4ER6A

Crystal structure of human dot1l in complex with inhibitor sgc0946
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
338
structure length
335
Chain Sequence
KLELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMENYVLIDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTTQPMKLNTRPSTGLLRHILQQVYNHSVTDPEKLNPFSPEVYGETSFDLVAQMIDEIKMTDDDLFVDLGSGVGQVVLQVAAATNCKHHYGVEKADIPAKYAETMDREFRKWMKWYGKKHAEYTLERGDFLSEEWRERIANTSVIFVNNFAFGPEVDHQLKERFANMKEGGRIVSSKPFAPLNFRINSRNLSDIGTIMRVVELSPLKGSVSWTGKPVSYYLHTIDRTILENYFSSLKNPKLREEQEAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Histone-lysine N-methyltransferase, H3 lysine-79 specific
publication title Catalytic site remodelling of the DOT1L methyltransferase by selective inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 107
structure length 335
sequence length 338
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2012-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08123 DOT1 Histone methylation protein DOT1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.60 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) 434 Repressor (Amino-terminal Domain) 4er6A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4er6A02
3BGIA 1JQ3A 4PNEA 1VP3A 2YVLA 1NW8A 3NVMB 2YXDA 4XCXA 1F38A 3UZUA 1ZG3A 2ERCA 3OFJA 4RTOA 3FYCA 4PYKA 4KVZA 4POOA 4FP9A 4C08A 5LQCA 3OPNA 3OZTA 3GNLA 5DSTA 3UFBA 4YUYA 3P2IA 3PLAE 1YZ3A 2QRVA 3A4TA 4PGHA 2QM3A 2WK1A 1G8AA 2NXEA 2ZWAA 1X19A 3P9NA 5CVVA 2IH2A 5GP1A 2PXAA 1BKYA 2YUIA 4P7FA 3RODA 3C3PA 3KR0A 3U81A 4BP1A 1B42A 3NWBA 2ZULA 2XYQA 4PONA 4EKGA 2PX4A 2QRVB 1HMYA 2V74B 3C0KA 2ZVJA 3P2KA 5E9WA 3DTNA 4A6EA 3TR6A 1UFKA 3H2BA 1YF3A 3HVIA 4UOEA 1SKMA 1M0EA 2XBMA 2ZZNA 2IP2A 3CJRA 4GOND 3VC1A 3ER9A 5DX0A 3THRA 3TOSA 4IV0A 2VZ9A 3EGIA 2ESRA 5HOQA 5GIOE 4R8RA 5IKMA 1NV8A 4A6DA 4JXJA 2G70A 3KQMA 4BY9E 4M38A 5G02A 2O57A 3G89A 3KQPA 5LR6A 2P41A 1KXZA 2ZTHA 1JR4A 2IDKA 3DMHA 2EG5A 1SUSA 3AY0A 3V97A 4C04A 3BWCA 5D1NA 5EGSA 3UJCA 4WVLA 5K09A 3QOWA 2AN3A 3KPWA 3KQOA 3SMQA 3PTAA 1YFLA 2CMHA 5EMLA 3UJBA 5K05A 2WA2A 2WA1A 3FPGA 5CCBA 2OKCA 3DULA 1G8SA 3G2OA 1NBIA 4E32A 5IH3A 1Y8CA 3HCCA 4P7JA 2IPXA 5CIYA 4C03A 2AN5A 3DLCA 3M4XA 2AOWA 3EEYA 3BZBA 4EMSA 4F85A 3E23A 4ER3A 5CCXA 1P39A 3LKZA 5KVAA 3FZGA 2AZTA 5ICEA 1MJFA 3UJDA 4LWOA 2ZSUA 1XCLA 2UYOA 4QQNA 4PYNA 5BP7A 1VQ1A 5DRYA 3G2PA 3HCEA 1NE2A 3NJRA 2ZIFA 2JJQA 4FZVA 4QTTB 1NW7A 3G8AA 3HVKA 5FHQA 2QYOA 3NMUF 5EHGA 5KQSA 1RJDA 2PJDA 3K6RA 2GAFA 2QE6A 4PYMA 5DM1A 5B1SA 5T6BA 1P1CA 4RYLA 4CTJA 8MHTA 3CC8A 4XUCA 5ICGA 3M6VA 3PFGA 5CM2Z 4RTNA 4PCAA 3AJDA 3EVAA 3HCDA 3FYDA 2ZCJA 4U7PB 4HTFA 2YXLA 4OX9Y 2PT9A 1DL5A 1TW2A 2PWYA 2B3TA 3AWIA 4FS8A 2HNKA 1YB2A 2DULA 3EVDA 4EKIA 3MB5A 2NYUA 4L7VA 4RWZA 5EPEA 5HIJA 3FTFA 2AVDA 2FYTA 2Y1WA 3OE5A 4DM3A 2OB2A 2OYRA 3HA3A 4HTFB 2EX4A 1P1BA 2OZVA 4IV8A 5CUQA 4YMHA 3ER8A 2I62A 4YV2A 3A27A 1VPTA 3KHKA 5E1BA 4X61A 2JHPA 3T7TA 2PX5A 3C3YA 1BOOA 1X1DA 3EGVA 5LQUA 2JHCA 3P9CA 5FA8A 5LQNA 3AXTA 1SUIA 4E2ZA 3O31A 4QTUB 5C9ZA 1O9GA 2JG3A 3QV2A 3HCAA 5CVJA 3REOA 4MWZA 1IY9A 3GRVA 3KQVA 2VS1A 4XUDA 3A26A 3EMBA 3ELYA 3HCBA 2HMYB 3B89A 1Q0SA 5EEHA 2ONYA 2ZBQA 3FPEA 3X0DA 4YMGA 4KIGA 1ORIA 4PCLA 1R00A 5JR3A 3FUVA 3MERA 4BLUA 5DTQA 3S68A 10MHA 3LHDA 3SSOA 4M36A 1VLMA 1H1DA 5KYGA 4AUKA 2JH8A 2GA9A 3FRHA 5DWQA 2AOVA 5K0LA 1WG8A 2C7RA 4E2YA 1XCJA 4FSXA 2PBFA 2BR4A 3BGVA 3EVBA 5DPMA 4E33A 2B9EA 2P1DA 4RTSA 5GOZA 2Q41A 5FWAA 2IDJA 3SSMA 2ZBRA 1R74A 1RI3A 3C6KA 3LKDA 1KR5A 2ZW9A 5LSAA 2BM8A 2P3QA 4IKPA 4OBXA 5DM0A 3HEMA 5LQRA 4ER6A 2IFTA 3DR5A 3JWHA 4QVKA 5JUWA 2VDVE 5FWDA 4HH4A 4K6MA 3DH0A 3UJ9A 1FP2A 4P7KA 1KP9A 4YUZA 3RW9A 3EGEA 5EG5A 2PX8A 3ELUA 3LCCA 2UYHA 1EIZA 3HA7A 4RSRA 5FHRA 5E9QA 3OU7A 4KW7A 1XTPA 2PXXA 2AR0A 1ZGAA 4GQBA 2IH5A 3CJQA 4RTQA 3B5IA 4PWYA 1X1BA 3FPHA 3A7EA 4V0QA 3C6MA 3IEIA 2C7QA 2B25A 3TKYA 1G60A 2PLWA 3P97A 4F84A 5K01A 3G8BA 5E1OA 3KR9A 2JH9A 2I9KA 3LDFA 3NTVA 2N47A 5P8WA 5BXYA 3KR1A 1XDSA 3SSNA 3GIWA 1KYZA 2NXCA 3BGDA 2NXJA 3ID6C 5DM2A 1M6YA 3SR4A 1WZNA 3DLIA 3GWZA 3ME5A 4PIMA 5EC8A 3T7SA 3THSA 3TPZA 3I64A 4RVHA 2IIPA 3ERCA 5HEKA 4RTMA 2I7CA 1DCTA 2HV9A 3OU6A 1R18A 5EEGA 5KS2A 1TPYA 4HGZA 5HZMA 1XDZA 2AVNA 2OB1A 2YX1A 3LBYA 2ONZA 5E1MA 2O0LA 2ZLBA 5C0OE 3JWIA 1VIDA 4AZWA 3EEOA 3IHTA 3JWJA 4KWCA 5E8JA 1JQDA 3FTCA 3UJ6A 2KW5A 3TKAA 1X1CA 3NDJA 1V39A 4RVDA 3OFKA 3Q7EA 2F8LA 4X60A 2HR1A 1RI5A 3HVJA 3KPJA 2AOUA 1I9GA 4KDCA 4RTKA 2K4MA 4DZRA 3EVCA 5U4XA 5K0GA 7MHTA 3M6XA 3MAGA 3O4FA 5DTMA 4QVGA 4V0RA 5CD1A 3BT7A 2R6ZA 4QPNA 1RI4A 2BM9A 3KKZA 1RJFA 4PYOA 3G5LA 4QDKA 1VL5A 4KRGA 4ER5A 1RJEA 5DRTA 2AOUB 3P9KA 5K0FA 1D2HA 5T67A 1G55A 3GDHA 3R9XB 2LD4A 2PSSA 3E7PA 3NW9A 3GRZA 3M6WA 4GOMD 4H0NA 4RVGA 1L9KA 2HTEA 1ORHA 2AOXA 3R3HA 5DX1A 4GOOD 5FULA 4YUXA 3G2MA 5EKUA 3I58A 3NVKI 2R3SA 4R05A 9MHTA 1XJ5A 2P7HA 3D2LA 4F86A 4YUWA 3V8VA 1NW3A 2XYRA 3R0QA 4DA4A 5DXJA 4GUAA 1N2XA 3BWYA 5LQKA 3GXOA 3KR2A 2ZIGA 3CGGA 5FTWA 3ORHA 1EAMA 4MTLA 1L3BA 5H02A 2BH2A 3HVHA 4GOLD 2YTZA 4ER7A 5EQJB 3TM5A 5LQJA 3HA5A 1ZHFA 2A14A 5ICCA 1JG3A 2H11A 2P8JA 5DLYA 1NKVA 3HNRA 4OA8A 4RVFA 5K0BA 