4ER6A

Crystal structure of human dot1l in complex with inhibitor sgc0946
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
338
structure length
335
Chain Sequence
KLELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMENYVLIDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTTQPMKLNTRPSTGLLRHILQQVYNHSVTDPEKLNPFSPEVYGETSFDLVAQMIDEIKMTDDDLFVDLGSGVGQVVLQVAAATNCKHHYGVEKADIPAKYAETMDREFRKWMKWYGKKHAEYTLERGDFLSEEWRERIANTSVIFVNNFAFGPEVDHQLKERFANMKEGGRIVSSKPFAPLNFRINSRNLSDIGTIMRVVELSPLKGSVSWTGKPVSYYLHTIDRTILENYFSSLKNPKLREEQEAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone-lysine N-methyltransferase, H3 lysine-79 specific
publication title Catalytic site remodelling of the DOT1L methyltransferase by selective inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 107
structure length 335
sequence length 338
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2012-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08123 DOT1 Histone methylation protein DOT1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.60 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) 434 Repressor (Amino-terminal Domain) 4er6A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4er6A02
4CTKA 4OBXA 5E1BA 2ZSUA 3Q87B 4L7VA 5CVDA 1R8YA 4CWAA 5FQOA 4F84A 5EZSA 1N7JA 2PX2A 4IV8A 1NW7A 8MHTA 3B89A 3A7DA 4RTOA 1KPHA 5LQJA 5EG5A 2ZBQA 4E2WA 1P1BA 3A7EA 5EOVA 5CCXA 2B78A 2P7IA 2PXCA 3ELUA 4QTUB 5CUQA 5EMJA 3A25A 5T67A 5K01A 2IFTA 3BUSA 3FPHA 1O54A 3EGVA 3KPVA 3OU7A 1SG9A 4IV0A 5ERGB 3TMAA 5ICEA 2IH5A 3REOA 1JR4A 5K8VA 2CWWA 3LKDA 3BWYA 1L9KA 3FTDA 3BGDA 3TM5A 5DX8A 1WXXA 3OE5A 1X1AA 3JWJA 2ZFUA 2AOWA 5K09A 2GA9A 3F4KA 4GUAA 3THSA 3L8DA 4X1OA 2OXTA 2JHCA 5ICFA 3DLCA 1ZG3A 3UA3A 1V39A 1IXKA 4PONA 5HZMA 3SX0A 3I9FA 1NT2A 2EFJA 1L1EA 3KQYA 3D2LA 2NXNA 3LECA 3OCJA 5EEHA 1XDZA 5FULA 5U4XA 1TPYA 2XVMA 2PGXA 1KPGA 4RTKA 2HWKA 3BT7A 1KIAA 3HVKA 3NDJA 3ID6C 3EVBA 5FWDA 2UYQA 4NECA 4KVZA 4R05A 4BLVA 3OFKA 3FPFA 5GM1A 3GXOA 3NVMB 5E1DA 2ADMA 2VDVE 1KR5A 3R6TA 3LGAA 4OX9Y 3CGGA 2I62A 5E8RA 5EC8A 4BLWA 2G1PA 1NW5A 1TW3A 1R74A 5HIIA 1SUIA 3UJCA 5DTQA 1FJXA 3FPGA 3FTFA 2O07A 4PGHA 5IKMA 3B3JA 2YUIA 3EMBA 7MHTA 5K05A 2ZVJA 2ESRA 3MTIA 4IKPA 3CBGA 5DWQA 3PX2A 5KVAA 2PXXA 3KPYA 5CM2Z 2UYCA 1YFLA 1X1DA 1M0EA 2NP6A 4BLUA 2CMGA 4C4AA 2LD4A 5HIJA 3KR1A 3PLAE 3FZGA 3KHKA 4YV2A 5DSTA 1N7IA 4P7FA 4PCAA 1G38A 5K0BA 5CVEA 2B9EA 5FADA 1G8AA 4E32A 3B5IA 3G2MA 3E23A 1KP9A 5E8JA 2H11A 2P40A 3KR2A 3G88A 3TLJA 3G8AA 1NBHA 1SKMA 2FK8A 5EMKA 2G70A 3E8SA 2I9KA 5DTRA 1JSZA 3BGVA 2OO3A 3TKYA 4PYQA 2OKCA 3C6MA 3KQPA 3LPMA 4UOEA 2BR3A 5JUWA 3TR6A 3GO4A 1QAOA 1O9HA 3QOWA 3OPNA 3CJTA 2ZZMA 4WXHA 3X0DA 1Q0SA 5K03A 1EAMA 1RI4A 5DM1A 2Y1XA 3PFGA 3SSOA 3DR5A 4RVGA 1EIZA 4HC4A 3IYLW 1SUSA 4P7JA 1JG4A 5LQKA 3P9IA 2PT9A 1YZHA 2AN5A 1EJ0A 3FYCA 4QDKA 3K6RA 4X63A 3EVFA 3BWMA 1OR8A 1HNNA 2VDUE 1QAQA 3I58A 1VE3A 3EVGA 3LBYA 2WA2A 1I1NA 3O4FA 5GIPE 2DULA 2UYHA 2ZCJA 1EG2A 2O57A 2AN3A 1Z3CA 4HRAA 1NBIA 1G60A 3GWZA 5ICCA 1X19A 3M6VA 4HG2A 5DX1A 1I4WA 1ORIA 1RI3A 3LCCA 4K6MA 4PYMA 3G2OA 3HCFA 2PVCA 3ELDA 5EZQA 4AZVA 3HTXA 3DOUA 1XDSA 3JWIA 1D2HA 4QVKA 4FSDA 4M36A 2OYRA 2GB4A 5LR6A 4GC5A 1YF3A 5KYGA 1RJEA 1AF7A 2E5WA 3G8BA 2JH9A 5DRYA 3R3HA 1UWVA 4X41A 1P91A 3MCTA 1R6AA 3SMQA 4LWPA 2IBSA 2P1DA 5CVJA 4KIGA 3DXZA 1KXZA 3GDHA 3HCCA 3KKZA 3LL7A 2O0LA 5FQNA 3EGEA 4E31A 4RTLA 5LQAA 3M70A 3IHTA 3NWEA 4PIPA 3PB3A 3G5LA 3CKKA 5CVUA 2GPYA 3UJ6A 4A6EA 1N2XA 2ZBPA 3E05A 2AOVA 4QVGA 3RW9A 2PWPA 3NVKI 5FUBA 1ZQ9A 3PS9A 5E9WA 5LQRA 5EKUA 4CTJA 2AOTB 5LSAA 2UZ4A 9MHTA 1AV6A 3KQMA 4RVHA 1WZNA 3P8ZA 4P58A 2IH2A 3CJRA 3P9CA 3V97A 2OB2A 1TW2A 2P7HA 2PY6A 3LBFA 2YTZA 5DXJA 2PXAA 4RTSA 4ER7A 4PYNA 4QTTB 3UJ9A 4LWOA 5HIKA 5KQRA 1YUBA 3HCEA 3VYWA 2A14A 3LDUA 3FTEA 5K0FA 3C3YA 5FCDA 4YUWA 5M5BA 4MIKA 1ZGJA 4C05A 3BWCA 4RTNA 4YMHA 4Z2YA 4QQKA 1VQ1A 5DLYA 1R00A 5FHRA 2XYRA 5B1SA 3UJDA 2VDWA 3KQOA 5DM0A 2GH1A 2OB1A 4RTPA 4DA4A 4YMGA 3THRA 4YV1A 3O7WA 5HOQA 1XJ5A 2ZZNA 3I53A 3LKZA 1XVAA 2Q41A 3EVEA 5DM2A 4AZWA 3Q7EA 3VC1A 4MWZA 3VC2A 2O06A 1FBNA 5EIFA 4QPNA 2FYTA 2WK1A 1YFJA 1X1BA 3TOSA 5BW4A 3KQTA 1FPQA 2G8NA 3EMDA 3R9XB 3JWHA 4HH4A 2AOTA 1FP1D 3C6KA 3TRKA 1BHJA 5EHGA 3DTNA 1VL5A 3CCFA 1AQJA 1WXWA 2GAFA 4Y30A 4RVDA 3DLIA 2QE6A 3DP7A 3E7PA 4CKBA 4KWCA 4E30A 4F86A 5DSXA 3FTCA 3KR9A 3ELWA 3MCZA 3K0BA 4FT4A 4OQDA 3HVIA 4XUCA 4EVIA 4PYKA 5KQSA 4RTRA 4IWNA 5LQNA 2QY6A 5BW5A 4X60A 2ZIFA 2B2CA 3A27A 3DMFA 4ER3A 3HVJA 3VSEA 3O31A 4ATNA 2P41A 3WSTA 4KIFA 2NXEA 2BR5A 3HEMA 1G6Q1 3KPUA 1RJDA 4KDCA 5IH3A 2HNKA 4M37A 3CVOA 4DF3A 3HNRA 1L3IA 3R0QA 2XYQA 1RJGA 4YUYA 4A6DA 3IV6A 1T43A 2OPBA 3DH0A 4XUDA 5C0OE 1ZGAA 1JG3A 2XYVA 4C06A 3ER9A 2YXLA 3KU1A 3OZTA 5DPMA 2ONYA 4PNEA 3V8VA 3KPJA 2C7OA 2ORED 3GIWA 3OZSA 4PYOA 4X61A 4FGZA 5EQJB 2EX4A 5FA5A 5LQCA 3AWIA 4BP1A 2F8LA 4GQBA 4GOOD 3UBTA 2QYOA 2R6ZA 3QV2A 3MB5A 1ORHA 2B25A 3BGIA 4WVLA 5LQUA 4CXMA 4RTMA 1MHTA 5T64A 3KQQA 1B42A 1HMYA 3OFJA 3T7RA 4GOND 1JQEA 2IDJA 1FP2A 4GBED 3B3FA 4V0QA 1SQGA 2QRVA 3PT9A 1ZHFA 1JG2A 2P35A 3P97A 5GP1A 3KR0A 2FPOA 4U7TB 5EKXA 3T7SA 2P3OA 2UYOA 