 3SCFA 3B7HA 3JXCL 4JCYA 2XJ3A 3ZHIA 3O9XA 3JXDL 2L8NA 1BDIA 5K98B 2D5VA 4X4DA 1NEQA
chains in the Genus database with same CATH superfamily
2LYKA 3BS3A 4IVZA 2O49A 3RZZA 2R1JL 3NXHA 2PPXA 4I6RA 1VPWA 2KEKA 1LLIA 4DE9A 1ZVVA 2HINA 2PUEA 2YBDA 4MCXA 2OR1L 3CLCA 2LYLA 4X4BA 3NDBB 4PU3C 4X4IA 1AU7A 3G5GA 1EFAA 2MEZA 3F52A 2XXAA 3VK0A 4Z5CA 2GRMA 2PUFA 4JQDA 2LYRA 3LISA 4EK9A 4Z5DA 5DSXA 4ER6A 4YG7B 3UWPA 2PUDA 3TELA 3U3WA 2PUBA 4Z59A 3G7DA 2A6CA 2CROA 4I6TA 2PXFA 2XCJA 1ZUGA 1JFTA 4IA8A 1OSLA 2IVQA 1OCTC 3LFPA 5DRTA 2MQKA 1Y9QA 1LMB3 1QP4A 4FBIA 1S7EA 1BDHA 4YG4A 4MCTA 3F51A 2LYPA 2LYJA 1JFSA 3GUUA 4ER0A 2IV1A 1QB2A 2PXPA 2M4HA 4ER7A 3OMTA 1MFQC 4J1XA 1YSEA 3LQXA 2JQEA 3B7HA 3JXCL 3ZHIA 3O9XA 2L8NA 1NEQA 3CECA 1JH9A 4OBMA 3SCGA 1DWKA 3JXBC 1LCCA 2LYQA 2MXDA 2KEIA 4Z58A 3OWQA 2HSGA 3A9YA 4I8TA 3NROA 1QPZA 1O4XA 2HCNA 4YG1A 2PXTA 1POUA 3KJXA 1R63A 1XWRA 1CJGA 2WUSR 5GAGi 1UXCA 2ODRD 2IVBA 3KL4A 1L1MA 2JVLA 4Z5HA 3OP9A 1QP0A 1PNRA 3A9XA 1PRUA 4EKGA 2BNNA 4Y42A 4ER5A 4YARA 3MEJA 3FMYA 2XXPA 2PXDA 3TFLA 2PE5A 2XIUA 2PXUA 4GQMA 5GAHi 5A7LA 2HCSA 3IVPA 4ER3A 2IVGA 2LYSA 3FYMA 3HZIB 4JCXA 4X4HA 4O8BA 3EUSA 2AXVA 3DM5A 5DRYA 4GHJA 1SQ8A 4HRAA 2XSDC 3QWGA 2XI8A 4FN3A 1WH6A 3R1FA 2PUAA 2AXUA 3GZDC 3PE5A 3OQMA 2AWIA 3FYAA 1ZS4A 1X57A 1DULA 2LLVA 1ZZCA 4OB4A 1IC8A 3VWSA 4JCYA 5K98B 5DTMA 2PXLA 2IU7A 3GN5B 1PRVA 2J7WA 3BD1A 3KZ3A 1E3OC 3QFIA 4PU7A 2AUWA 1ZZ7A 3ZKCA 2PXQA 1CQTA 2KPJA 5DT2A 4WVLA 4X4FA 1RIOA 2J7UA 3GZCA 2LLWA 2OFYA 4DE8A 2PUCA 2O38A 1ZZ6A 1WETA 1LCDA 3CROL 2PXBA 3A9ZA 3OQOA 2AXZA 1HQ1A 1Y7YA 2GZUA 1ZAYA 3L1PA 1WIZA 2XXQA 1ZPQA 2PUGA 3G0TA 4J1WA 1UXDA 1R69A 4EZIA 1ZZBA 2PIJA 2ICTA 4YBAA 3R09A 2EF8A 3KXAA 3QOXA 4NDWA 4X4CA 3M9LA 2CSFA 5DTQA 1BDIA 4IWRA 3QF3A 2IUOA 3BDNA 3H5TA 3NZLA 2H8RA 3GBFA 3S8QA 3QYXA 2LNMA 2AW6A 3SCHA 1LQCA 4PU4C 1RPEL 2KZ8A 2PXVA 3F6WA 1RZRD 3DNVB 1DW9A 3OQNA 3QOWA 4PU8A 2O4AA 2BNOA 1B0NA 3QQ6A 1QQBA 3ZHMA 4EQZA 2BNMA 2EWTA 2FFHA 2R63A 3SX0A 4F8DA 3OKZA 1UTXA 1PERL 3UFDA 1RZRA 1NW3A 5DTRA 2ICPA 1ZZ9A 1RZSA 5JUWA 2L49A 3PXPA 2KEJA 4EKIA 2L1PA 4X4GA 1HF0A 2EBYA 1GT0C 2PXEA 1WH8A 3ME5A 3GZDA 1JWLA 2FJRA 4Q2JA 2LCVA 2HFZA 2B5AA 1U2ZA 3D1NI 3GN5A 3TEPA 1NERA 1QQAA 4I6UA 3SR4A 1ADRA 2PXKA 3TRBA 1X2LA 1PRAA 4X4EA 2BJCA 3MLFA 2GRLA 1QZXA 2V3CC 2WIUB 3ZPXA 1QP7A 2VEOA 1ZZ8A 2JCGA 3SCFA 2XJ3A 3JXDL 2D5VA 4X4DA
