4ER6A

Crystal structure of human dot1l in complex with inhibitor sgc0946
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
338
structure length
335
Chain Sequence
KLELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMENYVLIDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTTQPMKLNTRPSTGLLRHILQQVYNHSVTDPEKLNPFSPEVYGETSFDLVAQMIDEIKMTDDDLFVDLGSGVGQVVLQVAAATNCKHHYGVEKADIPAKYAETMDREFRKWMKWYGKKHAEYTLERGDFLSEEWRERIANTSVIFVNNFAFGPEVDHQLKERFANMKEGGRIVSSKPFAPLNFRINSRNLSDIGTIMRVVELSPLKGSVSWTGKPVSYYLHTIDRTILENYFSSLKNPKLREEQEAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone-lysine N-methyltransferase, H3 lysine-79 specific
publication title Catalytic site remodelling of the DOT1L methyltransferase by selective inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 107
structure length 335
sequence length 338
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2012-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08123 DOT1 Histone methylation protein DOT1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.60 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) 434 Repressor (Amino-terminal Domain) 4er6A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4er6A02
1JG4A 3CJRA 4AZSA 5MHTA 3FUTA 5EKXA 4A6DA 3C6KA 1X1DA 1XTPA 3PS9A 5F2NA 5FA8A 5EHGA 5BXYA 5DTRA 2C7QA 5DT2A 3REOA 3UJ9A 1L3CA 1N7IA 3B89A 4PGGA 5D1NA 4L7VA 2JH8A 3G5TA 3ME5A 4RV9A 3M70A 4YMHA 4AZTA 3PT9A 5KQSA 2R3SA 2ZVJA 3LHDA 3A26A 2FK7A 3TQSA 2AZTA 4YV2A 1AQIA 5EIFA 1FBNA 4E30A 3PB3A 4ISCA 5K05A 3UZUA 2O0LA 3LPMA 4HG2A 4ER3A 3SSMA 5EG5A 3R3HA 3UJ8A 1FP2A 1P39A 3EVCA 5BW4A 1EIZA 2PT9A 4MWZA 1P1BA 2P7IA 3DP7A 3OZTA 4FZVA 3CC8A 4PGHA 3B3JA 3JWIA 1BC5A 1JG1A 4QTUB 1WXXA 3PX3A 4X63A 1TW2A 4ZTBA 4PYKA 4BP1A 5EVJA 4YUXA 5IH3A 2IBTA 1L3IA 3GDHA 3G2MA 1UWVA 4QPNA 5E2AA 2UYCA 4Y30A 3FUXA 5ICEA 2HR1A 2IH5A 3A25A 5BP7A 1NKVA 4RVGA 1BHJA 4RTLA 2ESRA 3DMHA 3MTIA 2YXLA 5EMJA 4E70A 3MQ2A 3OFJA 2GB4A 2G8NA 1BOOA 4C03A 4E31A 2BZGA 2I7CA 2AVNA 2VS1A 5EKUA 1VL5A 2AR0A 4PCLA 2PJDA 4V0RA 3LDUA 3O4FA 1I1NA 2ZLBA 5E1MA 3JWJA 4HH4A 5E9QA 3T7SA 5LQJA 2V74B 4AUKA 1UFKA 5HIJA 1NW5A 1R8YA 3CVOA 3HCBA 1XCJA 4POOA 4DA4A 4MQ4A 4HTFB 3EVFA 1I4WA 1ZGAA 2PXAA 2WA1A 4OA8A 5FHQA 1ORIA 3MTEA 2C7OA 2I9KA 1X1CA 3E05A 1QANA 4RX1A 5U4XA 5JR3A 10MHA 2UYQA 2DULA 3SR4A 2HTEA 1D2GA 3KKZA 3KU1A 3OU6A 2FK8A 3P9NA 4IV0A 4EMSA 1QAMA 4BLWA 3DULA 3KQQA 1KPGA 3DUWA 2Y1WA 1PJZA 3C3PA 2NXCA 4CKEA 2HMYB 3AXSA 4F86A 3EGEA 4M37A 2P1DA 1U2ZA 2B78A 2FYTA 3I53A 1G55A 1OR8A 3DXXA 5B1SA 5IKMA 1WXWA 4HC4A 3V97A 3OPNA 3P9CA 1RI5A 3EVGA 4R05A 4LG1A 2OZVA 1R00A 1IXKA 3UJ6A 1KP9A 4QTTB 2GA9A 4B17A 4KW7A 5E8RA 3NVKI 3HVIA 3GRUA 3BGDA 1WY7A 3DXZA 2WK1A 3SSOA 5FWAA 3EVZA 1ZQ9A 1Q0SA 3M33A 3BGVA 4C06A 4DCGA 3KHKA 4GUAA 5D1HA 4HRAA 1JTFA 2P41A 3KPVA 1NBHA 1JG2A 1JSXA 2ORED 1O54A 2IH2A 9MHTA 5C9ZA 5CVJA 4CTJA 2A14A 1D2HA 1YUBA 3TOSA 4RTNA 2ZIGA 3KQVA 2E5WA 3BGIA 4A6EA 5DM1A 3OE5A 4MIKA 3DOUA 2IFTA 3FTDA 1N2XA 4CKBA 3B3GA 4QVGA 5HIKA 2PX2A 5DPMA 5KQRA 3ELDA 4ER5A 1JQ3A 2YXEA 4AZVA 3BWCA 2OB1A 2YTZA 1RI3A 3GXOA 2AOWA 1KYWA 3I9FA 2ZULA 2V7EA 1XJ5A 2BR3A 3FPEA 1I9GA 2ZWAA 3I58A 4PIMA 4XUDA 4ATNA 2ZZNA 2PXXA 5HZMA 3DH0A 2NXJA 3NWBA 4P7FA 2HNKA 4V0QA 3HA5A 3T7TA 3G2PA 3LL7A 3CJQA 5DM2A 3HA7A 5FQOA 3SGLA 3SM3A 4G56A 1RJGA 3B7PA 2ZBPA 5ICCA 2G1PA 4ER0A 2IPXA 4QPPA 3LSTA 2P40A 3FUWA 2IH4A 4YUVA 3FUUA 3THSA 3CCFA 1WZNA 2QY6A 4H0NA 3EGIA 5CUQA 2Y1XA 3OCJA 3UWPA 1ORHA 4P58A 4MHTA 1M6EX 1P91A 4XCXA 3ER9A 3M6WA 4IV8A 3DR5A 2PGXA 3BXOA 2PKWA 3DTNA 3B5IA 4FS8A 5G02A 4DCMA 2UYOA 5HEKA 3TFWA 2ZBQA 4RVFA 5FWDA 5KYGA 5CCXA 4IKPA 2OKCA 1EQAA 1INLA 1DL5A 2AS0A 2QE6A 3JWGA 3NWEA 1BKYA 3ERCA 2ADMA 5E1DA 2N47A 3LECA 2AN4A 3FYDA 2QRVB 4R8SA 4YUZA 4ER6A 2ONYA 3OZSA 4OA5A 5DXJA 3TLJA 5GM2A 4OBXA 2PSSA 4HGZA 5DWQA 4E2WA 2AOUA 3EEOA 4PINA 1AV6A 3R9XB 2ZIFA 3FYCA 4HGYA 3EMDA 3ER8A 2BM8A 1IM8A 5K0EA 4RYLA 3FTFA 4CTKA 2BR4A 4GOMD 3DMFA 3K0BA 4BP3A 3FPHA 1XDSA 2GLUA 5LQAA 3G7UA 3KR2A 1T43A 3P2KA 1MHTA 2I6GA 1SG9A 2F8LA 3NVMB 3KQPA 4PONA 3MERA 4X61A 1YZ3A 5EQJB 3K6RA 3O7WA 3ID6C 3KR9A 5H02A 2OYRA 2PX4A 2PX8A 3EPPA 3E7PA 3DLIA 3HCDA 3EMBA 1SUSA 2AVDA 3FPFA 5T64A 4PYNA 2VDVE 2IP2A 3G5LA 4LWOA 4RVHA 1SQFA 1UIRA 5DX1A 4DM3A 2UZ4A 2HV9A 4XUEA 2VZ9A 4Y2HA 3FZGA 2EFJA 2PX5A 3KQWA 5ICFA 5E1BA 1NT2A 4KIGA 4PCAA 3Q7EA 3IV6A 5DRTA 3BWYA 3UJBA 2NXNA 2XYRA 3THRA 5DLYA 4C05A 3C0KA 5E9WA 5BW5A 2ZFUA 3KQYA 2ERCA 3LCCA 5C1IA 2OXTA 3CKKA 4DF3A 2P35A 5HOQA 3U81A 4M7RA 1VE3A 5FUBA 5CCBA 3LDFA 3NW9A 5EZSA 4F84A 5DM0A 2ZTHA 5LSAA 3FRIA 5F2KA 4FSDA 4HSGA 5GM1A 3UBTA 4RTKA 2C7RA 4GC9A 2IDJA 3R0QA 3FTCA 4YV0A 3V8VA 2JH9A 1XCLA 5K09A 3QV2A 1ZKDA 5K0GA 3A7EA 3HNRA 3PTAA 1Q0TA 2PV0A 1X1BA 2YX1A 1JR4A 3HVHA 2BH2A 4CWAA 3BKXA 3KPJA 4OBWA 3C6MA 5K01A 2O05A 3AY0A 2FRXA 3FPGA 3MCZA 4DQ0A 4P7KA 3A7DA 3TM5A 2H11A 3DLCA 3KQSA 2VDUE 5DX8A 2ZZMA 3EEYA 4OQDA 4QQKA 2VP3A 3S68A 5DXAA 3LKZA 1WG8A 5LR6A 4O29A 4RTMA 2EJUA 4E32A 4M36A 3IHTA 3UJAA 3P2IA 3T7RA 1DUSA 1VLMA 1VIDA 2I62A 3EVAA 3G2OA 2VDWA 1NW6A 4KWCA 5DX0A 2PT6A 3I5UA 5ERGB 2PBFA 2CMHA 1G8SA 1KXZA 3P9IA 2JG3A 3ELWA 