4IVZA

A y37f mutant of c.esp1396i bound to its highest affinity operator site om
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
76
structure length
76
Chain Sequence
ESFLLSKVSFVIKKIRLEKGMTQEDLAYKSNLDRTFISGIERNSRNLTIKSLELIMKGLEVSDVVFFEMLIKEILK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Mutagenic Analysis of the RM Controller Protein C.Esp1396I.
pubmed doi rcsb
source organism Enterobacter sp.
molecule tags Transcription/dna
molecule keywords Regulatory protein
total genus 28
structure length 76
sequence length 76
chains with identical sequence B, E, F
ec nomenclature
pdb deposition date 2013-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 4ivzA00
1ZS4A 3JXBC 1BDHA 1UXCA 3GN5B 3O9XA 1CJGA 2IV1A 1RZSA 3CECA 1JWLA 3QF3A 1LMB3 3ZHMA 2ICTA 2LYLA 2AXZA 2KZ8A 2PIJA 4J1XA 2HSGA 2KEKA 3FYMA 1ZAYA 4I6UA 4YG7B 2R1JL 3UFDA 2PUFA 1DW9A 2XI8A 2LYKA 1WETA 2KPJA 2LYPA 2KEJA 2GRLA 3L1PA 3ZKCA 2O4AA 2PE5A 1RPEL 4PU3C 4IWRA 2XJ3A 3R1FA 1LCDA 2AWIA 1RZRA 1OCTC 3F51A 3H5TA 4J1WA 4GHJA 1ZZCA 2B5AA 1B0NA 3S8QA 1QP0A 3KJXA 4OB4A 3CLCA 3OQNA 3OQMA 2FJRA 1Y7YA 1ZZ6A 4YG4A 2IVBA 3BS3A 4X4CA 1JH9A 2D5VA 1ADRA 3VK0A 2EF8A 4X4IA 3EUSA 1CQTA 1SQ8A 4MCTA 4FN3A 2PUEA 2A6CA 1BDIA 2O38A 4YBAA 1QP7A 2LCVA 1ZUGA 2BNOA 3OMTA 2BJCA 2IU7A 3FMYA 2KEIA 1ZZBA 3RZZA 4JCYA 4GQMA 2MEZA 4PU4C 1OSLA 4NDWA 2EBYA 3SCFA 3G7DA 3F6WA 4X4BA 3OP9A 1S7EA 3GBFA 1RIOA 5K98B 2AW6A 2AUWA 2IUOA 2GRMA 4I8TA 4JCXA 2BNNA 3F52A 1YSEA 2CROA 1L1MA 5A7LA 2MQKA 3PXPA 2PUGA 3GN5A 1ZZ7A 2PUAA 2WUSR 3D1NI 1VPWA 4F8DA 1DWKA 3U3WA 1PNRA 1QP4A 2OR1L 2PUCA 4Z58A 2L49A 1X57A 2XSDC 3HZIB 3CROL 2JCGA 4IA8A 4Y42A 4YG1A 1IC8A 2LYRA 3SCGA 2R63A 4X4FA 3JXCL 1QQBA 1PRVA 1ZPQA 2LYQA 1WH8A 2JVLA 1XWRA 3QQ6A 2AXUA 3QWGA 1AU7A 1QPZA 3IVPA 3TRBA 2IVQA 2CSFA 2OFYA 1ZVVA 2BNMA 2AXVA 2GZUA 1R63A 1LQCA 3OQOA 1RZRD 2O49A 1UXDA 1PRAA 4I6RA 2H8RA 4X4GA 1PRUA 3LISA 2LYSA 3KXAA 3QYXA 1PERL 1R69A 3FYAA 1LLIA 2XCJA 4PU7A 1NERA 2ICPA 4Z59A 3B7HA 1JFSA 1WIZA 1E3OC 3ZHIA 1UTXA 2PUDA 2EWTA 2WIUB 4X4EA 3BDNA 4JQDA 4MCXA 1HF0A 4IVZA 3LFPA 2PUBA 1JFTA 2LYJA 1LCCA 4FBIA 4Z5DA 3JXDL 1QQAA 3G5GA 3BD1A 2HINA 2XIUA 4Z5HA 4YARA 1ZZ9A 1GT0C 4Z5CA 2IVGA 3SCHA 2PPXA 1ZZ8A 3MLFA 4O8BA 4I6TA 4X4DA 1POUA 2L8NA 1X2LA 4PU8A 3KZ3A 1EFAA 1Y9QA 4X4HA 1O4XA 3DNVB 1NEQA 1WH6A