2ZBPA 4MIKA 1R6AA 3FUUA 3OZSA 2ZZMA 1YFJA 4GBED 3GJYA 5EMKA 3KPVA 5FUBA 3PX3A 4HRAA 3I9FA 2ZFUA 1JG4A 5EMMA 3OU2A 1AV6A 5HIIA 2DPMA 4NECA 2BZGA 1R8YA 1XVAA 2QY6A 2ZIEA 2VDWA 1WXXA 4B17A 5BW4A 3UJ7A 5K0CA 3FUWA 2CMGA 4MHTA 5FADA 2NNWB 4PYJA 3LECA 2G71A 5DM4A 2C7PA 1Z3CA 5HIKA 3M6UA 5FCDA 2UYQA 5C1IA 1N7JA 1DUSA 3LX6A 1IXKA 2ZZKA 4PYQA 2PY6A 4QPPA 4CKBA 3HCFA 1RI1A 4C4AA 5M5BA 1RJGA 1ZGJA 3SXJA 5GINE 3MCZA 1KPHA 5E2AA 4EVIA 1SQFA 1R8XA 4GC5A 2IH4A 2FK8A 4CWAA 5GM1A 4G56A 4PINA 3DXZA 2O07A 3UBTA 4KDRA 4BP3A 1I4WA 4EQZA 2EFJA 4DCMA 2CWWA 5K8VA 3GO4A 4Y2HA 3MTEA 2BR3A 2XYVA 3AXSA 3MQ2A 4EK9A 4GF5A 4RV9A 5FA5A 2Z6QA 4X41A 1XXLA 3PT9A 1YZHA 2PGXA 4Y30A 4FGZA 4O29A 1XDUA 3FRIA 1INLA 2IGTA 3OCJA 3TFWA 1JG1A 2XVAA 1FJXA 2CL5A 4GC9A 3R24A 3IV6A 5K0NA 1JTFA 3P2EA 1M6EX 4PIPA 4E30A 1KPIA 1Q0TA 5DTRA 2H00A 3LCUA 3MGGA 3GRUA 4E70A 3LL7A 2EJUA 3P8ZA 3DUWA 3R6TA 2UZ4A 3HTXA 4FR0A 4C05A 5EKXA 4R8SA 5FQOA 2Z6UA 3UJ8A 5EZSA 2FK7A 3K0BA 5ERGB 4RTPA 2Z6AA 4YV1A 1WXWA 2GLUA 2GB4A 3DMGA 3BUSA 3DXXA 2FRXA 3ANXA 3LDUA 3GRYA 1QZZA 1EJ6A 3DP7A 2YR0A 5CVEA 5E9JA 2AS0A 4ZTBA 3KPUA 3QOXA 2PWPA 1OR8A 5GM2A 3GGDA 5EIWA 4HGYA 3G5TA 1N7IA 2V7EA 1AQJA 2AOTA 3E8SA 3LGAA 3EVEA 2PVCA 3SX0A 1PJZA 2OPBA 4PYLA 4KIFA 4OA5A 5GIPE 2XVMA 3KQQA 5HFJA 1QAMA 4ATNA 2P35A 3SM3A 1BC5A 3CVOA 3PB3A 2P40A 3B3FA 2E5WA 5T64A 2AOTB 2ORED 2FCAA 4X1OA 1WS6A 5ICFA 3IYLW 1EG2A 3SVZA 3LPMA 1P91A 3I53A 4QDJA 3BKXA 3KU1A 4ER0A 2B78A 3CBGA 4HC4A 3PX2A 1KHHA 1BHJA 4DCGA 1FP1D 3MHTA 2OBFA 5CVDA 1VP9A 1JTEA 1KPGA 2G72A 3M70A 1AQIA 2OO3A 5EIFA 1O54A 3EPPA 4P58A 3KQSA 4PYIA 1VE3A 4CKCA 2ADMA 3ELWA 1L1EA 5K03A 1NT2A 4BLVA 1MHTA 5HILA 3FTDA 3P9IA 4P7GA 2PT6A 2G8NA 3FPFA 4C06A 3M33A 3PVCA 2CKDA 5MHTA 3NDIA 1EJ0A 4C07A 1G6Q1 5KQRA 3BWMA 4AX8A 2NP6A 5DT2A 2ZWVA 2AN4A 3HP7A 4RTLA 5K0EA 1PRYA 3JWGA 3B3JA 3EVGA 2IBTA 1FBNA 3T7RA 1D2CA 1QANA 2PX2A 4LECA 2UYCA 4AZSA 5FQNA 4GEKA 3B3GA 2Y1XA 4BLWA 4RTRA 2O05A 1QYRA 4CTKA 3I5UA 3E05A 2IBSA 1SQGA 3A7DA 3BKWA 4WXHA 4FT2A 2GH1A 3OZRA 5F2NA 2G1PA 1NW6A 4AZTA 2O06A 3GRRA 1AF7A 1U2ZA 3EVZA 3PS9A 5DSXA 1VBFA 3RIEA 2FHPA 3NWEA 1ZKDA 5GWXA 5F2OA 5EMJA 2GPYA 2PXCA 3KQTA 2JHAA 1QAOA 3EVFA 3FUTA 3L8DA 4DMGA 4HSGA 4YUVA 3VYWA 4DF3A 4RTJA 4DKJA 1G38A 4RX1A 3G2QA 5DXAA 1TW3A 3P71T 1ZQ9A 3ELDA 4X63A 2GS9A 4U7TB 3KQYA 3TMAA 3UJAA 5LQAA 1NV9A 5E2BA 3TRKA 3B7PA 2I6GA 3CJTA 4Z2YA 3PFHA 5K0JA 3TLJA 1SG9A 1I1NA 3VC2A 3GU3A 3T0IA 2P3OA 3LBFA 3UA3A 3Q87B 2P7IA 3BXOA 1KIAA 1FPQA 3LSTA 1D2GA 1JSXA 1O9HA 2VDUE 2YXEA 3FPJA 3LCVB 3G7UA 4FT4A 3CCFA 3GCZA 4R6WA 4AZVA 5DX8A 2B2CA 3FTEA 1L3CA 3UA4A 2FPOA 1SVUA 5EOVA 4FSDA 4PGGA 4MQ4A 3G88A 4YV0A 2PKWA 1EQAA 1JQEA 4HG2A 4QQKA 2NP7A 2BR5A 1JSZA 3OE4A 3HM2A 4XUEA 1F3LA 3WSTA 3SGLA 2C7OA 5EHIA 5HIMA 5EZQA 5CVUA 5F2KA 3TQSA 4LWPA 1KYWA 1QAQA 3DOUA 4ISCA 2OXTA 1NBHA 2HWKA 5E8RA 4OQDA 4E2XA 4M7RA 3EMDA 2VP3A 4CKEA 1NW5A 1L3IA 5BW5A 3MCTA 1UIRA 1JG2A 1HNNA 3A25A 4LG1A 5EVJA 3O7WA 4CXMA 5D1HA 3KQWA 3BWBA 1X1AA 3UWPA 4M37A 1RI2A 2OY0A 1UWVA 3MTIA 3TM4A 4E31A 4IWNA 2NXNA 3DMFA 2H1RA 3CKKA 3F4KA 3FUXA 3VSEA 2EJTA 1YUBA 2YQZA 2PV0A 4OBWA 1T43A 3DXYA 1WY7A 4E2WA 2P3LA 3LDGA 4OQEA 4R6XA 5E1DA 1IM8A 4DQ0A 3KPYA
chains in the Genus database with same CATH superfamily
2XECA 2YY6A 1SVLA 5EZ5A 3K9NA 3HGQA 3QEKA 3UMGA 1F2VA 3JYOA 3PKZA 1J09A 1C8LA 1ZG3A 1FNCA 2Z8XA 1FX0B 1UODA 1YRYE 3DEYX 3QBDA 3SDZA 3ST7A 3HMQA 1W5BA 4BO1A 6REQA 5LQCA 3H9QA 3DOOA 4N9QA 1NJFA 3DTVB 3UUEA 4LFCB 2ZAOA 1A82A 2VJLA 2NXEA 3ABZA 3DYVA 4KYIB 5NULA 4BFTA 2PUBA 1NWHA 2YY7A 1JEYB 1ESDA 3NHWA 2QY9A 1Q0ZA 4FMCF 4IXTA 4MQLA 5EXTA 3L1VA 3M7IA 4DN6A 2XIUA 2LYKA 2D7JA 4Q0MA 2AL7A 4E4RA 4GMXA 2E21A 4LJ6A 3ND6A 1E3WA 3H3JA 3C0KA 4P5PA 4UDOA 5DO9A 1SXJA 4QGSA 1MIOA 2ZRBA 4P0PB 2JLSA 5AKHA 5FL7D 5CEJA 3IJRA 3KVNA 4GYWA 3TTTA 2H1OA 4UAVA 4AQ7A 3I37X 4ZGGA 2BLLA 4M7PA 2VRCA 1PJLA 4KREA 3FOCA 3S2EA 2QTTA 3A9VA 2G08A 2IYYA 4CM4A 1J8QA 4M38A 3IVXA 3TK1A 1IOZA 2ETXA 5LR6A 3OPXA 2W2LA 1ZM4A 5BN3B 1UEJA 4AS2A 4ZZ3A 1OTXA 1M2NA 3TIVA 2F48A 4FLFA 3VU9B 3GFFA 3QOWA 3KXIA 3DE5X 4HMPA 2IPNA 1NN1A 1NKTA 5HP4A 3P0FA 1W96A 4NKRA 4C0XA 5CCBA 1DBQA 4IVRA 2WYUA 4LHSA 1NBIA 2NW6A 1KEEB 9ABPA 2GEUA 2ODBA 3E5MA 1EE9A 1KH2A 2R8ZA 1VE9A 1G66A 4TN5A 5AHXA 4ZRMA 4CG2A 2O3JA 1SEPA 4EMSA 3D1JA 3IIJA 2AZTA 1OU0A 2CLHB 2OHHA 2IVQA 2GCEA 4MGYR 5E0OA 1ST2A 4PYNA 1VQ1A 3ZXXA 4J4BA 4XIGS 2RCNA 5IBQA 2XGOA 1QVWA 1AKWA 3BMQA 1U04A 2YW2A 1TKRA 4YO7A 3B5EA 2Q5OA 1P4GA 1X42A 4X1IB 3LL4A 5BN5A 3ISVA 1PYGA 3C7KA 4ZEMA 3ADOA 4F91B 1JDJA 2C78A 3JWPA 2YWEA 1ZOLA 4LKOA 1O97D 2R85A 4YRBA 2H2FA 1YO6A 2ZAMA 2C4VA 4B32A 2IEGA 4MULA 1NX6A 4J4TA 1Z0AA 5KMGA 5TGTA 3PA8A 4OGGA 4NC9A 3EVAA 2IHUA 4Z53A 1KK1A 4BYMA 4DWJA 4OX9Y 3ND5A 1LW7A 4CMCA 1C9KA 2HDOA 4IOLA 1IQ0A 2CFTA 1YB2A 4FBGA 1Z2AA 2A58A 3WIDA 2XZLA 3OURA 1GRNA 3PF8A 3U3KA 2QXUA 2AVDA 2VYVA 1V95A 3P0EA 4M1KA 4R1PA 2Q6IA 2BC9A 4JJIA 4KUHA 2JLVA 2OZVA 4ZHSA 3ENNA 1G5QA 2HK8A 4OQLA 3ZHZA 3EGOA 1WCWA 2XSZD 5C31A 3X1YA 3VYRB 3N0WA 5I8WA 4YRZA 4ITUA 1UBHS 2EL9A 3BA1A 4EX6A 5LQNA 2VTEA 1OUMA 3O31A 4KEAA 1SOVA 4MIYA 3QV2A 4X71A 4ESEA 3FMPB 3R7BA 2CJWB 1F6DA 4QD3A 3K0HA 4UATA 4X8HA 