2PUGA

Crystal structure of the laci family member, purr, bound to dna: minor groove binding by alpha helices
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
338
structure length
338
Chain Sequence
TIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAAYFAEIIEAVEKNCFQKGYTLILGNAWNNLEKQRAYLSMMAQKRVDGLLVMCSEYPEPLLAMLEEYRHIPMVVMDWGEAKADFTDAVIDNAFEGGYMAGRYLIERGHREIGVIPGPLEQNTGAGRLAGFMKAMEEAMIKVPESWIVQGDFEPESGYRAMQQILSQPHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEVHPRLIERRSVADGPFRDYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-based redesign of corepressor specificity of the Escherichia coli purine repressor by substitution of residue 190.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription/dna
molecule keywords DNA (5'-D(*TP*AP*CP*GP*CP*AP*AP*AP*CP*GP*TP*TP*TP*GP*CP*GP*T
total genus 119
structure length 338
sequence length 338
ec nomenclature
pdb deposition date 1997-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00356 LacI Bacterial regulatory proteins, lacI family
A PF13377 Peripla_BP_3 Periplasmic binding protein-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2pugA01
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2pugA03
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2pugA02
2RGYA 1PNRA 4P1ZA 2CWDA 3LUAA 3UKJA 3OLYA 2OR1L 2FQYA 1ZPQA 2GRMA 3EDCA 4KREA 3QLUA 3T6KA 3KZ3A 1QKKA 2HJ9A 3HCWA 3HM9A 1AB6A 4XXHA 2XJ3A 1LK0A 2BNMA 1Z25A 2H3HA 1QP4A 2WJWA 3MF4A 1ZZBA 3OM0A 4JASB 4UHKA 1CEYA 2P4UA 4RK7A 3H5OA 3KG2A 1JFVA 1GCGA 2FKAA 3M9XA 5C5CA 5IUNC 1BVHA 5JNWA 3SY8A 2FN8A 4MCTA 2X7XA 3SQNA 1ZVVA 1ABEA 5KQMA 3JXBC 1EWTA 1URPA 3CKMA 2F8SA 3KHTA 5HM6A 4W5QA 4NQRA 3IP5A 5FWYA 3EULA 5DLEA 2QZJA 4RY0A 1RNLA 4YP9A 5B3JA 3EUSA 1FFSA 4N47A 3KLNA 3TMYA 5KQLA 3E3MA 4KVFA 2A9QA 1U2PA 2AUWA 1NXWA 4KPYA 4OLBA 4YG1A 3IPAA 1WETA 3I42A 1FSPA 2HPHA 4MYRA 2NZVG 3O1JC 4RK5A 4JB2A 3OLWA 2WY2D 3T8YA 4MGEA 1NXOA 4O1HA 3LTEA 4YGXB 4D6XA 3KS9A 1ISSA 3M6MD 4B09A 3I45A 3MM4A 3LUKA 4P98A 3TB6A 4YCSA 1TM2A 1DCKA 2FSPA 3HVRA 3Q15C 4WUTA 5IUJC 3CS3A 1JL3A 4RK6A 2R47A 3OQNA 2OENG 1CJGA 4IF4A 4ETNA 3F51A 2HQOA 2LCVA 1YK0A 3ILHA 3EGCA 3QLVA 4MR7A 2XIUA 3CG4A 5E3JA 2IV1A 4YG4A 2HQBA 3OMTA 5EWJA 1ZS4A 