chains in the Genus database with same CATH superfamily
3A9YA 2PXFA 4ER5A 1JWLA 2FFHA 4J1XA 2PIJA 2XI8A 2O4AA 2XXAA 4IWRA 2AWIA 4J1WA 2B5AA 3A9ZA 3TFLA 3OQMA 3EUSA 4EKGA 3TEPA 1SQ8A 4MCTA 2O38A 4YBAA 2BNOA 2KEIA 3RZZA 3SR4A 2MEZA 1QZXA 1RIOA 3QOXA 5DRYA 2BNNA 3F52A 1YSEA 1L1MA 5A7LA 1ZZ7A 3D1NI 1PNRA 1QP4A 2OR1L 4Z58A 3HZIB 1XWRA 2PXKA 2PXLA 2IVQA 2BNMA 5DTMA 4X4GA 5DTRA 1PERL 1LLIA 4PU7A 3GUUA 3GZCA 1E3OC 4WVLA 4IVZA 4FBIA 4Z5DA 1QQAA 4Z5HA 5DRTA 1GT0C 2M4HA 3DM5A 3R09A 4I6TA 4PU8A 1Y9QA 4X4HA 4ER3A 2JQEA 2IV1A 3ZHMA 2LNMA 3QF3A 1LMB3 3G0TA 2KZ8A 4EZIA 2KEKA 2LYKA 1WETA 2LYPA 2KEJA 3ZKCA 2PE5A 4PU3C 1LCDA 1OCTC 1RZRA 3H5TA 1ZZCA 3KJXA 4OB4A 1Y7YA 1ZZ6A 2IVBA 3BS3A 1JH9A 3VK0A 2PUEA 2A6CA 5GAGi 2LCVA 4EQZA 3OMTA 4EK9A 4NDWA 3OP9A 1S7EA 2AW6A 2IUOA 2MXDA 2CROA 4HRAA 3GN5A 2XXPA 2WUSR 1VPWA 2YBDA 2PXBA 4IA8A 4Y42A 1U2ZA 3SCGA 2R63A 1ZPQA 3QQ6A 5DSXA 2CSFA 1R63A 1LQCA 3OQOA 1UXDA 2LYSA 1HQ1A 2XCJA 3VWSA 3OWQA 4Z59A 5DTQA 1JFSA 3ZHIA 4DE8A 4X4EA 3BDNA 4JQDA 4MCXA 1HF0A 3LFPA 2PUBA 2LYJA 2XIUA 2PXDA 3SCHA 3MLFA 1POUA 2L8NA 3QOWA 2PXQA 1NEQA 1ADRA 1ZS4A 1BDHA 3GN5B 3O9XA 1CJGA 3NZLA 1RZSA 3CECA 3TELA 3SX0A 2HSGA 3FYMA 2L1PA 2KPJA 2GRLA 3QFIA 3L1PA 1RPEL 3R1FA 3F51A 1B0NA 3S8QA 1QP0A 2FJRA 4YG4A 4X4IA 1CQTA 4FN3A 1DULA 1ZUGA 2PXTA 2BJCA 2IU7A 1ZZBA 4GQMA 4PU4C 1OSLA 3SCFA 3G7DA 3F6WA 3GBFA 5K98B 2AUWA 3PXPA 2PUGA 4OBMA 2PUCA 2L49A 2XSDC 1MFQC 3CROL 1IC8A 4YG1A 2HCSA 2LYRA 3GZDA 3JXCL 1QQBA 1PRVA 2AXUA 3QWGA 3IVPA 3M9LA 3TRBA 3A9XA 2OFYA 4DE9A 3PE5A 2O49A 1PRAA 3LISA 4ER7A 3KXAA 3QYXA 1R69A 3UWPA 1NERA 2ICPA 3B7HA 1WIZA 3ZPXA 2EWTA 1LCCA 3G5GA 3BD1A 1ZZ8A 4X4DA 2V3CC 1X2LA 3KZ3A 1O4XA 3DNVB 1WH6A 3JXBC 1UXCA 2PXEA 2ICTA 2LYLA 2AXZA 4ER0A 1ZAYA 4I6UA 4YG7B 2R1JL 3UFDA 2PUFA 1DW9A 2XJ3A 4GHJA 2PXVA 3CLCA 3OQNA 2D5VA 4X4CA 4EKIA 2LLWA 2EF8A 2HFZA 2J7WA 1BDIA 