5EHIA 2FRXA 4M7RA 4E2XA 3UFBA 4PIMA 5FHQA 3OU6A 1JTEA 4Y2HA 3MGGA 3TKAA 3UA4A 3GNLA 4O29A 2IBTA 2H00A 1D2CA 1KYWA 3DULA 5CIYA 1Q0TA 1P1CA 3FUTA 2XBMA 2YX1A 2VZ9A 1MJFA 1SQFA 2QRVB 2JHPA 2PJDA 2CKDA 3HCAA 2ZZKA 5E1MA 4C04A 2PSSA 10MHA 4EMSA 5F2NA 4RYLA 1BC5A 2P3QA 2ZW9A 4KDRA 3TQSA 2VS1A 3R24A 2XVAA 2NNWB 2PLWA 1RI1A 2IP2A 4PYJA 1YB2A 1R8XA 1INLA 1YZ3A 2HTEA 2YQZA 3G2QA 1NV9A 3OZRA 4G56A 3UJ8A 1X1CA 1WY7A 3EVCA 4LECA 5K0EA 4PYLA 1WS6A 3GGDA 3KPWA 1KYZA 3M6WA 3AJDA 3T0IA 4GC9A 3HA7A 4V0RA 2EG5A 3G2PA 3GRZA 4RV9A 5HFJA 2ZTHA 3SR4A 4PGGA 4BP3A 5FTWA 4F85A 1XCLA 3EEOA 5K0JA 2IDKA 3DXXA 3MAGA 1VPTA 5FA8A 3FRIA 3CC8A 2BR4A 2ZWVA 2OY0A 2ZIEA 4QDJA 3LSTA 1ZKDA 3NWBA 3P71T 3DMHA 3H2BA 3SGLA 3TM4A 2NP7A 4OQEA 3A4TA 2P8JA 3GRVA 3U81A 5CD1A 3S68A 1L3BA 3DMGA 5FWAA 2K4MA 3G7UA 3EGIA 3AXSA 4FZVA 1D2GA 4EQZA 1U2ZA 2DPMA 2HV9A 1VP3A 1VBFA 3NMUF 3HA5A 3EVDA 4U7PB 4DM3A 1VP9A 2YR0A 3UWPA 1NKVA 2AR0A 3FRHA 2ERCA 5F2KA 4EK9A 2PX4A 1NE2A 5K0NA 2BM9A 3P9NA 3PFHA 4FT2A 4PWYA 5EMMA 4MQ4A 4EKIA 4HTFB 3KQVA 2AOUB 2FK7A 4ZTBA 4FR0A 1XXLA 1F3LA 3LX6A 4C07A 4RTQA 4C08A 2PT6A 4E2YA 5EVJA 3TPZA 1KHHA 4AUKA 5G02A 2PX5A 5CVVA 3BWBA 4OA8A 5EMLA 4E33A 2YXDA 3EPPA 3B7PA 3T7TA 2CMHA 5EGSA 1QAMA 4GOLD 3EVZA 3BKWA 3UJ7A 5EEGA 2PKWA 4RX1A 1AQIA 3FPJA 3P2IA 2Z6UA 3M6XA 3HVHA 2IPXA 1M6EX 5E2BA 1PRYA 3HP7A 1BOOA 5GM2A 1NW8A 5K0LA 2V74B 4RTJA 2PX8A 1NV8A 3FUXA 2FHPA 1QANA 3IEIA 2ZULA 3LHDA 2C7QA 4YUXA 3KQWA 4GOMD 5C9ZA 3NW9A 3JWGA 1JSXA 1O9GA 3BZBA 5HIMA 5GINE 4QQNA 2Y1WA 3EEYA 3AY0A 3GRUA 4MHTA 2AN4A 2AVDA 3C0KA 3FUUA 3MTEA 2ZLBA 3FUVA 4BY9E 2FCAA 5E1OA 2GLUA 4POOA 2P3LA 3HCDA 4HTFA 3MERA 1QYRA 2AOUA 3PTAA 5MHTA 1R18A 4R8RA 3FYDA 2AZTA 3ER8A 2NYUA 5CCBA 1JG1A 1EJ6A 1I9GA 1L3CA 5EPEA 2I7CA 2BM8A 5DT2A 2JHAA 3HCBA 4KRGA 1JQDA 5E2AA 2C7PA 5DX0A 3PVCA 2OBFA 4M38A 3G89A 4RVFA 1UIRA 4FSXA 3G5TA 3UJAA 4GF5A 5K0GA 2I6GA 2O05A 3SVZA 3P2EA 2WA1A 2G72A 5D1NA 5DM4A 5C1IA 3SM3A 3P9KA 5DRTA 1PJZA 3UJBA 2ZIGA 4QPPA 2HR1A 3FPEA 4P7KA 3LCUA 2PV0A 4R8SA 4R6XA 3PX3A 2NXCA 2PWYA 4MTLA 3QOXA 2B3TA 3A26A 2AOXA 1VIDA 1NW6A 3M33A 2GS9A 2IH4A 4ER0A 1BKYA 3TFWA 5GWXA 3B3GA 4AX8A 3ORHA 4RWZA 4YUZA 3MQ2A 2EJUA 4H0NA 1QZZA 1XTPA 3ANXA 1M6YA 2HMYB 4GEKA 4CKEA 3M6UA 2EJTA 1SVUA 3I5UA 3DUWA 2IGTA 5D1HA 4C03A 4HGZA 3SSMA 1G55A 3FUWA 3CJQA 4ISCA 5JR3A 1Y8CA 2CL5A 3AXTA 5HEKA 3NJRA 1KPIA 1XDUA 4FS8A 2JG3A 1XCJA 4DKJA 3BKXA 2AS0A 3BXOA 3NDIA 3LDGA 3GRYA 3ME5A 4PINA 5E9QA 4E70A 4OBWA 2QM3A 2VP3A 4XCXA 4AZSA 1DUSA 1IY9A 1WG8A 4P7GA 2Z6AA 2BH2A 1RI2A 4ER6A 4DMGA 2OZVA 3OE4A 4LG1A 5H02A 5GIOE 1IM8A 2BZGA 3SXJA 2PBFA 2ZBRA 3HA3A 4FP9A 3OU2A 1RI5A 1RJFA 4CKCA 1NW3A 3HM2A 5DTMA 3GJYA 3LCVB 5EIWA 3DXYA 2H1RA 1VLMA 4AZTA 3KQSA 5E9JA 4B17A 1JQ3A 3SSNA 4DQ0A 2NXJA 2AVNA 4JXJA 4YUVA 3GRRA 4PCLA 3RODA 5K0CA 5ICGA 2IIPA 4R6WA 4DCMA 4EKGA 4OA5A 3UZUA 1DCTA 3GU3A 3P2KA 2ONZA 3RIEA 4ER5A 1JTFA 4DZRA 1H1DA 4PYIA 5KS2A 3EVAA 1G8SA 3GCZA 5F2OA 5P8WA 4RSRA 2C7RA 4E2ZA 2JJQA 3LDFA 2G71A 2R3SA 1P39A 5T6BA 4XUEA 2Z6QA 1EQAA 5GOZA 2V7EA 2ZWAA 5BXYA 3I64A 2JH8A 3C3PA 1UFKA 4KW7A 3M4XA 4HGYA 2YVLA 2KW5A 1F38A 5BP7A 1DL5A 3MHTA 3ERCA 2YXEA 5DXAA 4DCGA 3ELYA 4YV0A 2N47A 3NTVA 4HSGA 5HILA
chains in the Genus database with same CATH superfamily
4JBHA 2QMOA 3QVXA 4LS3A 4N3GA 3RS0A 2MQKA 3F98A 2HFZA 3WWDA 2IYQA 2XB9A 2RGWA 2BFFB 3IUNA 3DZIA 4BNJA 2YWRA 2BDUA 1V8DA 4RD4A 2EBUA 2W6CX 4F97A 5H3HA 1V7QA 4X54A 4MB2A 2B4AA 3FVQA 3R0JA 2COUA 5F1KA 1KO1A 1N9KA 2C1EA 1U6JA 2GYWA 1KDZA 1QRAA 5TPWA 1KQGA 4IHJA 1FUYB 1GKYA 2CHUA 2NTEA 5IAOA 2HRDA 1A9PA 1C7ZA 4M88A 5IUKC 1GPUA 1N7HA 2PRYA 1ENYA 3CF0A 5HDBB 2E4ZA 2RGNA 4J16C 3OY2A 4XD2A 3E5HA 4GMKA 1YHNA 4IS2A 3VO9A 3U40A 3NONA 3S8EA 3T54A 1XKTA 3THSA 4Y2TA 1VCNA 4COOA 2OXTA 1FSZA 4R5MA 3FVRA 3O74A 3CR8A 2D2IA 1MIOB 5KNBD 3BBLA 1UK6A 2OCYC 4Y2UA 1XI2A 4JDPA 3U19A 2NXNA 2IWHA 4DT1A 4M1MA 4EFDA 3QFRA 2DWOA 4MINA 1ORDA 2HMTA 2ZIXA 1N2BA 1NVGA 1JA0A 1F4LA 1MF7A 2B8EA 2VBIA 3G1TA 2Q6TA 5AI0A 3JXBC 3THXA 1L5HA 4Q9LA 1SUEA 3AJ8A 5LP6C 5K0SA 1U28A 2X4DA 2ZP1A 4JJIA 1V37A 4NJMB 1WP9A 5JAIA 1P4SA 4Q4JA 5LVAA 1FFBA 1H23A 2IS1A 4H3SA 4HAOA 2WIKA 1KI3A 1R74A 4TWIA 4YR7A 2MR5A 5JHHB 1IVNA 2NW6A 4RHFA 4XARA 2IEIA 1IG0A 3A37A 3PNLA 1ZH8A 1GZ3A 4RPLA 1IWPB 2EBFX 1I36A 2HEIA 2V5AA 4Y2RA 2C5SA 4ZHSA 1NP3A 3M1LA 4QXAA 4JI3B 3TMKA 1P0MA 4B7CA 2UYCA 1HNZB 2V65A 4H1TA 1A9QA 2CMGA 2P9QA 2AX3A 2IVQA 1CRLA 3GLUA 3M4NA 2ZB7A 4MVWA 5K3FA 3H5VA 4UDXX 5TR9A 3PLAE 3L7MA 1A27A 5LDGA 2QRQA 3F6WA 1TNDA 2W2TA 3F7OA 2R5FA 5E38A 4ZN6A 3WHKA 4KR7A 3OKZA 2MHCA 1G5HA 3WMGA 4GZ5A 4EEKA 1PG5A 4WNIA 3D8NA 2A35A 1YE8A 1JIVA 2RK3A 3EWAA 3VZQA 1ST2A 1G8PA 1RSZA 2D5IA 2IS6A 3L5OA 4G0YA 1F7UA 1YJQA 3I34X 4UZSA 4K46A 4PXAA 1WUJS 3QF4B 4XYGA 1FDRA 2G9NA 1JAXA 3ZGZA 4Q24A 3GMTA 5DHAA 2EZUA 4GBMA 1Z2EA 3DE7X 4UCQA 3TOVA 4N0PA 1GTJ1 4D8WA 2C5FA 1GZ7A 1YJBA 2ACEA 2GHTA 3QOWA 3KJZA 3O75A 4A8PA 4DM7A 4DCUA 2GKOA 2BGKA 4FNAA 3KQUA 4YYZA 3AEKA 3NC1C 2GEVA 4IJQA 1CYEA 3CNNA 3SSOA 6AT1A 3UMJA 2PA3A 3FMIA 5K9ZA 2C77A 4HC4A 4XVCA 1NBWB 5C8YA 2BH9A 4IV5A 4X4BA 1N6KA 3WIEA 4E13A 5JY6A 1M2KA 2G40A 2UVPA 1PRVA 2FZ4A 3P9IA 5L3SA 3AFMA 5ALFA 1MMFB 