chains in the Genus database with same CATH topology
2LYKA 3CECA 3BS3A 4IVZA 1JH9A 2O49A 3QF3A 3SCGA 1DWKA 2IU7A 3JXBC 3RZZA 2LYQA 2R1JL 1LCCA 2PPXA 2KEIA 2IUOA 4Z58A 2HSGA 3GN5B 3BDNA 3H5TA 4I6RA 3QYXA 3GBFA 2KEKA 3S8QA 1PRVA 1LLIA 1VPWA 1ZVVA 4I8TA 3BD1A 1QPZA 1O4XA 2HINA 2PUEA 2AW6A 4YG1A 3SCHA 1LQCA 4MCXA 3KZ3A 1POUA 3KJXA 4PU4C 1R63A 1XWRA 1CJGA 2WUSR 2OR1L 1E3OC 3CLCA 2LYLA 4X4BA 1RPEL 2KZ8A 1UXCA 4PU7A 2AUWA 2IVBA 1L1MA 2JVLA 3F6WA 4Z5HA 3OP9A 1RZRD 1QP0A 4PU3C 3DNVB 1ZZ7A 4X4IA 1AU7A 1PNRA 3G5GA 1DW9A 1PRUA 1EFAA 3OQNA 2BNNA 4PU8A 3ZKCA 2MEZA 2O4AA 3F52A 2BNOA 4Y42A 3VK0A 1CQTA 1B0NA 4YARA 3QQ6A 2KPJA 4Z5CA 1QQBA 2GRMA 3ZHMA 2H8RA 3FMYA 2BNMA 2EWTA 4F8DA 2R63A 2PUFA 4JQDA 2LYRA 3LISA 4Z5DA 1UTXA 2PE5A 4X4FA 1PERL 1RIOA 2XIUA 3UFDA 1RZRA 4YG7B 2OFYA 2ICPA 4GQMA 2PUCA 1ZZ9A 2O38A 2PUDA 5A7LA 1RZSA 1ZZ6A 2L49A 3U3WA 1WETA 2PUBA 1LCDA 4Z59A 3PXPA 3CROL 2KEJA 3IVPA 3G7DA 4X4GA 1HF0A 2IVGA 2EBYA 2A6CA 2CROA 1GT0C 1WH8A 4I6TA 2LYSA 3FYMA 3HZIB 4JCXA 4X4HA 2XCJA 3OQOA 4O8BA 1ZUGA 2AXZA 1JFTA 1JWLA 3EUSA 4IA8A 2FJRA 2IVQA 1OSLA 1Y7YA 2GZUA 2AXVA 1ZAYA 1OCTC 2LCVA 3LFPA 3L1PA 2B5AA 1WIZA 1ZPQA 2PUGA 4GHJA 3D1NI 3GN5A 1NERA 2MQKA 4J1WA 1UXDA 1R69A 1QQAA 1Y9QA 1SQ8A 2XSDC 1ZZBA 2XI8A 3QWGA 4FN3A 4I6UA 1WH6A 2PIJA 3R1FA 1ADRA 2PUAA 1LMB3 1QP4A 2ICTA 4YBAA 3TRBA 4FBIA 1X2LA 1S7EA 1PRAA 4X4EA 2BJCA 2AXUA 4YG4A 1BDHA 4MCTA 3F51A 2LYPA 2LYJA 1JFSA 3OQMA 2AWIA 2EF8A 3KXAA 3MLFA 4NDWA 2GRLA 3FYAA 4IWRA 2IV1A 4X4CA 1X57A 1ZS4A 2CSFA 1ZZCA 4OB4A 2WIUB 1QP7A 1IC8A 3OMTA 4J1XA 1ZZ8A 2JCGA 1YSEA 3SCFA 3B7HA 3JXCL 4JCYA 2XJ3A 3ZHIA 3O9XA 3JXDL 2L8NA 1BDIA 5K98B 2D5VA 4X4DA 1NEQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LYK A;  3CEC A;  3BS3 A;  4IVZ A;  1JH9 A;  2O49 