5HX7A 1R9NA 4GWGA 1AN9A 1XVTA 2B8JA 2BZ0A 4G0YA 1U4NA 1ZZBA 1O5TA 4AN0A 2OHOA 5JXHA 3ETDA 4HADA 2ZJ0A 2LCIA 3PC4A 5JZOA 5HKBA 5LDHA 5A5VA 2VF4X 4EO7A 3MMSA 4QPDA 5BQ5A 3RKSA 3LY8A 1ZUWA 1ISSA 4URUR 3NIFB 5NLLA 1QS0B 4UUQA 2WDPA 3QVJA 1KYIA 3AF3A 3GL9A 1F2UB 3SSOA 4ZC1A 2Y2VA 4CT0A 4E0BA 8ADHA 5KQLA 1L2TA 5KYWB 1Y5IA 2KEJA 4JUDX 3P0JA 4G1EB 3T3HA 4CMEA 4IDNA 4OP3A 4DHEA 3ZY2A 5ARCA 2NO7A 4AECA 2HRQA 1NTOA 5GAGi 3ENKA 4NJEA 4C4ZA 4QFCA 3N9IA 1KFJB 2GN8A 5PNTA 5GOZA 4ZOLB 4OYRA 2M6SA 3Q7IA 4DLRA 5JSZA 1ADGA 1CUAA 2P9YA 2XLCA 2BFWA 3FETA 1G8GA 2CJPA 3JSAA 3NDPA 5FWDA 4BX0A 4QXAA 3ED5A 3OA0A 4FQ5A 3FAKA 4HNQA 1W49A 2ZRMA 4TUYF 1MG0A 5IFKA 2OA0A 1DC3A 2CXQA 3FD8A 3TZBA 4NBKA 4MYDA 3DT6A 2Y0CA 1TGVA 4QEDA 1L8AA 1I33A 1WBDA 2EAUA 4A91A 1TA4A 4CT4B 1CRZA 2V3CC 1KK3A 3ESXA 4GNKA 4JHXA 4C7OA 4Z4QA 4DGSA 1EESA 3L46A 1GLNA 5FPKA 4CCSA 4XM2A 1QH9A 3BGSA 3UMCA 4ZICA 1KJIA 4C87A 1ZGHA 3JXBC 1YQUA 2QR5A 2VPXA 4C76A 3CCCA 4BNKA 4I4CA 3TKYA 1Y6FA 4U4AA 2X86A 1GWNA 1W9MA 1YHYA 2X7HA 4L72A 1ISIA 4C5BA 3HCPA 4MV9A 2ZR0A 3NEJA 1VECA 3IULA 2R6GA 2XRMA 2C20A 4P4SB 4G0XA 5BRJA 1NUQA 1B23P 4AKGA 2NXJA 1REQB 3UAOA 3ME5A 2OYSA 2WHYA 4GXNA 4JJGA 3L0CA 3QE4A 4PC7A 2J5RA 2OFXA 4RJ2A 2B36A 2C2BA 2ZRNA 3AUAA 3EA5A 3JQ8A 3MGAA 3CB2A 1XPOA 5LIPA 2I3DA 4B76A 1XEFA 1ENZA 2ZRQA 1DCTA 1V5EA 1M74A 1Q22A 1XK6A 1NM5C 1Q77A 2N42A 1L5GB 3VNAA 1VLHA 5AKEA 5I7RA 1W2WB 1Q7CA 3BEDA 1XP8A 1HYGA 3HCNA 3MPUA 1RWBA 4OQQA 3NM4A 4DMUB 4FOPA 1JQDA 1IXZA 3DHNA 1OIVA 3NDJA 1LI4A 1Q50A 2F8LA 1EPUA 2K4MA 5D85A 4B6OA 2A9PA 5AVWA 5A71A 2JARA 3DE3X 2HK6A 4Q4CA 3HBFA 2V55B 1BH2A 1R16A 2HUPA 4BLTA 3DWEX 2BEUB 3N87A 2C00A 2DRIA 4C43A 4ER5A 1FL9A 3UJNA 2IUEA 3ROMA 1J1UA 3T3IA 1W44A 1SH7A 3R3ZA 3CRVA 1F06A 2OVFA 4QDXA 3ZWAA 2BFDB 4KAJA 1VFPA 3VGPA 1P0PA 1FLDA 2H5EA 1GJRA 3GBPA 4LHEA 2PMDA 2R6R1 4TLCA 3FNHA 1I6KA 3SKVA 4YUWA 3THWB 1AKVA 2AEJA 2W6JA 4GPD1 4HTAA 2I91A 3BWYA 1BXRB 3S5JA 3QU7A 4B3IA 4CR8A 1F5SA 1KO8A 3L1KA 1UMBA 2BFAA 4MV0A 3IHKA 1I80A 3NRBA 1F60A 2HU5A 3PC8A 4TL9A 1HMPA 1XTVA 2D59A 4OB6A 4CMKA 5L4NA 4LX0A 4HLCA 2H11A 3BXHA 4D9HA 5IJZA 2D6FA 2I2FA 2VDPB 1MJ5A 3N0TA 4CI9A 8OHMA 5ESRA 1OB2A 3LNCA 4Y6QA 4Q6BA 4PBTA 1YFJA 3CH4B 3T9FA 3ENVA 1SVWA 4CU2A 3PXUA 2MWMA 4CMGA 2WV7A 5FL3A 4F46A 2OUIA 4BVGA 4RSMA 2AC2A 2BZGA 3WFIA 4ARIA 3DAHA 1X87A 4B0OA 2PTHA 4ETMA 4TXMA 3I76A 1FJHA 3UGKA 4N6NA 3IVGA 1L5QA 2WUGA 4Q1AA 3JAMA 3FYMA 3NHJA 1IXKA 3KJIA 5JSFA 2ZJAA 3ESBA 3FKQA 2WJHA 3MSXA 5GONA 1KPHA 1Z0IA 4D82A 1SQFA 4HL6A 3UPUA 3AHHA 1T8UA 1W4AA 2IH4A 4W7HA 4G56A 2Z9BA 3Q72A 5AXBA 3I8OA 4S1WA 2NZVG 4BTEA 3RB8A 2RK4A 2BKUA 3WIEA 3S3TA 4C7MA 5B7QA 2EFJA 2TMYA 4KG7A 2CWWA 1A8QA 3RI3A 1U2DA 2PZEA 2QVXX 4CZ2A 1FUYB 5CG2A 5K8VA 5HHTA 1BA3A 4H1UA 2D1YA 1TUBB 1XXLA 2JBAA 2VWGA 2CNKA 3O90A 4C0LA 1K66A 1DAEA 5IBPA 1LB1B 1KKUA 2IGTA 3T4UA 3VPFA 3GCGA 4FQ7A 4FHEA 1CQJA 4GRAA 2OE2A 2XUPA 3AHDA 3OIYA 4ND3A 4WXYB 5HRAA 2XNKA 1CD5A 3I3OA 2WG1A 4UTOA 4KJXA 3ZWMA 1EBBA 5CB6A 4IH1A 3LISA 2ASVA 2GF9A 3P8ZA 3DUWA 1CG6A 1DB3A 1OLXB 3RS8A 3EK2A 3Q9UA 3ROEA 2AV6A 4N6GA 4KXMA 1XROA 5JH7A 1R8JA 2HCFA 1IY2A 2PKCA 3DT8A 2VDLB 3VZCA 4A6PA 5CTAA 4CIWA 3MLEA 3E8MA 3WP1B 2HAEA 2P1ZA 2PBRA 4NOKA 4U6NA 1QGED 1E4OA 4BYGA 1MQ8B 2YR0A 4DCOA 2DPGA 5CVEA 2COEA 4H0CA 3RRXA 3S2ZA 1G5TA 2CJXA 3KPUA 1RHRA 4HDRA 2AQHA 1VSBA 3QJYA 3FM9A 1KMCA 3AR3A 3ICQB 1N7IA 2HADA 3VPXA 2LCVA 2FETA 2R751 1TJYA 3IO3A 4H7KA 4D9JA 5BURA 1PJZA 2UZ0A 4UU8A 1P74A 1N8TA 1SXHA 1U2QA 4OA5A 5GIPE 3V8RA 1DAIA 2YJNA 2NO9A 3LLSA 2X4LA 4LXGA 4BWYA 4C7VA 1AA6A 1IN1A 4B3FX 3S1AA 5FBRB 2GK3A 1PVOA 1GUDA 4YRPA 3BHIA 2IBMA 3TXYA 1NZFA 1P1RA 4I50F 3VH4A 3IYLW 2XE7A 4S2EA 3FPBA 2NU6B 4CM9D 4ER0A 3AT1A 4CIDA 3H4IA 3WISA 4MS4B 1NVWQ 4PWZA 4OFXA 1BQ4A 1B0UA 1ZL2A 4KVGA 3I12A 4O2LA 4EHNA 1ZZ6A 4W9RA 3KEOA 4BECA 3U9LA 4EHLA 1YQGA 3EPJA 1GRCA 3BXPA 4NV0A 3FTDA 4LNAA 4KWIA 2Q7OE 2W6IA 3AUFA 3RJ9A 3HY4A 1UWLA 2CKDA 4AFNA 2FSHA 3OFSA 4N3CA 4XIJA 5T41A 1RAHA 4QYMA 4AX8A 2R8BA 2B0JA 4I2VA 1WCXA 5JC8A 3D8RA 4P6VF 2IOYA 4CLOA 4OB7A 4IYJA 1LY1A 3SBEA 1ZD2P 4MROA 2E4UA 1R6BX 1TZBA 1UBFA 4HHEA 4UXHA 5CNMA 5AM3A 1WXIA 2HCJB 3IQDB 4ZYXA 4Q47A 2Q3MA 4LN1A 1JG7A 2WHQA 7REQB 2AXZA 3LUDA 4I4NA 3GZDA 3VJLA 2VP6A 5ED4A 3FNEA 1BCRA 5AH0A 3ZNNA 1SZJG 1Q15A 4X1YB 4FEAA 4JJZA 3A3OA 4ZMRA 1U2ZA 1V2GA 3F7OA 5CYFA 1F20A 3QXGA 2OPHA 5JAIA 1A76A 2D2IA 2EBHX 2JKYA 3LX4A 4NBVA 2JHAA 4O1IA 2IEIA 2KYRA 4YMWA 2YN0A 5IDXA 3A2KA 2NPFA 3KX2A 5FNVB 2C3OA 2LV8A 5DXAA 1AK1A 4JBXA 1TW3A 2ATXA 3AOEC 3P1JA 3P71T 5UKDA 3BL8A 3VVLA 5MN6A 4YK7A 2B30A 2QI9C 2FB9A 3A1WA 2WJZB 5JPIA 1OXMA 3CR7A 2QM8A 4ZDKA 2V6JA 3LUGA 2X3YA 4XQ9A 3DCNA 2R6DA 4MIOA 2YC2C 1JEQA 1TK9A 1RXEA 1JDPA 3NBAA 1CQPA 2BM0A 1JJVA 1DKPA 2JATA 5HCIA 4II3A 1RP7A 1KIFA 4AUMA 4DB2A 1MENA 5AJTA 3CCFA 1UXJA 4J7XA 4J94A 3CO0S 1E7QA 4AJLA 4PC6A 1HNZB 1UM8A 2PCJA 1SUCA 1JT2A 2GVNA 4DILA 1PNQA 3OQ1A 4HG2A 2P11A 1XZEA 2OZLA 3Q7PA 4X64B 1N78A 2NP7A 1ULUA 3P9RA 3I9V1 4J7UA 3Q7QA 3JPYA 3OE4A 2PZFA 3PC2A 5IW8A 1SQ0A 4D1YA 4LXQA 1Q7GA 4HV4A 5HIMA 3PC6A 3P4YA 3WQHA 4BZQA 2EFHB 2C0PA 2CDNA 1ZH4A 2BIFA 4OHFA 2AK3A 4BX9A 4JR2A 3IAEA 5C7LO 3HB7A 4LNUB 4PO8A 