3F6WA 4D74A 1XHEA 4LDZA 4NICA 3FYAA 2XI8A 1USKA 4N76A 3RVMA 2L49A 2GKGA 4L85A 1VLZA 4MS4B 5DKFA 5HSGA 5JNTA 1DJMA 2RJOA 4MPTA 1ZITA 2FQWA 9ABPA 4KNYA 1DBWA 1M5UA 3W9SA 1OXBB 4WZZA 2KZ8A 1PRUA 2LYQA 3T95A 4ZMSA 1Z15A 3MMNA 5HKOA 2IUOA 2PUEA 1A04A 5TPWA 1F51E 3B7HA 4X4IA 2J48A 5CHYA 3RVQA 1A0OA 1JYEA 1QNLA 1DC8A 2PUGA 1D2AA 2LYJA 4JCXA 2JVLA 2PAFA 1PEAA 3H5VA 1JDPA 2ID9A 3RVSA 4W5OA 3QYXA 5PNTA 2IDMA 3ZKCA 1NY5A 4PU4C 1KMIY 4NCAA 3M9WA 2R4QA 1QP0A 3D8UA 3DLBA 2GBPA 4EYKA 3A0UA 1RZRD 3OM1A 4MRMB 4JAVC 3FMYA 1QMPA 1LBHA 3O75A 4RV5A 1ZZ9A 3GRCA 3S99A 4Z4HA 4S05A 2O4AA 4N0QA 1UXCA 3QLUC 4RDCA 4RK4A 4RXUA 4W5RA 7ABPA 5ABPA 3BD1A 2WIUB 1Z26A 1DC7A 4Z5DA 2FTKE 4MAAA 4WXEA 1BDHA 4LE2A 3QQ6A 3QWGA 4F8JA 1E6MA 2E4UA 3GWGA 4PICA 3DNVB 3C3WA 3F7NA 2D5VA 3ILYA 1ZZ6A 3O74A 2B5AA 1P6UA 3LOPA 2LP4Y 3Q7TA 3SM9A 1E3OC 3BBLA 4S04A 2IPAB 2GI4A 1YSEA 3CLKA 3LFPA 4EGSA 2BNNA 3QX9A 2IVQA 1LBIA 1Z2EA 3HV2A 3MQ4A 4KV7A 2JVJA 2IYNA 3CNBA 3IP7A 1U8TA 5FWXA 3GBVA 3U3WA 3IDOA 3FGZA 1QPZA 3H75A 2HINA 4I6UA 4RS3A 3MYYA 3FFWA 1ZGGA 2MYPA 2KEKA 4OG2A 1DWKA 3FYMA 3F73A 5TE9A 2QSJA 1ZHHA 2FXIA 3O21A 4HNQA 1RIOA 3UUGA 4MS1A 1DCMA 2L2QA 4GHJA 3JS5A 4Y42A 2FEWB 3LUCA 4H60A 3CLCA 4QPJC 4EYGA 3HJFA 2BNOA 3F52A 4PU8A 2KEIA 4JCYA 3E61A 5GOTA 4EYQA 4IMIB 1MB3A 3H5LA 2JBAA 4G86A 4RU1A 1XHFA 4MS4A 3PXPA 4IA8A 2GWRA 1Y9QA 4Q6WA 3SNKA 5EWMA 4IRXA 3HUUA 1JFSA 4EYOA 2XCJA 5IEJA 1NEQA 2KEJA 3QF3A 3NNSA 2CHEA 2IPNA 2IPMA 3MIZA 4W5NA 1R69A 2L18A 3H6GA 4WXMA 3RVOA 2XDYA 3NBMA 3G1WA 5BQ3A 1M5TA 1YMUA 1CQTA 1UXDA 3CECA 1K68A 2EWTA 2VYCA 2PPXA 4RZSA 1OXKB 4OTZA 3A10A 1RZRA 4QYWA 4EY3A 3GL9A 1K66A 2E4ZA 1RPEL 4MS3A 3KYJB 1VRVA 1LCDA 4G97A 3QEMB 3H1FA 3EJWA 4G0XA 4PU7A 4Z59A 3DGFC 4JP1A 3FDFA 1S8NA 4ZJPA 4FE7A 4X4GA 1HF0A 3GT7A 4KRFA 3VNBA 1LLIA 1QO0A 3L1PA 4E7PA 2FLWA 4FB4A 1USIA 1ZGZA 4Z9AA 3GBFA 1SD5A 1DP4A 1WH6A 1EHCA 2ZWMA 4YS6A 1YS7A 2E4WA 2AXUA 4Z58A 3RVNA 4HNRA 2F8TA 2A9PA 3K4HA 4DADA 3Q7SA 1UTXA 2WB4A 2W42A 1Z18A 2GRLA 2IOYA 3C97A 3GBPA 5BRAA 3QELB 2OQRA 1L1MA 1JBEA 4LE0A 2MSLA 2AWIA 2O20A 4I8TA 3DZDA 4LRQA 2NT3A 3FMVA 3GYBA 5TQJA 3CU5A 2JVIA 1WIZA 1MVOA 2PLNA 4ZYLA 5IULC 2GZUA 2M98A 1CYEA 4J1XA 2IU7A 3I5AA 5IC5A 3NNNA 1EAYA 1FFWA 3EQ2A 5EWJB 3R1FA 1JH9A 3BREA 