3NXHA 1QP7A 1QB2A 2J7UA 3FMYA 4JCYA 3NDBB 2EBYA 2PXUA 4X4BA 2GRMA 4I8TA 4JCXA 2MQKA 4ER6A 2PUAA 2PXPA 4F8DA 1DWKA 3U3WA 3GZDC 3MEJA 1X57A 2JCGA 3ME5A 4X4FA 2LYQA 1WH8A 2JVLA 1QPZA 2HCNA 1AU7A 5JUWA 1ZVVA 2AXVA 2GZUA 1RZRD 4I6RA 5GAHi 2H8RA 1PRUA 3FYAA 2XXQA 3KL4A 1UTXA 2ODRD 2PUDA 2WIUB 2LLVA 2VEOA 4Q2JA 1JFTA 3JXDL 2HINA 4YARA 1ZZ9A 4Z5CA 2IVGA 2PPXA 3OKZA 4O8BA 1NW3A 5DT2A 1EFAA 3LQXA 3NROA
chains in the Genus database with same CATH topology
1ZS4A 3JXBC 1BDHA 1UXCA 3GN5B 3O9XA 1CJGA 2IV1A 1RZSA 3CECA 1JWLA 3QF3A 1LMB3 3ZHMA 2ICTA 2LYLA 2AXZA 2KZ8A 2PIJA 4J1XA 2HSGA 2KEKA 3FYMA 1ZAYA 4I6UA 4YG7B 2R1JL 3UFDA 2PUFA 1DW9A 2XI8A 2LYKA 1WETA 2KPJA 2LYPA 2KEJA 2GRLA 3L1PA 3ZKCA 2O4AA 2PE5A 1RPEL 4PU3C 4IWRA 2XJ3A 3R1FA 1LCDA 2AWIA 1RZRA 1OCTC 3F51A 3H5TA 4J1WA 4GHJA 1ZZCA 2B5AA 1B0NA 3S8QA 1QP0A 3KJXA 4OB4A 3CLCA 3OQNA 3OQMA 2FJRA 1Y7YA 1ZZ6A 4YG4A 2IVBA 3BS3A 4X4CA 1JH9A 2D5VA 1ADRA 3VK0A 2EF8A 4X4IA 3EUSA 1CQTA 1SQ8A 4MCTA 4FN3A 2PUEA 2A6CA 1BDIA 2O38A 4YBAA 1QP7A 2LCVA 1ZUGA 2BNOA 3OMTA 2BJCA 2IU7A 3FMYA 2KEIA 1ZZBA 3RZZA 4JCYA 4GQMA 2MEZA 4PU4C 1OSLA 4NDWA 2EBYA 3SCFA 3G7DA 3F6WA 4X4BA 3OP9A 1S7EA 3GBFA 1RIOA 5K98B 2AW6A 2AUWA 2IUOA 2GRMA 4I8TA 4JCXA 2BNNA 3F52A 1YSEA 2CROA 1L1MA 5A7LA 2MQKA 3PXPA 2PUGA 3GN5A 1ZZ7A 2PUAA 2WUSR 3D1NI 1VPWA 4F8DA 1DWKA 3U3WA 1PNRA 1QP4A 2OR1L 2PUCA 4Z58A 2L49A 1X57A 2XSDC 3HZIB 3CROL 2JCGA 4IA8A 4Y42A 4YG1A 1IC8A 2LYRA 3SCGA 2R63A 4X4FA 3JXCL 1QQBA 1PRVA 1ZPQA 2LYQA 1WH8A 2JVLA 1XWRA 3QQ6A 2AXUA 3QWGA 1AU7A 1QPZA 3IVPA 3TRBA 2IVQA 2CSFA 2OFYA 1ZVVA 2BNMA 2AXVA 2GZUA 1R63A 1LQCA 3OQOA 1RZRD 2O49A 1UXDA 1PRAA 4I6RA 2H8RA 4X4GA 1PRUA 3LISA 2LYSA 3KXAA 3QYXA 1PERL 1R69A 3FYAA 1LLIA 2XCJA 4PU7A 1NERA 2ICPA 4Z59A 3B7HA 1JFSA 1WIZA 1E3OC 3ZHIA 1UTXA 2PUDA 2EWTA 2WIUB 4X4EA 3BDNA 4JQDA 4MCXA 1HF0A 4IVZA 3LFPA 2PUBA 1JFTA 2LYJA 1LCCA 4FBIA 4Z5DA 3JXDL 1QQAA 3G5GA 3BD1A 2HINA 2XIUA 4Z5HA 4YARA 1ZZ9A 1GT0C 4Z5CA 2IVGA 3SCHA 2PPXA 1ZZ8A 3MLFA 4O8BA 4I6TA 4X4DA 1POUA 2L8NA 1X2LA 4PU8A 3KZ3A 1EFAA 1Y9QA 4X4HA 1O4XA 3DNVB 1NEQA 