1A2OA 3A9TA 1G5FA 2GCOA 4O2BA 4HI0E 3ZU5A 1HNNA 2NZUG 3R44A 1Q0ZA 2O5EA 4JCYA 2GPSA 4JQSA 1RXEA 1ZXLA 2VYVD 4MCJA 5LA6B 3VTFA 1E9BA 1Z3CA 2OBMA 2I7DA 3CEJA 2I4NA 2ZJ0A 3NHPA 3T9EA 3S55A 1XA0A 3OO1A 5DYTA 1KZ6A 3IP6A 2DR3A 5IXYA 1FNCA 3M82A 4CKZA 3CVJA 2F6RA 4EYEA 2F48A 1MVOA 1GUYA 2QDXA 3KNZA 3HRKA 4P2GA 3F6RA 4XPZA 4KNWA 1CVRA 1COZA 2LCFA 3DFMA 3OMLA 4U3JB 1TZBA 1G291 2FW6A 3NCHA 3NUZA 1N3BA 1VE6A 1ONNA 1T3GA 2E5WA 2QVXX 3G8BA 3OLYA 3MJTA 3L0BA 4R8VA 3UM9A 4B43A 4LMBA 1IBLB 1QXSA 4RJTA 4Z8XA 4YI5A 4LAFA 1M6VA 3OX4A 4F3TA 4B3RB 3DEIA 4MOWA 3VHLB 1RS0A 3R7FA 4CM8B 1Y1PA 3M70A 1VE5A 2V7VA 3NBQA 4PIPA 3Q8MA 3G5GA 4NE9A 3VQTA 3N2EA 4ARVA 2EKLA 3DKRA 4RY9A 3ZDXB 1BKDR 2FPWA 2QENA 2VWPA 3KQMA 1L5SA 2Q5IA 1ZA1A 3R4CA 5LMCA 5FF9A 3KU4A 2BW0A 3E22A 1Z5VA 3NGMA 3BMNB 4QTTB 4KX5A 3X1YA 5IKEA 3FTPA 5JNSA 2WJZB 2Z2YA 1KI2A 4WADA 4Z0PA 5CHYA 4NU0A 1DRWA 1SURA 2OR1L 3AF0A 1T8TA 1YRAA 3AR5A 4KNVA 4KRXA 4NJOA 5F33A 5TEVA 1LNZA 3L7IA 1A9ZA 1X15A 2WTXA 3UJDA 4LDAA 3MTAA 4INOA 4DJTA 1F8UA 1NTRA 2G82A 5NULA 4TM7A 1KSHA 3RVLA 4Y2PA 4BQFA 3OFNA 3Q7EA 2VSQA 4OQZA 1D07A 4XQEA 4EY3A 4MB0A 3KJIA 5CW2A 4N03A 3A9SA 5DBEX 4B3TB 4IFIA 4EZIA 4XCQA 3ZDZB 4YQFA 4PHFA 2FN3A 4JN6B 1X6VA 2QZ9A 2TYSB 1KJ8A 2Q1XA 1PLKA 3VZDA 1BMDA 1CIVA 4CLOB 4ZV4A 1G1AA 2QD3A 3WK8A 5TX7A 1GTVA 4KYIB 2GAAA 3JZFA 4F9TA 1H6AA 2J67A 2ZI7A 2EP5A 3HY6A 3LXMA 4JXZA 1HE8B 4XB1A 4FU0A 3MCZA 4CNBA 3HVIA 4DA0A 2DLNA 4OHMA 4ZU3A 4EG7A 3PQCA 3QEMB 1ST3A 2YHUA 3GJ5A 3OIUA 3QBJA 4AJIA 1DVRA 1H8EA 1AKQA 4E0BA 2MYTA 4ATNA 1HBJA 2MYNA 5L53A 2Y2UA 4KIFA 5IVKA 2WTMA 4OGGA 3HEMA 3BG5A 2ZIVB 3C3AA 2BE9A 2W48A 1E5VA 4UNQA 4RKRA 1RJGA 3JWPA 3NOOA 4A6DA 1TLTA 2OPBA 4IXTA 4UNPA 4BNDA 3W8NA 1RRCA 1XROA 5KMGA 4M0MA 3LLCA 1I32A 2JAUA 4Q0MA 1Y48E 4Z58A 5H9VA 1R6DA 3IURA 4M8KA 2PO5A 4X61A 1E4EB 2MINA 2I4OA 1S4QA 4BECA 4EHBA 3UBTA 2C5EA 3C74A 1CHNA 1QHFA 3WTCA 1MHTA 3G5MA 1Z4OA 2R00A 3JYLA 3LFHA 4M22A 4BX9A 4Q6BA 4ENUA 3OM1A 1UP4A 1GU7A 3GK3A 4GI1A 4GOND 2H7CA 4MR9B 2O5VA 3GV0A 5J2UB 3ROKA 3KJEA 4AYXA 5IANA 2IXBA 4DCPA 3VKHA 3HRHA 2Z1MA 3TQQA 2VPTA 3TZKA 4I6JA 1T0JB 2G5TA 4KE7A 4PZ9A 5SY6A 4Q4AB 1XZBA 1J9ZA 1PR0A 2ZXFA 5IBPA 1PJTA 2GZDA 5TPZA 1XSEA 2HHHB 4A0SA 3F9IA 1L1MA 2AEFA 4O29A 1NT4A 1IJFA 3TQRA 2XOEA 1SUWA 4NAVA 4BIIA 5CFRA 4R5HA 4RHUA 1EP9A 1WLYA 2P27A 3SHFA 1CR1A 3ESZA 1F9AA 5GONF 3WWPA 1XKQA 1WPGA 4FCTA 1JMVA 3UV7A 4TTAA 5CJJA 3ZYCA 1N4DA 2QXTA 4LY3A 2JIPA 1MP0A 1RLJA 4L8FA 2RJOA 1I8TA 2YYSA 4LYGA 4DDMA 5T4EA 1XP8A 4OHUA 2GARA 4IUYA 5E6RA 3SEFA 5AW5A 2EC5A 4X7RA 4OXNA 1E2NA 2X9NA 2R84A 1C4KA 3DEAA 4KAAA 4O4IB 2XVAA 1BE0A 1KGDA 3AYZB 5AWFC 1YZ3A 3GUYA 1KI6A 3BMQB 4TUYA 4QU8A 2WKQA 3EVCA 4ZZ2A 3NCTA 3LUCA 3PU6A 1KO7A 1PK9A 4HFMA 4FBIA 4FFDA 4V0RA 5LZ9A 3GRZA 4LY6A 4HRYA 1N4AA 3R76A 4F7WA 1TT5A 1XCLA 2KPJA 2VF5X 3E7WA 3MRTA 3NALA 4HL6A 1PS9A 4XD7A 2IC5A 3ROXA 3TNYA 1G7RA 3DO8A 1WUTA 3EFBA 4KQWA 3SGLA 1ZISA 3HCNA 2PYDA 3FSGD 3U81A 1GWNA 1NM5C 3K5HA 4G9EA 5FOUA 3U4DA 3EGIA 5G4KA 1F8GA 2VKQA 1D2GA 1LV8A 5KWVA 2ILVA 2JFYA 4Q3LA 2QR2A 1P9OA 1IC6A 1DBSA 1JA9A 3LL4A 4U7PB 1E1NA 5FI3A 2YBEA 2ATCA 1Z73A 1NKVA 1P45A 3HXMA 1DO2A 1PR4A 2V6IA 5KYNA 1LLDA 4ARZB 5JZSA 2FW0A 2FJUA 2OUIA 2YWHA 1GFWA 4V0SA 4WN9B 2ZR8A 1QE0A 2XEXA 3SIRA 5JS7A 1Y81A 1E0AA 4FCWA 2GD2A 5C51B 3LISA 5GOTA 4DLNA 1JEOA 2XIQA 3ILHA 5ARDA 3DDCA 2NQ2C 4DIOA 4FX5A 1AGYA 2PKQO 2H0AA 3TPZA 2XXAA 1E2EA 4LRWA 1UP7A 1ATIA 2ZATA 3MTJA 1HPLA 1N2IA 1XDBA 1F8YA 3HU5A 3PXDA 4YREA 3DLBA 1TM2A 5BNTA 5EGSA 2W98A 4DJAA 4ZCRA 1KVQA 3EVZA 4DA9A 1RQ2A 5ENDA 1O08A 5ALSA 2PKWA 4GFDA 2FOLA 2J5RA 3M6XA 1Y9JA 2QLBA 3IBSA 1F2TB 1Q44A 1Z06A 4US1R 5BSUA 1CQTA 3OVMA 2ALJA 4YGYA 3OOEA 1B0AA 5DEIA 1K7XB 3JQ7B 5K0LA 2V74B 1I6WA 1T9GS 3LW7A 2W2XA 2BE7A 2ZE5A 4JITA 1Q1AA 4KPUA 3RG8A 2UUOA 3JXCL 4YUXA 3KHTA 3EZ6A 1M76A 1TMYA 5TRTA 2WB2A 1O2DA 3BRWA 3GXBA 1P18A 1JBEA 4LHYA 4P4NA 1QIIA 1I13A 1PJ2A 2O0MA 3GIDA 4KQGA 4Y6GB 3AY0A 1TYDE 1G5IA 3EQ2A 4QATA 4R2JA 4MHTA 3AMVA 4HGOA 1H8ED 2C7BA 3QMPA 4XX1A 5KVQA 1PV2A 4JLAA 2P3LA 2H8KA 3PD1A 5MHTA 3NETA 5B1IA 3MLBA 4TGLA 3ADDA 4E5DA 3DGFC 3HKBA 2XXJA 4ZCLA 3UAGA 1CZUA 1ISGA 2ZGVA 1M2GA 3DNFA 4FHGA 4CQNA 5B7GA 1EJ6A 4RWEA 1WVIA 4G1MB 2DVMA 4QOIA 5E7IA 2JHAA 3CHYA 4KRGA 2YINC 1G21A 1RHRA 4Z86A 1N3LA 3BULA 3TZHA 2NUTB 3LQQA 4CMGA 5CT9A 2VHCA 4G24A 3WKEA 4B32A 4KQ1A 4EABA 1EFKA 5KNDA 2LYSA 2AE1A 1ZMOA 3UGQA 2XA1A 4QUJA 3O8QB 4AWAA 4OHBA 1RXWA 4D9IA 1L5FA 1IOLA 1PG0A 2JD1A 2H2DA 1RMTA 3HFGA 2NXCA 4DSNA 5IASA 4J0JA 2IH4A 1QYDA 3WLRA 1VL2A 4OLBA 4AI6A 2YYYA 3VGPA 1KP3A 1QO0A 3G9TA 4MUMA 1TJ3A 4FOSA 3SIPA 4LMAA 2AXUA 3EISA 1PZXA 3KALA 4MVJE 4X8OA 1EHIA 2ZRGA 3ANXA 3Q11A 1M6YA 5FYDA 3ZWQA 2BUAA 4J43A 1PS8A 2G0AA 5FNZA 3GEPA 1GL6A 1AHHA 1HZZA 3P9XA 2DCUA 4MR8A 2WILA 4WFIA 1PSDA 4UHDA 5BXQC 4Z9YA 4MUYA 1JDNA 1G2PA 4V0NA 4E7PA 1DBQA 1MC5A 3DJFA 4BGVA 5JD6A 1YB4A 2E9SA 3D3WA 4JS0A 3E4CA 4L28A 3AX6A 1UJ6A 5TPZD 5TVKA 3ZE0B 1ZZBA 4ZP1A 1UC9A 2CLDX 2FZLA 2DQSA 2V0NA 3FRJA 4B3FX 4ZIRB 5AJHA 1T4CB 3EODA 5AVYA 2W70A 3P45A 4ER6A 1KZ9A 3DDWA 3H2GA 2A94A 2P5TB 3MWEB 4NPAA 4URZR 4YP5A 3DUFA 1IM8A 3WI7A 4NCXA 3L0IB 2X41A 4ZOQI 2CNKA 3R75A 1ZW6A 