4MQEB 5CNKA 1IC8A 1VPWA 1E6KA 1F4VA 1JLKA 5FBHA 4IVZA 4Z5HA 3CG0A 4O1IA 1BDIA 1ZAYA 4Y9TA 3LUGA 5CNMA 3LUFA 4G0YA 5D2CA 3RVJA 3HS3A 4EVRA 1TMYA 4KK4A 4XAQA 2MYTA 3KLOA 4RK0A 2B1JA 3NHMA 1Z16A 1E6LA 3BS3A 1R8JA 5TQ2A 2PMCA 4TLLB 1DG9A 1LJLA 3LKBA 5TQ0A 3TX6A 2N9UA 2JB9A 3OLVA 5IX8A 5EWLB 2KYRA 3HO1A 1PERL 1ABFA 3RVKA 2R63A 1KGSA 1P2FA 1M2EA 4I6TA 2R1JL 2JVKA 4KQ9A 4LDAA 4JA2A 2QU7A 8ABPA 1MB0A 4PE5B 3QLTA 4Z4GA 2OFYA 4CBVA 4MQFB 1SQ8A 5JNSA 1DZ3A 4H3KB 4MCXA 3H5IA 1YVUA 3O1IC 3LUJA 4QYMA 3ZHIA 2H8RA 2EF8A 4DQDA 2QR3A 3VNAA 4YG7B 1Z12A 1Z17A 4TLMB 3OMXA 4RKRA 3HZIB 2HSGA 2PKXA 4YLEA 4OB4A 5TQ0B 2YHBA 5KQGA 3CTPA 1OCTC 3QEKA 4XFKA 1SXGA 5DCLA 2FMFA 3KTOA 3KXAA 2MSWA 3N6VA 4Z5CA 2VK2A 4DN6A 2EBYA 3CROL 3N8IA 2LIVA 1JX6A 3RVPA 2CD7A 5BRJA 1APBA 4O5AA 4EVQA 2WUSR 1ZUGA 1USGA 2TMYA 1C4WA 3HUTA 2AYXA 4X4HA 2M1ZA 3NHZA 2FMIA 4WT7A 5KI6A 5JS1A 3F6CA 1ZDMA 3O2QB 3D1NI 1D1PA 2JRLA 3OMWA 3QEMA 4MS1B 3CHYA 1WH8A 4RWEA 3T38A 5A7LA 1QQAA 1ISRA 4RY8A 2AXVA 2QXYA 3ZHMA 1ZH2A 2R48A 4MR9A 1NTRA 4MR7B 1ZZ7A 4F8DA 4JB0A 2WJAA 5FBKA 1NATA 1EWKA 5TPZD 2HQRA 5FWXB 1JHZA 1LMB3 3LUHA 5TPZA 1O4XA 3P9YA 2MEZA 1PRVA 3DLHA 2WRZA 2BGGA 5JS2A 1LQCA 3N0RA 4FN3A 1NXSA 3QELA 3JXCL 3IPCA 3EQZA 1QO0D 1VKRA 3CZCA 4KQCA 5EWMB 3RH0A 4Z4CA 4G0ZA 2I6FA 3N75A 5T3YA 1X2LA 2MSKA 3BRSA 4EVSA 1DBQA 1POUA 2PUAA 3TO5A 3O9XA 4YR7A 4Q6BA 2JCGA 4QICA 1D4ZA 1PNTA 3SCGA 3H1GA 5CNJA 5TPWB 1RZSA 1JDNA 4XASA 4I6RA 4G0QA 2ICPA 4Q7EA 4Z4FA 1IIBA 2PUCA 3H6HA 4MLDA 1LCCA 2V0NA 1Z13A 2E4YA 1SXHA 4KFCA 1JFTA 1GCAA 3LUDA 4D6YA 2A9RA 2P9HA 3OQMA 3KKEA 5C5EA 4ZPJA 1LJUA 2FJRA 1A2OA 1D5WA 4FE4A 3JPYA 4N0PA 5CNIA 5ED4A 3JVDA 4MRMA 2NZUG 4YARA 5EWLA 4F11A 4X4EA 1SXIA 1YIOA 3MA0A 3HK2A 5B3JC 2FVYA 2L19A 2LBPA 3HSYA 3CFYA 5HQJA 4EUKA 2LYPA 2ICTA 1C0EA 2O38A 1DBPA 1RXEA 2AXZA 3GN5B 4RK1A 4IMJB 4LE1A 4M88A 1KRXA 3GN5A 3LKVA 1X57A 3D02A 2XSDC 1YS6A 2AYZA 3C6QA 1ZZ8A 4F3TA 2PUBA 3Q7RA 4W5TA 1GUDA 1RPJA 3JPWA 5IEBA 4RY9A 2O49A 3JTEA 2PE5A 2FMHA 1EFAA 1L5ZA 4YWHA 1J56A 2VUIB 1RXIA 2LUOA 3G85A 1TJYA 4MQEA 6CHYA 1Y7YA 5KC9A 4UHJA 1DRJA 1U2QA 1MIHA 1Z2DA 2LYLA 5GQSA 3MLFA 1NXTA 3I09A 4Z99A 1W25A 1BAPA 3SAJA 3KCNA 4Z9BA 4J1WA 4YO7A 2CSFA 3VK0A 1QQBA 1FQWA 3F6PA 2YHAA 1PUXA 2A9OA 4PU3C 3OQOA 