4DKJA 4FR0A 4KVZA 3FPJA 4R8RA 1QAQA 1L9KA 5ICGA 4BLVA 1M0EA 2P8JA 1NBIA 5EZQA 5F2OA 1RI2A 2PVCA 2NP7A 2G70A 3NTVA 3KQOA 5EMLA 2FPOA 1M6YA 4RSRA 2PWPA 2CL5A 2NXEA 3E23A 4JXJA 4EVIA 3B3FA 1D2CA 2ZIEA 5EIWA 4RWZA 2YUIA 3GIWA 5K0NA 4BLUA 5K0FA 4XUCA 1G38A 1F38A 1IY9A 4KRGA 1ZGJA 2CKDA 4EQZA 3PFHA 5E2BA 1HNNA 4C4AA 5LQCA 3PLAE 2P3QA 4FT2A 1QYRA 3AXTA 1RJDA 3BUSA 3GO4A 3PFGA 4AZWA 5EGSA 3UJ7A 3L8DA 3P97A 5P8WA 4PIPA 4FGZA 4X1OA 4RTPA 5E9JA 3WSTA 3HM2A 3LDGA 1YB2A 1HMYA 5DSTA 4BY9E 5K03A 2H00A 3OE4A 4EK9A 1NV8A 3G8BA 4OQEA 5FTWA 2Z6AA 3BT7A 3A4TA 3TM4A 2OBFA 3HCCA 1SQGA 3TKYA 1AQJA 2O07A 5GWXA 5C0OE 4WVLA 2EJTA 3GJYA 4YMGA 1AF7A 1EJ6A 2Z6QA 5GOZA 3LKDA 3ORHA 2AOVA 5GP1A 3IEIA 4UOEA 1VP9A 3CGGA 5EHIA 3MGGA 5EPEA 4FP9A 2ZCJA 4GOND 2YXDA 2IGTA 2B25A 3R24A 4C07A 2UYHA 1R6AA 2AN5A 3KQMA 5E8JA 2AOTA 4E33A 2Q41A 1PRYA 3GU3A 2YR0A 3OU2A 5FHRA 2CWWA 5K0BA 3FTEA 4R6XA 3HVKA 8MHTA 4GF5A 2FCAA 5GINE 2YVLA 1SKMA 3AJDA 5KS2A 3AWIA 5K0CA 5CVEA 3RW9A 4FSXA 3MB5A 4YUYA 5FULA 2XVMA 5EMMA 3UA3A 5CD1A 1L1EA 3BWMA 1VPTA 7MHTA 3M4XA 3P8ZA 1SVUA 4C08A 1H1DA 3FUVA 4PYIA 2C7PA 2O06A 3M6UA 2YQZA 1R74A 1QAOA 5EC8A 1O9HA 3SSNA 2ZZKA 3SXJA 4RTRA 2NP6A 1JQEA 2XYVA 1RI4A 2JHCA 5CVUA 4PYMA 3ELUA 1G60A 3CJTA 1V39A 4U7PB 3HVJA 5HILA 1KYZA 5HIMA 3KPWA 3H2BA 4QQNA 4RTJA 3E8SA 4GOOD 3MHTA 4RTQA 4PNEA 2GAFA 4MTLA 5CVDA 3HP7A 3LBYA 2QYOA 3EVDA 3NDJA 1KR5A 3NDIA 1X19A 1B42A 3I64A 3KPUA 3MCTA 1YF3A 3LX6A 1YZHA 1R8XA 4C04A 4M38A 3KR0A 2IIPA 4DZRA 2XBMA 3HCAA 4NECA 3HEMA 5E1OA 3SMQA 3PX2A 3VC2A 4YUWA 4OX9Y 1N7JA 2XVAA 3G2QA 2G71A 2EG5A 3KR1A 5DTMA 1EG2A 5GIPE 4GEKA 5JUWA 3A27A 3TKAA 4E2ZA 3O31A 3EVBA 3GGDA 2OY0A 5K0JA 1JSZA 2AN3A 5LQNA 2DPMA 2NYUA 3EGVA 4F85A 3OFKA 3R6TA 3G8AA 5LQKA 5CIYA 5M5BA 1WS6A 5DRYA 2PLWA 1VBFA 2QRVA 4X60A 1NW3A 1EJ0A 4PWYA 3GNLA 3GRRA 4E2YA 4RTOA 5EMKA 1YFLA 1VQ1A 2IDKA 2XYQA 3LCVB 3TPZA 4GC5A 2ZSUA 1XDZA 3VC1A 1KIAA 1R18A 4QDKA 5HFJA 4YV1A 2OO3A 3OU7A 4E2XA 3KPYA 2ZBRA 1TPYA 2B2CA 3HCFA 3CBGA 1FP1D 3DMGA 3JWHA 3C3YA 4LECA 2IBSA 3GRZA 3OZRA 3PVCA 3NJRA 3SVZA 4WXHA 3UJCA 1FJXA 5EEHA 3ANXA 2B9EA 3VSEA 2EX4A 1JQDA 3GRVA 5K8VA 2P7HA 1NE2A 3QOXA 1Z3CA 4PYOA 2PWYA 5FCDA 2HWKA 3F4KA 3HA3A 2PXCA 4P7GA 1XDUA 2CMGA 1TW3A 3T0IA 1JTEA 3GRYA 2AOXA 3ELYA 4KIFA 4LWPA 3BKWA 3UJDA 1RJEA 2GPYA 2OPBA 3MAGA 4PYQA 4ER7A 3VYWA 3NMUF 4RVDA 2P3OA 2WA2A 4QDJA 1L3BA 3P9KA 4HTFA 3RODA 4CKCA 1G8AA 1DCTA 2NNWB 2Z6UA 2ZWVA 3HTXA 3SX0A 2BM9A 2JHAA 2AOTB 2GS9A 3HCEA 2FHPA 3G88A 1FPQA 1O9GA 3M6VA 2ZW9A 1MJFA 3EVEA 3UA4A 2ONZA 4EKIA 2AOUB 2GH1A 1KHHA 4GBED 4P7JA 5GIOE 1XXLA 5CM2Z 1SUIA 1NW7A 2OB2A 3IYLW 4R6WA 2BR5A 3LGAA 5EOVA 1ZHFA 2K4MA 5FQNA 3M6XA 4DMGA 2B3TA 5K0LA 3TMAA 4RTSA 3P2EA 5EEGA 1QZZA 1KPHA 3G89A 5LQRA 3D2LA 4GQBA 4X41A 1X1AA 3LCUA 5CVVA 5FADA 5FA5A 4FT4A 5T6BA 4PYJA 3RIEA 2G72A 1G6Q1 2H1RA 2R6ZA 1EAMA 4IWNA 4PYLA 4AX8A 4Z2YA 5KVAA 1YFJA 1RJFA 2QM3A 1Y8CA 3FRHA 3X0DA 4CXMA 1VP3A 2P3LA 1JG3A 4GOLD 5T67A 4QVKA 5DSXA 3TR6A 3UFBA 4EKGA 5LQUA 4KDRA 4K6MA 3TRKA 3KQTA 4KDCA 3BWBA 3QOWA 2KW5A 2JJQA 1XVAA 1F3LA 1ZG3A 1RI1A 2JHPA 2LD4A 2O57A 3DXYA 3LBFA 3Q87B 4U7TB 5HIIA 1KPIA 3GWZA 3P71T 5DTQA 1NV9A 1NW8A 1P1CA 2PY6A 3BZBA 5DM4A 3GCZA
chains in the Genus database with same CATH superfamily
5DTEA 3I8SA 1OROA 1REQA 3KZKA 2E49A 1QIKA 3RRJA 3ET4A 2Y3IA 3GNTA 4YJ3F 4MV7A 4TVOA 1CFJA 3SNKA 3V4VB 5I4KA 1IZZA 3T7KA 3WI7A 3UJ9A 5H3CA 5GJBA 3ND5A 2GBFA 3F7NA 1YJ5A 3BH6A 4WCFA 1KJJA 3K2QA 1M8FA 5AI6A 1DGQA 1Z4OA 3PT9A 4C43A 5KQSA 4BVLA 2V59A 1ISPA 1R0XA 3AL2A 4RA9A 1XCPA 2XOKA 3U80A 4KAJA 3VTFA 4TTAA 1XRQA 4FOPA 4QSHA 2IEIA 2O9JA 4HH1A 5EG5A 4MCHA 4GW3A 4YRMA 1XUOA 2PT9A 2WM2A 2L17A 3DP7A 1GZ4A 3HSYA 3SIPA 2VH2A 2PHZA 1L4HA 3SP1A 3VDQA 1ISHA 4CZ2A 4DVGA 1KARA 5F7JA 5JCPA 2NZYA 4MP6A 2PZFA 4MEAA 1RC1A 1Z34A 5EWLA 3RARA 1SRRA 4PLYA 2VOEA 3RFTA 4B87A 1ETUA 1QFSA 3U9TA 5DIFA 3ZCXA 1CSEE 1T2NA 3E3NA 3Q5DA 4WDQA 1A2OA 2YFQA 2YH2A 3EZFA 2HQRA 4M9UA 5LKRA 1NF3A 3UGKA 2ESRA 4FOLA 4KMRA 4MA4A 2W98A 2PQ2A 1R4ZA 4GPIB 1L5FA 2BFOA 3MQ2A 5CFLA 3MCWA 3Q3VA 2BZGA 2QLBA 3ZQJA 1YNOA 2JH3A 3A6DA 5AUPB 2IW1A 4J9UE 4ARUA 5I6DA 5LBUA 2WT4A 5EFOA 4OJNA 1HBJA 4QGSA 5KWIA 3DOIA 1XAHA 2IP4A 3NP7A 4LRYA 3IUPA 2AEMA 3P0IA 3X3HA 4FFVA 2ZITA 3KB8A 4HTFB 2C0PA 2RMKA 3IS3A 1ZGAA 5DLPA 2UV8A 4HVTA 5DULA 4K81B 4JX9A 3UT0A 3TVTA 3HPQA 1DI0A 4H3VA 1S3SA 3DT9A 1GL9B 3E4CA 3OU6A 3QVJA 3TQTA 5JXWA 3T4EA 3BXGA 1HF0A 4NJEB 3B6ZA 3I73A 3OIFA 4LFAB 2H29A 3V7NA 2NXCA 1P33A 1Z0AA 3LAWA 1GZUA 2SBTA 3DP9A 3HV2A 1NBOA 3MN1A 4EX6A 4MV4A 3DEYX 1R37A 3R9WA 2HDWA 3T34A 1VHQA 2OSVA 4EG1A 4OU5A 4F72A 3G9ZA 2RFLA 2QJRA 3O7MA 3JQ8B 1YZFA 1IXKA 1GDTA 3DR3A 1L0BA 3IFSA 4AJIA 4L78A 5LDDC 3PG5A 3PEWA 5F51A 5SY4A 3V8NA 1U3CA 4Q4JA 2YV1A 2ZE5A 3DPUA 3M33A 4KJXA 4ZD6A 2ZTSA 3RFUA 5IJ9B 2HXYA 1LQ2A 2XIUA 5ALHA 5C18A 1MB2A 2BUBA 1GTG1 1DT5A 4MI3A 4TVKA 2VZ8A 4YP9A 2KSQA 2ZSIA 1QF7A 3DCJA 1NVMB 1AT1A 3FDZB 3CLUC 4RENA 4CTJA 3Q8XB 2PO7A 4Y8VA 3EW9A 5AXAA 1XFDA 4WIAA 5FJJA 3HDHA 1B15A 2BAGA 3IO5A 2Y1KA 1D4FA 1MC5A 5AKXA 4ZQBA 1P0QA 2BEVA 4LZAA 4CKBA 2O8FB 3B3GA 2BKVA 4KXLA 4NDAA 3FYTA 4QUJA 5IASA 2CLCX 1CQTA 2GNAA 1A50B 2Q4BA 4JOQA 2JCYA 