4YAOA 1KVQA 2NTNA 2GAIA 3BK1A 3X2EA 2XWBF 3PJRA 4FFPA 2FR8C 2XH8A 5B6IA 3H2GA 4C7BA 3V48A 1T5DX 1I13A 3AZOA 3FZEA 4JB3A 4URWR 3AP1A 5GJCA 1U2EA 1WDKA 4F11A 3KSDO 4EP1A 4ZVTA 3MIIA 2JJ1D 2EFDB 4K7JA 1QQ6A 3W2IA 1S8NA 1HEUA 1UZAA 3BIXA 2IL1A 3B1KA 4DQ0A 2A9VA 4PQGA 2GN6A 4PNEA 1XUOA 1B43A 4PZ9A 2C4KA 1I9CA 4WINA 5J2UF 2QTLA 1HXHA 1RRKA 2PBZA 2XQIA 4ZK6A 4JR0A 3OFJA 4PO1A 2CK3D 1QTNA 3FYCA 3S29A 3NBFA 1EMDA 3ZWNA 3QXXA 4R4JA 3TD9A 4ZCIA 1WXGA 1CUDA 4CR7A 3PK0A 1ZR4A 2RGGA 5T4HA 2CNLA 1K8RA 3K6KA 1L5HA 3UTDA 4OHXA 3DMPA 3CZQA 2D4HA 1JKFA 1X9GA 4PGHA 2QM3A 1R0WA 2VZLA 2WK1A 3C43A 3P9NA 3MWFA 4GMFA 2XEDA 1RHQA 4PCUA 4Z4GA 2P0EA 2HA4A 3ENWA 1Y42X 2FSFA 3RAJA 3LD9A 1EE2A 3WNCA 1B7GO 4E14A 2MOKA 2G67A 4U6SA 4Q7QA 1ADJA 3GEBA 2HDWA 2V3WA 2L18A 4JUBA 2OQRA 2V4UA 5E9WA 2M6KA 1CVIA 1UKEA 1IDOA 4MW9A 4P32A 3H2BA 2CT8A 1WKBA 2X5NA 2DCUA 2QNIA 3KFVA 3W2HA 4BKRA 3WGVA 4HB0A 3KXAA 3PRJA 3GJ0A 2QT9A 4KX5A 3AUUA 4YRTA 2ZB3A 4KIWA 4TWJA 4MYUA 1HV8A 1Z45A 2XUIA 2WF7A 3CLUC 1G8JA 3L93A 5DVZA 5JQGF 2FUNB 5J3JA 1C4XA 1P45A 3G89A 4I6EA 5K6TA 1S8OA 3VUEA 3I2GA 2FSGA 1K3TA 1GLVA 5G1NA 2Z98A 3E84A 3EFOB 3IP7A 4C04A 1XDDA 4RVNA 3UJCA 3ZX4A 1T8TA 3MTAA 3E22B 1A7JA 4FDMA 3TNLA 1I10A 2TMGA 2YWJA 2C3MA 5DNDA 4F9GA 4RL4A 1I2CA 1ZWLA 3FVQA 1ZESA 2FX3A 4CIBA 3DULA 3JCZA 1QNLA 3MNFA 5SY4A 5EJ9A 2QBYA 4GYYA 3K5IA 1J0DA 2OD9A 3EEYA 1Q1GA 3A58B 1P39A 2GYYA 4QEKA 5L3SB 3BJMA 1DS6A 1T5TA 3IAUA 1TO6A 2WJYA 1XCLA 1SUWA 1WQ1R 1H5NA 2J5BA 1QIEA 2CDBA 2OXFA 4MA0A 2DFNA 3H1BA 3E0QA 3MA0A 1QX4A 1YJXA 2YOFA 4I6GA 4RFSB 4Y0VA 5EERA 4CEJA 2ISCA 2C97A 3WADA 3H0KA 1X92A 5KQSA 1KJZA 3K5WA 2FGKA 1Q2XA 3UC9A 1CUEA 5IXSA 4ZODA 3REQA 2V59A 1WLYA 3KK0A 1CP3A 5HIAA 1XPRA 2B1IA 3FGZA 3FVRA 2WQZA 3EFEA 4MR7A 2C2OA 4Q3OA 3T52A 4A15A 3WRXC 3PKIA 3TLAA 5DNCA 2V6MA 4Y98A 3UMJA 1T0UA 2DMRA 3KAKA 2PT9A 1IC6A 3U7HB 3EVDA 4RWZA 2D54A 2C54A 1LLDA 1UWKA 2IW1A 2NYUA 3NCHA 1CIVA 1B15A 1OCTC 3PHCA 1L4GA 5ERYA 5AW0A 3VZBA 5J59A 3G7SA 1Y8RB 4ZO9A 4NJMB 5FXMA 1R0RE 4U39A 2EX4A 3MRSA 1B6TA 4MI9A 4YXFA 3FLEA 4FMBB 4TQ9A 2BSAA 3HYTA 4FILA 2FHSA 4PHCA 5CT5A 4E51A 5D84A 3EEIA 3P9CA 4UULA 3V8QA 2NV2B 2Y1CA 3NEPX 2BRUC 3OZUA 3X1MA 1KVTA 2IV1A 3HJBA 3PLRA 4BO9A 4C14A 5E2IA 4FKZA 2JQEA 1G9XA 4V24A 4AIIA 4PSUA 1IY8A 1FFXB 2Y2UA 3A6PC 2P9BA 2ZIVB 3FF1A 1L7XA 4XUDA 5C51B 3B89A 1SCNE 3VC7A 5EQTA 4JEIA 3PCXA 2MQKA 4ODIA 2BZ1A 5EEHA 5I8PA 3A2MA 3X0DA 3A9RA 5C18A 2HA7A 3EUSA 1M2WA 1T5IA 1XKXA 2G07A 2C0CA 4H7IA 5E38A 4LOHA 5EKDA 5EP4A 5BNIA 1JFTA 3AK4A 3OZIA 3FUVA 3MERA 3G2HA 1UJ5A 2DBRA 5FWXA 3IAM1 1ZONA 1ZK3A 2JFZA 5DV9A 3DMRA 2QE7D 3E03A 4W5WA 3CF4G 2HA5A 2O52A 2PMEA 5A02A 5JCZA 2GN9A 2HHAA 3OM8A 3FRHA 5KYTA 4H7HA 4YQFA 4DMHA 5DLDA 4NPHA 1IU9A 4E33A 3EVBA 4HN2A 3U0BA 4YAKA 3ZIDA 3QHPA 4BMOB 2IZOA 1PJTA 4WHMA 3LP5A 1ZK4A 2XA2A 4E94A 1O89A 2VAXA 2VAMA 2QLJA 4IO1A 1J0EA 2PL1A 2YCLA 3FHJA 1LLQA 1OFVA 2FVYA 2HPVA 4NOJA 4QULA 1TCCA 1CT9A 1I5RA 3HB1A 1DPFA 5HNKA 1U3DA 1EB9A 4Z6KA 5HJ2A 4RVSA 2P6UA 1KY4A 3F7NA 1ICEA 2P9QA 4YP9A 5HF8A 2YWRA 5LNK1 3AESB 2ZVDA 1QKJA 1NVGA 3AW9A 2HPAA 3IPXA 2J0UA 1ISJA 5EFOA 4TMTA 3WIBA 4P5DA 3AEQB 1QE5A 1MC5A 1V41E 4BUCA 3RS2A 3PFFA 1I32A 1PSDA 5FYDA 2IWRA 4RTQA 3WR5A 5ULLA 1R9MA 1C1HA 2ZXUA 1FTGA 1U9JA 3QLVC 3WLNA 4YWJA 1KEUA 3JQFA 1NNUA 3OKFA 2ISSD 1LH0A 1BW9A 3Q9SA 1E6LA 1HUQA 1R4NA 2O4UX 3FNRA 1UXGA 3S4YA 3NOOA 3M34A 2AZXA 1RQGA 2JH9A 5EA2A 3FZNA 1IOLA 3E2PA 5EXSA 3ZU2A 4ZHQB 1IUKA 1CR6A 1MXFA 1PL6A 2B0CA 4DBVO 4M8IA 4TYWA 3T0FA 1EWQA 3T7SA 1K7CA 4YRSA 1QYIA 4CQLA 4QG3A 3E9MA 1EHIA 5AJHA 1ICIA 1AA9A 3QVGA 4HGOA 2J3KA 1JGTA 2QM0A 4WD3A 3D3WA 1G4HA 2G5GX 4A8JB 4F5YA 4R81A 3PGKA 5HMLA 4ZI2A 4RM3A 3UK0A 3ZH9B 1XTSA 4J0JA 1K2VN 3PUVA 1AUPA 4CF4A 1CY0A 1P1HA 2GX6A 3OIVA 1WULS 5CFOA 2V9CA 2F3SA 1GFZA 3GLTA 4MWDA 1WBBA 4Q02A 2WU1A 1EU1A 3RTBA 3NNDA 1CUCA 1W59A 2PGIA 5D6NA 3GLHA 3OFKA 3UW3A 3WWDA 3FPLA 4QU5A 2LBPA 1SQSA 1EDZA 2AOUA 2X58A 4EG4A 4KXLA 1TC1A 2WKPA 3KAPA 4CJXA 5F77A 1ORTA 2IYOA 5K0GA 4R2XA 1JDVA 2OXEA 3W1EA 1CJUC 1GSAA 5F1KA 5J2TF 1GPMA 3HHEA 3U49A 1RI4A 4N5LA 1P3JA 4EELA 5BV0A 3R74A 1N6NA 2HN9A 4ALNA 3SBDA 5DGXA 3N0RA 1N2ZA 5TJHA 4D5EA 1GAWA 4A1OA 5C7IO 3RHFA 1CEXA 4CIXA 5DF1A 4KI0A 4U7GA 4UC0A 4REMA 2ZQZA 3A6EA 4JY7A 5FULA 1QZTA 1G3RA 3BE4A 3H5VA 4EVSA 5CYGA 2R3SA 3DZHA 4ARVA 5AYVA 1RXSA 3UN1A 5JAPA 4PPFA 1QUEA 1EVZA 3TB6A 2CEKA 2JGMA 5FYQA 4X00A 4R51A 3RJMA 3P2MA 3F8WA 5C3UA 3WDKA 1C80A 4KDFA 5AW1A 5J58A 2GYWA 4IDFA 3MJTA 3HVHA 3OQIB 1KOJA 3BXEA 5KJCA 1WSAA 2FW7A 2O8BA 5DGHA 4BAGA 4LYEA 2XJ3A 2V96A 4LQ4A 1KSFX 5T57A 4H3SA 1EZ1A 2R97A 3KYDA 1I30A 2M9MA 2MMCA 1WZIA 4V0MA 2IOHA 1JTVA 4FYWA 3GJYA 2LYSA 4KNVA 3WC4A 1GUAA 1ZITA 3SHFA 2EZUA 2XKBA 1TO2E 1AV6A 3DDOA 5DH9A 4JQOA 4ZYTA 2IYSA 3OTWA 4QPZA 2FX2A 2FWNA 2P2SA 3AEKA 3G1TA 2KWIA 3OKPA 4V0KA 4QHTA 5FADA 5KWIA 1G41A 3V55A 4P4UA 5JFGA 3S2GA 3ZDRA 4NMMA 2R1ZA 3LQRA 1QRTA 5EXXA 3IAS6 2PNFA 1RJGA 2AFVA 2PXHA 4OVKA 3SIWA 3UJHA 4QOFA 1ULSA 4U8GA 3O4RA 5GINE 3M4JA 3JALB 2EP7A 3W6PA 3D8NA 1O4WA 2IU3A 1RPEL 3DWGA 1L4YA 3FR8A 4N7JA 3H8JA 4HBGA 1MHPA 4Q16A 3KVYA 5I7AA 1NVXQ 3U5ZB 1SD1A 1NYLA 3DJYA 2NSYA 3B9BA 4HLDA 2C98A 2GR9A 