1ZH4A 2B4AA 2FEKA 3HZHA 4YRZA 1E2BA 5IBQA 3N0XA 3LISA 1P6QA 2IVBA 1PEYA 1T34A 4ZMRA 4N03A 2QV0A 3DBIA 3HDGA 4H3HB 4L4UA 4TMYA 1DW9A 3JVIA 3SG0A 3SCFA 4G0PA 2PJUA 4NCBA 5IUKC 4F06A 1BA2A 3LFTA 3ROFA 4OBBA 1M2FA 2E4XA 1NERA 2AW6A 4IILA 5DTEA 2MQKA 2JBAB 3OP9A 4MR8B 2FQXA 1P8AA 4Z4EA 4IGAA 4MR8A 4YBAA 3QX8A 5FWYB 6ABPA 3B2NA 3BILA 3R0JA 1U04A 3DGEC 5T7BA 3G5GA 2LYSA 4O8BA 1NXXA 2FN9A 3OO1A 4WWHA 3S8QA 4TN5A 4ETIA 4NV3A 4ETMA 5BR1A 4Z4IA 1KRWA 1Y1LA 5F64A 2VUHB 1FFGA 3A3KA 1ZESA 1BDJA 2CHFA 4RXTA 3CZ5A 4XLTA 3OLXA 3JY6A 3G7DA 2ZAYA 4HYEA 1HEYA 2PL1A 4RXMA 2IPLA 3L49A 1GT0C 1B0NA 3URMA 2R25B 1JYFA 1YK1A 3O2JA 1ZZCA 1JWLA 3O2SB 4PEVA 5JNUA 4NDWA 4XARA 1TVMA 1EWVA 4G0MA 5JNVA 3RQIA 2E4VA 3BRQA 2FLKA 3GV0A 2IVGA 1AU7A 1CHNA 3QK7A 4PYRA 5DGCA 4GPAA 3A0RB 3IP9A 4LX8A 1PHRA 2PL9A 1B00A 2FW0A 2L8NA 1OSLA 2BJCA 1GUBA 4JQDA 3QLVC 3IP6A 3Q9SA 1XWRA 4LZLA 3BDNA 3UK0A 2PUDA 4MLCA 2MYUA 4MS3B 3CRNA 1W9HA 2Q5CA 3KJXA 2JK1A 1DRKA 1JF8A 1I3CA 3H1EA 3N53A 2RJNA 1YMVA 2PUFA 4GNRA 1ADRA 3C3KA 2NT4A 4HNSA 2QVCA 3EODA 3JXDL 5KQPA 3O1HB 3TRBA 1SRRA 3KSMA 4X4CA 4MR9B 3ROTA 2NUBA 3TD9A 4F12A 4YV7A 4X4BA 4KMRA 5KC8A 1H9CA 1ZY2A 2RDMA 4PZ0A 3H5WA 3Q41A 3H5TA 4RKQA 2CROA 1UDRA 2PIJA 3NNDA 4G0OA 3C3MA 3UFDA 3OLZA 1YTUA 2LPMA 2FMKA 1QP7A 5JNRA 1L5YA 2DRIA 2L17A 1AB5A 1DCFA 2QVGA 3L6UA 5K98B 4FBIA 3N0WA 4E7OA 3FFXA 4RSMA 3SCHA 3RVRA 1XWWA 5TQ2B 2LYRA 4KK3A 1D1QA 4IWRA 3LMKA 1NXPA 5KWSA 2A6CA 3HXMA 1MAVA 1NXVA 3KYIB 3HEBA 5I4CA 1TLFA 3RZZA 1ZN2A 4X4DA 3RVLA 3IVPA 1GLGA 1S7EA 2KPJA 4ML3A 4N41A 3EAFA 4MQFA 2GX6A 3OO0A 2IKSA 3GA5A 3K9CA 2QW1A 2WMYA 1U0SY 2LYKA 2FEPA 2H0AA 2MYNA 3HDVA 2WWVD 4X4FA 1R63A 2ID7A 4KZKA 4OLAA 4Z0NA 1PRAA 3FFTA 4JOQA 4GQMA 4OATA
chains in the Genus database with same CATH superfamily
1ECGA 2XWSA 5C35A 5CUQA 5KQRA 1J6UA 2FEXA 3UKJA 5JU6A 2HA2A 1B6TA 3P2KA 3F5MA 2QP3A 4N5MA 1UBMS 2CT8A 1OFUX 4QO8A 4HWPA 4YLYA 5I7EA 2X0DA 2C7RA 1J7KA 2DU8A 2CEAA 4LYEA 1XBTA 4AMYA 5CDHA 2CLIB 1SHJA 3OLQA 2FW7A 1Z7BA 3WGJA 1FEZA 4EMBA 3R3YA 5EKXA 5EQDA 1ZNZA 2LD4A 3R4VA 1TUBA 3TZ6A 3UICA 2AGVA 2PZBA 4MUYA 1ODCA 1JHXA 1I13A 1Z4LA 1B73A 3LI2A 4K6HA 5DIZA 2GCEA 1W36C 1O6ZA 1F17A 4MO9A 4EQ6A 5BNIA 5JECA 3RQSA 4YP9A 5ALYA 1PEKE 3NALA 1LSJA 2FE4A 1AD2A 