A;  3QF3 A;  3SCG A;  1DWK A;  2IU7 A;  3JXB C;  3RZZ A;  2LYQ A;  2R1J L;  1LCC A;  2PPX A;  2KEI A;  2IUO A;  4Z58 A;  2HSG A;  3GN5 B;  3BDN A;  3H5T A;  4I6R A;  3QYX A;  3GBF A;  2KEK A;  3S8Q A;  1PRV A;  1LLI A;  1VPW A;  1ZVV A;  4I8T A;  3BD1 A;  1QPZ A;  1O4X A;  2HIN A;  2PUE A;  2AW6 A;  4YG1 A;  3SCH A;  1LQC A;  4MCX A;  3KZ3 A;  1POU A;  3KJX A;  4PU4 C;  1R63 A;  1XWR A;  1CJG A;  2WUS R;  2OR1 L;  1E3O C;  3CLC A;  2LYL A;  4X4B A;  1RPE L;  2KZ8 A;  1UXC A;  4PU7 A;  2AUW A;  2IVB A;  1L1M A;  2JVL A;  3F6W A;  4Z5H A;  3OP9 A;  1RZR D;  1QP0 A;  4PU3 C;  3DNV B;  1ZZ7 A;  4X4I A;  1AU7 A;  1PNR A;  3G5G A;  1DW9 A;  1PRU A;  1EFA A;  3OQN A;  2BNN A;  4PU8 A;  3ZKC A;  2MEZ A;  2O4A A;  3F52 A;  2BNO A;  4Y42 A;  3VK0 A;  1CQT A;  1B0N A;  4YAR A;  3QQ6 A;  2KPJ A;  4Z5C A;  1QQB A;  2GRM A;  3ZHM A;  2H8R A;  3FMY A;  2BNM A;  2EWT A;  4F8D A;  2R63 A;  2PUF A;  4JQD A;  2LYR A;  3LIS A;  4Z5D A;  1UTX A;  2PE5 A;  4X4F A;  1PER L;  1RIO A;  2XIU A;  3UFD A;  1RZR A;  4YG7 B;  2OFY A;  2ICP A;  4GQM A;  2PUC A;  1ZZ9 A;  2O38 A;  2PUD A;  5A7L A;  1RZS A;  1ZZ6 A;  2L49 A;  3U3W A;  1WET A;  2PUB A;  1LCD A;  4Z59 A;  3PXP A;  3CRO L;  2KEJ A;  3IVP A;  3G7D A;  4X4G A;  1HF0 A;  2IVG A;  2EBY A;  2A6C A;  2CRO A;  1GT0 C;  1WH8 A;  4I6T A;  2LYS A;  3FYM A;  3HZI B;  4JCX A;  4X4H A;  2XCJ A;  3OQO A;  4O8B A;  1ZUG A;  2AXZ A;  1JFT A;  1JWL A;  3EUS A;  4IA8 A;  2FJR A;  2IVQ A;  1OSL A;  1Y7Y A;  2GZU A;  2AXV A;  1ZAY A;  1OCT C;  2LCV A;  3LFP A;  3L1P A;  2B5A A;  1WIZ A;  1ZPQ A;  2PUG A;  4GHJ A;  3D1N I;  3GN5 A;  1NER A;  2MQK A;  4J1W A;  1UXD A;  1R69 A;  1QQA A;  1Y9Q A;  1SQ8 A;  2XSD C;  1ZZB A;  2XI8 A;  3QWG A;  4FN3 A;  4I6U A;  1WH6 A;  2PIJ A;  3R1F A;  1ADR A;  2PUA A;  1LMB 3;  1QP4 A;  2ICT A;  4YBA A;  3TRB A;  4FBI A;  1X2L A;  1S7E A;  1PRA A;  4X4E A;  2BJC A;  2AXU A;  4YG4 A;  1BDH A;  4MCT A;  3F51 A;  2LYP A;  2LYJ A;  1JFS A;  3OQM A;  2AWI A;  2EF8 A;  3KXA A;  3MLF A;  4NDW A;  2GRL A;  3FYA A;  4IWR A;  2IV1 A;  4X4C A;  1X57 A;  1ZS4 A;  2CSF A;  1ZZC A;  4OB4 A;  2WIU B;  1QP7 A;  1IC8 A;  3OMT A;  4J1X A;  1ZZ8 A;  2JCG A;  1YSE A;  3SCF A;  3B7H A;  3JXC L;  4JCY A;  2XJ3 A;  3ZHI A;  3O9X A;  3JXD L;  2L8N A;  1BDI A;  5K98 B;  2D5V A;  4X4D A;  1NEQ A; 