3D1VA 2H8GA 1GOTA 4RETA 3GFQA 3RFVA 4UU8A 4HEHA 4P33A 5IARA 4B44A 2FDRA 4H7HA 4R1TA 1JQ3A 1T0UA 4UMVA 4WK4B 5ALTA 3WGLA 1TIBA 1K6EA 3FZYA 1Q1BA 3GUUA 4BNLA 3TLXA 2IW3A 1M2EA 3K7EA 5JAHA 3S70A 2OENG 5GZ6A 4BTVA 4YAGA 3HPRA 2PZFA 2GZ1A 4FE3A 4DCMA 1COWD 3L6DA 3RRXA 1XMQB 2YY6A 1HG1A 2E1RA 2DPYA 1NN0A 3H3XA 3K9WA 1YR7A 4V0MA 2VDLB 1GQSA 3CG4A 4UBKA 1C9YA 3EIUA 1OBCA 2I8LA 2WF6A 3JALA 1N1GA 1LDGA 4OKIA 4P81A 5FPYA 2XCJA 4XD7D 5GGYA 2OXRA 5AM5A 4IXWA 3J7TA 2WMOB 1C2YA 3EVTA 3N5KA 3ZJ4A 2A5YB 4AD8A 1CU1A 4CTMA 1MO3A 1O94C 1V3UA 1ZPDA 4DN6A 3I64A 3NHZA 1ONSA 4LGYA 1DEKA 2DBQA 2ZAOA 3N3AC 4KBYA 2GD1O 2H08A 3BAZA 1DX4A 1OXUA 2EP8A 3OPXA 4UEWA 5IM5A 5BNIA 4RDXA 1GNVA 4TKUB 4DG5A 1YS2X 4OFXA 3RSHA 2ZSUA 3Q87B 3BXZA 1FDVA 3TLGB 3WK4A 5FQOA 3PE6A 4W5RA 1DG9A 2BHRA 3HH8A 3TS1A 3W5DA 4P36A 3TRBA 3B89A 1YHYA 3RRJA 1FLAA 3V9AA 3RS4A 4LJSA 2PQ0A 3SEQA 2C2KA 3QGMA 1C8LA 3ZHVA 3PC4A 4BNUA 3HXOA 4ANFA 2HDHA 3AO0B 5IWAB 3EASA 2E4YA 3B70A 5ERGB 3IOCA 5WRFA 3REOA 1Q1ZA 4RZHA 2WYWA 4LWZA 1HKUA 2WZCA 3JYPA 5JYEA 4PO3X 3WV4A 1JR2A 3DO6A 3K1AB 2KMLA 5AXDA 3QE9Y 4R1UA 2DBYA 4HYTA 3OE5A 4UBMA 3EIXA 1YA4A 3VSAA 4MI6A 2GA9A 5EFOA 1XU7A 4IRMA 2ROQA 3P0HA 5TT0A 3RVDA 4XTCS 3F5SA 3V2UA 1PYOA 3WLOA 4RMNA 4YRAA 3I9FA 1HH4A 4EPWA 2EFJA 4EIWA 3GLGE 4YCLA 2HTFA 4FK8A 2XUPA 2GD0A 4RF4A 2ZYWX 2EV9A 4DREA 2ATIA 1I01A 5DLDA 3C3BA 3ANYB 1TC2A 3NDJA 3UKOA 3SC2A 3TL2A 5AM1A 2PGLA 1KH2A 1L7PA 2JFWA 2GK3A 3FPFA 3QWBA 4MUIA 3A6PC 2W9XA 4LEIA 1EXMA 3X2EA 5LNK1 2C0CA 4YAWA 3VBEA 1FMCA 1JVBA 4BLWA 2AJCA 2PSHA 3AEQA 1Z7BA 1H2AS 2C9BA 1NJ5A 2RC6A 1E3OC 3GMSA 4RY8A 2EAUA 5SZKB 1UBUS 4GKAA 2Q3HA 3FTFA 5KNDD 1ZLYA 3BJMA 3PL1A 1SIUA 1P61B 3RCBA 4AYWA 2NUAA 1E3DA 1T9HA 3N2ZB 3MTIA 4IX1A 3ZEIA 2PXXA 3IP1A 5K0TA 4RJIA 4WA8A 2NP6A 4JC8A 2X0NA 1L4KA 2GRJA 2AKAB 1KTVA 5KB3A 2YKGA 1J2UA 1QO0D 1ZX1A 3UNXA 4ILKA 4DPLA 1E5XA 3PRJA 2I2CA 1HE4A 2RHGB 1X7ZA 2VWHA 3ESBA 3A3KA 3QFFA 2OORC 4M9RA 3EN0A 3FAKA 5CPFA 5ALMA 3MLEA 3KE8A 2MSNA 1KS2A 2VBFA 5IVIA 4CMHA 5LWHA 2FAXA 4E32A 1J8VA 1WIWA 4HAIA 3VKFA 1IRXA 1NN3A 2P40A 5E8JA 1OH7A 2EGGA 2PUJA 3QPBA 1W5SA 1AK9A 4A26A 4XIYA 4BX8A 2CNBA 3BK7A 3CEHA 1MAVA 4HWKA 1E2BA 4M98A 3QVWA 3MINA 3SDSA 2LR0A 2OO3A 5E3HA 1H69A 4D8YA 2R1VB 1T0PA 4DC1A 3A3OA 1ZOSA 4WZAA 3TLBA 5FOSA 3VA7A 2WWFA 3UW1A 4HYEA 4FZRA 3S2SA 1Z83A 1DXQA 3EYWA 4B73A 4EPRA 1RPNA 4H77A 4N01A 5C7LO 1EVKA 2Q9AA 2Z3VA 3OLQA 4UHHA 3NS7A 4AZ3A 5DGHA 4PQYA 2V1UA 2JIRA 1SCIA 5ARCA 4Z53A 3PFWO 1T24A 5LM3A 1Y8QB 5LQKA 2P2CA 2Y4OA 3PDIB 1EJ0A 3LBAA 3FYCA 4M6WA 1N9GB 1CY6A 1HKHA 1CVLA 2CV1A 1IEWA 1VCMA 4GWGA 1YKFA 2H6EA 5JJLA 1XOIA 2DSTA 1OR8A 3AB3A 5D5PA 4UD6A 2WKSA 3FXAA 3PUJA 4EJSB 5F98A 2V58A 2AN3A 3HDYA 4IDAA 4BE9A 2IA5A 2YHSA 3FNFA 1BCRB 4DEYA 1VECA 1LPMA 4GXRA 4HNHA 3SP1A 1EFTA 3D6VA 3M6VA 4HG2A 5HUHA 4RAQA 1AGNA 1HLDA 4IZIA 1KZ7B 1CP2A 4H2DA 5F9FA 4LHXA 2NPFA 4FOTA 2HI0A 2I2WA 2XB8A 3CKLA 4R9UC 2QORA 3SHOA 4CV0A 2A1IA 3OHSX 1I3NA 3PVSA 1MPXA 4A23A 3W34A 4RNDB 4AWXA 1D2HA 3IQGX 1I3CA 1Y37A 3ZUGA 2OXFA 1KDPA 4GC5A 1YB1A 1T15A 3CRVA 5KYGA 4C4SA 2VQFB 2VSNA 3OJOA 4EW2A 5JQGF 4NYJR 3H8JA 3RROA 4BNKA 4P3YA 4BGUA 1UBMS 2VPZA 4X41A 3WV5A 3NT4A 1NJSA 1TU0A 3LDAA 3HXTA 4RTLA 2GQ0A 1JU3A 4V39A 1GZHB 2O0LA 5FQNA 4BFVA 5I9NA 3T5CA 2B5WA 3ENKA 4EB0A 4BQPA 2JFFA 3DKPA 5IFKA 5BQOA 4XB6B 1AURA 3NVKI 3UKDA 3PGXA 3IELA 3ZJUA 2BBTA 1LLUA 1UXGA 2C57A 2O2DA 3TSWA 5CG1A 3DJYA 3P9PA 4NK4A 2Y05A 1QTIA 2BKXA 3B60A 3H9UA 3V8MA 2ZSIA 3SHVA 4DVGA 1PSWA 1N5RA 5DYYA 4EB6B 1R6UA 3DHNA 1GSOA 2DBRA 2YTZA 3QEKA 3RWOA 3A9WA 1IULA 1W87A 4OAPA 1MFPA 1BX0A 2C2WA 2VYFA 3RT7A 4D41A 1TF5A 2O2HA 2AV6A 1BEZA 2IXEA 2QTVA 5BV7A 1EDDA 3AP1A 2DWCA 4ME6A 1MLDA 5FBKA 4OKNA 2PS1A 2IQIA 5THQA 1QH0A 4XIFA 1PFWA 3H17A 1B1CA 4KKXB 3KUXA 5DDIP 5HBRA 3THRA 4ZYUA 4AWBA 2FZ5A 4QFBA 4PS0A 1RCTE 3QV1A 3SXUB 2EFCB 4B85A 3DAHA 2DKFA 2RHJA 2C3OA 3QPDA 2EHJA 2D1YA 1V8OA 3OZUA 4EUKA 1NI5A 4Q9JA 3HL0A 4RGQA 2NZWA 3K70C 4MVJP 1UR5A 2FUEA 1JE1A 1KOFA 1NVUQ 2AMFA 2AYXA 2LKDA 3MJCA 4QG7A 1TA9A 4W99A 3TFOA 3BDIA 1T29A 2OHJA 4D6XA 2JIDA 3TRKA 3UY4A 3OQMA 3I52A 4IM7A 1BHJA 4TQ9A 4BS9A 2HWXA 4YPVA 1L5NA 5H9WA 1P7VA 4RHTA 2DGDA 2IELA 1EA7A 4HO1X 3ROFA 4K9MA 3AVPA 4U5QA 3FYUB 3PFFA 1NKSA 3K0BA 1NNUA 4OQDA 4S0XA 1VIYA 1DBVO 1GQQA 3F78A 5EZYF 1F5SA 1HYQA 5ER9A 4BNVA 4B48A 3L7OA 1KY5A 1QS0A 3IXMA 3MCUA 4XQCA 1KA9H 2NT3A 3WSTA 2D3WA 4B47A 3OM0A 1FUKA 2RGYA 2GN8A 4X00A 4TWJA 1EVEA 4BMNA 3GNQA 4XIIA 3W1VA 4P6VF 4BKQA 3L7AA 3IV6A 2WW8A 4HAVA 1E8NA 1Y3HA 2Q0SA 3PA8A 5DYNA 4FDAA 3GEMA 4ZVKA 5C0OE 1WBJB 3KJGA 3RBVA 1CZRA 1XMSA 3HGMA 2B8WA 2YXLA 2BGIA 2XLBA 2ZJ7A 3IBTA 1ZOPA 3OZTA 5CTJA 1EFCA 1G8MA 2AHRA 2QF7A 5A7HA 4JYZA 1ZZGA 4A8JB 3GBPA 4LRSB 1O6CA 3PHBE 5FO0A 3K09C 2WNSA 3IQEA 2ZBEA 3MB5A 5EIBD 2QYHA 4N5NA 2OQRA 2W37A 3WRXC 1PQ4A 4M1SA 2H4FA 1OAOC 3DEJA 3GZDC 1LCIA 2JARA 3JVUA 2BFDB 3R7WA 1PFUA 3QMMA 4G5HA 3SOPA 3DQPA 4CIAA 5JCPA 3EUSA 1CE8A 2GX6A 2IDJA 4PO9A 4XEUA 2C2HA 1E2IA 2D1FA 1P81A 2IUYA 4H16A 1NATA 3B3FA 2G9ZA 5JMPA 2ZUFA 4FINA 3P97A 1JG2A 1R16A 5CA1F 3MFQA 2QGFA 3VMMA 3E1SA 3CX6A 3B1XA 1WXEA 4X92A 1IUNA 1MAHA 2ZRHA 3LIPA 1G9XA 4NOMA 3EGWA 4J3FA 3VC7A 