2PIJA

Structure of the cro protein from prophage pfl 6 in pseudomonas fluorescens pf-5
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
59
structure length
59
Chain Sequence
MKKIPLSKYLEEHGTQSALAAALGVNQSAISQMVRAGRSIEITLYEDGRVEANEIRPIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Transitive homology-guided structural studies lead to discovery of Cro proteins with 40% sequence identity but different folds.
pubmed doi rcsb
source organism Pseudomonas fluorescens
molecule tags Transcription
molecule keywords Prophage Pfl 6 Cro
total genus 15
structure length 59
sequence length 59
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09048 Cro Cro
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2pijA00
4JCXA 2IVBA 1AU7A 2LYLA 3GN5B 2R1JL 3QYXA 1ZZCA 1ZUGA 2ICTA 2EWTA 2BJCA 2GRMA 2LYJA 4FBIA 2IVGA 3G7DA 1B0NA 4X4BA 4X4HA 3OQNA 1WIZA 3JXBC 4J1WA 3OQOA 2B5AA 3JXDL 2IU7A 2A6CA 4YG7B 3IVPA 3FYMA 3QQ6A 1VPWA 4X4DA 4X4FA 1JFSA 1JFTA 1JH9A 4YG4A 3JXCL 1POUA 4Z5HA 2PUAA 1QP0A 1ZZ9A 2AUWA 3GN5A 4PU4C 2XSDC 1UXCA 1ZZ6A 4YARA 2O4AA 1S7EA 1LMB3 1UTXA 1RZSA 2WIUB 1SQ8A 3SCGA 1GT0C 3G5GA 2KEIA 1CJGA 2PUDA 2O38A 1ZPQA 3BS3A 1RZRD 1ZAYA 3RZZA 1PERL 4FN3A 4PU8A 3VK0A 1EFAA 2AXZA 2EBYA 3TRBA 1RZRA 2PUFA 2OFYA 4X4IA 4I8TA 2O49A 2CROA 3FMYA 2JVLA 2HINA 2HSGA 3F51A 3PXPA 3SCHA 1BDHA 1UXDA 2BNOA 3KJXA 3LFPA 3L1PA 2JCGA 3R1FA 2D5VA 2AXUA 1CQTA 2AW6A 2IUOA 1IC8A 1ZZ8A 4JQDA 3CECA 4YBAA 2OR1L 1RIOA 1QPZA 4GQMA 3KZ3A 2XIUA 1XWRA 4I6UA 2LYRA 1WH6A 4NDWA 2PE5A 4O8BA 3O9XA 2H8RA 2LYPA 2IVQA 1ZVVA 1QQAA 2L8NA 1WH8A 2R63A 2CSFA 2XJ3A 4I6RA 3ZHIA 2PUCA 1X57A 4YG1A 2FJRA 3OP9A 4X4GA 1HF0A 3LISA 3HZIB 1QP4A 4MCTA 2BNMA 2PUGA 1RPEL 3OMTA 4Y42A 5A7LA 2PIJA 4F8DA 4Z58A 5K98B 2XI8A 3ZKCA 2KEKA 1Y7YA 2LYQA 4PU7A 4Z5DA 1E3OC 1PRAA 2KEJA 1ZS4A 1BDIA 1JWLA 2LCVA 4Z5CA 2BNNA 2PPXA 3BD1A 4J1XA 1OCTC 1Y9QA 3F6WA 3B7HA 3BDNA 1YSEA 3F52A 2GZUA 3CROL 3SCFA 1LLIA 2AWIA 2LYSA 3MLFA 4IA8A 1DWKA 4IVZA 1OSLA 2PUBA 4GHJA 1L1MA 3ZHMA 3UFDA 1R63A 3H5TA 1R69A 3QF3A 2GRLA 3EUSA 1QP7A 1LQCA 2ICPA 2MQKA 4OB4A 1LCCA 1ZZ7A 4I6TA 2AXVA 1ZZBA 4JCYA 2XCJA 1ADRA 3U3WA 4X4CA 3FYAA 4IWRA 2MEZA 1QQBA 2KZ8A 3OQMA 1X2LA 2L49A 2EF8A 2LYKA 4X4EA 1PNRA 3S8QA 3CLCA 1PRVA 3D1NI 3DNVB 4Z59A 2KPJA 4PU3C 1LCDA 1NEQA 1WETA 2PUEA 3QWGA 1DW9A 2WUSR 1NERA 2IV1A 4MCXA 1PRUA 3GBFA 3KXAA 1O4XA