1WH6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZS4 A;  3JXB C;  1BDH A;  1UXC A;  3GN5 B;  3O9X A;  1CJG A;  2IV1 A;  1RZS A;  3CEC A;  1JWL A;  3QF3 A;  1LMB 3;  3ZHM A;  2ICT A;  2LYL A;  2AXZ A;  2KZ8 A;  2PIJ A;  4J1X A;  2HSG A;  2KEK A;  3FYM A;  1ZAY A;  4I6U A;  4YG7 B;  2R1J L;  3UFD A;  2PUF A;  1DW9 A;  2XI8 A;  2LYK A;  1WET A;  2KPJ A;  2LYP A;  2KEJ A;  2GRL A;  3L1P A;  3ZKC A;  2O4A A;  2PE5 A;  1RPE L;  4PU3 C;  4IWR A;  2XJ3 A;  3R1F A;  1LCD A;  2AWI A;  1RZR A;  1OCT C;  3F51 A;  3H5T A;  4J1W A;  4GHJ A;  1ZZC A;  2B5A A;  1B0N A;  3S8Q A;  1QP0 A;  3KJX A;  4OB4 A;  3CLC A;  3OQN A;  3OQM A;  2FJR A;  1Y7Y A;  1ZZ6 A;  4YG4 A;  2IVB A;  3BS3 A;  4X4C A;  1JH9 A;  2D5V A;  1ADR A;  3VK0 A;  2EF8 A;  4X4I A;  3EUS A;  1CQT A;  1SQ8 A;  4MCT A;  4FN3 A;  2PUE A;  2A6C A;  1BDI A;  2O38 A;  4YBA A;  1QP7 A;  2LCV A;  1ZUG A;  2BNO A;  3OMT A;  2BJC A;  2IU7 A;  3FMY A;  2KEI A;  1ZZB A;  3RZZ A;  4JCY A;  4GQM A;  2MEZ A;  4PU4 C;  1OSL A;  4NDW A;  2EBY A;  3SCF A;  3G7D A;  3F6W A;  4X4B A;  3OP9 A;  1S7E A;  3GBF A;  1RIO A;  5K98 B;  2AW6 A;  2AUW A;  2IUO A;  2GRM A;  4I8T A;  4JCX A;  2BNN A;  3F52 A;  1YSE A;  2CRO A;  1L1M A;  5A7L A;  2MQK A;  3PXP A;  2PUG A;  3GN5 A;  1ZZ7 A;  2PUA A;  2WUS R;  3D1N I;  1VPW A;  4F8D A;  1DWK A;  3U3W A;  1PNR A;  1QP4 A;  2OR1 L;  2PUC A;  4Z58 A;  2L49 A;  1X57 A;  2XSD C;  3HZI B;  3CRO L;  2JCG A;  4IA8 A;  4Y42 A;  4YG1 A;  1IC8 A;  2LYR A;  3SCG A;  2R63 A;  4X4F A;  3JXC L;  1QQB A;  1PRV A;  1ZPQ A;  2LYQ A;  1WH8 A;  2JVL A;  1XWR A;  3QQ6 A;  2AXU A;  3QWG A;  1AU7 A;  1QPZ A;  3IVP A;  3TRB A;  2IVQ A;  2CSF A;  2OFY A;  1ZVV A;  2BNM A;  2AXV A;  2GZU A;  1R63 A;  1LQC A;  3OQO A;  1RZR D;  2O49 A;  1UXD A;  1PRA A;  4I6R A;  2H8R A;  4X4G A;  1PRU A;  3LIS A;  2LYS A;  3KXA A;  3QYX A;  1PER L;  1R69 A;  3FYA A;  1LLI A;  2XCJ A;  4PU7 A;  1NER A;  2ICP A;  4Z59 A;  3B7H A;  1JFS A;  1WIZ A;  1E3O C;  3ZHI A;  1UTX A;  2PUD A;  2EWT A;  2WIU B;  4X4E A;  3BDN A;  4JQD A;  4MCX A;  1HF0 A;  4IVZ A;  3LFP A;  2PUB A;  1JFT A;  2LYJ A;  1LCC A;  4FBI A;  4Z5D A;  3JXD L;  1QQA A;  3G5G A;  3BD1 A;  2HIN A;  2XIU A;  4Z5H A;  4YAR A;  1ZZ9 A;  1GT0 C;  4Z5C A;  2IVG A;  3SCH A;  2PPX A;  1ZZ8 A;  3MLF A;  4O8B A;  4I6T A;  4X4D A;  1POU A;  2L8N A;  1X2L A;  4PU8 A;  3KZ3 A;  1EFA A;  1Y9Q A;  4X4H A;  1O4X A;  3DNV B;  1NEQ A;  1WH6 A; 
#chains in the Genus database with same CATH topology
 3A9Y A;  2PXF A;  4ER5 A;  1JWL A;  2FFH A;  4J1X A;  2PIJ A;  2XI8 A;  2O4A A;  2XXA A;  4IWR A;  2AWI A;  4J1W A;  2B5A A;  3A9Z A;  3TFL A;  3OQM A;  3EUS A;  4EKG A;  3TEP A;  1SQ8 A;  4MCT A;  2O38 A;  4YBA A;  2BNO A;  2KEI A;  3RZZ A;  3SR4 A;  2MEZ A;  1QZX A;  1RIO A;  3QOX A;  5DRY A;  2BNN A;  3F52 A;  1YSE A;  1L1M A;  5A7L A;  1ZZ7 A;  3D1N I;  1PNR A;  1QP4 A;  2OR1 L;  4Z58 A;  3HZI B;  1XWR A;  2PXK A;  2PXL A;  2IVQ A;  2BNM A;  5DTM A;  4X4G A;  5DTR A;  1PER L;  1LLI A;  4PU7 A;  3GUU A;  3GZC A;  1E3O C;  4WVL A;  4IVZ A;  4FBI A;  4Z5D A;  1QQA A;  4Z5H A;  5DRT A;  1GT0 C;  2M4H A;  3DM5 A;  3R09 A;  4I6T A;  4PU8 A;  1Y9Q A;  4X4H A;  4ER3 A;  2JQE A;  2IV1 A;  3ZHM A;  2LNM A;  3QF3 A;  1LMB 3;  3G0T A;  2KZ8 A;  4EZI A;  2KEK A;  2LYK A;  1WET A;  2LYP A;  2KEJ A;  3ZKC A;  2PE5 A;  4PU3 C;  1LCD A;  1OCT C;  1RZR A;  3H5T A;  1ZZC A;  3KJX A;  4OB4 A;  1Y7Y A;  1ZZ6 A;  2IVB A;  3BS3 A;  1JH9 A;  3VK0 A;  2PUE A;  2A6C A;  5GAG i;  2LCV A;  4EQZ A;  3OMT A;  4EK9 A;  4NDW A;  3OP9 A;  1S7E A;  2AW6 A;  2IUO A;  2MXD A;  2CRO A;  4HRA A;  3GN5 A;  2XXP A;  2WUS R;  1VPW A;  2YBD A;  2PXB A;  4IA8 A;  4Y42 A;  1U2Z A;  3SCG A;  2R63 A;  1ZPQ A;  3QQ6 A;  5DSX A;  2CSF A;  1R63 A;  1LQC A;  3OQO A;  1UXD A;  2LYS A;  1HQ1 A;  2XCJ A;  3VWS A;  3OWQ A;  4Z59 A;  5DTQ A;  1JFS A;  3ZHI A;  4DE8 A;  4X4E A;  3BDN A;  4JQD A;  4MCX A;  1HF0 A;  3LFP A;  2PUB A;  2LYJ A;  2XIU A;  2PXD A;  3SCH A;  3MLF A;  1POU A;  2L8N A;  3QOW A;  2PXQ A;  1NEQ A;  1ADR A;  1ZS4 A;  1BDH A;  3GN5 B;  3O9X A;  1CJG A;  3NZL A;  1RZS A;  3CEC A;  3TEL A;  3SX0 A;  