#chains in the Genus database with same CATH topology
 2LYK A;  3BS3 A;  4IVZ A;  2O49 A;  3RZZ A;  2R1J L;  3NXH A;  2PPX A;  4I6R A;  1VPW A;  2KEK A;  1LLI A;  4DE9 A;  1ZVV A;  2HIN A;  2PUE A;  2YBD A;  4MCX A;  2OR1 L;  3CLC A;  2LYL A;  4X4B A;  3NDB B;  4PU3 C;  4X4I A;  1AU7 A;  3G5G A;  1EFA A;  2MEZ A;  3F52 A;  2XXA A;  3VK0 A;  4Z5C A;  2GRM A;  2PUF A;  4JQD A;  2LYR A;  3LIS A;  4EK9 A;  4Z5D A;  5DSX A;  4ER6 A;  4YG7 B;  3UWP A;  2PUD A;  3TEL A;  3U3W A;  2PUB A;  4Z59 A;  3G7D A;  2A6C A;  2CRO A;  4I6T A;  2PXF A;  2XCJ A;  1ZUG A;  1JFT A;  4IA8 A;  1OSL A;  2IVQ A;  1OCT C;  3LFP A;  5DRT A;  2MQK A;  1Y9Q A;  1LMB 3;  1QP4 A;  4FBI A;  1S7E A;  1BDH A;  4YG4 A;  4MCT A;  3F51 A;  2LYP A;  2LYJ A;  1JFS A;  3GUU A;  4ER0 A;  2IV1 A;  1QB2 A;  2PXP A;  2M4H A;  4ER7 A;  3OMT A;  1MFQ C;  4J1X A;  1YSE A;  3LQX A;  2JQE A;  3B7H A;  3JXC L;  3ZHI A;  3O9X A;  2L8N A;  1NEQ A;  3CEC A;  1JH9 A;  4OBM A;  3SCG A;  1DWK A;  3JXB C;  1LCC A;  2LYQ A;  2MXD A;  2KEI A;  4Z58 A;  3OWQ A;  2HSG A;  3A9Y A;  4I8T A;  3NRO A;  1QPZ A;  1O4X A;  2HCN A;  4YG1 A;  2PXT A;  1POU A;  3KJX A;  1R63 A;  1XWR A;  1CJG A;  2WUS R;  5GAG i;  1UXC A;  2ODR D;  2IVB A;  3KL4 A;  1L1M A;  2JVL A;  4Z5H A;  3OP9 A;  1QP0 A;  1PNR A;  3A9X A;  1PRU A;  4EKG A;  2BNN A;  4Y42 A;  4ER5 A;  4YAR A;  3MEJ A;  3FMY A;  2XXP A;  2PXD A;  3TFL A;  2PE5 A;  2XIU A;  2PXU A;  4GQM A;  5GAH i;  5A7L A;  2HCS A;  3IVP A;  4ER3 A;  2IVG A;  2LYS A;  3FYM A;  3HZI B;  4JCX A;  4X4H A;  4O8B A;  3EUS A;  2AXV A;  3DM5 A;  5DRY A;  4GHJ A;  1SQ8 A;  4HRA A;  2XSD C;  3QWG A;  2XI8 A;  4FN3 A;  1WH6 A;  3R1F A;  2PUA A;  2AXU A;  3GZD C;  3PE5 A;  3OQM A;  2AWI A;  3FYA A;  1ZS4 A;  