2ZIEA 4X24A 2IYXA 4AL4A 2PX8A 4RC9A 1VSTA 2AUWA 3T3HA 5IYZA 4WN9B 1WETA 2KB0A 1E77A 3AUSA 3QVGB 2W8BA 1A5AB 3NB0A 2JFZA 3PBKA 4FBGA 4K28A 1LQUA 3MVEA 4X71A 3LCVB 1FU7A 3KZNA 1A7AA 4KAJA 3U7IA 3D8RA 3VBEA 5FBRB 1YE5A 5G1PA 4Q16A 3R40A 3OQNA 3IIIA 1KMHA 4WRRA 4R8SA 4PHGA 3AI2A 3BHMA 4MYCA 1RLJA 1GTMA 1ZIXA 3IKJA 4X7MA 4L95C 3I92A 2XMPA 3VUFA 1P4SA 1GO2A 1T9AA 3AETB 3L79A 4PCLA 1JJIA 1CJKC 4GR4A 1XHEA 1ZD4A 2H4YA 4L5IA 3OKFA 2XI8A 3B9PA 3O8OA 5A0FA 3ICEA 1EK5A 4C4ZA 2CFRA 5CXQA 1ZXBA 3NI2A 3L8DA 1VLZA 2OCDA 3I6IA 5DKFA 2FUKA 3ZJ5A 2CN1A 1YJXA 2H2GA 1UL1X 5KYYA 1N3IA 3E22A 1AMUA 4QM7A 3T95A 3A1CA 1JQ5A 4POOA 4UUMA 1R9JA 5DVZA 1O5TA 2J4CA 3AEKB 3BTSA 3SFZA 5HQ3A 1JZSA 5JDIA 1RC8A 1G55A 2JJ8A 2WR8A 4G9EA 4DA0A 1YXMA 3Q8WA 3WB9A 1YJ5A 2E1PA 1FNDA 3GN2A 3HDYA 5CTAA 3JALA 1WE2A 4WLFA 1HQDA 3K09C 3U3OA 4OJTA 1VMEA 2BDEA 4TKVA 4H1WA 3MS2A 4DA4A 4GVXA 1PFUA 3M9WA 2Q0XA 1VE9A 4IMRA 1U3DA 3L04A 2CCKA 2C9DA 2VJPA 5DNAA 4B3HA 4OB6A 1BC5A 2B8TA 2R85A 4MCHA 2XQFA 4BATA 3WMWA 4ZVPA 4RV5A 1GL3A 1VI6A 1Q5PA 2OCPA 3OTOB 4PAOA 2X9QA 1QOPB 2YWBA 3QLUC 1MH1A 4RK4A 3SZUA 5CDTA 1EQAA 1D6MA 2FETA 4PYQA 1DC7A 2RI1A 3RRBA 1GRNA 5LXTB 4CT5A 1VYTA 2ZBEA 1KI7A 4KYUA 2OFXA 2WLSA 2Y1CA 3B7PA 3C3WA 2YFYA 1P7YA 2H29A 1Z7EA 3F7NA 3GWGA 3ILYA 1YNSA 5AUNB 2J7WA 1P4HA 1YBMA 1G9TA 1CR6A 3H17A 3PC7A 4F3CA 1CJSA 4CF6A 1XD8A 5F9HA 2VTKA 3DAFA 4MDHA 4P7FA 3TW6A 5GWXA 2IVQA 4IHAA 3QTBA 1G8PA 2CVPA 3L0BA 3H1PA 2AR0A 3D4LA 5CJJA 4OJYA 2DB3A 3GBVA 3R7WB 1FNMA 4JOCA 3EIWA 4Q4AB 6ADHA 1YD7A 2F3SA 3BD7A 3MYYA 4HDNB 5AVQA 3EX7C 4MQLA 3F73A 3WRXA 2I6GA 4LF6B 2RARA 5I9BA 4AY3A 3O21A 4XEHA 1SCBA 5L4SA 4Z2YA 1M1XB 5DHUA 1RXWA 4GHJA 1DWOA 3A6HA 1P0QA 2GB4A 2AN5A 5HZGA 4NMWA 2C29D 4FFLA 2FF5A 4YRJA 2PR7A 3E61A 2ASVA 3I4FA 2YNMD 3LVBA 3TCNA 3H8JA 4NBLA 4YXWD 4LYAA 2VCEA 3Q2OA 4M0CA 1SIWA 4CE6A 3ZVNA 4UVEA 4HMOA 4P54A 5FPQA 2ALJA 4RVUA 3AVXA 3JYPA 4LRYA 2WD8A 5JJKA 4FS3A 1PJ3A 4Y1EA 3AV0B 4I5EA 4GOND 2XDWA 4UTOA 2V4MA 4NU0A 3V8PA 4X60A 4C4TA 1HT1E 3O3OB 4CDRA 5JBIA 4PVCA 2W2TA 5AXDA 4BQIA 1OXVA 3H6GA 3GHHA 2XI4A 4FFVA 2NAPA 2XDYA 1Y3BE 3BHNA 4CCYA 3KTDA 4WCFC 4CMEA 1P2DA 4LC0A 1ISFA 1ULSA 1YRYE 2VJMA 3EG5A 3KZVA 3E70C 4IJKA 5I7HA 1T5OA 3P2JA 4QYWA 1DT5A 3CH5A 2FP4A 3L4KA 3RUAA 