chains in the Genus database with same CATH superfamily
4JCXA 1ZUGA 2GRMA 4ER5A 3G7DA 4X4BA 4X4HA 1WIZA 3JXBC 4J1WA 3OQOA 2A6CA 1NW3A 1JFTA 1POUA 3G0TA 2XSDC 1S7EA 1LMB3 2PXVA 3SCGA 1GT0C 2O38A 1ZPQA 1RZRD 3RZZA 1PERL 2OFYA 3QOXA 2JVLA 2HINA 2LNMA 3NZLA 3KJXA 3L1PA 5DT2A 1ZZ8A 1HQ1A 2OR1L 4GQMA 2PXFA 1XWRA 2IVQA 4WVLA 1ZVVA 2XJ3A 4HRAA 3LISA 2BNMA 3OMTA 1E3OC 4Z5DA 1PRAA 3QFIA 2KEJA 1ZS4A 1JWLA 3R09A 2LLVA 4Z5CA 1YSEA 3CROL 2V3CC 4IVZA 1OSLA 1L1MA 3ZHMA 3OKZA 3H5TA 3QF3A 1QP7A 1ZZ7A 1ZZBA 4JCYA 2XCJA 1ADRA 3U3WA 1QQBA 2KZ8A 3GZCA 2EF8A 2LYKA 1PRVA 4Z59A 3QWGA 1DW9A 3MEJA 3GBFA 3KXAA 2IVBA 3A9ZA 2LYLA 2PXKA 1DULA 2IVGA 2IU7A 3A9XA 1JFSA 1JH9A 3ME5A 4YG4A 1ZZ9A 2AUWA 2J7UA 4YARA 2O4AA 1UTXA 1RZSA 1SQ8A 3TELA 4Q2JA 2KEIA 2PUDA 1RZRA 2PUFA 2CROA 3TFLA 3QOWA 2BNOA 2D5VA 1CQTA 3LQXA 2PXBA 3PE5A 4EKGA 4JQDA 2H8RA 1WH6A 2PXPA 2L8NA 3ZHIA 4I6RA 3GUUA 2PUCA 4YG1A 2XXPA 1RPEL 4Y42A 5A7LA 2MXDA 2PIJA 5K98B 2PXDA 3ZKCA 2XXAA 4DE9A 4J1XA 2PPXA 2PXTA 1OCTC 3KL4A 3F52A 3DM5A 3SCFA 2AWIA 2LYSA 3MLFA 4IA8A 4ER0A 4EQZA 3UFDA 1R63A 5DTMA 1LQCA 2MQKA 4OB4A 1LCCA 4EKIA 4IWRA 3OQMA 4X4EA 2L49A 3CLCA 3DNVB 2KPJA 4PU3C 1WETA 5GAHi 2WUSR 2YBDA 1AU7A 2R1JL 1ZZCA 2EWTA 2BJCA 1B0NA 2LLWA 3JXDL 3IVPA 4X4DA 4Z5HA 3VWSA 1UXCA 1ZZ6A 3UWPA 2WIUB 1U2ZA 1CJGA 1ZAYA 4FN3A 4EK9A 2AXZA 2EBYA 3FMYA 2JQEA 2HSGA 3F51A 3PXPA 3R1FA 2IUOA 3CECA 4YBAA 2XIUA 2LYRA 4O8BA 5GAGi 3O9XA 2HFZA 1QQAA 2PXUA 2CSFA 4X4GA 3HZIB 1QP4A 4MCTA 3GZDA 4Z58A 2J7WA 4EZIA 1Y7YA 2LYQA 4PU7A 3OWQA 2HCNA 3BD1A 2PUBA 1DWKA 4ER7A 2PXQA 2M4HA 2HCSA 2GRLA 3EUSA 2ICPA 4I6TA 2FFHA 3ZPXA 3SR4A 4X4CA 1QZXA 2PXLA 2PUEA 3TEPA 1NERA 2IV1A 4ER3A 1QB2A 3GN5B 3GZDC 3QYXA 2ICTA 2LYJA 4FBIA 3OQNA 3A9YA 2B5AA 4YG7B 3QQ6A 3FYMA 1VPWA 4X4FA 5DTQA 5DSXA 3JXCL 2PUAA 1QP0A 3GN5A 4PU4C 3G5GA 2PXEA 3BS3A 4PU8A 