7ADHA 2XOKA 1NSTA 5TT1A 1ESZA 3MGGA 3UMMA 2A3NA 1Q5PA 2H00A 5JOQA 3RAPR 3ZDDA 2H7VA 1S7CA 1GG5A 5CFLA 2RB4A 7GPBA 5CIYA 4LJLA 2FZGA 5F7ZA 2CYBA 4O4HB 2YX1A 4RIHA 1ILWA 4JBGA 3T9DA 4K9QA 2UXDB 1L7MA 1ZUNB 3VZBA 1J0CA 2A9VA 3FPSA 4LK2A 1YL7A 2REXB 3B6JA 4K6GA 2O6LA 1ZLXA 3K5WA 5TF4A 3LQRA 2UVQA 5A71A 4MW9A 1DLIA 4WSOA 3AIMA 2P9ZA 2GEKA 2NNWB 2QJWA 1GNSA 2EW1A 5HZKA 3CVVA 2PKCA 3L8YA 2O2GA 2OYSA 4FYHA 1SR8A 4MUNA 3UB2A 1WY7A 5TPWB 3WLQA 2AFVA 2ZBVA 3GGDA 2FN9A 1NUUA 3HWRA 4KDFA 1ORRA 3T0IA 1U7OA 1IVYA 4F85A 4RV9A 4C4ZA 1BX1A 2VPYA 2XKJE 4LBWA 5EJ9A 3NQ41 1YI0A 4ND5A 2ODWA 2VDQB 2PXPA 1XD2A 1Y4DE 3Q0EA 4P1ZA 3D1JA 2ZWVA 2OY0A 3MPOA 4QT0A 3P71T 3DMHA 3EOAI 2AFHA 3I0NA 3U80A 5C52B 1IEQA 3A4TA 5IF9A 3DMGA 2CY0A 3I6ZA 1NF2A 2NU6A 2O7VA 4HVLA 5IDVA 4U63A 2FWPA 3V2HA 4DT1B 2G06A 4EZBA 3AJ9A 3OAAA 1G17A 2NO0A 1FYVA 3EVDA 3TFQA 3T3GA 2YR0A 2FR0A 5EKSA 2BMFA 4AQYB 5TARA 3M9LA 4D74A 5BN4A 2ZIXB 3JZMA 4MVCA 4DA8A 1CUAA 3BL6A 3P9NA 1YDFA 1NVVR 1FX1A 1QCDA 3I9KA 3OOWA 4LCEA 3F90A 4LISA 4MV3A 2F64A 4E1AA 5TC4A 4UM9B 3LGXA 4CGZA 4JBYA 3ZI0A 2XUQA 4Z3OA 4MO2A 3Q85A 4CR7A 1M1ZA 1U6KA 2JFXA 1MC8A 2PT6A 2RH5A 4ZVSA 4CMJA 1AS2A 4Q4JB 3HSYA 1O89A 2VTBA 5CVVA 1RHJA 1J0DA 3RF7A 5FKJA 2QR3A 1GO2A 3WLNA 2OO5A 4V1CA 3ABQB 4DQLA 1TQ8A 1CR4A 1DPFA 1B4DA 1F60A 1RQPA 3FPJA 4DCTA 2M2IA 1DG1G 2BI7A 4F1KA 5FOXA 1M7GA 1E18A 3HP7A 1GTL1 3I39X 3FPLA 3CE6A 3WGNA 3WMEA 1AU9A 1SHTX 3H8SA 3NFYA 5K3FB 2HLDD 4MCTA 1I5EA 2YMMA 3KQWA 3PP8A 3TI7A 1ACJA 3P1JA 1ZP6A 4J91A 2WHEA 2VP4A 3JWGA 4H6WA 2FSIA 3NXHA 4OHVA 4BQSA 4ARUA 1OFVA 2NM0A 2PL9A 4LXGA 1L7BA 4AN4A 5JSZB 3FDXA 3RUDA 1W0KD 2O2EA 2AVDA 5D86A 2RJ3A 5M7EA 4DMHA 3I23A 3QLUA 1C1XB 1RC1A 2OV2A 1Z12A 3IQHX 4LSZA 3VKVA 3ZY6A 4PGMA 2XX3A 3PTAA 3G8YA 1P5FA 1W34A 4R8RA 2OA0A 3FYDA 1GY8A 1EUQA 1MQ8B 4JP8A 4GI7A 3ER8A 1U2GA 1RKUA 4GPIB 3S1AA 1E2FA 1LNSA 1ZYUA 3FZNA 4UE2A 4EYKA 3KZXA 4H7JA 4V2UA 2D1TA 2LIPA 3L6RA 2KPOA 1Y6QA 4TX1A 1TJ4A 2FSUA 2ORIA 3C41J 5GY7A 1QGAA 2FR1A 3CX4A 1PGNA 2AQKA 1U1FA 5JSFA 1B8NA 1UZMA 3CH4B 3BE8A 4GQAA 3AONB 4JKYA 2WEKA 4P7KA 4Z5HA 1T5IA 1Z2DA 3H87A 5C8YB 4L50A 4UTZA 1NTOA 3U6KA 2NLOA 1UKCA 1VI6A 2QLLA 2UVPB 3ON5A 5L3SB 2C04A 4FJ0A 3B7WA 4CLDA 2A9JA 1CQJA 4AX8A 1J49A 4RWZA 3CE9A 1S3SA 2GCOB 2CHFA 4O2BB 1AXEA 1SCBA 2IV7A 1YS7A 4GICA 3UMCA 1UBOS 5DI9A 4BCCA 1UPUA 4IF6A 2YS7A 3WA7A 1Y6GA 1J7JA 3F7NA 4J94A 3TIFA 3WL8A 3E5NA 3KTDA 5LZ7A 4GI2A 3VV2A 1EFAA 1VXOA 5AKJA 5ETJA 3U5TA 4YCJA 3ZOZA 1M74A 1YH3A 2JJMA 2XOKD 1VSQA 5LYJF 3N87A 1RADA 5TY0A 2JG3A 1NOIA 2BFBA 2H65A 5DASA 2AS0A 2DCMA 3QNWA 1UFOA 3V42A 2BHNA 3L41A 4L5JA 3P32A 4D0GA 3WLAA 1NBAA 2ZTSA 3RJ9A 1HO3A 3IBCA 2ODEA 3EG5A 4BATA 2JJ2A 4Y2JA 3VR6H 2QP9X 4F2WA 3TG2A 2ZR7A 3LZDA 5LD2B 1K66A 1YGYA 2NTYC 4GX0A 4O02B 3FYSA 1LX6A 4MYSA 5K8TA 4OJMX 1ZH4A 1T8WA 2NTVA 3TQCA 1MW9X 3CWQA 2C03A 2PUTA 3HMKA 1YWGO 4PZZA 1KH3A 1G2OA 5JS2A 1H6DA 1YQEA 1NN5A 1EBBA 4ZYYA 2CFOA 2QR5A 4CM7A 4DANA 3GW8A 4ZT7A 1E6MA 3TSAA 2H3HA 9LDBA 1ZD5A 4F91B 3PRYA 2Q7OE 3H1GA 2OXIA 1OXVA 1P0FA 1KH1A 3LNCA 4IQFA 4P0PB 2ILTA 2VA8A 4BUJA 4HVTA 4G67A 5HUQA 2X40A 1GFSA 4QDOA 4TKLA 2ZWAA 1P0CA 1UT5A 2O3RA 2NZVG 2HAEA 4ND7A 2W2OA 3SZ3A 1TVMA 2O8NA 1F38A 4FC7A 5K98B 4BNYA 1TTPB 2KSQA 2YXEA 3HLKA 5DXAA 3OAAD 1XVTA 5LUBA 3HFRA 5TS2A 4ZVNA 1KAMA 3PA6A 2QRVA 5DE3A 1XLUA 5B58C 4PLVA 3PQ5A 1U7TA 1DIHA 2XWPA 5IUNC 3T12A 3UHJA 4HH1A 4NH0A 4UHEA 3FWZA 3N07A 4MQBA 4RBNA 4LNUA 5JTTA 3FOZA 1YVPA 8MHTA 1ULTA 1YXMA 1L8AA 1QK4A 2WDPA 3BWVA 2BEKA 3CYFA 3PLRA 3Q7SA 4QGAA 5EOVA 4DMFA 4CL3A 4NBWA 5DGDA 3DFZA 3R3UA 4CQMB 2JAQA 1NNI1 1QNLA 1BGWA 1KZGB 1Z8NA 2E0IA 3U13A 5LN1A 1EX9A 2HF2A 1AXGA 5TQ2B 1U3FA 3WRWA 3O8CA 4N7MA 4I1RA 1QFZA 2Q4OA 3GJ3A 3T7KA 3F46A 5IAJA 1E32A 1L5ZA 1U8UA 3F4KA 5CMLA 5DHUA 3IKTA 4ALLA 2PWZA 2Y1CA 3TSYA 2W6MA 4BBPA 2W2PA 5A3VA 3ZDFA 2XCSB 1N7GA 2WWHA 4OJKA 4PBSA 5BO5A 1NX6A 4YY3B 1BA2A 3ESDA 4BKOA 3GJ6A 1AKMA 1ISSA 1MX9A 4H27A 5EEHA 1JLRA 1I6KA 3PLNA 1CB7A 4X8MA 4ZEOA 3VPDA 4C43A 5CB4F 3F3KA 2RK4A 1K97A 2QTAA 3EHEA 1ULSA 4R4JA 3QVUA 3EJ6A 4TTVA 4XGKA 1N0VC 3L40A 4RPCA 3BH7A 2IYTA 4GRIA 3GT4A 1J09A 5KMGB 2OM6A 5JH7A 2OCLA 2Y66A 1UJMA 2H07A 4Z3KA 2PFSA 3JVVA 1Z0AA 5GM1A 3GA7A 1PL7A 4IVZA 1E3JA 1PZGA 5K45A 3P5SA 2MINB 3DZKA 4OX9Y 4KI7A 3UC9A 3ES9A 3ZCRA 5CDUA 5HFNA 2ZYVX 4ITRC 3DS8A 4PC1A 2GSDA 2W6NA 3DQZA 4H7KA 2EJBA 4IFBA 4E5PA 2H52A 3HO8A 3MBOA 3WKCA 3CWCA 4RADA 3VNRA 2C98A 2QG4A 4Z5CA 1K1EA 3B3JA 5JE8A 4F2DA 2QZJA 5K05A 2HA5A 5AYVA 5HR5A 3A32A 3C8UA 2HWUA 3RBAA 2D06A 4DUGA 4YAJA 4F6CA 1YFLA 1M0EA 4KQFA 4WBNA 3ABIA 4MPDA 3U3OA 4C4AA 1DAOA 2HQ1A 5CEJA 1C4WA 2Q6IA 2AIRA 4N12A 1SH7A 2NAFA 4JLOA 1WMSA 2SCUA 1FNSA 5F76A 4JLVA 2R1JL 3M1YA 4MKGA 4OB8A 4PQEA 2PUBA 4BPRA 5FD8A 4XWOA 1JXAA 2BC9A 3OSUA 5BSHA 1B8VA 1MAAA 1OBFO 3HCPA 3RVMA 3QYPA 2H2FA 5AXAA 3UAXA 1TAUA 1E1CB 2Y0PA 3UOAB 2J9RA 4C0XA 3HCOA 1ZVQA 2ZE6A 3M5CA 4PQGA 4BO1A 3GFVA 1UWKA 3EH2A 3IDOA 1PNRA 2GCPA 3O7MA 1U1CA 1P75A 3AEZA 3AILA 5E6RB 2BSAA 3VJMA 4PRLA 4A27A 3LVBA 4K3VA 2MXDA 1X14A 3K6JA 4U6QA 4ZZ3A 3MD9A 4YHBA 3DFIA 1MORA 4CKXA 1OGYA 4Z7JA 2BTEA 2JJ2D 4PPQA 3WYGA 3A4YA 3NLLA 3UPDA 1FXWA 2X23A 3DZFA 2ATEA 4C9BA 