1X57 A;  1DUL A;  2LLV A;  1ZZC A;  4OB4 A;  1IC8 A;  3VWS A;  4JCY A;  5K98 B;  5DTM A;  2PXL A;  2IU7 A;  3GN5 B;  1PRV A;  2J7W A;  3BD1 A;  3KZ3 A;  1E3O C;  3QFI A;  4PU7 A;  2AUW A;  1ZZ7 A;  3ZKC A;  2PXQ A;  1CQT A;  2KPJ A;  5DT2 A;  4WVL A;  4X4F A;  1RIO A;  2J7U A;  3GZC A;  2LLW A;  2OFY A;  4DE8 A;  2PUC A;  2O38 A;  1ZZ6 A;  1WET A;  1LCD A;  3CRO L;  2PXB A;  3A9Z A;  3OQO A;  2AXZ A;  1HQ1 A;  1Y7Y A;  2GZU A;  1ZAY A;  3L1P A;  1WIZ A;  2XXQ A;  1ZPQ A;  2PUG A;  3G0T A;  4J1W A;  1UXD A;  1R69 A;  4EZI A;  1ZZB A;  2PIJ A;  2ICT A;  4YBA A;  3R09 A;  2EF8 A;  3KXA A;  3QOX A;  4NDW A;  4X4C A;  3M9L A;  2CSF A;  5DTQ A;  1BDI A;  4IWR A;  3QF3 A;  2IUO A;  3BDN A;  3H5T A;  3NZL A;  2H8R A;  3GBF A;  3S8Q A;  3QYX A;  2LNM A;  2AW6 A;  3SCH A;  1LQC A;  4PU4 C;  1RPE L;  2KZ8 A;  2PXV A;  3F6W A;  1RZR D;  3DNV B;  1DW9 A;  3OQN A;  3QOW A;  4PU8 A;  2O4A A;  2BNO A;  1B0N A;  3QQ6 A;  1QQB A;  3ZHM A;  4EQZ A;  2BNM A;  2EWT A;  2FFH A;  2R63 A;  3SX0 A;  4F8D A;  3OKZ A;  1UTX A;  1PER L;  3UFD A;  1RZR A;  1NW3 A;  5DTR A;  2ICP A;  1ZZ9 A;  1RZS A;  5JUW A;  2L49 A;  3PXP A;  2KEJ A;  4EKI A;  2L1P A;  4X4G A;  1HF0 A;  2EBY A;  1GT0 C;  2PXE A;  1WH8 A;  3ME5 A;  3GZD A;  1JWL A;  2FJR A;  4Q2J A;  2LCV A;  2HFZ A;  2B5A A;  1U2Z A;  3D1N I;  3GN5 A;  3TEP A;  1NER A;  1QQA A;  4I6U A;  3SR4 A;  1ADR A;  2PXK A;  3TRB A;  1X2L A;  1PRA A;  4X4E A;  2BJC A;  3MLF A;  2GRL A;  1QZX A;  2V3C C;  2WIU B;  3ZPX A;  1QP7 A;  2VEO A;  1ZZ8 A;  2JCG A;  3SCF A;  2XJ3 A;  3JXD L;  2D5V A;  4X4D A; 
#chains in the Genus database with same CATH homology
 2LYK A;  3CEC A;  3BS3 A;  4IVZ A;  1JH9 A;  2O49 A;  3QF3 A;  3SCG A;  1DWK A;  2IU7 A;  3JXB C;  3RZZ A;  2LYQ A;  2R1J L;  1LCC A;  2PPX A;  2KEI A;  2IUO A;  4Z58 A;  2HSG A;  3GN5 B;  3BDN A;  3H5T A;  4I6R A;  3QYX A;  3GBF A;  2KEK A;  3S8Q A;  1PRV A;  1LLI A;  1VPW A;  1ZVV A;  4I8T A;  3BD1 A;  1QPZ A;  1O4X A;  2HIN A;  2PUE A;  2AW6 A;  4YG1 A;  3SCH A;  1LQC A;  4MCX