2YXEA 4CKYA 3RJZA 3OY2A 1LVHA 2IYQA 5AM2A 3ZCVA 1Z35A 3MTBA 1T0UA 3STTA 6REQB 1V1RA 1YHYA 5COBA 1PV2A 3EWAA 3TNLA 3I9NA 4YI5A 2GDZA 1NN3A 2GQ0A 3BSWA 3PWKA 1XZAA 1X7WA 2AKEA 4Q15A 1AKUA 1EFVA 4NAVA 2UXBB 1LWNA 4O8BA 2JZOA 4RELA 2G7ZA 2XXBA 1PX0A 3HUDA 4H4DA 2X9QA 4WLEA 1B1AA 3RUCA 3SOPA 3LO5A 4IW3B 3T3GA 3TR0A 4WN9A 1LK5A 3WGGA 4AY3A 4CV0A 2GK4A 2D7DA 1KXJA 5A6SB 3DDZX 1XYVA 2QRMA 3VZDA 4NC9A 4MQEA 2DAPA 2QY6A 4H0NA 3SM9A 1PJLA 1J24A 4LJ5A 1KMMA 4M6WA 1Z2DA 5TR9A 4D9GA 2E5FA 4PQEA 2X1MA 4MQFB 2ZBUA 1FE8A 3OETA 1Q6YA 3D64A 2WSBA 3OC0A 2IZ0A 3WP0A 3UIEA 1OYOA 3L8HA 1LJ8A 3I23A 1RRPA 1ZGBA 4YRCA 2ZYAA 3E9DA 1BKYA 1MEJA 4IF4A 4B7CA 4CMEA 5KREA 4PLVA 2AWIA 5BQFA 1G7SA 4FNOA 2XD9A 2ALJA 2B4YA 1ZVMA 3GCWA 3SKVA 5IM4A 3BHNA 4FDUA 4X1IB 1B6TA 3F9RA 1ONOA 3GFPA 1O0SA 3E3MA 4DEVA 1GM5A 4JLVA 1K8ZB 4ALLA 2C3YA 2OCLA 4ZGGA 3FTFA 5EIHA 1XRRA 4K28A 3UV6A 3AZOA 1G98A 1XDSA 1T43A 1XZPA 2HHJA 4PONA 2GBPA 4MAAA 3TTYA 1GO2A 4RY2A 1CXZA 2QL7A 4PRZA 4DIDA 4BP9A 4DR5B 2J7UA 3JAWB 1NVVQ 4GAEA 3EVNA 4OYLA 1P1RA 5BNZA 1KSGA 2AVDA 1Y5IA 1CQPA 4F06A 2HHAA 1LSOA 2QTBA 4GLFA 3NR2A 4LWOA 3V7FA 5JZOA 1CNEA 5DX1A 4PANA 3ONWA 4IWYA 4ZT2A 4YRPA 4TTQA 2UZ4A 1W88B 3KSZO 1XV5A 3UQZA 5ALOA 1NT2A 1T1SA 1HEUA 1ZITA 4RHXA 3UMSA 1K7EB 2VT7A 2G9NA 3MIIA 1EEXB 2PUEA 4E15A 1H1LA 4CQMD 4AG5A 3KQYA 3GBPA 4ASUA 5ICMA 1DKOA 1JHXA 3I8OA 5AM1A 1GSOA 1WAMA 5WRFA 3NEJA 4NNOA 3MIZA 3ESXA 3OECA 1MC4A 5KSYA 2FMTA 2CF6A 1TC1A 2I6FA 3BH0A 4Y6LA 4NLLA 5GM1A 2C7RA 3LUKA 1S8NA 3WQRA 3QVGB 5B55A 4A82A 2HPZA 1J6UA 1CZLA 1L4YA 221PA 2BTOA 2RGYA 4PPFA 2GRAA 3GMDA 5TGTA 1SCQA 4W82A 4OHRA 4E3ZA 5CDGA 4BECA 3IIIA 3LXMA 5C81A 1Q0TA 4RD3A 1E1RD 2OKGA 1HDYA 2WTMA 4KLCA 4XZ3A 3U62A 3UMRA 4IQ0A 3TW8B 1CUGA 3BAFA 1EWYA 4TPKA 1XT6A 5ES3A 5K01A 3WGZA 3SLKA 3RJ9A 4CM4B 1CLEA 3OZVA 4DBZA 4TZTA 3NHRA 3AOEC 1PNOA 3K4PA 2N3ZA 3DLCA 1IN6A 1EJ2A 1Z6ZA 2P2CA 2PUVA 4MWTA 4Y6OA 2IS4A 4RF3A 1C7EA 3QX7A 4RZSA 2IL1A 3BMQB 3OO0A 3UWOA 1CQXA 2E2WA 4M36A 4JB8A 2W6ZA 2JEOA 4V1CI 1VLMA 4DNQA 1SB9A 5ALYA 5IAEA 1JA1A 1MTZA 1RC0A 3P9IA 1XTUA 4DLAA 4PPGA 4C5BA 5JH7B 1J70A 2OD9A 2ZIUB 3R4CA 1RMYA 2JKVA 4I8IA 4H77A 4UUNA 1DRVA 3P32A 2W93A 2Z56A 1SVOA 3A3OA 3HMQA 1NR5A 1VKJA 2R8XA 4LRXA 3ODPA 2PZGA 1KU6A 3FHLA 5AT1A 4BNNA 3TX2A 1KO7A 3N8DA 5BSVA 4YYZA 4JEHA 2WTAA 1PDVA 3RREA 4EEXA 1N3YA 2FPOA 2C5GA 1D1QA 4PFQA 3L0OA 5EP2A 1JR3E 2H9IA 4NPAA 5AM5A 3E23A 4GPD1 3VPBA 3B3FA 3WL3A 3FCEA 3AI7A 3FW1A 4RJJA 2IYPA 2GEUA 1U2EA 3JTMA 3ZVRA 3TVYA 4DJFC 4J75A 4EQZA 5DWDA 2C57A 2NWQA 2ZYVX 4Y0VA 4B40A 3T1NA 4NOJA 4LNAA 3KRTA 4RE6A 1PJ3A 5AWFC 2FR1A 3T0GA 4AZWA 5EGSA 5KMGA 4P83A 5KCMA 3M5WA 4LY6A 3RT7A 1XL1A 3CB4A 4G5FA 2JAQA 3I42A 5E95A 1RQGA 1H9BA 2A9QA 4JFAA 3CX3A 5HSGA 3WSTA 5TJ9A 4KP7A 2NUTB 4RZ3A 4W4TA 3PUWA 5D7BA 1EK5A 1PT7A 1RQPA 1HOXA 1PJ8A 2I6TA 3HXTA 4QUKA 5FTWA 4U2KA 3GGGA 1RQXA 3JZAA 1SHZA 4NBSA 5ILOA 1XO1A 2EWVA 3QIVA 4IFTA 1W73A 3OTQA 1AF7A 1EUQA 2PT5A 3NHYA 2EC5A 3C7TA 4WESA 3KT8A 2XODA 4DBLC 1OZAA 1S2NA 1QHSA 1VP9A 4JLUA 5EHIA 2ODQA 5IDQA 1X77A 3RYCB 2XKKA 2R7LA 2CUKA 4LGCA 3V5NA 3WWCA 4JC8A 1G4HA 2AN5A 2VZLA 4JHLA 4W8GA 4WBSA 1EUCB 5HE9A 3VM6A 1TA0A 2Q41A 2W4QA 5C7IO 1VECA 3GU3A 1TQ8A 1YRLA 2D2IA 2R1TA 4PZZA 1EXDA 3UPDA 3UXYA 4KTTE 3L7CA 1V3QE 4N01A 2KEKA 1MX9A 4PXSA 2EV9A 1M1YB 4R40A 2I2CA 1PL6A 2XITA 3SBOA 1Q0ZA 3D8HA 4YO7A 1J99A 2F48A 1ZZEA 2QAGB 3ZIUA 3OPVA 3FUVA 4NVRA 3T95A 2O06A 3LT5A 2YQZA 2ST1A 1RQ2A 2PIAA 5HYVA 4Q9KA 1MNQA 3AKCA 4WERA 1YZLA 5DHFA 5TT0A 5B30A 4JVNA 1CYEA 2H5JA 1P73A 4QQRA 3SG0A 3R6DA 2ZTVA 4Y0NA 1OJLA 5I7FA 2JGDA 3MHTA 4GX2A 2XSZA 4AWXA 1ZZ6A 1NT4A 3ECAA 3LX8A 4Z51A 4RTQA 2II6A 3RHSA 5KWSA 1GJRA 2C3PA 3KVOA 3I6IA 2LIPA 1XZIA 5G3YA 3MCTA 2FMXA 4QNMA 3IDQA 4TS9A 5HXAA 5JC1A 4LJ9A 2B35A 1R8XA 3GMSA 3SD7A 4KSCA 2IIPA 3P9ZA 4DCCA 3SQWA 2I2DA 1CF9A 2FMUA 1F17A 1MQAA 2I4OA 1W5SA 2J30A 2NPOA 2XKBA 4NMLA 5TPZA 4C2BA 2ZG6A 4N41A 1B0ZA 3DKIA 4D4GA 3FJYA 1Y89A 2EJWA 3KZVA 4GEKA 1PWZA 4J16C 3OWQA 2XUGA 3AF1A 4NE9A 4X20A 3WKAA 4HNTA 3I8XA 4UVIA 2ODBA 3OLXA 3SCHA 4Z4QA 4I0WB 2DPMA 3N76A 3U3JA 5BSEA 2I2AA 3NEAA 3D6FA 5FPHA 3I0MA 4ZOLB 2B36A 2E7ZA 4C7OA 3E2PA 3QUCA 1SCJA 4AKSA 2CNNA 3BD9A 4G0YA 1M1YE 5DHQA 4AY4A 4MB6A 1P7WA 4CNQA 1CEYA 2J07A 3D0QA 4Y2VA 3LQFA 2XYQA 3AEUB 1ZD3A 1Y9ZA 1GDDA 1I6LA 3VC1A 3IPLA 3W3AD 1SZJG 2NOAA 3GZNA 1KVSA 3PEEA 1FDWA 4RZUA 4CL2A 2A3NA 3FYUC 2YRXA 1A9TA 3PKIA 5LXTF 1KI7A 2CFRA 1LPNA 1PYDA 3RSZA 4B2LA 1LH0A 4NE7A 4YJ3B 3AUUA 2FE1A 2A6CA 1WV1A 3OZCA 1VRWA 4ZQCB 4X95A 3SVZA 1IOVA 1EK1A 2BFCB 4GM4A 1I4OA 4YIHA 3JXBC 3A1WA 1W30A 1VIMA 1KE2A 4DMKA 1S89A 3KKQA 2J3EA 3IOCA 5EP4A 5IAJA 2XB9A 2JLSA 2A1UA 3V2GA 2OFXA 3GRYA 3TPFA 2AOXA 3QBJA 5TGDA 4UFPA 1HQDA 2AK2A 3A70A 2BOVA 1ODLA 1ZNWA 5CTJA 1NEQA 3RS7A 1KOGA 4UNNA 1Q3HA 4P84A 1R8JA 3T7EA 4R1LA 3DM5A 3VZRA 1YS9A 4H31A 4KQWA 1UK9A 1EVZA 3M4ZA 5TV2A 1PYGA 5H68A 3NNSA 5HQJA 3G1WA 3O1LA 3PFFA 2JFGA 1HXHA 4BVGA 1C29B 3JAKB 4HLUC 2ZW9A 4PLHA 1E61A 1VLJA 1DP4A 2WTXA 1GCUA 3R7WA 2PYDA 4ZZ1A 1MAVA 3LY9A 2PXKA 1UJ4A 4P7JA 2VH5R 3Q1KA 2OB2A 5K2OA 3LGAA 1SCUB 1C9JA 5B1IA 3EC2A 3LXXA 5BUSA 3ESCA 1OLSA 3BWVA 1QZZA 1J2EA 1GFWA 1KPHA 4J6FA 