3C98A 4I7EA 4JELA 1R6VA 1PK7A 5LU8A 1W75A 3EULA 1HX7A 1RAFA 5IBCA 2WJAA 1TT5B 5F51A 2OFOA 4UAUA 1RXUA 2H1HA 4LHEA 2CXQA 1SA0A 1TMKA 2J3HA 5JD3A 4K88A 3LT5A 3ZG6A 2HF9A 2FSPA 4MB6A 1DP4A 4ZO9A 4DCJA 4DIFA 4HUJA 3RUPA 4EUNA 1DC6A 3F6EX 4Y2YA 5ALZA 4MV7A 2ZUSA 4YDQA 3O94A 5G4KB 3DMDA 2EBWA 1JS1X 3BVPA 4KR3A 5JSKA 3PD7A 2O48X 4B80A 4EVQA 5AVVA 2FG6C 2FEPA 1J9GA 3WGTA 3IMEA 4BQRA 4DABA 4DIEA 1U0HC 3TCXB 3LCCA 3F4LA 1UQRA 1V5IA 3R6DA 4MRMA 4R1MA 3HCFA 1AM4D 4L72A 1TCAA 4KQKA 4PICA 1Q19A 3PPVA 4Z3DA 1O95C 1R10A 1XDSA 1II9A 1ITZA 2C4UA 2LW7A 1ZJWA 1GGMA 4CKCB 4R0MA 3LFUA 2A5LA 2JDID 4FIZA 4BHTA 1AF7A 1PUXA 2GTHA 2QDKA 2JH9A 5E7MA 2XXAB 4WA7A 1UWVA 5KTYA 1R6AA 1ESEA 2X3YA 3MJFA 1XTUA 4ERNA 1X57A 1HQDA 3GFRA 4FMBB 3L0PA 5D7BA 1JDVA 3RABA 2W6JA 3A4MA 2NPIA 1TO6A 3QQPA 3ADBA 2IEGA 1JB1A 4ZOCA 1VJTA 2VR1A 2OP0A 1NFQA 1U0EA 1SBNE 4MDEA 2AMVA 2D4HA 3FOWA 3GLHA 3RW9A 1PKEA 2GZ3A 2WAXA 3L0SA 1NUTA 3RRNA 4II3A 1G2QA 2YJZA 3ZH2A 4KPUB 1PD1A 5DLEA 3AUYA 1ZMBA 3RDPA 2HO5A 2IH2A 1XMXA 2CL7X 3P9CA 4DQDA 1JSCA 4NE2A 2QT1A 1Q7EA 1P77A 5DNUA 1U81A 3O3CA 5FTJA 4E21A 1N1DA 1HQCA 2XVZA 1XKLA 2VIIA 2W6QA 2ZRKA 4QGGA 5FYQA 4CCYA 2W8ZA 5CXSA 2EX0A 4ZGGA 5A5FA 3HKBB 3NEPX 3TSZA 3T7DA 1OOEA 4MMZB 4B75A 2YWFA 4QFMA 5U9CA 2R79A 4ENQA 4DA4A 1PZHA 1G21B 3CRZA 2PBZA 3AG6A 1Q2UA 3E5RA 3LQKA 3MYRA 4NHOA 4Q12A 5ECGC 5JISA 3KYDA 4J0GA 3OF5A 1MOZA 4F4DA 1AO0A 3DE1X 2Q3BA 3CPJB 1K75A 4LPKA 2QUIA 3P0IA 5G0TA 4X1YB 4QPNA 1GCIA 2FYTA 2MDTA 4ZAVA 2CW5A 2HMWA 3FTNA 3TOZA 2P65A 4CIVA 5KOHB 4Y1FA 2WICA 5L6MB 3DLHA 3P2OA 2XUOA 4LDRA 2C2BA 4M9CA 1U2SA 4A73A 1S8AA 4Q3OA 1P7CA 1ABFA 4DTIA 3L8MA 1EGMB 3QG1A 3MQ4A 4JUCA 1WXWA 2AWNA 4UBOA 1NY6A 2FFBA 4PCVA 3CURA 3FTCA 1YSEA 1ISPA 1EVZA 5E6UA 4MR8B 2CJWB 5DBGA 5BQ5A 3RJZA 4DUGD 3CINA 3GOHA 5LQNA 2WP8J 1GN8A 2RAFA 3LCRA 3NUGA 1TQ4A 1MJHA 3KEMA 1J07A 1JSLA 3DF9A 3L7BA 5CLLA 2VHXA 3LBNA 1AK1A 3RGWS 3KPUA 1NQOA 2WAAA 4LHWA 2HHJA 2EKQA 3ONVA 3HNRA 1IN4A 3I0MA 4FKZA 2HYDA 1N92A 3HB0A 4FWIB 1L4HA 3L05A 1WDTA 3KT8A 1Y9AA 4B9AA 4W1QA 1JG3A 2CL0X 3FNEA 3D54D 3P5BA 2GDZA 5FTMA 4HPXB 4B3CA 3JTEA 3H6KA 4AS1A 3DDHA 1Y8ZA 5AJWA 1SIOA 2J5KA 1P1FA 2QTFA 4M46A 5DNCA 5LXTB 2VLIA 4Z4GA 2Z4SA 3KHUA 1NYRA 2WZDA 7MDHA 4CR6A 3WNZA 3LV8A 4FW9A 3T15A 1U9IA 2JGLA 1BROA 1V1RA 2QQ0A 1KKMA 3ISTA 3LD9A 3MJEA 3PUHA 4WLFA 5HQ3B 2YWBA 1OGIA 1KMNA 1Z2OX 1K88A 1OWPA 1J0AA 1TCUA 2PLRA 3A6JA 3BZUA 1EDEA 3GG2A 3GJ4A 4LCBA 4Y2QA 4J9UE 4YFVA 2GNOA 3HU1A 4OLJA 4DDWA 2JLRA 4YRMA 1SQGA 3W6PA 1WF3A 2QIPA 3VVBA 5TB5A 2XXQA 2C9CA 4U7TB 4E3WA 2Y6UA 4BO9A 4UNSA 3E0XA 1XELA 2PMWB 3MOGA 1GKUB 3C97A 3QYJA 2AG5A 1XQVA 3ZZTA 2DF8A 3MMZA 3NAMA 1JTEA 1KAHA 5BR1A 4BQOA 4KAFA 1GCAA 2VF7A 5ILGA 2CC2A 1R63A 2FWMX 1UAAA 1ZCZA 3VWSA 4OHOA 3FETA 1KKUA 1ZICA 2GYUA 1XRMA 2JHPA 4EJ6A 3SJUA 4AJPA 3OWHA 5AOCA 3TTYA 4FS3A 2JIMA 1E2MA 2PSEA 4OI0A 5AW7A 2TECE 5KPJA 1BD4A 4A2WA 1SVNA 2EGHA 1CS0A 4F3RA 3R24A 4MS1A 1ZUGA 5AH0A 5AVKA 1A88A 1QP8A 3I5MA 4LHVA 2IP2A 4NATA 2NSDA 3ROTA 3UVEA 3C43A 1B3RA 3ILXA 4OB6A 5K0EA 5KU7A 3GMDA 2ARKA 3QE0A 1E9EA 3MUFA 1ICIA 4WKOA 1GPH1 1LQTA 3HA7A 2I55A 4BP3A 3G2PA 4L0QA 3AVVA 5FTWA 1BDJA 5K0JA 4LKOA 3KOOA 4P2BA 1Y98A 5IPFA 1YVEI 4YH1A 2PUWA 3K6KA 5SY9A 3KBBA 2CXSA 1V7PC 5CIWA 4JLSA 4F9FA 4OQXA 1RWXA 4KXFB 1ZEJA 3DZDA 5BYJA 3QWGA 4TMKA 1QF9A 4I8IA 2VF4X 2B61A 3L02A 4D2IA 4BLRA 1D4OA 4JLWA 4TS3A 2FPPA 4IH9A 1LK5A 1RAEA 2Z1NA 2OGSA 1RQ7A 5LZ2A 4YRKA 2CE7A 4FSHA 3GAAA 4W6QA 4EK9A 1QIDA 3SC2B 2HJVA 2VBCA 3CQ9A 4G5RA 1DGQA 2OQ2A 4ZV9A 3ZQUA 4WXYB 3TEFA 3KVRA 1PIWA 2E5LB 1PWEA 1UPCA 5AK3A 1PN3A 2XAUA 4JLMA 1PVDA 2ZI6A 1WHSA 2VATA 4CHGA 3GRKA 4OMCA 2QX7A 2JA1A 1PL0A 1KGSA 1HL3A 1NJ6A 1KJNA 2PV7A 2PHZA 4FQ7A 1JDBB 4GRDA 1M8KA 3VU8A 1HURA 1P62B 1EEHA 1RKQA 3IRUA 3ENZA 3MTBA 2P8SA 3N2LA 3IVCA 3I8SA 1G98A 5CK4A 5D01A 2VQ6A 3CPSA 3GVHA 4E03A 3UTCA 2VTVA 3I04M 4YALA 5L7WA 2YOHA 2XCIA 1MFQC 4KH1A 4PSUA 1GCUA 1D2EA 3C8ZA 2ZULA 4DILA 2BEWA 2H59A 1PJBA 9ATCA 1HXHA 5CLGA 1JVNA 3Q3HA 3ZXSA 4XR4A 5DO9A 4GOXA 4UZEA 2XUJA 3DEFA 4A1OA 4AECA 4IMRA 3WGOA 2FFRA 3CW9A 1E58A 1PYDA 1JHMA 3OMWA 3LI2A 5FOWA 3PYLA 2KQUA 5B53A 3QPCA 3EGXA 2AOUA 2I9PA 3BH0A 4OK6A 1FXSA 2QPOA 4RLQA 3PQ4A 2FPMA 3N8KA 1PU2A 3F49S 3N2KB 3QA3E 5EMNA 5H59A 2JLWA 1UF9A 2R6R1 5KPDA 1XDDA 5EPEA 2ODQA 5DT2A 1N57A 1XYVA 2PK3A 2GMWA 4WZAB 2X0DA 1CRPA 4M38A 1ZDMA 3G89A 4OK3A 2O8DB 2VJYA 4GWLA 2WA1A 2XMCA 1K6XA 1EGQA 1MVLA 1ULAA 3IUEA 5AHWA 4QFCA 2O8BA 2JKYA 3LPCA 4D0LB 5C1DA 4PSAA 2VYNA 5M3BA 1G7SA 1CY0A 3ETGA 1DFHA 2PWYA 4JMPA 4A5SA 5JSQA 2WE8A 2ZETA 4GNRA 1R0CA 1K0UA 5FNVA 3SLRA 2MYPA 1AJEA 4M6WB 5H82A 4JY7A 3R09A 3H1AA 3OQIB 4D9BA 4TZKA 1QZZA 1SBYA 3U7JA 2BEUB 3OZGA 1A72A 5KKNB 4R8MA 5AI8A 4NKRA 3IVAA 4KUEA 3JPYA 5D3KA 4KN5A 4YRTA 4C03A 3M2PA 1H6CA 1TYBE 2R751 4PPYA 2QLFA 3AGPA 1CETA 2JI9A 4H31A 3EGDA 3FW1A 4LK3A 4P4GA 4W5WA 2XD4A 1P3DA 3AM3A 2I2FA 3SS7X 1Y8CA 4A2QA 1CEYA 2JI6A 3NJRA 2CXOA 1XDUA 2IYEA 2K2QB 1XCJA 5T6MA 2XKKA 1FS4A 2CN1A 4PFQA 5ELMA 2GTPA 3L8HA 2VPWA 3AF2A 4ZWNA 1IBKB 2AUWA 1QQ5A 3ZBTA 2R8YA 2VJPA 2WU0A 3QIAA 4KQIA 3T52A 2O2JA 1CERA 4DMGA 1SM4A 3T5GA 4ZMRA 5L4LA 4G0WA 3PEEA 4I2NA 4I5EA 4WV3A 3SXJA 3H0KA 