2HSG A;  3FYM A;  2L1P A;  2KPJ A;  2GRL A;  3QFI A;  3L1P A;  1RPE L;  3R1F A;  3F51 A;  1B0N A;  3S8Q A;  1QP0 A;  2FJR A;  4YG4 A;  4X4I A;  1CQT A;  4FN3 A;  1DUL A;  1ZUG A;  2PXT A;  2BJC A;  2IU7 A;  1ZZB A;  4GQM A;  4PU4 C;  1OSL A;  3SCF A;  3G7D A;  3F6W A;  3GBF A;  5K98 B;  2AUW A;  3PXP A;  2PUG A;  4OBM A;  2PUC A;  2L49 A;  2XSD C;  1MFQ C;  3CRO L;  1IC8 A;  4YG1 A;  2HCS A;  2LYR A;  3GZD A;  3JXC L;  1QQB A;  1PRV A;  2AXU A;  3QWG A;  3IVP A;  3M9L A;  3TRB A;  3A9X A;  2OFY A;  4DE9 A;  3PE5 A;  2O49 A;  1PRA A;  3LIS A;  4ER7 A;  3KXA A;  3QYX A;  1R69 A;  3UWP A;  1NER A;  2ICP A;  3B7H A;  1WIZ A;  3ZPX A;  2EWT A;  1LCC A;  3G5G A;  3BD1 A;  1ZZ8 A;  4X4D A;  2V3C C;  1X2L A;  3KZ3 A;  1O4X A;  3DNV B;  1WH6 A;  3JXB C;  1UXC A;  2PXE A;  2ICT A;  2LYL A;  2AXZ A;  4ER0 A;  1ZAY A;  4I6U A;  4YG7 B;  2R1J L;  3UFD A;  2PUF A;  1DW9 A;  2XJ3 A;  4GHJ A;  2PXV A;  3CLC A;  3OQN A;  2D5V A;  4X4C A;  4EKI A;  2LLW A;  2EF8 A;  2HFZ A;  2J7W A;  1BDI A;  3NXH A;  1QP7 A;  1QB2 A;  2J7U A;  3FMY A;  4JCY A;  3NDB B;  2EBY A;  2PXU A;  4X4B A;  2GRM A;  4I8T A;  4JCX A;  2MQK A;  4ER6 A;  2PUA A;  2PXP A;  4F8D A;  1DWK A;  3U3W A;  3GZD C;  3MEJ A;  1X57 A;  2JCG A;  3ME5 A;  4X4F A;  2LYQ A;  1WH8 A;  2JVL A;  1QPZ A;  2HCN A;  1AU7 A;  5JUW A;  1ZVV A;  2AXV A;  2GZU A;  1RZR D;  4I6R A;  5GAH i;  2H8R A;  1PRU A;  3FYA A;  2XXQ A;  3KL4 A;  1UTX A;  2ODR D;  2PUD A;  2WIU B;  2LLV A;  2VEO A;  4Q2J A;  1JFT A;  3JXD L;  2HIN A;  4YAR A;  1ZZ9 A;  4Z5C A;  2IVG A;  2PPX A;  3OKZ A;  4O8B A;  1NW3 A;  5DT2 A;  1EFA A;  3LQX A;  3NRO A; 
#chains in the Genus database with same CATH homology
 1ZS4 A;  3JXB C;  1BDH A;  1UXC A;  3GN5 B;  3O9X A;  1CJG A;  2IV1 A;  1RZS A;  3CEC A;  1JWL A;  3QF3 A;  1LMB 3;  3ZHM A;  2ICT A;  2LYL A;  2AXZ A;  2KZ8 A;  2PIJ A;  4J1X A;  2HSG A;  2KEK A;  3FYM A;  1ZAY A;  4I6U A;  4YG7 B;  2R1J L;  3UFD A;  2PUF A;  1DW9 A;  2XI8 A;  2LYK A;  1WET A;  2KPJ A;  2LYP A;  2KEJ A;  2GRL A;  3L1P A;  3ZKC A;  2O4A A;  