2YMMA 3JYNA 1KF0A 1U0HC 3QGMA 2P9CA 3HR4A 5BYJA 1S2LA 2BR3A 1EG7A 1YE3A 4TTSA 5TS3A 4DNOA 2CFRA 2Z6QA 4GOKA 1WD7A 1AKYA 1VE1A 1Z5OA 3VZSA 2DBQA 1B2RA 3V1KA 1G59A 4DV1B 1XDUA 1U7HA 3G0DA 4CN8A 2A86A 5FWYB 2WM3A 2YIDA 5L7WA 4L57A 3ZU4A 4G2NA 1PS9A 2NVWA 4YEDA 1C7RA 1MN6A 3A9TA 4M55A 3FYTA 1Y4UA 1XEAA 2A5LA 2WLSA 3MGGA 2Y67A 3KXPA 3RYFB 1OASA 5C7YA 4BRWA 4Q4HB 4B5KA 1LQUA 1J0XO 3B1JA 4RABA 2A7XA 3U26A 3CLSD 5AVZA 4ZVNA 1UK9A 1W47A 1ZYUA 4RMHA 2EGUA 2UVPA 1TAUA 1FW8A 3NZLA 4QARA 4EI2A 3SYTA 2Z6UA 1NZDA 1T0BA 3K0BA 3HXOA 3CTPA 1WXWA 4EITA 2C8KA 1QZZA 1V11A 1G2QA 3F6PA 1AGPA 1ZIPA 2DZDA 1Q91A 4TKVA 5LVAA 5LZ4A 3STTA 3KQHA 2J4FA 1MVOA 1THZA 3N7TA 1GGMA 3SHVA 2DHQA 3DZBA 2HDHA 2QAGB 1U2GC 4MUMA 4YJDA 5REQB 1RHKA 2O2SA 4CF7A 1JQAA 1YCDA 3SX0A 4PYLA 3P9YA 2D7CA 3N3BC 2B4YA 2BCGY 2JFUA 3EZ7A 3CWQA 5EE0A 1B8PA 1DG9A 1QXSA 2O3QA 1ESMA 1LKZA 1V3UA 2E49A 2QV0A 4HUTA 2GHTA 2GPNA 4EA6A 4YCLA 5M3BA 2P2ZA 3BL5A 4QOEA 1YJ5A 1YVDA 4O2AB 1PSWA 1M0WA 5CA1B 3VU0A 1SCUB 2HWUA 1TADA 3BREA 4QDJA 3ESCA 3VHQA 1KHHA 3HB5X 3WLMA 4KV7A 4OUDB 3A6ZA 2OBFA 3GUHA 4Q00A 3T54A 4C78A 3L1UA 4WXRA 2QTCA 4PYIA 2BFBA 5AM5A 5ABPA 4S1NA 3JATA 3CRNA 1DWKA 4FFNA 4Q1CA 1CZHA 3P96A 1BKSB 3RJZA 4LYHA 2PT6A 3L40A 5FBVB 4QLAA 2DG2A 1WQ3A 3O7MA 4A73A 1L5YA 4GICA 2OSBA 2IIBA 2QL9A 4PZDA 2G8LA 2BKXA 1KYYA 3IPLA 4I99A 4BLVA 4XSGA 3OFVA 3KUXA 4Z3DA 3ANYB 4HEHA 1ODIA 3E2MA 4EHJA 4Q34A 4J0HA 3SDSA 3WXBA 4BP9A 2PHZA 4EPRA 4IVQA 4KYVA 2HLDA 3KCNA 2Q1SA 1PD0A 2HXYA 3DEHA 3AL0C 3UMBA 1OBVA 1XEWY 1YA8A 2JGKA 3E05A 1W19A 3S27A 5B3LA 3A7DA 1LDMA 1RU3A 2Q5HA 3F6YA 4FT2A 4PW0A 4E4TA 2XCRB 2NZUG 2WIFA 1EX6A 2ZR8A 2QTNA 2IZ6A 2ATVA 1BMDA 3A3KA 3AFGA 4X8OA 4JI4B 3QX8A 3T9EA 4ZYLA 1IN8A 1BAPA 2RH4A 1QP8A 5F2OA 1IBCA 3KQTA 5LU8A 3ICEA 3H5RA 4MWCA 4K86A 1WPRA 4BPRA 4CV3A 4DMFA 4OKSA 4XIIA 1C41A 4HSGA 4FYMA 4L8YA 1GPJA 4ZOCA 4F5EA 5ITZA 2VQFB 3ZE0B 5FFMA 5JNTA 3N39C 1YV9A 1V25A 1M5TA 3VR3A 1N36B 1BDJA 1TCAA 1W0JA 3KEMA 4Z2YA 4WN9A 1TM4E 1GPH1 2QM7A 2LLVA 4MUYA 5EP2A 4AO8A 4HUJA 1ECFA 1JF8A 4BPBA 3OJOA 1A9TA 4H16A 4QU0A 4XPIA 3WBJA 1KQGA 3RC9A 4WI1A 2X2OA 1FPQA 1MO2A 4XJTA 4DR4B 3VXKA 2JFGA 3FPJA 4R6WA 1OYWA 5F52A 2IOQA 5LPNA 3AR2A 4RY0A 3OCZA 5EGNA 4HS9A 2GJSA 4G0WA 2DPHA 3R6LA 5EOVA 3K16A 3GFGA 2GSWA 3M9LA 1YBVA 1TUIA 3DLHA 1IG0A 1ZXBA 2QZZA 1F0PA 4LC9A 5TQ0B 3WI7A 5BPHA 5JADA 5LA6A 3WMWA 1CRPA 2BR5A 1N2SA 1FE8A 1WW3A 5CB4B 4GHWA 3F6EX 4EW1A 1S9DA 3W8EA 2LW7A 5IK2D 1MXHA 1EKXA 2VEDA 3I23A 3LOPA 3G0IA 1SB8A 4X95A 5EZQA 3K0SA 3FYUB 2ZT7A 1UOQA 3NR2A 4BHTA 2PRKA 4WEOA 3KOZA 5KVVA 2VRBA 4UCQA 1YR6A 3L7NA 2I5PO 5E4JA 4A27A 2CLCX 2RG1A 3PQ5A 1C9JA 2WB4A 1NW5A 1KJWA 1TRHA 4J1NA 3WWEA 2WV9A 1JDNA 4K03A 3COJA 1JU4A 1D5WA 1SURA 1FMTA 1T34A 2G9QA 2QMZA 4I2NA 2O1SA 4LDQA 5D1HA 2ZUEA 1NOKA 3I34X 1TIKA 2QMYA 3D6VA 3FVVA 5K51A 1L5KA 1MQSA 1FXWF 2BGRA 4PSKA 5F78A 4FFBA 2JDID 4CKEB 4IILA 5AOAA 1CFJA 4TSFD 3ULKA 4KPUB 2CZCA 2DR2A 1VL6A 2JCYA 4PG5A 4DWOA 1HT1E 1L5VA 1T6XA 2CFIA 2V3VA 1T4MA 3CCBA 4ITRC 3V4VB 2HMSA 4BMYA 3LBAA 2VHXA 4C2BA 2WMNB 3S1SA 3KPYA 1AZLA 2PXLA 2YVLA 3DBLA 1EWRA 3C4VA 3BFVA 4BQNA 2EP5A 1N6RA 4BE9A 2ERCA 1QRUA 1BWRA 2J6CA 4YA6A 3CW8X 3ZV7A 1J23A 2VHWA 4ESOA 3KEGA 4OL0A 4CTOA 5B2FA 4YUYA 4ETNA 5CVTA 1RJWA 4Y2JA 2F62A 5KNCH 1E7MA 4YV7A 2WPDD 1G3MA 3FDFA 4MMYB 5FBZA 5IF3A 1YD7A 1USIA 2JFYA 4O2BA 2EXXA 5GP1A 2PXAA 2YUIA 5DN6D 1I94B 4IJKA 1GT91 2X8AA 4NQZA 3VO1A 2CHEA 4BATA 4KSCA 1IWOA 3GN2A 3I2FA 4R9SA 4YAWA 5CXXA 4EUHA 4OXKA 4JLOA 1NY5A 1JPNA 2ZJOA 5DOZA 1H1TA 2SBTA 4DABA 1A5SB 1M0EA 5EKSA 2Y0EA 4EAAA 5K8JB 9LDTA 1YDWA 2EFYA 5KSZA 4YGYA 1DLJA 2X8WA 4OH7A 1IK6A 2L42A 1RZVA 2YWCA 3AZQA 3ZKWA 4HYEA 4BFSA 5HOQA 1XPUA 2QG6A 2O5VA 1YL7A 4R2MA 1SM4A 5DHSA 4DEXA 1NM5A 4IG9A 3KQPA 3MCAA 3P4XA 3SCGA 1KXZA 3BIOA 1DAGA 2PN1A 1PFKA 2O7RA 4LOAA 4TKLA 3OX4A 3FOZA 1P4HA 3SM9A 5JWOA 2IYAA 4IDAA 4NH4A 4EW2A 2NQ8A 3TI9A 5K09A 4ZU1X 1LJLA 2ONKA 1L5NA 2WJWA 1A1SA 2WA2A 3K2BA 4C22A 1UXIA 4A0QA 2WE8A 3PXCX 5IWAB 4UBKA 2P0YA 5KNDD 1T5HX 1HGXA 1TM7E 2QQFA 3WMFA 2Q45A 1NP6A 1C14A 4LHYA 4BCDA 3NX4A 1R0LA 4PX3A 2E2WA 1X2EA 1KI6B 2VKQA 3BHNA 4QOJA 3UHOA 5IT5A 3ONFA 4QQNA 3G2PA 1MJGM 2PXPA 2CJYA 3IQXA 1G7RA 4JB2A 3AEZA 4MRMB 4B0PA 4R8VA 4RJTA 4XLTA 1GAXA 4ZJPA 2AKEA 4JLAA 1PHRA 1AE1A 3NCTA 4KXNA 4Q4LA 3Q41A 2HSGA 1JE0A 4U8HA 1AM4D 4AF8A 3K6RA 1BXGA 1QHNA 4Q3LA 1PIWA 1MJNA 4JXKA 4IDHA 4N82A 4O25A 4XUCA 3M6VA 1C9NA 4J2TA 5A7FA 1WCIA 2PR7A 1K3FA 5SY6A 2AXEA 2C29D 5JCPA 2GO7A 3HB0A 4DIKA 1DKRA 4IDCA 4ZAGA 2ICPA 1H2YA 2ASEA 3IO5A 1IXYA 1RBZA 1SBCA 1TW2A 3HU5A 4MVJM 4FS8A 4EH1A 4PG8A 2OOKA 2IKSA 1YS4A 4P4NA 2V03A 2DBZA 2HEGA 2VHZA 2Z1DA 4DV7B 1RKBA 3ICWA 3D7KA 4HQKA 2Y1WA 4IMPA 2XGGA 4RKEA 3ILVA 1Q16A 2GD0A 5I7EA 1DRUA 1P1BA 5G0UA 1ACJA 3OLWA 1VPTA 4DANA 2QTWB 4IGIA 4RF3A 2JHCA 3O83A 4LJ5A 4X94A 4EL5A 1A9SA 2WZCA 3H4TA 4EG7A 1TO1E 2FW8A 2F3QA 4TTIA 4I9NA 1ZR2A 1EZZA 4AZ0A 1Z56C 2ZCVA 3IBYA 2WABA 3KZKA 3REOA 1C30A 4M1WA 3USES 1GGKA 2GASA 2FJUA 4PLTA 4D46A 4L75A 2JAPA 3H84A 2VS1A 3RVPA 4DKXA 1CB7A 2O54A 2Z30A 4UTNA 4EZEA 2I6SA 4L4XA 3INYA 5D7NA 5E7MA 4BO8A 3Q85A 2BYTA 1E3EA 5KQPA 3OP4A 2A94A 3A9YA 1P0CA 1ZA2A 2BMJA 