A;  3KZ3 A;  1POU A;  3KJX A;  4PU4 C;  1R63 A;  1XWR A;  1CJG A;  2WUS R;  2OR1 L;  1E3O C;  3CLC A;  2LYL A;  4X4B A;  1RPE L;  2KZ8 A;  1UXC A;  4PU7 A;  2AUW A;  2IVB A;  1L1M A;  2JVL A;  3F6W A;  4Z5H A;  3OP9 A;  1RZR D;  1QP0 A;  4PU3 C;  3DNV B;  1ZZ7 A;  4X4I A;  1AU7 A;  1PNR A;  3G5G A;  1DW9 A;  1PRU A;  1EFA A;  3OQN A;  2BNN A;  4PU8 A;  3ZKC A;  2MEZ A;  2O4A A;  3F52 A;  2BNO A;  4Y42 A;  3VK0 A;  1CQT A;  1B0N A;  4YAR A;  3QQ6 A;  2KPJ A;  4Z5C A;  1QQB A;  2GRM A;  3ZHM A;  2H8R A;  3FMY A;  2BNM A;  2EWT A;  4F8D A;  2R63 A;  2PUF A;  4JQD A;  2LYR A;  3LIS A;  4Z5D A;  1UTX A;  2PE5 A;  4X4F A;  1PER L;  1RIO A;  2XIU A;  3UFD A;  1RZR A;  4YG7 B;  2OFY A;  2ICP A;  4GQM A;  2PUC A;  1ZZ9 A;  2O38 A;  2PUD A;  5A7L A;  1RZS A;  1ZZ6 A;  2L49 A;  3U3W A;  1WET A;  2PUB A;  1LCD A;  4Z59 A;  3PXP A;  3CRO L;  2KEJ A;  3IVP A;  3G7D A;  4X4G A;  1HF0 A;  2IVG A;  2EBY A;  2A6C A;  2CRO A;  1GT0 C;  1WH8 A;  4I6T A;  2LYS A;  3FYM A;  3HZI B;  4JCX A;  4X4H A;  2XCJ A;  3OQO A;  4O8B A;  1ZUG A;  2AXZ A;  1JFT A;  1JWL A;  3EUS A;  4IA8 A;  2FJR A;  2IVQ A;  1OSL A;  1Y7Y A;  2GZU A;  2AXV A;  1ZAY A;  1OCT C;  2LCV A;  3LFP A;  3L1P A;  2B5A A;  1WIZ A;  1ZPQ A;  2PUG A;  4GHJ A;  3D1N I;  3GN5 A;  1NER A;  2MQK A;  4J1W A;  1UXD A;  1R69 A;  1QQA A;  1Y9Q A;  1SQ8 A;  2XSD C;  1ZZB A;  2XI8 A;  3QWG A;  4FN3 A;  4I6U A;  1WH6 A;  2PIJ A;  3R1F A;  1ADR A;  2PUA A;  1LMB 3;  1QP4 A;  2ICT A;  4YBA A;  3TRB A;  4FBI A;  1X2L A;  1S7E A;  1PRA A;  4X4E A;  2BJC A;  2AXU A;  4YG4 A;  1BDH A;  4MCT A;  3F51 A;  2LYP A;  2LYJ A;  1JFS A;  3OQM A;  2AWI A;  2EF8 A;  3KXA A;  3MLF A;  4NDW A;  2GRL A;  3FYA A;  4IWR A;  2IV1 A;  4X4C A;  1X57 A;  1ZS4 A;  2CSF A;  1ZZC A;  4OB4 A;  2WIU B;  1QP7 A;  1IC8 A;  3OMT A;  4J1X A;  1ZZ8 A;  2JCG A;  1YSE A;  3SCF A;  3B7H A;  3JXC L;  4JCY A;  2XJ3 A;  3ZHI A;  3O9X A;  3JXD L;  2L8N A;  1BDI A;  5K98 B;  2D5V A;  4X4D A;  1NEQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...