3VV2A 4GFDA 3FTPA 3Q40A 1S2IA 3SY8A 3EIOA 2W90A 4L76A 2QBYB 3O95A 5EHNA 2WOJA 3QKRA 1K92A 2H5EA 3IAAA 4M1MA 2R6CA 1P75A 1U3VA 1S8OA 4QTXA 4AX8A 1FMJA 1NVBA 1EM6A 4QLOA 3EQ9A 3WYCA 3VU9A 1ESCA 2IHUA 1MT3A 2Y1DA 2XHZA 3NUZA 4U7GA 2ZS9A 1UZLA 3E9QA 3EWSA 1FUIA 2B1QA 2LTAA 2W6CX 5ICSA 4RNCA 4LPKA 5HFAA 3TRKA 3JYHA 2CVOA 4FXOA 4WY2A 3G0HA 3NUQA 4R81A 2ONJA 4EITA 2X0EA 1BQEA 1W2GA 3DB1A 3IHLA 2W6QA 1N9GA 5JLJA 4O4HA 4O4JF 2EKDA 4LSZA 1SO8A 5ALMA 2PGJA 3VOTA 4Z9BA 2G9ZA 2WIFA 5BOSA 2MQKA 3LU1A 3QX8A 5FX2A 4O02B 1T5HX 3CVJA 1Z5PA 2VCYA 3AUKA 4JLJA 4RV9A 2QT9A 1PSWA 1JG4A 3BSSA 4I5IA 3G6WA 4UTXA 1NVUQ 5MHTA 5AM3A 1XTPA 2LCIA 1JPNA 5JNSA 4MW9A 3B89A 4UM8B 2R6R1 4JEMA 4DLSA 3G5TA 1ZI6A 4ZHQF 3M70A 4AZTA 1UEXC 3NAGA 3AKEA 4LXIA 1BDJA 4PXAA 1T0HB 1XZQA 2YUTA 3A26A 2QK4A 3BE5A 5KNCH 2EIXA 3IEVA 4F46A 1FBNA 4M21A 4MEBA 3SHVA 4QBIA 1OTHA 1XEAA 4W99A 3VFDA 3ZHYA 2JBAA 1N3LA 4TVSA 1Y1RA 5LLTA 3FFTA 3VAZA 1XYYA 3QVMA 4UAVA 5CFNA 2DH6A 4X65B 4DV6B 1QGAA 1A5TA 1B3RA 2Y8EA 1E99A 3GJQA 2R1JL 1FFHA 3NIGB 4HAVA 4DY6A 5I7RA 1A72A 4I3GA 4E7PA 3X1KA 4ZTBA 5LMNB 4LI0A 3RLFA 1NUQA 4XDYA 2Y0BA 2A1TR 3ETGA 3G2MA 1U8UA 5IU6A 2Z4TA 3FCSB 2E9SA 2Q3FA 3CXRA 2VWPA 5AOBA 1JEQA 2RGBA 2P90A 3FJOA 3UTCA 1NC1A 2CV2A 3BZUA 1KK0A 5A3JA 1U0LA 4X71A 3G6KA 5KTYA 4EG8A 2XMZA 3MLEA 4L15A 1WMDA 2AVNA 2COKA 4HLDA 3WIBA 1ITZA 1QH8B 4G37A 4CMIA 3WBKA 1XRJA 1J97A 1F8XA 2QORA 2GN9A 3C4VA 1G0OA 3IKMB 4YWHA 4YCBA 4DDWA 8GPBA 4YDQA 1XDWA 3NM4A 5HIJA 3NJ8A 5G40A 4NYMR 2P8SA 4G65A 1NJ8A 3I9JA 3E82A 3NDRA 3U13A 1Z2OX 3QUQA 4R2KA 4G0VA 4I4CA 4LE1A 4KN9S 2RHBA 2VTDA 2ZSJA 5B4VA 1P72A 3RTGA 3SR0A 3SR4A 2Q3EA 2VYNA 4HGPA 3HFJA 1PW7A 5KOHA 4IKOA 1QCZA 2L42A 4WZ6A 5BUZA 2A94A 4W1SA 4AS1A 1FNCA 2HY7A 4MVCA 2PZMA 5IJ0B 2H1VA 2FYTA 4RXMA 2PKQO 3NEYA 3DXXA 1E6WA 1K6XA 1Z5UA 2W6IA 3V97A 1O95A 1N9KA 4LUCA 4NMWA 2LYLA 1Z0IA 4QUEA 2E85A 1TLFA 5JMPA 1MH1A 1XTIA 1OT5A 2IIQA 4AFNA 3HFGA 4D81A 4L4RA 4BEWA 4YUAA 1RRGA 2WEKA 2VLIA 3I1FA 4EMTA 4PM4A 5JEEA 4PU3C 2A5YB 1P5ZB 4YMSA 3OEYA 4E4YA 3LQXA 1UBUS 1D04A 2E4UA 3OZXA 1J21A 3JQ9C 4TWAA 1ADYA 3OE1A 4Q02A 5CVCA 1A4IA 5D3MA 5K99A 1Q7CA 3DLHA 3OEEA 4RULA 5D86A 2A14A 3AF0A 3SC2A 1NW4A 4F45A 1WZUA 2ZI9A 2JFVA 4I6RA 3F98A 1VBKA 2ZDQA 2X6QA 4ZAVA 4AU1A 1P2TA 3LO8A 4MIKA 1D9XA 3BJEA 3Q3CA 4EIWA 3UMBA 4P5PA 4RA6B 1MO5A 3KP1A 2CYAA 4H1VA 1NRXA 4H15A 1SURA 4ZI5A 2O0HA 2ZTUA 3MTDA 3OA2A 5J5AA 1YI8A 4AMBA 2F8TA 4G9GA 3BWCA 1KZ1A 3KT3A 2D1TA 4HEA6 3L40A 2F3QA 4KI7A 3FPEA 4G0PA 4EARA 5JE8A 3SE0A 3WZ2A 3IP8A 2EFHB 1RPAA 4P7FA 2YW9A 3CR7A 3QA3E 2MSEB 4NCBA 3LISA 1COWA 1HE8B 1LX6A 1U2DA 1ULAA 1USGA 4QBKA 4WK4B 3SYRA 3ISTA 1EWQA 4XYBA 4G56A 1C9DB 5KTKA 3ZY5A 5L8VA 1MOPA 2OYCA 4W9NA 1SVSA 4LBZA 5C5EA 1QNFA 2A33A 3FUWA 4NFHA 5E3IA 5T57A 5AJHA 2IYZA 5CG1A 3AKDA 2IHTA 1KH2A 3H5IA 1JIQA 3EZ9A 4RIFA 2NQ2C 2XUZA 4EG5A 4NQZA 2JCSA 5A4JA 3QITA 1UOEA 1II0A 2AZDA 5CJ2A 1XVIA 4RDHA 2C3OA 1U02A 5DLDA 1JR6A 4FS8A 5K3FA 3GEPA 2FZEA 2FW0A 4GT1A 2Z8XA 4XRRA 3FOEC 5FWDA 1YHZA 5CCXA 4RFSB 3FI9A 4W5WA 5F4BA 5J2TF 3UKJA 1DWOA 1DJMA 4NBNA 1BXRA 4E22A 2HA3A 1CCWA 4DLUA 5LP6A 3ERCA 5EE0A 4A2PA 2Q99A 1LSSA 1WUJS 2QQFA 1QG6A 3T3NA 3GYGA 2FUNB 3LECA 4REOA 1H2AS 3QHAA 1QH9A 5ALWA 2Q3BA 1SPBS 4BGUA 4G5QA 2GLXA 3AR8A 3LQ4A 4KPUA 5EINA 4MYUA 3T5AA 1O77A 1XF9A 1WB6A 2IPOA 5IFKA 2VWGA 4FHDA 3OBIA 2D54A 4ITUA 3Q0EA 1V95A 1X92A 1N5JA 1EJBA 2MWMA 2EKZA 3EFBA 4INOA 4LRUA 4YJDA 4D9KA 821PA 5K0EA 4H7EA 1WO8A 3OFSA 2PANA 2WIDA 3DBVO 4L0CA 2GEVA 4J90A 1NVFA 3KLNA 4Z99A 5DFAA 3X1MA 1H3FA 3O7WA 2OYRA 1SEPA 3Q72A 5DH9A 2ZUVA 4G0QA 4PHHA 1XBTA 3TZKA 3ZU2A 4CM8A 1UDWA 1P7ZA 3PLNA 1A98A 1HQYE 4D92A 4B6GA 1P2UA 1R6UA 2PH3A 4QUBA 1EX7A 3ONNA 1SNYA 5CP8A 3CLTC 1HDGO 4YBRA 2NSHA 2GZHA 1T36A 4YRIA 5ICFA 4R9UC 1OAAA 5TF0A 4LJLA 2NT4A 4TYYA 2QRUA 3Q7EA 3WB0A 1DKMA 2AIRA 1GT91 1SXPA 3BVPA 3NLLA 4KO1S 4BL5A 1ZW6A 2HMUA 3GRKA 4CKCB 5KX5F 3L1HA 5BWBA 1TM5E 4NBRA 2A5FA 3WZLA 4FGJA 1RPEL 3OOWA 4YG1A 2I7VA 3CUUA 2BFWA 2NVOA 3A4IA 4A2WA 4ASUD 2XQGA 2GAOA 3KJEA 3LUHA 4KQGA 3LDFA 4NFSA 1R0KA 3A4MA 3AWDA 3QXCA 1PO7A 5DM0A 3TINA 5A2GA 3HEAA 4HSGA 1W36D 1XAJA 2VQFB 4GC9A 3WYEA 3C3MA 1F2UA 3GRAA 2A59A 4J0IA 1CQIA 1YSCA 3EQZA 3LYLA 5EZYB 1WKVA 1OUMA 4KB5A 5KTNA 1A5BB 2JARA 3SHQA 5FO0A 4O4LA 1J00A 4HHEA 2PV0A 2A6PA 3HVHA 4I1OA 4JJ4A 2XYPA 3E5HA 3EIQA 3V4LA 2NTJA 3I5MA 4Q7KA 1T0IA 1S1CA 1XF1A 4PC7A 4S1OA 3AY0A 4OCZA 3PC6A 2X76A 1RYMA 5AJXA 3RFVA 2H0RA 5DGDA 3VR3D 1NRIA 1JJIA 2Z83A 1ZFNA 1AM4D 5DX8A 3PXUA 4P4GA 1V3VA 2RHRA 1DKUA 1JHVA 2R4TA 3AIMA 2UVPB 1LJLA 3HRKA 2EJUA 4FQ7A 1T3TA 3ZWWA 4DXHA 4EJSA 4E32A 5KKAA 1FEZA 1I2BA 2R62A 1JUDA 3KEMA 5JRZA 4FHEA 2D1QA 3WMXA 1UBOS 1PV4A 3L0PA 4LHSA 4FYXA 5TDHA 3D4OA 4Y1RB 3PVZA 3IAEA 2UKDA 1PT9A 2AUTA 2JATA 1IDN1 4LRWA 2ZQYA 1DIGA 4Z0TA 2PZEA 3RVKA 2CFIA 4YYEA 4LF7B 1ULHA 4C29A 1ZPDA 2BFBA 4HAIA 4TYMA 3QUTA 2M1XA 3AR4A 1HFWA 4GECA 5F1KA 4X45A 4TKVB 2H1FA 3NTVA 4HADA 4OATA 5F9FA 1AZTA 1IWBB 1LRKA 2A9JA 3LW8A 4H17A 5FP0A 1YVPA 2QRKA 3D0RA 3NHLA 3RRZA 1E8MA 4RH0A 2AJTA 1GZ6A 3UPTA 1H4TA 1J1ZA 2RCNA 2V96A 5FTLA 2VTKA 2PWAA 3PHLA 2HUNA 3Q6MA 2YWBA 4GBMA 2KX7A 1AXEA 3NBZC 4M1KA 4DNFA 1E77A 