4ZO4A 3L4JA 1RPEL 4KDCA 4LKOA 3VSBA 1N2CE 2RAPA 3IQZA 1S8NA 3TCXB 3DBLB 4L07A 1T6XA 3VNQA 1WLSA 1NJ2A 5GV7A 2Z6VA 4KQHA 4G3XA 3DSRA 3AIMA 2BFBB 3ZIAD 3DVRX 3ID6C 2ZWMA 4YS6A 3DKPA 1JLMA 3U49A 1XDSA 2A9PA 3FVQA 5H3LA 2CGEA 4DRYA 5I8ZA 2OCLA 3VH3A 3SS9X 1RWXA 1RXCA 4WNIA 1XEFA 1KPHA 3GBPA 1W4CA 3P8ZA 5EIOA 3G59A 3V00A 4JEUA 3WA6A 3ICWA 4AKGA 2EKBA 2Q7XA 4JN6B 1NHWA 3CX3A 3EPPA 5KJCA 3VPXA 3GRUA 2PLNA 2NVBA 2W0SA 2J31A 3I23A 3SJAA 4DDTA 4CM4A 1P73A 2LTAA 5D3MA 5EKSA 4C06A 1PK9A 1WDLA 3L77A 3PGKA 3WE7A 3JX9A 2F43A 1KO5A 3EQ2A 2IYVA 2NQTA 4PX9A 2X0NA 5AO9A 2O7QA 4IF6A 1ZNXA 3HVHA 2DTEA 2XUQA 3RREA 1I2BA 2IYEA 2H1IA 3BGSA 3T7AA 1TLLA 2P77A 4IVZA 3PL1A 1QIGA 3CG0A 3OTWA 4JYAB 4JUCA 3LUGA 5IC4A 4EVRA 1YACA 3ANXA 3LCJA 4WGGA 2ZM6B 4RK0A 1D2RA 4LWZA 5DNDA 4M0KA 1EBFA 1FRQA 3EXEA 5BV7A 2QNIA 3QE3A 2TMDA 2WC1A 5TMDA 4FYWA 1U0OC 1DTEA 3MZ0A 4JLSA 4I6JA 3MT8A 4QSHA 5CLHA 4EABA 3MBKA 5JSFA 1KIAA 3OZSA 1GTG1 3EH2A 2R1JL 4FFPA 1GTJ1 2EZ8A 1SBCA 4IL5A 1EGAA 4L3WA 4OQLA 4JVNA 3MNFA 5ALTA 2AXNA 2OKGA 3STWA 2OQ2A 4CBVA 1UXIA 1BXRB 1QKJA 2A1IA 5DM4A 3V7NA 4UVGA 3FZQA 4BMDA 2QD4A 3LQKA 5GM1A 2HSGA 1BX0A 1W2GA 4G1MB 4GLLA 5FEUA 4WUVA 4JELA 4LGVA 3CTPA 4MK4A 4O2AA 4QVIA 5CLLA 1AXGA 1WCXA 2OAQ1 5MGBA 2XYRA 4LTNA 4I4TF 5JJBA 3K9FC 2UZIR 4R9NA 2G88A 1IEXA 5EE3A 3PZBA 4ZYZA 2CHUA 1N2SA 1KU6A 3PGVA 3RSLA 3AWDA 1QVWA 1IG0A 4CF4A 4O5AA 2OQVA 3HYTA 1DTWB 3D7SA 1SUPA 3K15A 5KI6A 5B12A 1LDBA 1SD1A 3P2MA 2R6R1 2JRLA 1H93A 4GVPA 2WSSA 3QEMA 4PHHA 4XD7A 3UAGA 4C87A 1ISRA 1RM5A 3IB3A 4NCKA 2P90A 2PKEA 2WPNA 5EMJA 5KMGA 3G0HA 3M6IA 3V42A 2B4YA 5K0NA 4JU9A 5ADWA 2XGSA 3NMUF 2HIHA 1M1UA 5BN5A 1UAAA 3LK7A 3P9YA 1TYDE 4Z3KA 4Y0AA 3PX7A 4G67A 2H4XA 5B7NA 3OQ1A 3D8SA 1LVUA 5T41A 3WNVA 1HDIA 2GBCA 1NVDA 3IEKA 4X44A 5GINE 4BFZA 1GPLA 1BVYF 3AOGA 3DB1A 3HJAA 2IU6A 3VMFA 3O9XA 2BHSA 4Q6BA 4LPSA 1XRRA 2P4SA 4WADA 5D01A 3HHEA 4GM0A 1RPZA 2IH4A 4UE6A 3TLGB 1WW2A 4AJJA 5K8TA 4I9FA 4O1MA 1U28A 1XRQA 4ICIA 1B8NA 1IQPA 4DLUA 3H6HA 2GHTA 4YQZA 1XTPA 2PVCA 4CEHA 4A4DA 3SBXA 4F72A 2AJ8A 4RQBA 2GOYA 3QE2A 3T5DA 2IYQA 1F2UA 5I7FA 4ZPJA 1RACA 3VR3D 3BXXA 3OZ7A 3PF9A 4YT4A 1HOXA 2A6PA 4EF5A 5CDUA 2NVWA 4K0RA 2I03A 4FBLA 2Q3HA 2X4GA 1R16A 3NAGA 4KQMA 3SYTA 4BQQA 4ZDKA 1IBMB 