3VK0A 3NXHA 1EFAA 4I8TA 3TRBA 4X4IA 2O49A 3SCHA 1BDHA 1UXDA 4DE8A 3LFPA 2JCGA 2L1PA 2ODRD 4OBMA 2AXUA 2AW6A 1IC8A 1RIOA 1QPZA 3KZ3A 5DRTA 3NROA 4I6UA 4NDWA 2PE5A 2LYPA 4ER6A 1WH8A 2R63A 1X57A 2XXQA 2FJRA 3OP9A 1HF0A 2PUGA 5DRYA 4F8DA 2XI8A 2KEKA 1BDIA 5JUWA 2LCVA 2BNNA 1Y9QA 3F6WA 3B7HA 3BDNA 2GZUA 1LLIA 4GHJA 2VEOA 1R69A 3SX0A 1MFQC 2AXVA 3FYAA 2MEZA 1X2LA 1PNRA 5DTRA 3S8QA 3D1NI 1LCDA 1NEQA 4MCXA 3NDBB 1PRUA 3M9LA 1O4XA
chains in the Genus database with same CATH topology
4JCXA 2IVBA 1AU7A 2LYLA 3GN5B 2R1JL 3QYXA 1ZZCA 1ZUGA 2ICTA 2EWTA 2BJCA 2GRMA 2LYJA 4FBIA 2IVGA 3G7DA 1B0NA 4X4BA 4X4HA 3OQNA 1WIZA 3JXBC 4J1WA 3OQOA 2B5AA 3JXDL 2IU7A 2A6CA 4YG7B 3IVPA 3FYMA 3QQ6A 1VPWA 4X4DA 4X4FA 1JFSA 1JFTA 1JH9A 4YG4A 3JXCL 1POUA 4Z5HA 2PUAA 1QP0A 1ZZ9A 2AUWA 3GN5A 4PU4C 2XSDC 1UXCA 1ZZ6A 4YARA 2O4AA 1S7EA 1LMB3 1UTXA 1RZSA 2WIUB 1SQ8A 3SCGA 1GT0C 3G5GA 2KEIA 1CJGA 2PUDA 2O38A 1ZPQA 3BS3A 1RZRD 1ZAYA 3RZZA 1PERL 4FN3A 4PU8A 3VK0A 1EFAA 2AXZA 2EBYA 3TRBA 1RZRA 2PUFA 2OFYA 4X4IA 4I8TA 2O49A 2CROA 3FMYA 2JVLA 2HINA 2HSGA 3F51A 3PXPA 3SCHA 1BDHA 1UXDA 2BNOA 3KJXA 3LFPA 3L1PA 2JCGA 3R1FA 2D5VA 2AXUA 1CQTA 2AW6A 2IUOA 1IC8A 1ZZ8A 4JQDA 3CECA 4YBAA 2OR1L 1RIOA 1QPZA 4GQMA 3KZ3A 2XIUA 1XWRA 4I6UA 2LYRA 1WH6A 4NDWA 2PE5A 4O8BA 3O9XA 2H8RA 2LYPA 2IVQA 1ZVVA 1QQAA 2L8NA 1WH8A 2R63A 2CSFA 2XJ3A 4I6RA 3ZHIA 2PUCA 1X57A 4YG1A 2FJRA 3OP9A 4X4GA 1HF0A 3LISA 3HZIB 1QP4A 4MCTA 2BNMA 2PUGA 1RPEL 3OMTA 4Y42A 5A7LA 2PIJA 4F8DA 4Z58A 5K98B 2XI8A 3ZKCA 2KEKA 1Y7YA 2LYQA 4PU7A 4Z5DA 1E3OC 1PRAA 2KEJA 1ZS4A 1BDIA 1JWLA 2LCVA 4Z5CA 2BNNA 2PPXA 3BD1A 4J1XA 1OCTC 1Y9QA 3F6WA 3B7HA 3BDNA 1YSEA 3F52A 2GZUA 3CROL 3SCFA 1LLIA 2AWIA 2LYSA 3MLFA 4IA8A 1DWKA 4IVZA 1OSLA 2PUBA 4GHJA 1L1MA 3ZHMA 3UFDA 1R63A 3H5TA 1R69A 3QF3A 2GRLA 3EUSA 1QP7A 1LQCA 2ICPA 2MQKA 4OB4A 1LCCA 1ZZ7A 4I6TA 2AXVA 1ZZBA 4JCYA 2XCJA 1ADRA 3U3WA 4X4CA 3FYAA 4IWRA 2MEZA 1QQBA 2KZ8A 3OQMA 1X2LA 2L49A 2EF8A 2LYKA 4X4EA 1PNRA 3S8QA 3CLCA 1PRVA 3D1NI 3DNVB 4Z59A 2KPJA 4PU3C 1LCDA 1NEQA 1WETA 2PUEA 3QWGA 1DW9A 2WUSR 1NERA 2IV1A 4MCXA 1PRUA 3GBFA 