1B26A 1DHRA 4QFCA 2XADA 4CG3A 3CVWA 4UEWA 1NR7A 2ZCVA 3C8HA 2HJ9A 5BSTA 3HRHA 1WR8A 2Q5QA 2JLXA 5KHOC 3QNMA 1MJHA 3D7RA 4PIPA 3UHAA 4BMDA 1J25A 4YT8A 5C46F 2E4WA 2G80A 4M7OA 3U61B 1RKUA 2C7BA 4XAQA 3T5TA 2Q1SA 3RAPR 1CLUA 5JSFA 4M86A 3OQ1A 2C9BA 4OI1A 4Z3KA 4G4GA 3VH3A 4HDRB 2R6GA 2YIJA 3HBNA 1CIPA 2Q7OE 3DZKA 2ID7A 5GWXA 5I8ZA 2J3KA 2OWDA 2EJTA 2P11A 1UDXA 1DAOA 3WWDA 1RM3A 4YHBA 2TRSB 4YC7A 4Q19A 2A1TS 1W7AA 2JJ8A 1KH3A 3C45A 2R47A 1LK7A 3K35A 1R0RE 3MGGA 3C41J 3UUEA 2VK2A 2IGTA 5LXTB 1ZNXA 4U4AA 4X4BA 4BN4A 4Q4LA 4OQMA 3T1OA 1QRSA 5KTTA 3QI2A 4WZBB 2FPXA 4AS3A 2JDID 1G5PA 2VVTA 1PF7E 1QFYA 4KQ1A 1FTGA 3JARB 1P77A 4G0ZA 1BMQA 2LYQA 1YIDA 3CVVA 2NVUA 1KWGA 2PS0A 4HEHA 2KM1A 5KTRA 1UZAA 3GFQA 4AMYA 1H66A 4DGQA 1FVFA 1JEEA 4E94A 3QH4A 1H94A 5DBOA 2PM8A 2BGNA 1G4AE 4PG5A 4C0HA 1IEWA 1U0NA 2QNIA 2YJGA 1SUBA 4MVJA 4EVSA 2JJYA 2DP4E 2HQOA 2WHPA 2C29D 2NP6A 1JFVA 2OZLB 3TUIC 5JYBA 1DLIA 1QGUB 4BX3A 3A05A 1RXUA 3A8TA 4PYMA 4P4SA 4D44A 3E0XA 1YMVA 1U9IA 5AHWA 5B1HA 2GILA 4UM9D 3KSMA 1X80A 1ST3A 3KHTA 4N5NA 2IVQA 3PJFA 3WDKA 3PICA 1J49A 3IPCA 2NSLA 3WY9A 3AERA 4KXUA 3K5HA 4FOOA 2XSZD 5ARDA 1O58A 1Q84A 1KAHA 1V1MA 4J76A 1K88A 2AG0A 1YZHA 1II8A 2HRRA 3BIJA 3ULKA 3KR0A 1OD6A 2HRCA 5E7QA 3EF1A 1EFTA 3HEMA 3PIRA 3HB4X 4KJZA 1UP4A 5K51A 4X66B 1I0LA 1G9SA 2FW7A 3QSGA 1MRSA 3UCXA 1JNXX 4ND4A 5TPZD 4RKQA 4K6CA 4UDNA 4K2AA 3U31A 2F7SA 1WSAA 3NC4A 1RXEA 4C3VA 4A5SA 3HKBA 1QGDA 1VL2A 2P9JA 3DFZA 4L8WB 2CF5A 1X7ZA 5B1YA 1GLNA 5JAHA 3DYIA 1A7UA 2YN0A 3EWNA 2QP4A 3CRQA 1U0BB 1XZEA 1U2GC 1D7AA 3KKNA 2O8CB 2RGDA 4JLBA 4Q7EA 3UK0A 1JQJC 1S2LA 2DUNA 3K8QA 5JROA 4TTIA 1I1HA 1GR1A 5CX1A 1B8NA 2J3QA 2JI8A 3B51X 1EVQA 4IGIA 1RSZA 1YC5A 3MRSA 1IZYA 1GPNA 4K03A 5EI5A 1KEEA 4TT3A 4BKUA 3F5FA 2X0JA 4IJ6A 4YJFB 3AUSA 2D5VA 1FQJA 4MPTA 4OKIA 4J1WA 2ZBRA 3H0EA 3WLHA 3D3EA 5AK3A 3TH5A 5F9MA 3C3YA 2J4CA 1NDQA 3RC7A 3KQKA 1WY5A 1T9ZA 3G5UA 2OBBA 4I7EA 3ACBA 3STYA 4N3NA 4ZHQB 3WK9A 2NZJA 4IMPA 1EWRA 1I6MA 4DFDA 5MGBA 2PUFA 1YS2X 2I76A 3M3DA 1JH8A 4ZOAA 2PWYA 3LCRA 2PXCA 2FUEA 4G8DA 1XDUA 4WE3A 2JIQA 1HZZA 2NX2A 2QUIA 3ZJ4A 1NURA 2FQWA 4LCEA 2DR3A 1KDVA 2HCNA 3ZVKA 3CR3C 1Y81A 1WPGA 3F8WA 3VYWA 5CCEA 4B3JA 4QDJA 5C8XA 1Y8AA 3P9KA 4HTFA 5FPYA 2VJCA 3GVIA 1GRNA 1Y1PA 2ZUSA 1SVKA 4OB7A 3W1VA 1TGVA 5FBVB 5D5QA 1UZUA 3MRTA 4DLBA 3AX6A 3S8QA 4FFLA 3ZQ6A 4YMIA 2O20A 1RQNA 4AWAA 4I5GA 1YKGA 4YDSA 1PQYA 4NJEA 4YJKA 7MDHA 1PR0A 3IOMA 1I10A 3VDNB 3W5BA 1WDKA 4BZPA 4JITA 3M6XA 2I2FA 3IXLA 3HU2A 5K0LA 4PQGA 5EEGA 3C4QA 3PYXA 4ID9A 1G291 5H82A 2IYNA 2AW3A 5SICE 3TTSA 2P5TB 2OV4A 2XQIA 4CQJA 4TL9A 2OM2A 1F5NA 1PJCA 1BVUA 2BKAA 2C4KA 2GNPA 3OPQA 1L5GB 4AKIA 2JQEA 1NJ1A 4PYLA 2G77B 1ZJ4A 3DOJA 3RUHA 1CJKC 2CEAA 2ISSD 4XSVA 3FZYA 3T99A 4Q7LA 4JL6A 1ICIA 2D5IA 3H13A 1L5HB 2ZSBA 3UFBA 1ZH2A 4B81A 4A73A 2UXCB 5C8YB 3NTXA 3WGQA 2ORWA 5HK9A 1BGWA 1UXGA 5IJ9A 2YV3A 3BWBA 1KOJA 5C1OA 2P35A 2N0SA 3DXYA 4TTVA 4M8KA 1FNSA 1SVNA 3LBFA 2FFQA 4U7TB 3A9SA 3Q41A 1N0WA 4WQMA 3GWZA 3ND7A 2CLSA 4MW2A 2QYSA 1T6ZA 3UAOA 3A36A 3INNA 4BUCA 2FY8A 2Q2OA 5IRCD 4IL5A 2GZDA 4KGDA 4EP1A 1NPDA 3KJIA 1TGYA 2O8FA 1CR2A 1FXSA 1NMEA 4I1YA 5D5HA 5EHGA 2PXEA 1E5VA 1V9CA 1YAHA 3P5SA 2IVZA 4N6NA 2R6HA 3SQDA 1K0FA 4L7VA 2BGLA 2EVWX 5J47A 2FI1A 1N6NA 2FPMA 2GCNA 1NQXA 2IC5A 5I8PA 4YV2A 3K9WA 4DR7B 1W46A 1AX9A 1EB9A 1Z38A 3AHEA 3E7DA 3ORSA 1FDIA 1Z07A 3M0EA 4D4IA 4BCBA 4ZGWA 2EQBA 3L3BA 1Q1AA 2J4DA 2CDRA 1EIZA 3NNDA 3AU9A 3GNSA 4UCFA 3PDUA 3T5MA 4BVEA 5AKEA 2HCRA 2XZOA 5C5IA 2Z2KA 3QW2A 5EVJA 4YR9A 3CG4A 2XT9A 3WGVA 4WBNF 4JOBA 3COZA 1UWVA 1PNTA 5BNIA 1SBZA 3GT3A 5E2AA 2BP7A 2RH9B 2ECPA 1TVCA 1PERL 2FN9A 3MWDB 4OQNA 1NKVA 1UT5A 2ET6A 3LDAA 4MQFA 4YALA 2FFRA 5FFNA 4OKNA 1CETA 3N8HA 1QVAA 5KAPA 5IS2A 5JNLA 1E2GA 4YAFA 1IAVA 1XRLA 1KZHA 1GYQA 3W9SA 2EGHA 5F1OA 4XOIA 1N32B 1KK3A 1PX2A 4MUKA 3A2LA 1GPWB 1P80A 3ZU3A 5BN3A 4IMRA 4MKHA 3SVTA 1GRQA 2ZLBA 3KX2A 3WL8A 3KTAB 3O3CA 2PZLA 1Z6TA 2QG9A 5ALZA 1LPOA 1DEKA 4POOA 3PWTA 3CLVA 2V7QA 3HBFA 2QRQA 2WSSA 3VSAA 4JYCA 4OA8A 4D6YA 4F0JA 1HX7A 1H42A 4X1IA 2ZWIA 3PPIA 4ZYXA 3ABSB 1NDUA 4PU8A 4B7AA 1HL3A 5AI5A 3KKZA 3P9NA 1JDBC 4EMSA 3LCMA 1JT9A 4D2IA 2VYND 2DPYA 1Y6JA 4FN4A 5JG7A 3OLQA 3DULA 3VAAA 2QLMA 5M34A 4BY9E 4CIWA 4XARA 4HDAA 2AFRA 5FNVB 1RQLA 1U2ZA 1LI4A 3PPYA 2WZQA 5AQ1A 1NTOA 3JAWA 1NLZA 4RMJA 3ESDA 5GZ3A 4J0DA 3IAM6 1ZM9A 4JT8A 1N6OA 1WXWA 2FFAA 2J4FA 2B1GA 4FYVA 4J3JA 3AFOA 4NCNA 4NRDA 3TB4A 3WMGA 4ZJUA 1JEYB 3DMDA 2R1VA 2IYSA 2W6ID 3U3OA 1O95D 3REFA 1T1JA 4MWDA 1Q77A 3OIYA 1XTTA 4FONA 1BXZA 4P35A 2B8WA 1RLMA 4KW7A 4M3NA 3T1HB 2A5GA 1BJKA 1WY7A 1HY3A 2C77A 3B13B 3IMGA 3R7SA 3NC1C 1MGPA 2ZJ8A 4FYPA 3I1YA 5LDGA 3COPA 5ELLA 1PRUA 1V8FA 3FSEA 1W8DA 4RMNA 4AUNA 3DE1X 2HRDA 2QTCA 1C4KA 2GFHA 4G5HA 3EXHB 1QWOA 5D8DA 1U0OC 2HCFA 5K6AC 1X15A 5ALDA 1OI7A 1F2TB 3OEED 2FPWA 3RSLA 1YUBA 1OC2A 4HXEB 3WGTA 3HVRA 3K32A 4ZK6A 2ZIGA 3CF4A 4CV1A 1ZL0A 2GRLA 2IXDA 3OE5A 3QVGA 3I2KA 5ALKA 5JZVA 1SOAA 3DZGA 1R16A 3KYDB 3SZRA 1TXGA 2QLLA 3V8BA 1TJYA 2YNMD 2GLTA 1FLDA 5SY6A 3T94A 2QW0X 3BL8A 3JW8A 4P3XA 5DP1A 5FL3A 5A04A 3FLAA 2RJOA 2OLKA 3TW8A 4PIMA 1I9GA 1DAMA 4L4XA 2IITA 4ALIA 