2PE5 A;  1RPE L;  4PU3 C;  4IWR A;  2XJ3 A;  3R1F A;  1LCD A;  2AWI A;  1RZR A;  1OCT C;  3F51 A;  3H5T A;  4J1W A;  4GHJ A;  1ZZC A;  2B5A A;  1B0N A;  3S8Q A;  1QP0 A;  3KJX A;  4OB4 A;  3CLC A;  3OQN A;  3OQM A;  2FJR A;  1Y7Y A;  1ZZ6 A;  4YG4 A;  2IVB A;  3BS3 A;  4X4C A;  1JH9 A;  2D5V A;  1ADR A;  3VK0 A;  2EF8 A;  4X4I A;  3EUS A;  1CQT A;  1SQ8 A;  4MCT A;  4FN3 A;  2PUE A;  2A6C A;  1BDI A;  2O38 A;  4YBA A;  1QP7 A;  2LCV A;  1ZUG A;  2BNO A;  3OMT A;  2BJC A;  2IU7 A;  3FMY A;  2KEI A;  1ZZB A;  3RZZ A;  4JCY A;  4GQM A;  2MEZ A;  4PU4 C;  1OSL A;  4NDW A;  2EBY A;  3SCF A;  3G7D A;  3F6W A;  4X4B A;  3OP9 A;  1S7E A;  3GBF A;  1RIO A;  5K98 B;  2AW6 A;  2AUW A;  2IUO A;  2GRM A;  4I8T A;  4JCX A;  2BNN A;  3F52 A;  1YSE A;  2CRO A;  1L1M A;  5A7L A;  2MQK A;  3PXP A;  2PUG A;  3GN5 A;  1ZZ7 A;  2PUA A;  2WUS R;  3D1N I;  1VPW A;  4F8D A;  1DWK A;  3U3W A;  1PNR A;  1QP4 A;  2OR1 L;  2PUC A;  4Z58 A;  2L49 A;  1X57 A;  2XSD C;  3HZI B;  3CRO L;  2JCG A;  4IA8 A;  4Y42 A;  4YG1 A;  1IC8 A;  2LYR A;  3SCG A;  2R63 A;  4X4F A;  3JXC L;  1QQB A;  1PRV A;  1ZPQ A;  2LYQ A;  1WH8 A;  2JVL A;  1XWR A;  3QQ6 A;  2AXU A;  3QWG A;  1AU7 A;  1QPZ A;  3IVP A;  3TRB A;  2IVQ A;  2CSF A;  2OFY A;  1ZVV A;  2BNM A;  2AXV A;  2GZU A;  1R63 A;  1LQC A;  3OQO A;  1RZR D;  2O49 A;  1UXD A;  1PRA A;  4I6R A;  2H8R A;  4X4G A;  1PRU A;  3LIS A;  2LYS A;  3KXA A;  3QYX A;  1PER L;  1R69 A;  3FYA A;  1LLI A;  2XCJ A;  4PU7 A;  1NER A;  2ICP A;  4Z59 A;  3B7H A;  1JFS A;  1WIZ A;  1E3O C;  3ZHI A;  1UTX A;  2PUD A;  2EWT A;  2WIU B;  4X4E A;  3BDN A;  4JQD A;  4MCX A;  1HF0 A;  4IVZ A;  3LFP A;  2PUB A;  1JFT A;  2LYJ A;  1LCC A;  4FBI A;  4Z5D A;  3JXD L;  1QQA A;  3G5G A;  3BD1 A;  2HIN A;  2XIU A;  4Z5H A;  4YAR A;  1ZZ9 A;  1GT0 C;  4Z5C A;  2IVG A;  3SCH A;  2PPX A;  1ZZ8 A;  3MLF A;  4O8B A;  4I6T A;  4X4D A;  1POU A;  2L8N A;  1X2L A;  4PU8 A;  3KZ3 A;  1EFA A;  1Y9Q A;  4X4H A;  1O4X A;  3DNV B;  1NEQ A;  1WH6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...