3KXAA 1O4XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JCX A;  2IVB A;  1AU7 A;  2LYL A;  3GN5 B;  2R1J L;  3QYX A;  1ZZC A;  1ZUG A;  2ICT A;  2EWT A;  2BJC A;  2GRM A;  2LYJ A;  4FBI A;  2IVG A;  3G7D A;  1B0N A;  4X4B A;  4X4H A;  3OQN A;  1WIZ A;  3JXB C;  4J1W A;  3OQO A;  2B5A A;  3JXD L;  2IU7 A;  2A6C A;  4YG7 B;  3IVP A;  3FYM A;  3QQ6 A;  1VPW A;  4X4D A;  4X4F A;  1JFS A;  1JFT A;  1JH9 A;  4YG4 A;  3JXC L;  1POU A;  4Z5H A;  2PUA A;  1QP0 A;  1ZZ9 A;  2AUW A;  3GN5 A;  4PU4 C;  2XSD C;  1UXC A;  1ZZ6 A;  4YAR A;  2O4A A;  1S7E A;  1LMB 3;  1UTX A;  1RZS A;  2WIU B;  1SQ8 A;  3SCG A;  1GT0 C;  3G5G A;  2KEI A;  1CJG A;  2PUD A;  2O38 A;  1ZPQ A;  3BS3 A;  1RZR D;  1ZAY A;  3RZZ A;  1PER L;  4FN3 A;  4PU8 A;  3VK0 A;  1EFA A;  2AXZ A;  2EBY A;  3TRB A;  1RZR A;  2PUF A;  2OFY A;  4X4I A;  4I8T A;  2O49 A;  2CRO A;  3FMY A;  2JVL A;  2HIN A;  2HSG A;  3F51 A;  3PXP A;  3SCH A;  1BDH A;  1UXD A;  2BNO A;  3KJX A;  3LFP A;  3L1P A;  2JCG A;  3R1F A;  2D5V A;  2AXU A;  1CQT A;  2AW6 A;  2IUO A;  1IC8 A;  1ZZ8 A;  4JQD A;  3CEC A;  4YBA A;  2OR1 L;  1RIO A;  1QPZ A;  4GQM A;  3KZ3 A;  2XIU A;  1XWR A;  4I6U A;  2LYR A;  1WH6 A;  4NDW A;  2PE5 A;  4O8B A;  3O9X A;  2H8R A;  2LYP A;  2IVQ A;  1ZVV A;  1QQA A;  2L8N A;  1WH8 A;  2R63 A;  2CSF A;  2XJ3 A;  4I6R A;  3ZHI A;  2PUC A;  1X57 A;  4YG1 A;  2FJR A;  3OP9 A;  4X4G A;  1HF0 A;  3LIS A;  3HZI B;  1QP4 A;  4MCT A;  2BNM A;  2PUG A;  1RPE L;  3OMT A;  4Y42 A;  5A7L A;  2PIJ A;  4F8D A;  4Z58 A;  5K98 B;  2XI8 A;  3ZKC A;  2KEK A;  1Y7Y A;  2LYQ A;  4PU7 A;  4Z5D A;  1E3O C;  1PRA A;  2KEJ A;  1ZS4 A;  1BDI A;  1JWL A;  2LCV A;  4Z5C A;  2BNN A;  2PPX A;  3BD1 A;  4J1X A;  1OCT C;  1Y9Q A;  3F6W A;  3B7H A;  3BDN A;  1YSE A;  3F52 A;  2GZU A;  3CRO L;  3SCF A;  1LLI A;  2AWI A;  2LYS A;  3MLF A;  4IA8 A;  1DWK A;  4IVZ A;  1OSL A;  2PUB A;  4GHJ A;  1L1M A;  3ZHM A;  3UFD A;  1R63 A;  3H5T A;  1R69 A;  3QF3 A;  2GRL A;  3EUS A;  1QP7 A;  1LQC A;  2ICP A;  2MQK A;  4OB4 A;  1LCC A;  1ZZ7 A;  4I6T A;  2AXV