3WBBA 2CBGA 1U0LA 5BQ3A 4BMXA 2PFGA 4XVRA 4UOEA 4HFRA 4OGFA 1WZIA 3KHSA 2WJVA 2AUNA 5KAMA 4RTQA 4NENA 2Y1FA 2C96A 2YXPX 2DFKB 4G97A 2EQAA 4FE4A 3AF1A 2OYCA 5AM3A 4W5OA 5BSGA 5K0CA 3NHUA 2ID8A 1QB8A 3EBPA 4L0CA 3CNQS 1Z45A 2ZROA 4EKGA 1WEHA 3K4QA 4X0EA 1ECFA 1L1FA 4CFSA 3OFSA 2DJ5A 3ZWCA 1JTFA 2W58A 2BF7A 2PUCA 2J3QA 4HATA 4C6TA 5DLQC 5C32A 4E2FA 3GPIA 4MTCA 1VA4A 4QQ8A 2ABWA 5T6BA 2J4CA 2F90A 1W2GA 1XNJA 1UFKA 3EY4A 3WFJA 1YFZA 1VI5A 2X9VA 2PL1A 3OKCA 3MHTA 5M34A 5G1OA 2PR2A 4HWSA 4MGEA 1IOWA 2D1QA 1I7LA 1WXDA 2N47A 4HSGA 1FTNA 2G7MC 2A58A 3PHCA 3EXFA 4UPEA 1V8ZA 3DHEA 2XB2A 1ZI6A 1Z5NA 3EOZA 1UBCA 3PUWA 3Q0IA 1P4GA 2Q3MA 3RGGA 3OTOB 1OAAA 1ZNYA 4WRRA 1ZJJA 3IODA 5EG5A 4N3CA 1QKJA 4M8NE 3HKDA 4M55A 3RBZA 1U4SA 1PZMA 2PXCA 2FQWA 1ZD1A 2ZRNA 4HFNA 4QGSA 2IFTA 1ORVA 1AGXA 2LRHA 1SG9A 2PPLA 4JUIA 5EVCA 1X7WA 5K8VA 4BYGA 2JVJA 3M4YA 1Z7GA 1E0JA 1K9SA 3LLUA 5K3OA 5DX8A 1VMIA 4RACA 8AT1A 3Q3VA 4E51A 4IJKA 1FDOA 3OP1A 3QUCA 1T2VA 2EFGA 5KKAA 3SS8A 5BVHA 1GPJA 1LTKA 3BTVA 2NUBA 2VTDA 1RFGE 3VSCA 5LLSA 1O7JA 2OZLB 3CSSA 5C5IA 4CEIA 2GETA 3CRRA 3WGZA 1PKXA 3A4IA 2AHOA 1U0JA 4GPD1 4RENA 5FULA 4GLJA 4EG4A 3NBMA 2Z95A 2C8VA 3MT0A 3ZHUA 2Y92A 3LQXA 2XWJI 4PAOA 1KIAA 4MA0A 4UM8B 3G0TA 4F5DA 3KLPX 8LDHA 1SN7A 2QYTA 4M60A 3H11A 4JJ4A 2JFBA 4RK4A 2B0JA 5EKTA 2Y0DA 4GQMA 4MR7A 4Q00A 3EOBI 4EJSC 1ZSYA 4HR7A 3T5TA 4NZPA 3HK2A 3QXHA 4MPPA 2HA6A 3GVIA 3V4FA 2JHFA 2R85A 3EF0A 3RTBA 4ADSG 3KM0A 3STWA 3DR3A 3IP5A 5EC8A 2JLZA 4IWXA 5F73A 1PDVA 5EIEA 5G3YA 5MN4A 4KHPB 4HAWA 5ESDA 4DFDA 3W8EA 3WK6A 2XUAA 4P3KA 1G20A 3R7WB 5HIIA 4J7XA 3B5EA 3HFJA 1T6YA 3FPGA 2FWBA 1FVHA 4OH1A 4ZJZA 3ICEA 1CE8B 2WUEA 1MNAA 5IKMA 3WGYA 3LGSA 4IEFB 2VYND 3PNBA 4IKPA 1PJLA 1QKKA 3PQ7A 4J9VA 5KVAA 4JLDA 4RC9A 1P0IA 1FW8A 1QOZA 4ZOAA 4UC0A 2PPXA 4LRYA 3DKIA 3U2QA 3UAZA 1GZDA 3HG7A 2IOFK 2RKBA 2AD5A 1DKQA 1KIMA 2QROA 2PIDA 1JAZA 2BKEA 2DHQA 2C3YA 2WTBA 1UH5A 3ORQA 4MQUA 2WU8A 3OEEA 3TEMA 5GAGi 3NHMA 1QP0A 5AHOA 3H99A 4U6NA 5FH9A 1CUZA 2J9FB 3Q3CA 4US2R 3DA8A 2NU8B 5GV8A 4C0HA 2B6NA 5F5NA 1CP3A 2VHWA 3R5HA 4DL9A 3TLJA 1ENOA 3SC3A 3PJFA 2D1RA 5F7JA 3R1IA 1L7VC 3A14A 2R63A 3MMNA 1AHIA 4LMPA 4Q3BA 4R3WA 1K3TA 4LOHA 4TTTS 3QX8A 2V97A 4DLXA 2OKCA 2VXBA 4KXQA 1KKLA 3IPCA 1RW4A 4L5YA 2C3UA 1V5GA 1GGEA 4U9UA 1XF9A 4KIJA 4NZYA 4WXHA 5CNIA 1RWWA 3H8VA 3JQAA 4JVOA 2V7TA 1M33A 3UUFA 2KYRA 5ALHA 2AWOA 2JAOA 3N2GB 1JEYB 3JYHA 1JG4A 4W7SA 2V7XA 3OOSA 4YRRA 3K5PA 4RIGA 5B1YA 1L7NA 3K96A 2ZYAA 4W4TA 2CXNA 5I48A 4EHHA 2Q2NA 4JGGA 4QPCA 2GI4A 3EVFA 5T8KA 5GZ1A 4D81A 2AFHB 5I45A 2UVDA 3O4FA 2WUGA 1LGYA 3WYBA 3JQ6A 1PWZA 2HK6A 4GP9A 1OWNA 2QEQA 5DFAA 2OFYA 2WJ6A 2B37A 4H7EA 4I1YA 4IDEA 4OCZA 1OLSB 2ADFA 4MUKA 2Z56A 3KXAA 3IVPA 4YCAA 1E5DA 3V8EA 1DAHA 5LNK6 5ICCA 3GLIA 8ATCA 3X1JA 3OQHA 3VOTA 3ZHIA 3LY5A 1I4WA 5AO9A 5BN4B 4F21A 3G2OA 3ELDA 3GF4A 5CEEA 4OB7A 4PPGA 1P44A 4TVSA 2J9ZB 1A3CA 1TAQA 4I50A 2VK8A 4LXTA 1UODA 3T5DA 2QAJA 3A9UA 4GI5A 2FLWA 3E82A 4C3UA 3M83A 4D0SA 4TN1A 4JC4A 2F1JA 4NOJA 5AFSA 5JASA 5HYVA 3NFRA 4MKFA 2PUGA 4WOCA 4TQUS 2AG6A 5HJ2A 1KXZA 1PEYA 3HCCA 4V1CB 3TTSA 3EGEA 5JCOC 5CNMA 4UOZA 5GVRA 1BXRA 4OM8A 4BNIA 5CVUA 1XK6A 1AB5A 2VF2A 5IVHA 3A10A 5KDOA 1XL1A 1CUIA 1ZO8A 1AQ6A 4D1YA 4G25A 2CCGA 5EKUA 4A8JC 4C6HA 3FCYA 4ZAFA 3BJEA 1E0DA 1QF7A 4BP9A 5L3QA 3N0WA 1C3OA 1EK0A 4NS4A 1D6NA 4F93B 2PY6A 4FDLA 5AKKA 5DEOA 3SF8A 1U5BB 4PX3A 2WKWA 1L4BA 3R74A 3VYVA 4DB4A 2DT8A 5KC8A 1KC1A 2UUBB 4LGVA 2IXTA 4DEXA 5ITSA 4O2AF 2HRBA 3PQ2A 2OLEA 3TJZA 2RH4A 4CV1A 3EQ7A 4FN3A 1Q0PA 3ZV5A 3O8OA 1Y3IA 5CNJA 4I1OA 3WDSA 4QOFA 4KITB 1GPYA 3ZZMA 4AP9A 4LW8A 4MEAA 1J8MF 2A3RA 1RKBA 4JKIA 3CIFA 1Y1TA 1V8PA 4J0KA 4A8HA 3Q2OA 3DNVB 2AJ8A 1M1UA 4J0EA 3BIWA 3V34A 1XVAA 3G2JA 3BHNA 5KX5A 1B2LA 1OCEA 4NU8X 2GCGA 4J90A 5A5EA 4B34A 3EFOA 5DP1A 4DZZA 1OE0A 2WTAA 4F12A 1TUIA 1IAVA 1JQ5A 1ODSA 4L3OA 4DUPA 2WK1A 4BDTA 1DOZA 4IILA 1K5PA 2JRLA 1ML3A 4X4HA 4KWTA 4A9AA 2V4UA 2EFEB 4JQYA 4JAVC 3QSGA 4TYWA 2EJVA 1X38A 1E6CA 2P4HX 2X1HA 3DE5X 3DKKA 5AP9A 4TTQA 4RA9B 1GQOA 2BTQA 2IHNA 1N9ZA 3FBTA 1AY0A 3DP7A 1D0IA 2YWXA 2OBYA 1Y33E 4RAOA 4E30A 4F86A 2IKSA 4ZCSA 1PV4A 1BWQA 1T5BA 1XQXA 5D87A 2R47A 3K05A 5AVXA 1L5GB 1HFWA 2QY6A 3FKQA 1X9IA 1IN7A 3PRKE 4HQ0A 3G2IA 1ES9A 3T7EA 2ZXUA 1ZD9A 1BU8A 3U3XA 3OEED 2HNKA 3IV7A 3ZWXA 2RGNC 2J87A 3B2NA 2ZQYA 1ZIYA 1XXHA 2BFBB 1HZJA 2CLSA 3CSDA 4TTSA 4MQ6A 2M9MA 3PDCA 5KJFA 3A3NA 2CUKA 5J47A 3B1KA 3OIWA 4KQHA 1EHCA 2ZVQX 2QIOA 1CC1S 5FEMA 1BYUA 1TOAA 1KY3A 2FX5A 3N9IA 1M1NB 1Y4SA 3EG9A 1GQFA 4PYOA 3S0JA 4FGZA 1N2EA 3AWIA 4BP1A 3LBIA 3RFTA 3EZ7A 1DV2A 5LBIA 4JXKA 1PJQA 1RWMA 5LQUA 4L8GA 4W8OA 1VMAA 3DZBA 4N0DA 2Y77A 3KEGA 1DJNA 3U3DA 2D7JA 2XT6A 4N9QA 3MAAC 1KE1A 1W36D 3JQAD 3RYIA 1RCUA 4M1OA 4NMXB 3PV0A 2CHEA 4Z54A 1LLQA 1U28C 3QI2A 1ZHFA 3UATA 2WUSR 3WL4A 3VJRA 1C0LA 2A1TS 3F6PA 4N1AA 4NZZA 4BBAA 1HEIA 3ANLA 4E2XA 1OH8A 3UFBA 2QVZX 1K7CA 3C3JA 2G28A 3JZDA 1R4MB 1YSCA 4H1UA 4MW5A 4NE7A 4WECA 1NPDA 5FHQA 5HZHA 3JQPA 2A6CA 2Q3EA 3CNEA 3WGIA 3DULA 3R5FA 1V4VA 4L07A 1B8UA 5K4GA 1X7XA 1XTQA 3TUIC 3NTUA 4M7WA 2QRVB 3W2IA 4HWTA 3DDNA 4XX0A 4ZT6A 2UZ1B 4UFPA 4P92A 10MHA 2O3SA 3IAM1 