4KLAA 1RKUA 4IDGA 5DTIA 3BAFA 3VR6D 4PG4A 2BHLA 2WSSD 4NAVA 2XXJA 3NVDA 3ZK8A 3VX4A 1HDIA 3LWZA 1I0LA 1E0JA 1XEXB 4BV9A 1EFAA 2D1QA 5KYGA 4CGZA 1O94D 2CNBA 1GV1A 2BFFB 1MX5A 5KSPA 1UXHA 3HJNA 5K0LA 3KZXA 4UHCA 3OF2A 1QGAA 4HOYA 4Y0AA 4ZO8A 3AW8A 2FZVA 3RTEA 4G9BA 4YDSA 4Z8YA 1DO0A 1F2DA 1WW8A 2I4RA 2VH5R 2CLDX 4G4GA 2BTEA 4LDZA 5DM0A 1QGYA 2HEIA 2Y1KA 2VJYA 1R9GA 5K3SA 3MGBA 4F21A 1RQLA 3TBHA 4M9RA 3JQ7B 2K6GA 5DYNA 5LKAA 1TCBA 3L0YA 2AXQA 1RCTE 1QORA 1NI4A 1XMSA 3HA7A 5GGXA 3GRAA 2ZVQX 4JP1A 4I5IA 1N77A 3BE8A 3K4PA 2WOJA 1G3QA 1UBRS 2NYVA 3ONNA 2JIDA 2J7PD 3CNLA 2FSIA 1YWGO 3SYMA 1T5LA 1T1SA 3C7AA 4FI3C 1BIFA 5ALHA 4UBIA 3WK7A 4E21A 5I48A 4AWAA 2FPIB 4ZI7A 4HDAA 5HRCA 4TTQA 5JANA 1ZHHA 4DRYA 5CCEA 4KRFA 4JVMA 4DCJA 2C88A 4E15A 4C5CA 4HNSA 3V2HA 2R1VB 2QV7A 3EBOA 2XBLA 3OZFA 2AWIA 3Q3VA 4KXFB 4NU8X 4OYLA 3VPCA 3SR0A 4NFSA 4OJNA 3VV3A 3LKBA 2SHKA 1NQ5A 2VDRB 2IIPA 4HDNA 2ADOA 4PTLA 2F55A 1NIPA 1O8BA 3KSRA 2WY2D 5JXIA 3QEOA 3WAGA 2D2VA 4JGIA 2F8SA 3BQ9A 4EB0A 4HSEA 4D4KA 4MI1A 1AKNA 4ZYUA 4C6TB 9GPBA 3HZHA 1FYDA 4MQFB 1CJVC 1ZD4A 2WWFA 4LNHA 4BV2A 3TDNA 4N49A 4G09A 5BNFA 2PUTA 2R87A 2VAVA 4OLHA 1RP1A 3TKAA 3KVOA 1OYYA 3GAZA 2FMKA 3W5UA 2F1KA 4JBWA 1I9GA 3OT1B 3V1UA 2C31A 4V1CA 2WJGA 5H7XA 4J6EA 4R83A 2XWQA 4LWZA 4J75A 2A5GA 4NE9A 3ZHCA 2QUAA 3MUOA 3CS3A 4CMBA 1V8PA 5T67A 2H5IA 2QQ5A 3WJ1A 4YR7A 1XV5A 2F8MA 1N5JA 4P54A 5CLLA 2O1EA 2JZNA 1BE6A 3MRVA 1PS8A 3V1MA 4P81A 4U7FA 3U44A 3FWPA 4DTCA 3ZGOA 5HVNA 2PA3A 2AYYA 4DARA 3WVNA 1IXRC 4DDUA 2DHRA 2P7HA 1VCIA 2G5TA 4AKTA 4MHSA 3AF5A 1TK3A 3AOEA 2J41A 2J85A 2XIQA 2XUJA 3LPCA 1L7MA 3OOJA 4OHPA 4U9UA 3DDCA 2XF2A 1KEKA 1NRIA 1PT7A 2PZLA 4JENA 3DNFA 5GADl 1RYMA 3VSAA 3O2QB 2NXWA 1MC4A 1NBAA 1QHGA 4MKXA 2VLBA 1DAMA 2WNSA 1N7GA 2ZR7A 4IMJB 4LF7B 4Y9RA 3OT5A 4OA8A 4HAOA 1LC3A 3I9LA 2ZBPA 4N0DA 3W78A 1R6AA 1U02A 3KPVA 2WIAA 1VYTA 3O0DA 1JG4A 3AL2A 4ZVVA 3ONEA 5LYJB 1XTUA 4RV5A 1AG9A 3B7GA 4EG3A 4IEFB 3A11A 4OI4A 4WZBA 5I7HA 3OTGA 3I1FA 5DIFA 1A96A 1RYEA 2VSXA 5D3MA 1SU6A 1ADCA 3GFSA 1FFCA 2EKQA 1VDMA 2OHGA 3R3SA 4ILEA 5DM4A 4AS3A 2Q4DA 1P5ZB 2PFSA 5DSZA 4ARSA 5KS2A 1D1PA 3Q7RA 3CXRA 3OG9A 4A6XA 3HJRA 3LNTA 2J5QA 3C7DB 2C9BA 3K9HA 1Z8NA 2FPWA 1T2CA 1X0XA 5HZGA 3JRNA 1N32B 4R98A 1JIIA 1CVRA 2PUDA 2O6HA 2R48A 2ONCA 2AQ8A 3O2SB 1F12A 1F3OA 1JQ5A 4YP5A 1FDOA 2MSDB 3C24A 3SFZA 1WW2A 1XZFA 4D0SA 1BTOA 2G06A 2RARA 1PLJA 3IODA 4AN4A 4C3UA 1IJEA 2FR8A 1ABFA 2Y68A 4L4SA 1IQPA 4KOEC 3W4IA 2PGXA 5H4HA 4OGWA 2WMDA 5HKAA 3OJWA 1OA0A 1JIVA 4PPNA 5DNWA 4YRIA 2CL5A 3C5WP 5I8ZA 1UPAA 1PQUA 2C61A 3GEHA 4E30A 5JZMA 4LQLA 2Y1OA 2P6OA 4YB8A 3RC3A 3VSCA 3WICA 3ZCPA 5HDBB 3FWHA 5BQ3A 1SBYA 1Z06A 2DXIA 3CZ9A 3A4NA 2PWAA 3R3WA 1PNTA 2WHEA 4BMVA 1GSOA 1EUDA 1LW6E 4PAWA 2PK3A 1WM1A 3DEIA 4MDHA 3CRMA 3DO6A 2I66A 3O1HB 2CWDA 4BRUA 1AHHA 1D1QA 2OBYA 1HDXA 4GL4A 1M1NA 2FRXA 2Q1UA 2W2TA 3ANXA 4IJQA 3OQNA 1GG8A 1FEZA 3FYAA 2W6MA 4RHYA 5ECWA 1QP7A 4W8HA 2AS0A 2JBWA 2ZWMA 5L3RA 3A2NA 2I2CA 3TTYA 3EIFA 5B6PA 5KOYA 1AMNA 3D3NA 3G5TA 1YASA 2VUIB 3GDWA 5JV5A 3ZCUA 3ICPA 3A1TA 3U3OA 1LQTA 1ENPA 3PD1A 3AJRA 5HFNA 2WHPA 4BE4A 1TD9A 2Y6VA 1E1QD 4JD5A 2H0QA 4YAJA 5AW9A 4G37A 5G0TA 4IWYA 2FCAA 3PQ7A 5AI9A 4HRXA 2OYCA 5ICFA 1U0SY 4BQOA 2QN8A 4D3SA 1RADA 4Y2GA 3EMKA 2HWYA 4DCGA 5LQDA 2ZUFA 4Q4JA 3UHJA 1Z8DA 1P5HA 2FPPA 1P0QA 1FSFA 5ECYA 3U39A 1SOWA 2J3IA 1V16B 1WPGA 3KQSA 4FYVA 4M0EA 1J20A 2N1BA 1DARA 4PFJA 4J07A 5JAQA 3ZGYA 3C8HA 3S81A 3T1HB 1Z5ZA 4P7GA 2QX4A 3K0CC 2FZ4A 3WGOA 1KYQA 5DGDA 3SQWA 1G7CA 5TSDA 1BMTA 4NTZA 4B6QA 1H9AA 5MHTA 1T24A 2WTBA 1VKJA 4QUEA 2QN1A 3E7DA 4YJ2A 1HE3A 3H11B 3DDNA 2WIKA 3DEZA 1E2PA 5JYEA 3NIBA 1R6DA 1VHJA 1JQKA 2JJYA 2HY7A 3FBGA 3FVTA 3HLKA 2OHFA 4ZO4A 1Y1QA 3H7AA 4RTRA 1YUNA 1TMKA 3WQBA 3R6GA 3U3XA 1C3XA 1FTSA 2CLFB 2ZJ8A 4RK1A 4WXHA 5F2NA 4MHOA 1P7PA 4U0KA 5CYOA 5ALXA 1HL3A 2LKCA 2B98A 5DSXA 2LKDA 1SUBA 2WWTA 4WZAE 5HW0A 4KWTA 3DEKA 1P7YA 3MQFA 4ARZA 4BZZA 3O38A 3PUXA 5G3ZA 5FUXA 3WRXA 2Y1EA 1DINA 3OWQA 1OF1A 2W11A 3QNMA 4AZ3B 1PJ3A 1K8ZB 3O92A 3O8RA 4RX1A 4MUNA 4LV6A 3OE7A 4P2BA 2R5NA 2JVLA 2YL2A 2DJ5A 3OZWA 3AJAA 4QREA 2JAHA 1NV9A 2I6XA 2GJ9A 1R69A 4ME6A 3USZA 1Z73A 5DCWA 4F06A 3BHMA 2C57A 3ITEA 4FZ5A 4G4SP 5EZYA 2C4NA 5TPZD 4ZOEA 1NUSA 1NXQA 4LV8B 2GK6A 2VUHB 4BNLA 5KTPA 3AV3A 3I3SR 1FJGB 2KHZA 4URFA 3M83A 5LBIA 5ES4B 5AP9A 2YVQA 4L8VA 4MUAA 5TT0A 3A9ZA 4F60A 1ZLYA 4OJMX 3TNFA 3GCZA 2IDMA 1AC5A 3EUWA 3SK0A 4HFRA 4ASUD 2WTNA 4N9WA 4PN7A 2BRUA 3IDOA 4FWBA 1RC8A 2FPOA 1FDVA 1OTHA 4Q4AA 2CLMB 3E3LA 4WLFA 3CTMA 4KJZA 2E5LB 2ZATA 1N7HA 2EJCA 1XK7A 3IVMA 2A0XA 1W88B 1YKGA 4CCYA 4YMIA 3OSUA 1JBKA 2PR2A 1WB5A 2F43B 1WWKA 5DB4A 3RUHA 2ACVA 5KNDH 1T6BY 3FIJA 1E6KA 1TTQB 3K3PA 4QYXA 3OEED 5CVUA 3IQIX 1L7RA 3FTPA 1KFBB 3ZWVA 2IUFA 1QAQA 1X8JA 1DIGA 5CDFA 3GPLA 4KZPA 3F3SA 4JSRA 4E2XA 4PLWA 1IEVA 3R1FA 1EVKA 1XQ6A 1UXDA 4OH1A 1P5JA 3BB3A 2X77A 3MD0A 4QLBA 2FZGA 2CLIB 3HN7A 1WBJB 3LF2A 4Y9DA 2ILVA 3EAGA 1Z5WA 1KEZA 4M1ZA 2V1UA 3FA2A 2OSVA 2NXNA 1Z6XA 1Q1QA 3MW8A 5C5IA 2H1RA 5CBPB 1P0IA 1IIRA 1DRKA 1GL3A 3C1TA 1R0YA 4J91A 1KSHA 2J07A 1FDRA 1M2VB 1OVGA 2ID8A 3H18A 3IGFA 3QI7A 4OBWA 1RYBA 1KO4A 4RJJA 