A;  1ZZB A;  4JCY A;  2XCJ A;  1ADR A;  3U3W A;  4X4C A;  3FYA A;  4IWR A;  2MEZ A;  1QQB A;  2KZ8 A;  3OQM A;  1X2L A;  2L49 A;  2EF8 A;  2LYK A;  4X4E A;  1PNR A;  3S8Q A;  3CLC A;  1PRV A;  3D1N I;  3DNV B;  4Z59 A;  2KPJ A;  4PU3 C;  1LCD A;  1NEQ A;  1WET A;  2PUE A;  3QWG A;  1DW9 A;  2WUS R;  1NER A;  2IV1 A;  4MCX A;  1PRU A;  3GBF A;  3KXA A;  1O4X A; 
#chains in the Genus database with same CATH topology
 4JCX A;  1ZUG A;  2GRM A;  4ER5 A;  3G7D A;  4X4B A;  4X4H A;  1WIZ A;  3JXB C;  4J1W A;  3OQO A;  2A6C A;  1NW3 A;  1JFT A;  1POU A;  3G0T A;  2XSD C;  1S7E A;  1LMB 3;  2PXV A;  3SCG A;  1GT0 C;  2O38 A;  1ZPQ A;  1RZR D;  3RZZ A;  1PER L;  2OFY A;  3QOX A;  2JVL A;  2HIN A;  2LNM A;  3NZL A;  3KJX A;  3L1P A;  5DT2 A;  1ZZ8 A;  1HQ1 A;  2OR1 L;  4GQM A;  2PXF A;  1XWR A;  2IVQ A;  4WVL A;  1ZVV A;  2XJ3 A;  4HRA A;  3LIS A;  2BNM A;  3OMT A;  1E3O C;  4Z5D A;  1PRA A;  3QFI A;  2KEJ A;  1ZS4 A;  1JWL A;  3R09 A;  2LLV A;  4Z5C A;  1YSE A;  3CRO L;  2V3C C;  4IVZ A;  1OSL A;  1L1M A;  3ZHM A;  3OKZ A;  3H5T A;  3QF3 A;  1QP7 A;  1ZZ7 A;  1ZZB A;  4JCY A;  2XCJ A;  1ADR A;  3U3W A;  1QQB A;  2KZ8 A;  3GZC A;  2EF8 A;  2LYK A;  1PRV A;  4Z59 A;  3QWG A;  1DW9 A;  3MEJ A;  3GBF A;  3KXA A;  2IVB A;  3A9Z A;  2LYL A;  2PXK A;  1DUL A;  2IVG A;  2IU7 A;  3A9X A;  1JFS A;  1JH9 A;  3ME5 A;  4YG4 A;  1ZZ9 A;  2AUW A;  2J7U A;  4YAR A;  2O4A A;  1UTX A;  1RZS A;  1SQ8 A;  3TEL A;  4Q2J A;  2KEI A;  2PUD A;  1RZR A;  2PUF A;  2CRO A;  3TFL A;  3QOW A;  2BNO A;  2D5V A;  1CQT A;  3LQX A;  2PXB A;  3PE5 A;  4EKG A;  4JQD A;  2H8R A;  1WH6 A;  2PXP A;  2L8N A;  3ZHI A;  4I6R A;  3GUU A;  2PUC A;  4YG1 A;  2XXP A;  1RPE L;  4Y42 A;  5A7L A;  2MXD A;  2PIJ A;  5K98 B;  2PXD A;  3ZKC A;  2XXA A;  4DE9 A;  4J1X A;  2PPX A;  2PXT A;  1OCT C;  3KL4 A;  3F52 A;  3DM5 A;  3SCF A;  2AWI A;  2LYS A;  3MLF A;  4IA8 A;  4ER0 A;  4EQZ A;  3UFD A;  1R63 A;  5DTM A;  1LQC A;  2MQK A;  4OB4 A;  1LCC A;  4EKI A;  4IWR A;  3OQM A;  4X4E A;  2L49 A;  3CLC A;  3DNV B;  2KPJ A;  4PU3 C;  