4RYLA 2UYCA 4XYEA 1K6MA 1GPBA 3ZHQA 1QB8A 3NDBB 3FXAA 3WTCA 4RLQA 3VR2D 2OC4A 4BTEA 2Q6LA 3U13A 4E3WA 5COAA 1XALA 1T3LA 2WNSA 2YMPA 2YQZA 3P19A 1N5MA 2H1WA 2VWGA 3EA0A 4WGFA 3R2JA 1L5KA 2GA9A 4YX9A 1E3WA 2B61A 3RYHA 2CLKB 5JNLA 2IU3A 4IMJB 3JV7A 2MJLA 1P60A 4OQDA 3AM3A 3JYQA 4UBIA 4V1CI 3T3PB 3IILA 3ILVA 4W82A 4IFIA 1QP8A 2H4WA 4A2WA 4H7IA 5L4NA 1AKMA 2HU8A 5IANA 1D0IA 5DEIA 1XGKA 3CRW1 2ZBDA 4UATA 4FYIA 1MV5A 1TQHA 2DJIA 3QOXA 1J23A 1OLOA 2AB0A 3R6WA 4JL5A 4CL0A 3AZQA 1CPYA 5BUSA 4HWGA 1H8ED 3AFNA 4X61A 4Y9SA 3EIFA 4ALKA 5HNKA 1HURA 3M81A 1KYYA 4DKXA 5ER6A 2X5NA 3EGXA 3H4MA 3LPLA 3OE4A 3PHLA 4G4SP 5DHQA 2LKCA 4CNQA 5J2UA 3FYTA 2GPNA 1DRUA 4PTYA 4JXJA 4R9UC 1XZHA 3AFMA 4L0MA 4MV0A 3RIHA 3LISA 1Z2NX 1PEYA 1UBTS 1Q1NA 2P5YA 2GT1A 2ECOA 4OO3A 4EI9A 1EKXA 4UU0A 5IKMA 3NYQA 1PJCA 5CAEA 1VSBA 1Q50A 2OILA 3QG5A 4JQZA 4TL9A 2H6EA 3WIDA 2JBAB 2DY0A 3LDGA 1POXA 5E9JA 3UJCA 4ONEA 1IPEA 4MO2A 5BR8B 5IN5A 1M6NA 3IDQA 4UMEA 3TLMA 3DKRA 1OW3B 3BILA 4FGSA 4GH5A 3G5GA 5LLDA 1OWMA 2V6MA 3G9UA 1QQ6A 4I4TB 3KVNA 4FHCA 3QGMA 3LC7O 2FG6C 4FFSA 1XEXB 1DPFA 1JFFB 3M1IA 3NXHA 4IZIA 4UM7A 3WYNA 3IAS6 3U3XA 4C4YA 5IYZB 5CCXA 3VYVA 4EDHA 7REQA 3JCZA 3CVYA 2GN0A 1L7DA 3RSZA 3GN1A 2DECA 1R6BX 1NVMB 2X7HA 4M1EA 4OXQA 4AJHA 1GUFA 1TVMA 4G0MA 4F1JA 2H57A 2F8LA 2TMGA 1EFVB 4JZKA 3ZY2A 1A7KA 1OD6A 2ENUA 2NUTB 1PHRA 4Y6LA 2QTGA 1LC3A 3BQMB 5KSPA 1W36D 5IZCA 4E15A 1Y8AA 2Q6TA 2WQZA 1ZBDA 2YTZA 4M55A 1OJLA 1FS5A 3TLZA 3TRFA 3T1TA 2FZGA 1ADGA 3ETJA 1UKVY 2DHEA 1V2HE 1W2WB 3AL2A 4FEYA 1GZ4A 4JCOA 5ALXA 5B2ZA 1DRKA 1I3CA 3N53A 4GNRA 1ADRA 5B30A 8ATCA 3TOSA 3RYFB 5DWQA 4ZCMA 3KSMA 4V0MA 3H19A 5E0OA 2GRAA 3GLGB 3VM6A 2VHXA 5KSWB 2WTBA 5A7HA 3I73A 4IGEA 1WOYA 1EUYA 4KR3A 4OYYA 5AW5A 1EUDB 3REFA 3FJ1A 3NNDA 3QFTA 5H0IA 2Z6UA 1SU8A 2FMKA 1PKEA 1O9HA 1R4AA 4Q37A 2L17A 3ZU3A 2VLIA 1CUXA 2HLHA 3L6UA 2QV7A 3D3WA 3DMYA 5BNZA 5LBUA 4KPEC 4B32A 3DWIA 2EVWX 2VOJA 1CBUA 2GCIA 4OUDA 4RSMA 4BNDA 5ITVA 5JXGA 3U5ZB 2C83A 1IH8A 1ZD8A 4FR5A 3W2HA 4UZEA 1A9PA 4DABA 1I01A 4IWRA 1CTQA 2ADFA 2I6UA 3USES 3WSVA 3RLFA 3N8NA 4BFTA 1JI3A 2WIGA 3H6KA 2BBSA 2QRZA 4NNOA 3LU1A 1N5LA 3MGBA 2OO7A 3RKRA 3ZVMA 4EJ2A 4FLFA 1XSEA 3T61A 4OHCA 2EJWA 2R7MA 4D99A 1ONNA 2H07A 4ZRMA 3SYRA 5IMBA 