3OPMA 5G4KA 1G8MA 4CLRA 5KJFA 4RTOA 4QXMA 1GIAA 4G8JA 2A78A 4ALJA 1NN3A 2IE8A 4PU3C 1IVYA 1V1MB 3TDKA 3TCXB 4CG0A 4KN5A 3FJOA 3B20A 1IN5A 4M9SA 2GVDC 4IH9A 4EAQA 4RZ3A 4V0NA 1TIBA 1KC3A 1U7TA 3SU8A 2WYWA 3T5PA 3RAPR 3ZLJA 1W5SA 1VLVA 4LE0A 1XMPA 2HJSA 4X62B 2QRVA 4EFDA 4DIFA 3SX4A 4UFPA 1NDQA 1MEOA 3CUUA 4NICA 4WBSA 5D7BA 3IUJA 3RODA 4QC2A 3ZWDA 5K3AA 2KQUA 1UZMA 2I4TA 3QTTA 1CEQA 4PONA 4EKGA 2KEIA 1VC2A 1NQVA 1VL0A 3GGJA 3I45A 4PXYA 5KYUB 1L8OA 3R7NA 2XXQA 4G5HA 1HDEA 2D0DA 4RF5A 1KDYA 2FUG6 3TG8A 1YF3A 2EBUA 4B79A 2L0XA 2AR9A 1VKOA 2QYTA 3FHLA 3PBKA 2GERA 2Z2ZA 3CJRA 4WOJA 5IAOA 4UHFA 5FDFA 5ENVA 1VLLA 1H2EA 3EEQA 5DX0A 1YOVB 3EGIA 2OWEA 1T4BA 1HWYA 1Z62A 3HKDB 3VR6H 4A6DA 1YOBA 4HXYA 2XB9A 3IEPA 4Q3DA 2IU0A 5SYMA 3BIFA 2JFWA 3M82A 3ZE1B 1TZJA 4ZD6A 4LRUA 3WRVA 3V97A 4R7TA 3D6JA 2ZI5A 1HE4A 3KPWA 3VU8A 4GM0A 3SMQA 3AUSA 3JARB 5CU7A 4RQUA 2CXRA 4KO8A 4ZHQA 2PKXA 5I6DA 3BOSA 3TFQA 5BMVF 2HOQA 2WA1A 4YQYA 1AGNA 1UEIA 2OKCA 4W99A 1LPBB 3KVRA 1Y8CA 1GTG1 4NMXB 4OGFA 4KFUA 4PHGA 1CXZA 4KTTE 4M0CA 3T5BA 2ZJ5A 3E23A 3NGLA 1TZ2A 4NCJA 4IIJA 5A6SB 4OMFG 4W5JA 3GN5B 4P53A 1SQ5A 2D06A 2UYOA 2PEZA 2ID7A 4JYZA 4OJKA 2Z3VA 3NHSA 3PXGA 1YE5A 2RGDA 3TXXA 3VTFA 5F7JA 1ML3A 5D2CA 1RFGE 2G9VA 2YHUA 4OYYA 3WRYA 2D0PB 1JPVA 5JZVA 2YJ6A 3TRIA 4D0NA 4JBNA 1A77A 2DE0X 1LDYA 1CNEA 2QMOA 2Q4OA 3LUFA 1IWBB 1J6UA 1W76A 2JANA 3MRXA 4LSZA 4BFUA 1P5FA 4TZ6A 4GR9A 4QXOA 5EIAA 2FWPA 2ZUVA 4OO3A 1GOTA 2GZUA 1RDFA 5A5GA 1FVOA 3TW8A 1IEQA 1N0UA 3IR6A 3ZI7A 2TMKA 1KMHA 4H7JA 4NS1A 2F7SA 2VOEA 2HU7A 1QDUA 2OM6A 4JR1A 1Z6ZA 3PHBE 4UXJA 2JVIA 3MSCA 1QR6A 3FB1A 3K8OE 4Y30A 1F14A 1A2BA 2NSLA 3WMXA 3QBVA 1F7UA 1G21E 1EAYA 1RE0A 3HCRA 3L7MA 1HSOA 1YVRA 3HA3A 2X40A 4FUQA 2AQIA 3EN0A 2GBFA 1RMQA 5LZ7A 4I8IA 3WLLA 1HE1C 2YZGA 4IIUA 1X1DA 3OHMA 3VVCA 3WK6A 4WECA 5JY6A 3C6YA 2OOSA 4XB1A 1YRAA 1E6EA 4WT7A 4B75A 1XOIA 2C5BA 1OH6A 3HWRA 4IKEA 2A1TR 2ZBEA 3PXPA 3ZLUA 3AI1A 3H99A 1JHMA 1CE8B 1L5LA 1JIXA 4QUIA 1SXJD 2P4UA 1YL6A 4NBWA 1Y8ZA 4EI9A 1E6UA 1I7PA 2N46A 3KAJA 4FQ8A 3QFRA 1AOXA 3TW6A 1NOJA 4RLFA 4IQGA 4XYLA 4J1XA 3FPEA 4LOIA 4NCIA 5IN4A 2PSJA 1C3LA 1S02A 2VRCD 3QUBA 4MUGA 4B7CA 1JVBA 3E5HA 2L1PA 1T5OA 1YUMA 4MV6A 3CG0A 3AR5A 1CB0A 3F6CA 4DCVA 4NU6A 1NNEA 2W2LD 1KJYA 3IEXA 5CNIA 5WRFA 4MIEA 4GKJB 5DISB 3LFTA 1WG8A 2LTAA 1R6TA 1HFJA 1FDUA 2OV1A 4KUEA 3RG2A 2R4QA 1C81A 2YHSA 4Q1BA 3H2ZA 1TZKA 1C0EA 1QBKC 1IC8A 4WXPA 2VCYA 4LJ4A 1E6CA 2CUNA 2HRDA 2OV4A 2ZI7A 3MJCA 3DKPA 4OI2A 4PGMA 1KR5A 2ZW9A 3PQFA 2FEKA 5LSAA 3GGGA 1NVKA 3NRJA 4CIVA 3GLGA 1A2KC 4QYSA 4B6PA 2IFTA 1F2TB 3CF0A 5A5DA 2Z3ZA 3T3MB 1NU6A 2CUKA 1QHHB 2J33A 4F6LA 2IS2A 1TQ4A 5EG5A 4OSPA 3G02A 4PO9A 4DE8A 3ZVRA 1NHGA 3GNSA 1CC1S 4G01B 2REQA 5CFQA 4MA5A 1IJKA 1N92A 4UEQA 1ZJ4A 3HYCA 1U2GA 2EHJA 5FD8A 1EFHA 3ZHQA 2PXXA 4E46A 2ODEA 3AEUB 3HABA 3LHIA 2QHXA 4NEGA 3L02A 2EVWX 4K9PA 1EWYA 4KCGA 2P79A 2GBLC 3CX6A 3H83A 2ECFA 3C3KA 4ZT3A 2WSMA 4ZCMA 3W3AA 1XNRB 3HUUA 3MWGA 3UGQA 2ZPTX 4QYTA 2RIRA 3C3CA 3PICA 1H5QA 1UBCA 5E1OA 3HU2A 1P3Y1 1A8SA 2OG1A 1K9VF 3D7MA 2N47A 1EFTA 4DC1A 1SBNE 1ZMOA 1HLDA 4EY3A 5A05A 2NU6A 3BULA 3DV9A 1F9AA 1JLLA 2OHXA 4MS4A 5A1JA 4FKBA 1XKQA 2VYVD 4O2RA 5I3ZA 1V7CA 4G5QA 1U8AA 2BLNA 3BCRA 4J90A 3RFCA 3OUTA 1Z0JA 2ZJ3A 3ICVA 1ZZEA 4UEWA 2VPYA 2I7XA 4ND7A 4YRRA 3B52X 1LK7A 4WLNA 2OBNA 3RSHA 4ENTA 1XDZA 4F7DA 2OB1A 1UQTA 3JZAA 4BRSA 1C9DB 2ONZA 5COQA 3R7WB 4A0GA 3ROXA 3H04A 1VGRA 2XQFA 4K1LA 4O4JB 1W5EA 1GXSA 4DIDA 1V8FA 1K6EA 1AGYA 4A0HA 1H94A 1YS2X 5JAZA 4F4UA 1RLMA 4HX2A 2NO0A 4H35A 3HVJA 4YMVA 4RTKA 3EWSA 3B1XA 1DAPA 4B4UA 4D6PA 4Y6LA 3PFKA 3G1WA 2J31A 7MHTA 2D2FA 4JROA 2I0FA 4DT1A 5TQ2B 3GLFB 5LXTF 2ZOSA 1OFHA 5A7LA 3G5LA 1ZRSA 3O84A 1DC4A 1G21B 4N7MA 4WDRA 2OXIA 5A4JA 2D00A 1H0RA 4X1YA 2I7TA 3DMTC 1N2CA 2FTKE 2H29A 2HZ7A 4UQPA 3WKAA 4D42A 2VJBA 3MEJA 4E6EA 1Y5MA 3AIIA 4YJHB 5DMXA 1F4LA 4GI7A 1UM9B 2GTPA 4Z7QB 2WWHA 3LG2A 2YZNA 1YHZA 2YIJA 1XTIA 5DXJA 2MDTA 3ROGA 4HWTA 3PHIA 4U2CA 2CHUA 4FNAA 5TGDA 1OX4A 4R2LA 4CV2A 4KFCA 3SI7A 1GRRA 2JGIA 4EEKA 2QORA 1FTWA 4JI6B 1M7GA 4KPYA 4YDQA 4P22A 2VUTA 1ILEA 2OHIA 4YRJA 4K6HA 4GM4A 5LQJA 3L9XA 1EFVA 2DR3A 3GT7A 4RHEA 3Q6NA 1NKVA 1P7CA 5K0BA 2GLXA 2QSZA 5IG2A 2DFTA 3UT5B 4GBED 1XALA 1YJQA 5FUBA 4YX9A 1QKKA 1E5TA 3AYZB 4ND8A 3CSSA 3NDBB 3GUYA 3OU2A 4HLNA 4JLKA 4YTEA 4O5AA 3OY2A 1XVIA 2DFLA 2QUJA 3GEDA 1CUYA 3OJEA 5BNWA 1TF5A 5BW4A 2BUAA 1R7RA 3ZC3A 2I4OA 2FKAA 2YWXA 4TKMA 1ZI9A 4BIMA 3MIZA 1SCQA 4NOMA 3QFFA 4JJ8A 1V45E 4V0OA 5BVHB 8ATCA 1OWPA 1E2JA 3K70D 1F8XA 2UYQA 3LX6A 3OOHA 5DI9A 5M5BA 1GCAA 3UO8B 2VHCA 2QP3A 1FDIA 3EDCA 3N8GA 5BWCA 2JPDA 1TCVA 4EF4A 1UC4B 4AICA 5KI6A 1PBTA 1FUIA 3HYNA 4KDRA 3EARA 4RD2A 4BP3A 4ZANA 3NHMA 3UAYA 4LOLA 2RGXA 1NULA 2RKBA 5KC8A 3AVWA 1BJTA 4URVR 3QPUA 3BMOA 3IOYA 3RK0A 1VMAA 1WV0A 1QIKA 2FW9A 3B3QA 1SCJA 1ORDA 2EKDA 4GC9A 1WPQA 2HK9A 3D8TA 3MS2A 2ODWA 4GXTA 3L6BA 5DBFA 5I9MA 4G97A 3UCEA 1SCKA 5HTOA 4QGBA 3P2EA 1HEIA 1KPIA 1DFIA 2ZTLA 4UXIA 4H18A 3VR2A 5TLSA 1Z0ZA 3GRUA 2ETVA 4MPJA 3ZU5A 3PQCA 4G0QA 3LL7A 3A6FA 2ODQA 4MGZR 1AB6A 3PJFA 2H52A 4QU8A 2UZ4A 4CEHA 1MB3A 3OKCA 2I7VA 3JAWB 5TNXA 4N76A 4JP5A 3RS3A 1L4HA 