1WET A;  5GAH i;  2WUS R;  2YBD A;  1AU7 A;  2R1J L;  1ZZC A;  2EWT A;  2BJC A;  1B0N A;  2LLW A;  3JXD L;  3IVP A;  4X4D A;  4Z5H A;  3VWS A;  1UXC A;  1ZZ6 A;  3UWP A;  2WIU B;  1U2Z A;  1CJG A;  1ZAY A;  4FN3 A;  4EK9 A;  2AXZ A;  2EBY A;  3FMY A;  2JQE A;  2HSG A;  3F51 A;  3PXP A;  3R1F A;  2IUO A;  3CEC A;  4YBA A;  2XIU A;  2LYR A;  4O8B A;  5GAG i;  3O9X A;  2HFZ A;  1QQA A;  2PXU A;  2CSF A;  4X4G A;  3HZI B;  1QP4 A;  4MCT A;  3GZD A;  4Z58 A;  2J7W A;  4EZI A;  1Y7Y A;  2LYQ A;  4PU7 A;  3OWQ A;  2HCN A;  3BD1 A;  2PUB A;  1DWK A;  4ER7 A;  2PXQ A;  2M4H A;  2HCS A;  2GRL A;  3EUS A;  2ICP A;  4I6T A;  2FFH A;  3ZPX A;  3SR4 A;  4X4C A;  1QZX A;  2PXL A;  2PUE A;  3TEP A;  1NER A;  2IV1 A;  4ER3 A;  1QB2 A;  3GN5 B;  3GZD C;  3QYX A;  2ICT A;  2LYJ A;  4FBI A;  3OQN A;  3A9Y A;  2B5A A;  4YG7 B;  3QQ6 A;  3FYM A;  1VPW A;  4X4F A;  5DTQ A;  5DSX A;  3JXC L;  2PUA A;  1QP0 A;  3GN5 A;  4PU4 C;  3G5G A;  2PXE A;  3BS3 A;  4PU8 A;  3VK0 A;  3NXH A;  1EFA A;  4I8T A;  3TRB A;  4X4I A;  2O49 A;  3SCH A;  1BDH A;  1UXD A;  4DE8 A;  3LFP A;  2JCG A;  2L1P A;  2ODR D;  4OBM A;  2AXU A;  2AW6 A;  1IC8 A;  1RIO A;  1QPZ A;  3KZ3 A;  5DRT A;  3NRO A;  4I6U A;  4NDW A;  2PE5 A;  2LYP A;  4ER6 A;  1WH8 A;  2R63 A;  1X57 A;  2XXQ A;  2FJR A;  3OP9 A;  1HF0 A;  2PUG A;  5DRY A;  4F8D A;  2XI8 A;  2KEK A;  1BDI A;  5JUW A;  2LCV A;  2BNN A;  1Y9Q A;  3F6W A;  3B7H A;  3BDN A;  2GZU A;  1LLI A;  4GHJ A;  2VEO A;  1R69 A;  3SX0 A;  1MFQ C;  2AXV A;  3FYA A;  2MEZ A;  1X2L A;  1PNR A;  5DTR A;  3S8Q A;  3D1N I;  1LCD A;  1NEQ A;  4MCX A;  3NDB B;  1PRU A;  3M9L A;  1O4X A; 
#chains in the Genus database with same CATH homology
 4JCX A;  2IVB A;  1AU7 A;  2LYL A;  3GN5 B;  2R1J L;  3QYX A;  1ZZC A;  1ZUG A;  2ICT A;  2EWT A;  2BJC A;  2GRM A;  2LYJ A;  4FBI A;  2IVG A;  3G7D A;  1B0N A;  4X4B A;  4X4H A;  3OQN A;  1WIZ A;  3JXB C;  4J1W A;  3OQO A;  2B5A A;  3JXD L;  2IU7 A;  2A6C A;  4YG7 B;  3IVP A;  3FYM A;  3QQ6 A;  1VPW A;  4X4D A;  4X4F A;  1JFS A;  1JFT A;  1JH9 A;  