5HZMA 5TMDA 5KX5B 3NWBA 2FPIB 4CM4A 1K8XB 2FX2A 3HA5A 4Q9HA 4E51A 1F4PA 4TS1A 2NV0A 3SM3A 3LUBA 2IHNA 3COWA 4D6PA 3RNLA 1RCFA 3DEKA 1IHOA 4AJKA 3BMQA 1D2AA 3EC1A 3OT5A 3OPMA 1CKEA 3ZLBA 4R1MA 2F8SA 3TUJC 1PEAA 1XN4A 2CLIB 1SIUA 4GUDA 2Y1XA 4TGLA 5JH7A 1HG1A 1LVGA 4OLAA 4QOHA 2QUBA 5LMZA 1I2DA 1ZU4A 1HYGA 3RC1A 1U7WA 3KOXA 4IDAA 4YJ2A 1PHPA 4DT1A 4C6HA 5EIXA 1Q1EA 2ACKA 2C5LA 2L49A 1PGNA 2CMDA 5AKZA 1Y1QA 3OTIA 1EBFA 4KNYA 3CLHA 4GP7A 2ZBQA 4MGEA 1ZVQA 1B74A 2Q5FA 3PL1A 4R8LA 1MB4A 1CUHA 1HRDA 3H2JA 4GSYA 3KSUA 4D41A 4M0FA 1AQNA 3HO6A 3EPRA 4JBIA 1G8PA 1I24A 4Y0AA 1VPLA 5FT9A 5A5FA 2MIIA 3AVYA 4UXIA 3WRXA 1JFFA 1E0KA 2H8GA 2JBHA 4D0LB 3V3KA 4FWBA 4HL6A 1XMSA 3TLJA 4EMUA 3PQFA 4EO9A 6Q21A 2FN3A 3OZWA 2OG1A 3DWIA 3EEOA 2FDXA 5AJZA 3C7DB 5COQA 1AZSC 1P0PA 2PG3A 1L5YA 3F7MA 1SOUA 2C9MA 1WEKA 2FQXA 4OQ4A 2YZ2A 3B36A 3Q3JB 4DM7A 4D25A 4L4UA 1LPAB 2B5WA 1J2TA 4WACA 3SBEA 3NHMA 3MAJA 4CLOB 2G4LA 1YE8A 3Q7SA 1V7PC 3P1JA 2QRLA 3Q9NA 4X6LA 4N1AA 4WKBA 5G0UA 2OCIA 3R0IA 4L5JA 2QN2A 2YIVX 3NG1A 3VH1A 2WM9B 1JDJA 2YV2A 1KY3A 2XCUA 4NFYA 2WHRA 4Y7DA 2ZGVA 5TIIA 4NNJA 1YO6A 5A0VA 1YL5A 3O9XA 1RM4A 4DC9A 5CXUA 3A1SA 3OFNA 4CDRA 1ODTC 2IXEA 3E5MA 4R41A 3ZUGA 1UF9A 3KFLA 4NDNE 4Z4GA 3GT7A 1YU6A 4YRAA 3H6KA 1EUCA 2VI5A 3BXEA 3ZGOA 2QSUA 4QXAA 4FYJA 7AT1A 4D8VA 3K6SB 4V2IA 3JD1A 1ZH0A 4DDMA 2V7XA 2RHMA 1NPYA 5CEEA 3HB5X 1DTEA 2PQ0A 4J1SA 4OMDA 2GD2A 2H92A 4KXYA 4HBZA 3JVUA 1NN1A 5E6RB 1SC6A 1DRWA 1RWKA 4FNGA 2NG1A 2BZ0A 1AQLA 2ETXA 2EFYA 4CF4A 1T6NA 3MT7A 3RK4A 4MCAA 3FRIA 3UBTA 3OQMA 2QAGA 4YCAA 1ZD2P 5AJWA 4Y2JA 4DAOA 4F8YA 3CEMA 3VDMA 3OH8A 2Q4EA 3MJRA 1CZRA 5I3CA 5KQGA 1HR0B 4WJZA 1GNQA 4ZU1X 3IV9A 4W6ZA 1UQRA 1Y5NA 3FOFC 3A6LA 3GLGE 1ZIOA 3AH8A 4JIGA 4Y1FA 3VWSA 3UV7A 3FDFA 5DASA 5JJCA 5B3AA 1BGVA 3SXUB 4OBWA 1Z82A 1RJ9B 4NOMA 2ODNA 2DKFA 4OXNA 3ZGZA 5JSHA 3CLSC 4FEAA 3ZJ5A 2PDAA 3KO8A 1LDMA 3W6PA 4TMYA 3PGVA 3EXG2 5IDVA 4EYOA 2VDUE 4CR8A 1PZMA 2QUZA 2RH8A 4NJMA 2WWRA 4KE9A 4OQDA 2WJJA 1A76A 1L7RA 4X6XA 5LUAA 3Q8MA 5INTA 2H3EA 4EY8A 1UEJA 1PAUA 2O50A 1VPVA 1A8PA 1QC5B 3LYUA 4NV0A 3PQ3A 3ZU4A 2WKWA 3RH0A 2VOJA 4P5DA 3EUFA 4AKEA 4F7WA 4Z3DA 4ARZA 5I3ZA 1KXZA 2Z95A 3DKKA 1J7KA 4QGHA 4A10A 1SCKA 2W2NA 1KVUA 3M2TA 5FBKA 3GGSA 2HK8A 1Y3IA 1D0SA 3FF1A 2IVBA 1Z7WA 1HSZA 1RACA 2IW3A 2QM0A 2X6RA 4MTCA 4FFBB 2AFIB 1R5OA 4ZOLA 3RQIA 3R9KA 4BV2A 3H86A 4H6WA 3AMVA 1JBEA 1ZK3A 1B0PA 2CXOA 5I9TA 2FWRA 2FZGA 1QHGA 3D5EA 3F9CA 4PAWA 2ZI4A 1M6YA 3PUVA 2B4QA 2PUAA 2GEDA 2I4RA 3EF3A 3AEUA 4MDHA 4ZYTA 1E9VA 1YQEA 2RHTA 3KOOA 4ZCIA 1FJ2A 3GGOA 3KL4A 4OHVA 3VOBA 4UUQA 5K0FA 4A0QA 2P9TA 3M6FA 4XFJA 4JMLA 4B74A 1KDYA 4EJFA 2CLLB 3NH9A 1I7SB 4HV4A 2I91A 2IUEA 1E64A 4EI2A 4YJ3A 3ZD7A 1FJGB 3VNUA 4LTMA 3DTVB 1YUMA 2PH1A 1GTSA 2J5QA 1S2MA 1OWNA 4FGZA 1Z33A 5EUCA 5CFMA 1PW5A 1SG0A 2BFCA 2VJKA 3OUTA 4E5NA 3W4IA 2QRGA 2VRBA 3LDGA 4NENA 3JYLA 4DBLE 2EYQA 2F00A 1O87A 4FGUA 2NU9A 3FZQA 1OBOA 4H1TA 4K9PA 4XTCS 5JSUA 1O03A 3DWFA 2M6LA 2EKPA 3GRCA 3ML1A 3JXDL 4KV7A 4GVPA 5EJ6A 4WVLA 1R9MA 3RZZA 3G3EA 2JLYA 1UJ6A 1DKQA 1J9EA 3NTUA 5J5CA 2Q3CA 1AKEA 2ZXFA 4LZJA 4TV8A 4UM7A 5DMXA 3ZHCA 4DANA 4RSHA 4FP9A 4ZAYA 2ZCJA 1XC7A 4OY3A 1XKXA 1NKSA 1Z8NA 1SJ9A 4S12A 3WYNA 1KZ6A 4UC0A 1ZEMA 4UBIA 1BN6A 2WD7A 1PEDA 3VNRA 1L4UA 3ZLTA 1YXMA 2QSZA 5E4JA 2VHTA 3GJ0A 3QBDA 5AJTA 1SZCA 3JAKA 2AFIE 5EQTA 3CKYA 5FHRA 1UR5A 4XPIB 3KJHA 2A9KA 5HK8A 1YRAA 5GJWC 3ZDBA 5CIQA 1KDPA 3GUVA 5DBGA 1SWWA 1TD9A 5B7NA 1IOWA 1IOZA 2R5NA 2W71A 3A3KA 1ZUNA 3U6KA 1E2DA 4LF6B 1KU0A 3UA3A 1G8HA 4FDLA 4BB6A 5JS1A 1F1BA 1VHDA 2VJPA 1N5RA 3IVPA 1R8SA 1E2EA 1K4MA 4LYHA 1KQGA 1U3FA 5EHQA 4RMHA 3TBFA 1C3JA 2B1JA 4RQAA 1NNUA 3TCKA 4LHWA 1XP5A 3E0QA 3T8YA 1RE0A 1G60A 3TLBA 2GSDA 2X0NA 5IJXA 3ZHTA 4GMHA 4WLNA 4DMMA 1J20A 1KERA 4Z9FA 4I3FA 3KPWA 2AN1A 1N1EA 3S5UA 4AF7A 4ZCRA 3RC8A 3ONDA 2V8BA 4GPBA 1NXQA 1EP3B 4IOMA 5FV4A 1U81A 2FWIA 2P9FA 2WAXA 2FR8A 2BBWA 3ZNQA 4M38A 4DZRA 2G0AA 3ICWA 3HPRA 5BSHA 2D5BA 1C3OB 2IE0A 3G68A 3GRPA 3GUCA 1JPUA 3WYFA 4ZAFA 4MV8A 3PFWO 4NATA 1SU4A 3KE9A 4YP7A 1N7JA 3ZTYA 2EWTA 2G71A 2OORA 3K9BA 5F12A 3ZGXA 1Z29A 4DW8A 4YRGA 1KYTA 1U80A 3L6RA 4IVRA 3ZY4A 3EQ8A 3GJTA 2OY0A 4D98A 1W4BA 1TDJA 5KOJA 4CQLB 1X2EA 4K6KA 1BHQ1 3OFKA 3IVMA 4GXTA 1C8KA 1FUYB 1SULA 5M5BA 2ASVA 1MUUA 3HI6A 5IBPA 3MLFA 2XH8A 1ISMA 4X7BA 3VUEA 1EJ0A 4PWYA 3DVLA 1HWYA 2YVUA 4GZ6A 2E6UX 4OG2A 3A0RB 3SX4A 4ETNA 1HT0A 3HYCA 2A0UA 3I12A 2PNFA 4IZOA 5CDHA 3MINA 4X97A 3P9SA 4ND8B 4RESA 4BX2A 4TT3D 1A3CA 2FZVA 2CL7X 1ODFA 4GQMA 3G17A 1TPYA 4BASA 2I8LA 3AR5A 1UTXA 1E89A 2FZCA 4P3YA 4BU1A 4C6TB 2BF4A 3IQFA 2APJA 4PNHA 5I9MA 1RKVA 4WN3A 2Z0MA 2LVBA 3QXJA 4WW0A 1W6UA 1L7BA 2AZMA 2AJBA 3HJTA 4FEYA 2AUWA 5EEHA 1KC3A 3RBVA 2QT0A 1GUAA 1N75A 1QOZA 1DQNA 2F90A 3PSHA 1XR3A 1TF5A 5LPNA 1MEEA 1XAIA 1EAYA 2E48A 4YACA 2QLFA 4BJ1A 1ORDA 2CNLA 4MK4A 1PD0A 1Y4SA 2WNSA 4J1NA 1MG5A 2EJCA 4IPTA 1GSHA 1LCIA 2D5LA 5KQMA 2HDOA 1ZLYA 4XTRA 2NNWB 4WBNB 3HJRA 1VXOA 1Z0UA 3TLYA 1CUIA 5C4MA 1U0FA 1XN1A 2DZDA 4JQSA 2R8RA 4IMJB 5KTMA 5LQDA 1GL7A 2W4MA 4JL5A 1HDRA 1G5FA 1PGJA 1LU9A 1PG0A 2BJWA 3HNPA 4QO8A 5D5PA 4C3UA 2ONZA 3I04M 4G5GA 4HNSA 4KVAA 4LYGA 3SYLA 