4YV1A 1C3VA 1Z17A 1ONPA 3T06B 1CJGA 1YZKA 3MWEB 3HXMA 4KXXA 2H4FA 3TFOA 2VSYA 2NLOA 1NUPA 4KQ2A 1KTVA 3B6JA 4CG1A 4CMIA 4FEYA 1DHRA 3WYEA 1R0ZA 1H2FA 2BW0A 3O47A 4F2DA 4CKWA 1ODJA 2XJ9A 4JWTA 4WX2B 5K3FB 1H2ZA 5AIBA 3TLXA 1AQJA 2AOTA 2W6JD 3E8SA 5F3RA 2I2BA 1QNFA 1JNXX 2NUBA 1NXWA 1TKAA 3L1IA 1UBKS 4KIFA 4IX9A 4P08A 5A62A 1DUVG 2CNNA 1RD4A 1RYHA 5TF4A 5FI0B 2ZRJA 4FGLA 1ZRMA 3CLRC 3IT0A 4D4HA 1NNI1 5FUMA 2PANA 1KZGB 5K3EA 3VYTB 1EH5A 3AY7A 3R9WA 1UANA 3GA0A 2UYHA 2VZEA 2B78A 2OC9A 4HC4A 4N3BA 1XKTA 2L82A 1PQ4A 1N3LA 4B45A 3BPSA 5COBA 2QX8A 1YZTA 1JIUA 1QSGA 3BD7A 2C2XA 3C8DA 2EWTA 3RTGA 1ZN7A 3VISA 4X54A 3EPPA 1TVCA 2X1LA 1JQLB 2JW5A 3I2HA 3VFDA 5L3VA 3DVLA 1ZPDA 1SU7A 3AHCA 3NAGA 4GWLA 3RKUA 4D4IA 4WQMA 3X1DA 4BO5A 3DM5A 1JIQA 3IXMA 4WEQA 5CYPA 1YBMA 1IB0A 5E3HA 5JYDA 1U0EA 3IQFA 4L76A 4ARBA 2NT3A 1QRAA 3E4CA 3TQCA 5JSYA 4G84A 5EL0A 1O0BA 4JI0B 4WDQA 3HP4A 1PX2A 3GF4A 4XLLA 1XZMA 3QV1A 2OQIA 5ADWA 1ZVKA 5IJ0A 2Q4RA 1TD1A 3HB9A 1Q92A 2X6TA 4FYJA 1ZGBA 2NQTA 3ZOZA 5BR4A 5KSWB 1PNVA 3MUNA 1SXJE 1JSRA 3GVIA 2I76A 3AEXA 1BFDA 3KWLA 3W2FA 3WWOA 4YRKA 2ENUA 5L40A 1V35A 3G2LA 3WLFA 4BGEA 2P75A 5EIEA 1LS1A 1NQTA 5TPWB 1HNXB 2O8FB 2O06A 2QJOA 4HDKA 1ODTC 1U8XX 3EVZA 3QRWA 4KRXA 1T6ZA 4RPIA 3UQZA 1UXCA 2FPLA 3NFRA 5J4LA 3ZHIA 1R0XA 2YHIB 3PUKA 3THOA 2BBWA 3QVSA 1M7HA 4BJ6A 5DLEA 5A4AA 2PUEA 4K2AA 2BMWA 3TQTA 4E13A 1I01A 1RPTA 2GJ4A 4K40A 1DDOA 1W1UA 1TRKA 3ZD6A 3QYAA 1NIJA 1NJ5A 3I9JA 3BEOA 3KQYA 4U7TB 4I4TF 4ZGWA 4BLSA 2YBEA 3M2PA 3IP6A 4AJ4A 4MGKR 7YASA 3V80A 2LYQA 3V4FA 4Y1FA 1CY4A 2R8EA 1YU6A 1EVIA 4PLFA 4YREA 1NVUQ 1V7QA 4G4SO 3WQQA 1DJLA 4EZIA 2PJUA 2PZKA 1H4VB 2ZDQA 3ADKA 3EE6A 3FMVA 5JYCA 1C50A 3UVEA 3E0XA 1DTWB 3BIJA 3IPAA 3QELB 2E0IA 4NE7A 4R0VA 3TL3A 4F92B 2PXVA 1VA4A 3T6KA 2ZBGA 4L9RA 4X91A 3EF1A 1QB2A 3GLVA 5AKZA 4RCVA 2V8OA 2MINB 3ZKCA 3FOWA 1VG1A 4ZALA 4D56A 3UCXA 1EJBA 1H1LA 1JU3A 3PR1A 1JRLA 2XDQA 3SD7A 4ANFA 3VU3A 3W9BA 4FFOA 4NWIA 2FEWB 5LUBA 3SGLA 5EHIA 2HFKA 4JIGA 3PDJA 1DSSG 1MNQA 4QFBA 3BBLA 4ZAXA 4YMUA 1RIIA 4U5XA 2HGZA 2GRMA 1NY6A 2DR0A 2V4ZA 3GPCA 1MAVA 4I55F 5THKA 4MP8A 1JWLA 1ND6A 5E8RA 4JL6A 1WUYA 4PLVA 3RIHA 4M7RA 1PYDA 2DF8A 4UCWA 3DNVB 1Q0RA 4EJFA 5BYKA 2F1RA 2DUJA 3HV0A 2A8YA 4URYR 5BVGA 1KQFA 3FCSB 3EZNA 2GCOA 1YHNA 2H54A 3KUDA 4YXWA 5HWSA 3W5SA 3H4MA 2VTBB 2CV0A 1RI2A 5T6MA 4TXHA 2Z5LA 1UFVA 2I4LA 4NRDA 2W6ID 3PA6A 5FNZA 3TAHA 2QUIA 1U5BB 5C32A 5HIKA 2CFOA 3CPSA 3VNSA 4I46A 3UAVA 2NPIA 4ZZ2A 3IP9A 1M33A 3SY8A 2ZT5A 2EJWA 4R8KA 3L8GA 4XVRA 1TEVA 4UEOA 5BSHA 2J9FA 3L05A 5JS1A 3AFNA 2FOLA 4PYRA 1CF9A 1HORA 1PT6A 2FSSA 3H87A 1U6IA 4CYMA 4BNNA 3GYGA 2EC5A 1N3BA 2QT0A 1RE1A 3W5IA 1X7WB 4ZA2A 3SOZA 4BIIA 1ECCA 3RYIB 3M4YA 1BS1A 1N9GA 3H05A 2VAWA 3IAS1 1XD2A 2Z09A 5DSTA 3SQOA 3UFBA 4BFVA 4DIBA 5IUJC 5A9SA 3IIKA 3D1NI 4ISBA 1DZ3A 3DF9A 3GOHA 4IXDA 2ZWAA 4UUPA 3F6SA 4JBYA 1EEHA 2OR3A 4C29A 5E0KB 3PPVA 5LP6F 4OHUA 1S4MA 2Z2KA 3DBHA 4TMZA 5CR9A 6AT1A 2VI5A 3HI4A 2EEZA 4YBAA 4X8MA 3Q2OA 4E1BA 5AK3A 4BFXA 4NR0A 1YR2A 3KQNA 2W2OA 3KOOA 3HVIA 1SOUA 4G8CA 3NG1A 4PVDA 5AUOB 3D3KA 4ZCLA 4L5CA 421PA 2HHHB 2XZPA 4L3WA 4AXBA 5AJVB 4X84A 3N7AA 2HXSA 1YMUA 4IZIA 4NFHA 1E3WB 1TEXA 2XUAA 2QUKA 2PUWA 1SXJB 1D9ZA 2A67A 1DXQA 2PRZA 3O4GA 1MIOB 4RL6A 5CJJA 1KSGA 3S70A 5G02A 3D7RA 3KKEA 1V48A 2P41A 5CDUA 1L7EA 1SUSA 4S1VA 2BJVA 4B73A 4KIUA 4F9FA 2C04A 1KAOA 5BSEA 3EFBA 3KYCA 5A0FA 1FP7A 3LY5A 3ZY5A 1O6FA 5IT4A 4CM4B 4NCBA 3U60B 1DT3A 3AHEA 3ZU3A 3ED1A 4IINA 1OZAA 1U8CB 1WF3A 2ZAGA 5TMPA 4TXLA 2JK0A 3O8BA 4D96A 4QOGA 1DC8A 3O93A 1VGVA 3GGCA 4P7JA 2BFNA 1A8HA 4J2HA 4G5FA 3BH0A 4DG8A 4ER3A 2H2WA 3H13A 4ABTA 4JWKA 3PDIA 3UV6A 2H1FA 1EX7A 4UQLA 3UJDA 1M2GA 2BMEA 3GNTA 5IYZF 5IKPA 1CLEA 3AVQA 1DULA 1HLPA 2CF6A 1UMCA 3EOBI 3O9VA 3R1IA 1G0NA 4MWOA 3T7KA 1UXOA 1X1SA 4MP6A 2PD6A 4K81B 2QYOA 5IX8A 5A3RA 2QVBA 2GHIA 4KUGA 5CDGA 2BWJA 4ES6A 4O4IA 4FDAA 5FWNA 1WMEA 4G0PA 3LT4A 4B74A 3BMQB 2MSLA 2JD1A 1GZ5A 4URXR 4NBNA 2GVZC 1GZVA 3QNUA 3RJ5A 3UHFA 1H3NA 3BK7A 3W7AA 4ZQHA 5BN5B 2FRVA 5B12A 3P27A 4MRRA 1RR6A 2WAXA 4ML3A 2WG0A 3GFQA 4DQXA 4YJFA 1DL5A 2WF6A 3M4ZA 1H9CA 2PWYA 3LXRA 2HNKA 5JECA 5EPEA 4IRUB 1B41A 3PQ8A 3GV0A 2YJ5A 3W1WA 5JD6A 5KMGB 1SFRA 3S8EA 4C7JA 4CEIA 3ES9A 4HEJA 4UHDA 4M8NE 4MQ6A 4U7HA 4YRDA 2A9QA 1KJ8A 1MEEA 1FU7A 4PQFA 4RANA 5E1BA 4BB9A 3CZ5A 1TF7A 5AQEA 1QZUA 1W36D 3MCWA 1H4TA 1YB7A 2CBZA 2J48A 3QTLA 3RU7A 1ABEA 4HLUC 2VP0A 1L7DA 3LUHA 5CD9A 3GEIA 4AI6A 1RJ9A 1ISRA 1DRJA 3HXKA 3ILXA 3ITNA 4O0LA 1H0SA 4JH0A 4CKZA 5C9ZA 2AMFA 2X1VA 4HDOB 2ZGVA 3R5HA 2LYPA 3GRVA 1O77A 1IBRA 3W6NA 1Y5LA 4BLQA 5FLXA 1U2RA 4OIFA 2W83A 3GJ8A 1AH2A 2HMYB 3MWLA 4EUKA 5AJWA 4JI3B 5IT0A 2Y0DA 1CWUA 5EJ6A 1QP4A 3IVAA 2G4CA 3ZJYA 1IULA 2F3PA 1FRVA 2MR6A 4HFNA 3BXZA 3ITDA 4I9UA 1JZSA 5FUVA 3VBCA 1L7PA 5EI5A 1P6UA 3C14C 5EN4A 5BW6B 5IXYA 4DAOA 1VLMA 5EJEA 10MHA 3H16A 3W05A 1VIAA 2I3BA 1NR5A 1PV2A 2G9ZA 2XV1A 4J7CA 4MDFA 2PBFA 1Q3KA 3A4IA 1XWRA 2XSDC 1SIOA 4JLJA 5EJ7A 4DV5B 4YT2A 5L6MB 3PGMA 1KQ3A 3C5EA 4BXOB 1T2AA 4S05A 3M5DA 3K71B 2JI8A 4I4LA 1UBGA 2BL4A 4NJEB 1GGHA 2AMLA 3N2EA 4G5GA 4GLOA 4NK5A 4B9EA 2REXB 1SVNA 3NBUA 3RQSA 4CM8B 2RMKA