4YG4 A;  3JXC L;  1POU A;  4Z5H A;  2PUA A;  1QP0 A;  1ZZ9 A;  2AUW A;  3GN5 A;  4PU4 C;  2XSD C;  1UXC A;  1ZZ6 A;  4YAR A;  2O4A A;  1S7E A;  1LMB 3;  1UTX A;  1RZS A;  2WIU B;  1SQ8 A;  3SCG A;  1GT0 C;  3G5G A;  2KEI A;  1CJG A;  2PUD A;  2O38 A;  1ZPQ A;  3BS3 A;  1RZR D;  1ZAY A;  3RZZ A;  1PER L;  4FN3 A;  4PU8 A;  3VK0 A;  1EFA A;  2AXZ A;  2EBY A;  3TRB A;  1RZR A;  2PUF A;  2OFY A;  4X4I A;  4I8T A;  2O49 A;  2CRO A;  3FMY A;  2JVL A;  2HIN A;  2HSG A;  3F51 A;  3PXP A;  3SCH A;  1BDH A;  1UXD A;  2BNO A;  3KJX A;  3LFP A;  3L1P A;  2JCG A;  3R1F A;  2D5V A;  2AXU A;  1CQT A;  2AW6 A;  2IUO A;  1IC8 A;  1ZZ8 A;  4JQD A;  3CEC A;  4YBA A;  2OR1 L;  1RIO A;  1QPZ A;  4GQM A;  3KZ3 A;  2XIU A;  1XWR A;  4I6U A;  2LYR A;  1WH6 A;  4NDW A;  2PE5 A;  4O8B A;  3O9X A;  2H8R A;  2LYP A;  2IVQ A;  1ZVV A;  1QQA A;  2L8N A;  1WH8 A;  2R63 A;  2CSF A;  2XJ3 A;  4I6R A;  3ZHI A;  2PUC A;  1X57 A;  4YG1 A;  2FJR A;  3OP9 A;  4X4G A;  1HF0 A;  3LIS A;  3HZI B;  1QP4 A;  4MCT A;  2BNM A;  2PUG A;  1RPE L;  3OMT A;  4Y42 A;  5A7L A;  2PIJ A;  4F8D A;  4Z58 A;  5K98 B;  2XI8 A;  3ZKC A;  2KEK A;  1Y7Y A;  2LYQ A;  4PU7 A;  4Z5D A;  1E3O C;  1PRA A;  2KEJ A;  1ZS4 A;  1BDI A;  1JWL A;  2LCV A;  4Z5C A;  2BNN A;  2PPX A;  3BD1 A;  4J1X A;  1OCT C;  1Y9Q A;  3F6W A;  3B7H A;  3BDN A;  1YSE A;  3F52 A;  2GZU A;  3CRO L;  3SCF A;  1LLI A;  2AWI A;  2LYS A;  3MLF A;  4IA8 A;  1DWK A;  4IVZ A;  1OSL A;  2PUB A;  4GHJ A;  1L1M A;  3ZHM A;  3UFD A;  1R63 A;  3H5T A;  1R69 A;  3QF3 A;  2GRL A;  3EUS A;  1QP7 A;  1LQC A;  2ICP A;  2MQK A;  4OB4 A;  1LCC A;  1ZZ7 A;  4I6T A;  2AXV A;  1ZZB A;  4JCY A;  2XCJ A;  1ADR A;  3U3W A;  4X4C A;  3FYA A;  4IWR A;  2MEZ A;  1QQB A;  2KZ8 A;  3OQM A;  1X2L A;  2L49 A;  2EF8 A;  2LYK A;  4X4E A;  1PNR A;  3S8Q A;  3CLC A;  1PRV A;  3D1N I;  3DNV B;  4Z59 A;  2KPJ A;  4PU3 C;  1LCD A;  1NEQ A;  1WET A;  2PUE A;  3QWG A;  1DW9 A;  2WUS R;  1NER A;  2IV1 A;  4MCX A;  1PRU A;  3GBF A;  3KXA A;  1O4X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...