2R87A 3TD6A 5JXIA 2WMDA 3K5PA 3MF4A 4CF7A 5GIOE 4HDCA 3F47A 2R65A 2J0QA 3W6OA 3VKGA 5C1PA 1HEYA 4QXMA 4RABA 1M7HA 3I2GA 3D2LA 3SICE 1K6MA 2QTMA 4MYSA 2H9AA 3TXXA 1QIMA 1L4BA 2QF7A 2CYCA 2R86A 4R2HA 4X8HA 4NI5A 2IEDA 2YXPX 2DR2A 2GCOB 2H1RA 3O3OB 4RK7A 4PZ0A 4TMWA 3RJMA 2XDQB 4DDKA 3OM0A 2PCLA 4RHYA 5HRAA 4HEA1 4O4IF 3HL0A 4EUSA 5ENVA 1Z5OA 2VDJA 1JG3A 3MMSA 1MO2A 4MR8A 4XA8A 1Y1SA 1VBNA 4UHCA 3U4MA 4LVOA 2OAGA 2Y27A 3TDNA 5EE9A 2GCPA 4BU0A 3HXMA 4YH1A 1ZG3A 2YC4C 1M2OB 1VG8A 1R0LA 1AE1A 3X43A 4ABTA 1CY6A 3E4DA 3HH8A 1LDNA 2H5IA 4QL3A 5CAEB 2Q2WA 1I3CA 2VNJA 2CV0A 4A8JA 2VK1A 2P1RA 2YVAA 1CS0B 1W4ZA 5FOVA 4FMDF 4JBHA 2YIMA 4FK8A 4ZV9A 4RA6A 4ZOEA 1CY0A 2O4UX 3ENVA 4F5WA 1L3CA 3LWBA 3EISA 4KQ6A 4PGGA 2JH8A 1R15A 3RGWS 1ZESA 3FCXA 1FMCA 4POAA 5FV7A 4ZJYA 2JB9A 2KLHA 3E9NA 5JCJD 1HEIA 4KVFA 5JNVA 3LH5A 1C41A 4DL9A 1BXGA 4MVJI 4GKBA 5ESXA 3RTCA 4I8TA 4AICA 1YWGO 3CUYA 1FP2A 4UHEA 1NI5A 4LE2A 4MWZA 1J7JA 2IZ6A 4C9BA 4K3VA 1KI1A 2P7IA 4IX1A 3WGJA 4DLYA 5HHTA 4FZVA 3FR8A 3CC8A 3LV8A 1ZGHA 3B3JA 1BC5A 3M4NA 3GFVA 3KS9A 3PU6A 4O8ZA 4LXHA 4QTUB 4WT7A 3S5JA 2IBTA 1E4OA 4HTAA 1ULUA 1KO4A 3UOGA 4ENPA 1X2LA 1Q15A 3QWBA 3M1AA 3QBTA 4FEGA 3V6LA 1Z7EA 3DDSA 1TJPB 3HHPA 3K15A 2BJVA 1YS7A 4Z0NA 1D7OA 4MWGA 1UOPA 1H8HA 1U1IA 4FC7A 3ANYB 1U3DA 4TSFA 2AUMA 3MMPA 4F2WA 1JKJB 4IG4A 4JJ8A 4J7AA 4I2VA 4IX9A 3TEJA 3TSCA 4E08A 3FPAA 4ZT7A 2FJPA 2X77A 3WLFA 4XWOA 4MVJH 2XNCA 1A5AB 3IDFA 4BYGA 3E70C 3MTGA 3B9RA 3B2QA 3S2UA 5E4TA 2X3YA 1TD1A 2W7TA 3E18A 3PXEA 5G0SA 2V7QD 2FQQA 2DWQA 2WSSD 1X1CA 1E6UA 3HUFA 4MWEA 3OO1A 4A15A 10MHA 4IVPA 5HF6A 3UMYA 4HUTA 2J9YB 4U2FA 1UADA 2Z30A 4Q3LA 3JALA 2B37A 2WF5A 5T4FA 4KE6A 1T9CA 1VE9A 2GBCA 3C2QA 3DE4X 4YK7A 1P7VA 5KTOA 3QY0A 2P4QA 1P4RA 1ZI8A 4M1ZA 4N0QA 1ENYA 3RANA 5IBQA 3VUFA 4A92A 2XUJA 4HQKA 1ZOOA 3AVWA 2ANBA 2A9OA 2F4NA 4HC4A 2FAXA 3D8TA 2AMLA 4BQPA 1YQ9A 2BY4A 4IDDA 2C4MA 3OMWA 4LCBA 4R2IA 3UM9A 4PZ9A 1UBGA 4XWYA 4MKZA 5AW8A 1G8YA 4U6QA 4XLZA 5KYXA 5JJIA 2CXSA 1GYPA 2ZSDA 2GZMA 4MGIR 5ALNA 2QYTA 1DBIA 2FZKA 3BGVA 5CRIA 2Q1WA 2PS9A 2VYVA 1GNTA 1JTFA 4BO1A 5ED4A 2P2GA 2P41A 1N6PA 3C3XA 5I9BA 4BNXA 4YLYA 3OCCA 3DZCA 3OY7A 2FEWB 3L01A 3RTAA 1AHPA 1SGWA 1IWOA 3Q9UA 4NZYA 1G6OA 1MOSA 2GFIA 1T9BA 1YOBA 4AKGA 3K9LA 1TADA 3TOSA 5CGQB 2E5WA 2CVHA 1XJ0A 2G82A 4E6EA 4JT4A 2XA1A 3R41A 1ZSNA 1IULA 1FRZA 2IQIA 2RAPA 2SCUA 3ES9A 1GPAA 4HH0A 3PFKA 4IIFA 1LDEA 2ZJ2A 5HF5A 4V0ME 4MHSA 5EP3A 2FMKA 1R4MB 5E1BA 1NOJA 1P29A 1M1UA 4MVJM 3OJ0A 2XQKA 4F4DA 1T3LA 1QHHA 2OG2A 4L27A 2Q9BA 4HDNB 2IODA 4R5HA 3KKPA 1JU9A 3A3YA 3T7TA 2DBQA 1WXEA 4EHFA 2PE5A 1JIUA 2XRZA 3HEBA 4PG4A 5DM2A 3T3MB 3CZPA 2Z4SA 4MDYA 2YBEA 3G9UA 4XX0B 4TRMA 1LUAA 1V11A 2UVPA 5CMLA 5A4KA 4NZPA 1QU3A 1FRFS 1SXIA 2E1PA 5FLEX 2JGFA 1ZPQA 1QS0B 4XYEA 3BL5A 1DEAA 1M0SA 1RKQA 8ATCA 3PZRA 3QMMA 5CUQA 5CD9A 4Y1RA 1VE6A 3UH1A 1SOMA 1OX5A 2BGMA 4LFCB 3SQLA 1E69A 3JR7A 4XCXA 3PNPA 1N57A 3DR5A 4M4SA 1P5FA 3FXAA 4LHVA 5CGZA 4C21A 3Q3HA 2RC6A 2I1WA 2YWJA 3DJYA 4C6SA 4B84A 3CV3A 4BMZA 1HT2E 4TKVA 4HNVA 3B9PA 2HF9A 5BYJA 3SC6A 3E84A 1KI8A 5CDTA 1WB9A 1A77A 4I66A 5E1DA 3EFHA 1ODCA 2JIBA 1W35A 5IAKA 3RVPA 1CT9A 4MJ7A 2OMKA 4Y6SA 2QROA 5B3LA 5G1PA 5C34B 3VR2A 1G3MA 4J4TA 3CONA 1CP3A 2OV8A 1V7QA 4HFMA 4J1QA 3MTJA 1SD2A 3A04A 3SSAA 4PEVA 1OI3A 1CR4A 1QJ4A 1U0EA 1LKZA 2A86A 1YE5A 1MBZA 4ZYWA 1U0JA 3RAFC 1PSDA 1TF7A 3ZXUB 3OOEA 1SKAA 4RYLA 4B6FA 2W2KB 1VCMA 4WH0A 5FWXB 3PCXA 2XJ9A 3P2KA 2JRCA 3JASB 3KOWA 5HS4A 2F8LA 5ITVA 1MHTA 5F3RA 3MERA 5TC4A 1YZ3A 2DHCA 4IIHA 1K89A 3FY4A 2IU7A 1K7YA 3ID6C 4XIYA 3RS5A 1ZBDA 5ALQA 4D4MA 1XPJA 2VJBA 3GEHA 4Q3NA 4DNPA 5T8KA 4ZDIA 3F8SA 3OZAA 2BIFA 5T64A 4C7KA 4G0WA 1GT0C 1AD2A 4CODB 4X91A 4WVFA 4A1FA 2YJ4A 5KJCA 2EFJA 2WFZA 3VNAA 4JA2A 1Z37A 3IV6A 3BWYA 2NXNA 3THRA 4WZBA 3V34A 2V55B 1RNLA 3AUYA 3IQEA 3A9YA 3JARA 2GZSA 1GKKA 1M34B 1NMYA 2VPXA 3D8BA 5LA6A 4CW7A 4JP5A 2YJ5A 5CB8A 5D7NA 3MOSA 1T24A 3EARA 1C4XA 1ZCBA 2ZXEA 4RQUA 5IABA 2PD4A 2F3TA 1COZA 1GA6A 2R00C 3QLJA 4OXXA 3VJMA 3K6JA 1Y7PA 1JHRA 2Q1YA 2YMLA 1W9MA 3JPWA 1T2AA 1ZN7A 3KB1A 4G25A 4N6GA 4OI4A 2R96A 4QFDA 4RNDB 5JSZB 1LJUA 3M6AA 2O59A 3PE5A 2OZLA 4KIJA 4C0QC 3AP2A 5I48A 1PDOA 1QGUA 3R1IA 5JEDA 1JFRA 2HBRA 2DE0X 1LDGA 4RLQA 5EP1A 4IDHA 4A6PA 4XDGA 1X1BA 2YX1A 2HN9A 2BH2A 3U0VA 3V4OA 1K7FB 3KPJA 2PLRA 1E0JA 1F6WA 4CF5A 3DGEC 2O05A 3PKJA 3WTBA 3RIYA 1GGVA 3GZ4A 2XRMA 3LY7A 1ACJA 4WPGA 2OFFA 1NXPA 4P7KA 4CMJA 4AG3A 5HZHA 3TM5A 2LWIA 3PUZA 2EAUA 4DV0B 1EZZA 1T2VA 2JZNA 3VPDA 3GCGA 2C3UA 5L3SB 2QTHA 4HNRA 5IKOA 4U3JB 4QGGA 3H5TA 3MXOA 3MGKA 2EEZA 4M0CA 5AHXA 1M2FA 3M81A 1CF2O 2X86A 4K86A 5LLSA 1DUSA 4ROTA 4RQTA 3UJAA 5K20A 1E2HA 3IBFA 4HVAA 2VEDA 1VYVA 4RPIA 3E9YA 1W5EA 1MABA 3NYIA 1LLDA 5D87A 4KO8A 2BGWA 2VHEA 1QG4A 2LPMA 3T1QA 5AP9A 3ZXSA 2V6JA 1M34E 1GGNA 1A5SB 5COAA 5KO2A 1G64A 4BB5A 4CCWA 4TWRA 1SVMA 4TRJA 1RKXA 2XE7A 1VMAA 3SDSA 2O8CA 3MLBA 3SIXA 3SZUA 2NXWA 5CXXA 4O4JA 2GD6A 3PNMA 2MXDA 4MA0A 5KIAA 3TRJA 4TM7A 4D3YA 1K98A 2ZIEA 3LP5A 2WSLA 2JAHA 1B43A 1F38A 3U49A 4YJFA 3QFRA 2Q2QA 3IBCA 4UNRA 5FWNA 1OSLA 4QOJA 2GBIA 3TTWA 2XDYA 3ZZ0A 1FUUA 3HI4A 2HNBA 4ZA2A 5HGXA 4YAWA 1HG0A 