2VDKB 4LI0A 4LNUB 1WUKS 3ZS8A 4NCAA 3Q9UA 4NPHA 4N3BA 3PBKA 3TVTA 4WFJA 4YI3A 2BFWA 2VJNA 3CVWA 1YIDA 2CXPA 2N1MA 2QTWB 2QJFA 3W8FA 3UPUA 5AW3A 4ZDWA 4BB5A 1YB5A 3L04A 4OI2A 4ZYXA 1EMDA 4GP6A 1NMXA 4BNTA 1VE9A 4XI9A 2V03A 3RU2A 3EEOA 3WYDA 5INTA 4M1KA 2A5JA 5IJ0A 3ACCA 4WK2B 3WWOA 4DWOA 1QG6A 2L19A 1VPTA 5BWOA 4IIYA 3P7MA 1N6HA 1SXJB 3AFNA 4AQDA 1NX9A 1SUDA 4KFCA 2NP7A 3ZU4A 2B98A 4Y18A 4I5GA 3WADA 3UFXA 5CD1A 1KU6A 1L3BA 1O77A 3B5JA 3FX2A 5JWOA 1T91A 1CY1A 3AJAA 3CN9A 4CMEA 2SECE 1VP3A 1VBFA 3ZTWA 2HZBA 1QTQA 1IB0A 1U9CA 4UUBA 1YKSA 1QR6A 1Y9EA 5HQJA 3NORA 1QO7A 3JSAA 3SNHA 1JQAA 4I46A 2NU9B 4Q7JB 1QZXA 1N75A 1TQHA 3BQNB 3DV2A 3TQOA 5DMXA 3W2GA 1UBLS 4E88A 2GLXA 4HEA6 3LF1A 1JMYA 1OWOA 3B2EA 3QKRA 4HTFB 5DLPA 4F4IA 3A2KA 1E2LA 3I6BA 1LPOA 4H1HA 1CEEA 2OAEA 3EUAA 3GEEA 3O9VA 2QUBA 5F1YA 3BMCA 4BEWA 5JAMA 4DJ5X 4YJDA 2O20A 2EF0A 2C78A 3O38A 4FHZA 2XV1A 5B4VA 4N41A 5KUTA 1Y80A 2IXGA 4BFYA 3OWXA 4KVAA 1UKYA 2EJCA 4YHHB 2XUHA 1FJGB 2J6IA 3CX3A 3FB1A 1JLHA 3BKWA 1HDGO 2X1VA 5EEGA 4RX1A 3FH0A 5FL7A 2P9JA 5GAJA 4LRXA 4CE6A 3CTMA 4YMUA 4DSUA 5AVTA 3WJ2A 4D97A 221PA 4IDBA 1M7BA 1DTWB 1DOHA 1MG0A 3KRTA 5REQA 4AY2A 3V6LA 4FFBA 1F06A 3A9ZA 1NV8A 1JFVA 2OFPA 4HUTA 3TAXA 4HZIA 4XWYA 2OV4A 3K15A 3GLTA 3GFFA 2E5FA 3FF1A 3JQBA 3R6GA 1RRPA 1JSXA 1FS6A 1EE1A 1K5DA 2IXDA 2IHBA 3BZBA 2SCUB 3EC7A 5BWNA 2UUPA 1GQRA 2H17A 4JSRA 3A28A 5IMBA 3UQZA 4L8WB 5J2TA 1ZITA 2ZG6A 1WLSA 4QYIA 3SMVA 3S29A 1EGHA 1G8FA 3PNMA 1THGA 4P4SB 3OEYA 4P5PA 1O97D 3K1TA 2QMQA 4ZZ1A 1LW7A 3T3IA 1QIFA 2NYUA 2O4AA 3TINA 1JG1A 3FOAA 3S8YA 4LJAA 5DGCA 2GKGA 3W2HA 1GA4A 1OIWA 1FFHA 2OXEA 3QLEA 3PVCA 2OBFA 4JJGA 4WZBA 5AHKA 2O3TA 4FSXA 1H4VB 2FRDA 4HDKB 3QZUA 4KAJA 2C31A 1TLFA 4I6UA 1QDEA 2VEOA 1T5HX 2GAIA 2NSHA 2QN9A 4FFSA 4G1BA 2FPIA 2VJLA 2IITA 1R8QA 3L7CA 5D1NA 5DM4A 1CZLA 4B79A 4AX4A 3GHYA 1CCWA 1H3FA 4HKTA 5FBLB 3VR5A 4NQRA 3MWYW 3L06A 4IHQA 3O8DA 1XEXA 3IQFA 4ZOEA 2B3TA 4KWHA 3WLTA 1A7KA 1HFKA 1KOLA 3WLMA 4FE7A 1DBIA 2QI9F 2B7CA 1JHVA 1HTTA 2WT8A 3L7NA 2J31A 4P3OA 3GC6A 1PHRA 4B45A 3NPMA 5HFAA 2ACVA 3KLMX 4CKEA 4ZC1A 2E4VA 3ZWVA 2JQEA 1HMPA 3EB9A 4RORA 1PR9A 821PA 4X95A 3RIYA 2H31A 3KX2A 4DXDA 2VPQA 1AK2A 2IVZA 5LBTA 3TIIA 1RQRA 3EDMA 1P2VA 2XUDA 4RKQA 2IE8A 4CETA 5AW2A 4GPEA 3NHKA 3VR3D 2XR1A 4HNAB 1QVRA 4MRMB 3VK0A 2VAPA 4EG1A 4GE0A 1D04A 1ZCBA 2A30A 2DWPA 4HT3B 2G77B 3IHLA 3MK31 1XYGA 4G9BA 2VP3A 2Z6AA 4OJTA 3QF3A 4OL0A 3V80A 3CUEF 5IVPA 1O58A 5K3EA 4C7OA 4IQ0A 5HM8A 1QZ3A 1YAHA 4OY3A 1ZC3A 4OQPA 1YBFA 4IZ6A 3USCS 4H08A 1YDMA 3C5EA 2AL7A 5B6IA 3AETA 3TNJA 2YIMA 4L9AA 3MMSA 1WCIB 2O2ZA 1BOFA 2F17A 2KWIA 2VQEB 5DZSA 1EI9A 1TL7C 2QQ5A 2BBSA 1QCYA 3EBLA 2G9VA 1YHZA 2IXAA 4MVJI 1ZINA 1JG7A 4BWGA 5A6SA 2MMCA 4R6WA 1L6IA 4OA5A 4NMLA 3UXHA 2DBVO 4D56A 4EQ6B 1HSOA 1P5RA 5D3MA 3BX1A 5DK4A 3ED1A 2EXXA 1A9XB 5CK5A 1Q21A 1HDYA 2C7RA 2VXCA 2R00C 3G59A 3PIIA 2R3SA 3U7GA 4ZMSA 3QENA 1DTEA 3AZOA 1ANKA 1UXJA 3KKEA 4MLDA 2Z2KA 4OP1A 2XWBF 1US8B 4EJ2A 2MWMA 3EAQA 1L5KA 1IDOA 3FROA 1BN7A 4EBBA 1OYOA 2PS9A 4Q16A 4DCGA 1BHO1 5THXA 3SN6A 1T9ZA 1S1MA 3HDQA 4FYXA 5PNTA 3QQ5A 1R8YA 2X0EA 1K06A 1N25A 3KJFA 1SRRA 1VKHA 3P9ZA 1MJGA 1DEHA 2O52A 2XDYA 4IOMA 4D4LA 3OTQA 1Z17A 1G21E 1IMOA 3FGOA 3ZQJA 3OJCA 5LQJA 2VHJA 5KYVA 3QSYA 1LDEA 4E2WA 1P1BA 1F6DA 3UV6A 5JZVA 2YVKA 1HRKA 2JGDB 2OR3A 1EH5A 4WNCA 1JYSA 4JH0A 3ROGA 3HO6A 1T1SA 1NC3A 3ZV6A 2CWWA 4CI9A 1K8RA 2GRLA 1DC7A 1GITA 3OC0A 4PXSA 1ONOA 1HOTA 1ZS9A 3QMVA 4JQOA 3RVBA 2OV8A 5FL7D 1WW8A 4FDVA 5FFMA 5FR1A 3AY7A 1YZTA 2KB0A 4Z9FA 1QHYA 3F0TA 3AHIA 3IAFA 3OCYA 3L8DA 3ONNA 1LDYA 1TU3A 2QSUA 4UEQA 3R5TA 5E6UB 5I9BA 3TOXA 1JECA 1NRJB 1V39A 4URFA 3VYSB 3KZ3A 3SX0A 4FI3F 1J06A 2Y1DA 1L1EA 3OZEA 1MHPA 1I3MA 2GN6A 3WIUA 1MQAA 3VAAA 4DV4B 1RYHA 3CLVA 3D6HA 3NBXX 3VPCA 1SCUA 2EIXA 5JI2E 3HABA 3IRVA 3MG9A 3BT7A 3WLHA 5T4HA 4FFNA 1JJBA 3ID6C 1KDRA 1Y8RA 1JKJB 3AY6A 4WXRA 1T9KA 2PZEA 3FNRA 5I7VA 4ASUA 4DLBA 4ZCMA 4ZCIA 4E12A 1JTVA 2LIVA 3G0CA 1P2GA 2JS7A 1MABA 2D0PB 1DW9A 3BB1A 3JATB 4FEEA 1X1EA 4OQNA 1LTHR 1X9GA 4B2LA 1V1RB 1QQ7A 2L0XA 1NW5A 4ZOLF 3CGWA 1UL1X 3QXXA 3V00A 1E3WB 2FOXA 3KDPA 4LYHA 4W9MC 1DAFA 1KMHB 2P4QA 4EYQA 1ADJA 2E49A 1OBOA 4GLFA 3VR5D 2ZVJA 5DWQA 2EJWA 3B36A 3PX2A 2QE7A 2V7WA 1E2GA 3DHWC 1T1IA 3HXLA 3L7YA 3QVGA 3W4JA 2XA2A 4CUJA 2QW0X 1WPXA 2LD4A 3GLKA 1M2WA 4V0ME 3DNMA 4ZREA 2PU7A 3V1MA 2SKDA 1P9WA 4Q4CA 2C9YA 4PS1A 2P0YA 1N7IA 5KYKA 1A2BA 1N8KA 4OI1A 2XCUA 5KYXA 1AN0A 1NQWA 4C6RA 5IXJA 3MUEA 1IZ7A 1AQNA 4K6FA 1LJUA 1A7UA 2EWTA 2NACA 3KR2A 3ONFA 3RIMA 3U62A 2QL9A 5K4HA 4DIMA 1B93A 1TZMA 4CDRA 4I5DA 1OX4A 1J1UA 4JJ8A 2AYZA 5CT4A 4M0FA 3TLKA 4S05A 5CEFA 2AN9A 1PEDA 4PYQA 1CS0B 4I55B 3CW2A 2P11A 4MGKR 3U9SA 4MS1B 5CFNA 1Q6ZA 2WM2A 3OFVA 3T1NA 5IEJA 2HMAA 1RVDA 1P74A 2HWYA 2XIJA 1SB9A 3AOGA 4I5IA 4QWMA 4TS9A 3RC9A 1BRMA 1Q0SA 3C1TA 3GPCA 3QVVA 4DB2A 3RSLA 3BTOA 1CKEA 3G9ZA 2O1WA 3CW8X 2PUFA 2ZI3A 1FYEA 3RFXA 1RYZA 3O4RA 4IFTA 1DIGA 1ESDA 3SOZA 5KTMA 3SJ7A 1AOXA 2G9RA 4I3HA 3IULA 4U00A 2D2EA 1XJWA 2WVGA 3QPAA 4PXYA 5CH5A 4GMGA 3RD5A 3V4SA 2YZGA 2NIPA 5AOAA 4DCCA 1EWKA 2XQIA 3BDAA 1JN0A 3ESAA 5IF3A 3TNLA 4XH9B 4L78A 1Q3KA 1T2EA