5P8WA 1GLVA 1N2IA 3NTRA 1TUBB 2L0XA 3G85A 5JNTA 1RR6A 4JP8A 3TZLA 4OHXA 1RYZA 2ZBGA 4W8OA 5E9JA 5CX4A 2NNLD 3ZC3A 4F8JA 3T5PA 2CNWD 3QEBZ 3T12A 1OAKA 3WC4A 3W6ZA 2HB6A 4QOEA 4QTYA 1UXCA 1PUJA 3OQ6A 4OQEA 3AO0B 1CTQA 5AW6A 3AVVA 3TE7A 4FHZA 4R2XA 4W9RA 4FQ8A 5HUHA 5I01A 1C9MA 3DNPA 3HDYA 5CURA 2N75A 3VZCA 4YMGA 1I13A 1JMKC 1KMNA 2ZJOA 4LJSA 4EEKA 1LW7A 2YY6A 1E8NA 2G5CA 3H9JA 3IHWA 3CGGA 4XWTA 1HTTA 4FNAA 4N18A 4TTSA 5AJVB 4L5YA 3WP1B 1N4DA 2B25A 4QU8A 4KR3A 4UMFA 2XNSA 2HC9A 3HGQA 4IWRA 4L73A 5DNDA 1L6RA 4B82A 1WCIB 1XZNA 4QJ3A 2YR0A 2OHJA 1CNMA 4UZFA 4OUKX 4R6XA 2YHSA 5B7GA 3PR2B 1QZXA 2FCAA 1P0CA 2QTVA 4GI5A 5GINE 2FWAA 4MS3A 1N2CA 3AFNA 3UAVA 3AWIA 3CNQS 2J9FB 3T9BA 5KS2A 2B8NA 1XD2B 3O90A 4DE8A 1HTWA 3ZV6A 4FCTA 4EPYA 4QEKA 1E7MA 3UQYS 3AETB 3I45A 5ANRB 4IXDA 2MYPA 5CCDA 4BBJA 4K6GA 2WJGA 3F1LA 3A1NA 3H42B 3ZWYA 2C7PA 1GZSA 2C20A 1EFDN 3K1ZA 1JQEA 2JHCA 2WICA 5CVUA 3WAJA 2VLBA 1KEVA 1WBJB 4LWQA 3VHQA 3GP8A 1DHTA 5FOSA 4OB8A 1L5HA 1PE0A 1PBNA 4QXPA 5E0OA 3RK1A 2GN4A 4US2R 5LVAA 1E0AA 4M1OA 3EDYA 3TD9A 3J7TA 2B61A 1CHDA 4PY2A 5JRDS 4TV9F 3LC1O 4DAEA 1IQUA 1I0IA 5CVDA 3L92A 2R5FA 3KLMX 4JKYA 1HNZB 3DO6A 4OHOA 1QTQA 5B58T 5CYGA 3OQJA 1NQVA 3ST7A 3CCBA 3HCAA 2VBFA 4KG7A 2J3HA 1GTMA 4MRMB 1WU8A 1PS0A 1EM8B 1HRKA 2FPGB 1E4YA 5EWMA 1G5RA 1OFUX 1CUCA 3EVBA 4GM0A 1O97C 2ZAIA 3GGDA 3SYMA 5K0JA 4O4IB 1OKKA 4MINA 4MVYA 3MC1A 3TSZA 4EJ0A 4P8RA 2ZRPA 1XCGB 1K8RA 4HPWA 5CJPA 2X8AA 4H2DA 4ZRNA 1LZKA 3IIEA 5AOVA 1GQOA 1DBWA 1JPJA 4H4CA 5ECWA 3X2EA 4DLZA 5GY7A 1DXOA 3GRRA 3ZK8A 3GX1A 1Q50A 2NZVG 1V8PA 4MUIA 4TKUB 3WBJA 2ZQ5A 1S9DA 4ENSA 2FSVC 4LOHA 4QXRA 3TNFA 2IKSA 2XJ4A 4GC5A 3TTXA 2H54A 2HEGA 3N9IA 4ZCLA 4HXYA 2Q28A 2NMVA 1O9BA 1T8WA 3ZU5A 2IWRA 1YQXA 4PF1A 4FMDB 1O4XA 1YQUA 3HCFA 4I5FA 3PTZA 1S8FA 2J32A 3UJ3X 3X2SA 3RK0A 1ZCZA 4WDRA 3NASA 2GJ8A 5B53A 1JDPA 3GFTA 3MWDA 3VSDA 4WD3A 4DPKA 1Z75A 4F21A 4A26A 3GC6A 1YRQA 3RSCA 4YRSA 3R1FA 5C35A 1OE0A 3AR2A 2E5LB 4COKA 1NE2A 5CEFA 2BMAA 1NUAA 3K9FC 5EXDA 3ZE1B 1YFZA 3IAM1 2RI1A 3A1EA 2CMGA 1JQKA 2QMOA 5K3DA 1ZGCA 1JTEA 2DU8A 4TMVA 5DCYA 1JPVA 1W94A 2G6BA 2Q5JA 3T3DA 2PXDA 5CB0A 1IWPB 2BCEA 5DBHX 1PUIA 2MSCB 3FNHA 3R5XA 5KNBA 2GZAA 4OFWA 1VJCA 1VG0B 2FLVA 2R8ZA 3K0AB 1UC8A 3L6UA 4L9SA 3SEFA 1OWOA 1M2NA 2H2HA 1HE1C 2ZYGA 3IXQA 1EWVA 1CRLA 5BRJA 2OHOA 2FHPA 1HTBA 4AMUA 4B46A 4XH9B 3N6VA 3C1TA 521PA 3OZIA 1Q7TA 4LBWA 3HS3A 1XHEA 4R6WA 1DPFA 3KV3O 3MS2A 1XEWY 3NQ41 4EHLA 4W5OA 5J2TA 1S3IA 3AKYA 5DEIA 5J59A 1HF3A 1Q91A 5LQRA 1A2KC 1K4YA 4X41A 4URHA 5T6BA 1R9JA 1XRNA 2WDPA 3K53A 4F4HA 1BS2A 2G40A 2QE7A 3MQFA 3DEZA 3N5KA 4A0GA 4Z49A 2P6RA 1RJFA 2OXRA 4HZUB 2VBGA 1Z6QA 1IBMB 4ADSG 4MWOA 3NHZA 1QBKC 2IJGX 3N0VA 3TR6A 1E3MA 3ZHOA 2R5WA 3C74A 3GK3A 3QVOA 3WSVA 2X4LA 3JQRA 1GOTA 1N92A 1KIFA 1OLUA 2H4FA 2WDZA 2WPDA 3AUAA 1Q7RA 1ZA1A 3ND8A 2D1SA 4RHTA 3DYVA 3BGOS 4M2LA 3W4JA 3HMKA 3I28A 1UK6A 3M6IA 2FJUA 3D43A 3NALA 2R4UA 1UPCA 5E1MA 4X4CA 2WSYB 3GCZA 5DM4A 1X1QA 4RJ2A 3CX4A 3MG9A 1JDBB 4KK4A 3UAGA 5AICA 5F2NA 2WUWE 3KYDA 3UEOA 3D0KA 3G9QA 1D1SA 2XNJA 5KDDA 4ERNA 2IS2A 2VATA 2L18A 1TYDE 2VA8A 1LBIA 1TZJA 3QFHA 5C8ZA 2AXNA 2FUG1 3EIWA 1IB0A 2GWHA 2CT8A 3LHDA 4PLFA 4JELA 1P17A 3PGA1 1JVBA 3A11A 1WB5A 1S7GA 3PB3A 4ISCA 4L50A 5BN5B 1Z5NA 3KBOA 1K5DA 3WX0A 1R4NA 4GYJA 2FPIA 5JV5A 1MXHA 1SVIA 1Y3BE 1KAGA 1JG7A 1XQ9A 2DSTA 2QG6A 1STOA 3B6JA 3FG9A 4BO2A 3H16A 1F14A 2JIOA 3GJ6A 3I0NA 1WKCA 1T3SA 1JN0A 2I67A 3LTNC 3N8NA 1QCCA 1S2DA 2CXXA 1CULC 1JG1A 2BM1A 2PL1A 2WFLB 3PFCA 1TW2A 3FM9A 3KXDA 3PX3A 4PYKA 5L6LB 5CLFA 3U37A 3WQBA 5HJ7A 1N4AA 4QPNA 3C8DA 3EQ2A 4MSUA 4EA6A 5KWEA 4DV3B 5FNZA 2UYCA 1T2DA 3FUXA 5EERA 1QQTA 2MR6A 3NIWA 4K40A 4Q12A 4WK0B 4ZO6A 4QTZA 1G6HA 3E9EA 4M0PA 1AS0A 1Q1BA 3DMHA 5CU7A 2B7CA 4P31A 5AK5A 3BERA 1G7TA 1MX1A 2F1RA 5C5CA 2I7CA 3NBQA 3OICA 4IJMA 4AMGA 4TSFD 2CFSA 1NQAO 2BL4A 1TJ4A 2IE8A 3GBVA 1IG3A 3O4RA 3UXHA 4K9OA 3T7SA 1PFGA 4D74A 5ARBA 2B3DA 4FI3C 4ACBA 3RV3A 3WNZA 1OH5A 5HQ3B 4LBYA 1J0DA 1IHPA 5EJ4A 4XDZA 3HJAA 1MHPA 2WA1A 1RLUA 1KMIY 3TMYA 2WP0A 4TN1A 2C03A 3AOEA 3D7NA 1ZGZA 4GMKA 3KKLA 4HUQB 4KHPB 4TWJA 2CBXA 3HR4A 1RTTA 4NZZA 2HCSA 4EFMA 3NB0A 3RDPA 3P4XA 3A1VA 2HMYB 4WV3A 4CM9A 1RS0A 3A1CA 4DEYA 4LMAA 1GCGA 3NHWA 1UJ5A 3GEMA 2I99A 1VCHA 3VVMA 5IJWA 3H75A 1OWMA 4NE2A 5JDCC 3B1VA 3F5MA 4KFCA 4QG7A 1GNPA 3S6JA 2C7VA 2P9GA 1ULSA 3CX7A 1CY1A 3IP3A 1RI5A 1KMHA 1V5GA 1NSYA 2Z04A 3IBSA 1SH7A 4ITRC 1R00A 4EUHA 4KWIA 3N59A 4K9SA 4KWTA 3RSHA 4B17A 2JLUA 3HVIA 3KJNA 4DXDA 1FFWA 1Z0DA 2WK1A 5FWYA 2JGEA 4UTNA 5BYAA 2FFJA 3A2MA 2V6BA 1W0CA 1I7PA 1N1DA 1N2OA 3DPIA 5EJ5A 2VYVD 3IEPA 4QGFA 1N33B 2NO9A 5ER9A 3ZHZA 2N1BA 2ORED 1O54A 3OM9A 3S81A 4P38A 4UDOA 1UP6A 3DXFA 1KJZA 5TRTA 4A6EA 1IPHA 2OHHA 4P34A 2IYVA 2AD5A 4PFKA 1O8BA 4M7PA 4EW1A 3CW8X 3QPAA 5HIKA 5HRCA 1Z6YA 2L82A 3KETA 3LBAA 5IVDA 1B8VA 2CXUA 2HOQA 3B8EA 3NT4A 4D9HA 1ENPA 1WA5A 5ESRA 3HCNA 1VIVA 3RKSA 4R54A 1RJ9A 2HIGA 1XPRA 3W6UA 2WKQA 4JB2A 1ZIYA 3QX9A 5AUOB 5ALVA 1OZ0A 2GZRA 5JFGA 2HNKA 4CT5A 4BNWA 8OHMA 4CI9A 4OQZA 1AU7A 2B69A 1NVVR 3SLRA 2JFBA 3BG5A 2EFCB 1IL0A 2QTNA 3DL4A 2P78A 3II6X 5JISA 3TIVA 3MS7A 1C9EA 4IJVA 1QC5A