3C8MA 3NTVA 3AU8A 1Z4IA 4QYSA 5L51A 1U2GC 3ZD8A 3KTAA 4Q19A 5IJWA 2BUBA 1C30B 1EI9A 2IDKA 2XW6A 3H2BA 3HMQA 3M33A 2H0AA 1XTRA 2WD7B 3FKSD 4QXRA 4YYZA 4M21A 5JIBA 1GPJA 2G8NA 4M8SA 4OLAA 1IFXA 2C2XA 3O6VA 4QJIA 4R2LA 4BYMA 3L9XA 4O2BB 4YRAA 1P1KA 3L41A 3LQFA 1Z22A 3PHBE 3CH4B 1MO4A 1S4QA 3UPDA 3KUUA 3Q72A 4AZWA 1JLSA 4J16A 3ANLA 3FOAA 3PE3A 3R0IA 2W6CX 4M4SA 5LFAA 1FLAA 1ZPQA 4DMMA 1FUIA 1W5TA 1MIOB 5C1BA 4IZ6A 2WINI 2Y9MB 1SOAA 4Q7MB 1SBYA 4LYJA 3EVFA 4A3SA 4HT3B 3A70A 4JASB 3O38A 1KSJA 3WMGA 1B43A 2JCVA 2QORA 3H5OA 3KG2A 1UBRS 3HVKA 4E33A 3O8RA 1QCYA 1OT5A 2OCXA 3SX0A 3K73O 4G0NA 3LT0A 1RHUA 1R0WA 4QDXA 4FHDA 2RGCA 3FTNA 3G2OA 3BK7A 3JYHA 4CJXA 2F8SA 1GFIA 1HG0A 3WDMA 3UPUA 4Q3DA 4AF8A 9MHTA 1XEWY 1DQPA 3HUFA 2CNWD 2QZJA 2WYVA 3K9LA 1FFSA 4Q18A 1MC1A 5HIAA 4QECA 3DW1X 1WMDA 1RAEA 4NV1A 2FSUA 1VG8A 1YR8A 3EBPA 5ECDA 4KPYA 4RLSA 1U02A 1PK7A 5KREA 3FPFA 3F3SA 3T3EA 5T4BA 3AVWA 4B09A 4QQ8A 5TF4A 1R18A 3NHKA 2BBTA 3UZUA 1DAEA 1PT8A 2ZRIA 2DF8A 2FDCA 1XLWA 4WUTA 1EFUA 1KK3A 2OCKA 4Z9XA 1T8YA 2PGLA 3O8LA 3R6DA 4QGHA 3L7LA 5JPDA 4B3TB 2BF4A 4JYMA 4F71A 1X8LA 2XIUA 5JDCC 3ZLBA 1I4EB 4GOLD 4ZXPA 2HSZA 2VYQA 1UIMA 4EY6A 1HYGA 2DAPA 2WJGA 2QM0A 3AF6A 4DLVA 1ECJA 3RVMA 2BZ1A 4MXDA 5D00A 1Y3IA 2CXSA 4B85A 5HSGA 4X65B 2AFIB 2EHJA 1OWOA 1WVGA 1YZ3A 2VP0A 1J2JA 3I05A 4R2KA 3WQRA 1KZ4A 3OKPA 4N1AA 1E6WA 3FMPB 4KR2A 1CXZA 2CMDA 4R6WA 1DIBA 3L3BA 2KLHA 2P4QA 3PEYA 2I2AA 4IZHA 1ZU4A 2ZSHA 4J6EA 1KZ1A 1A8SA 3ZG6A 5HCNA 4RAQA 2OLEA 3OJWA 3LHDA 5EQTA 1A0OA 1SCUA 4EHIA 4OBEA 1MRZA 1J33A 4GYWA 1D2AA 1YL6A 3Q5GA 1WP9A 3QBDA 4L28A 4DSTA 1X1QA 5JJCA 3PQCA 4QEKA 3U60B 2V7QD 1IN1A 4FBMA 1NBEA 1R0XA 1WD5A 3HLTA 3IJRA 4HGNA 3AR6A 4LZOA 1NY5A 5PNTA 2Z0MA 3CR7A 3NTQA 3GPDG 1UK8A 4E6PA 5CEFA 4DV4B 2PXKA 5JQGB 4PHTA 3N39C 3OM1A 4MGKR 4GXNA 4DTCA 1ZA1A 4MA4A 3EZLA 4UE2A 5FKJA 1YZVA 4QGFA 1LBHA 1QUFA 4P83A 4Y9DA 1KNQA 5DP2A 5DYIA 4BFCA 1M2VB 4AQ7A 1B1AA 1DX6A 4X91A 4LHEA 1HX7A 3LC2O 3LBFA 3ADBA 2OCYC 1QRSA 1TUGA 4XRRA 1HKHA 1JG7A 1N4AA 1KU0A 1L4MA 2V6GA 4A9AA 4ZZ1A 4GU5A 3GAZA 3OU7A 2GZSA 4COKA 1GGVA 1R27A 2FPLA 3A31A 1LW7A 5JAUA 2WHEA 1IRXA 1DEKA 2IYAA 4IG4A 3T1NA 1CF9A 2Z1NA 3H9EO 2C9CA 3MTDA 2XXAA 1TFRA 2XKKA 1Z2EA 2D5CA 1G3IA 1Q0RA 1NOJA 4KV7A 2ZYVX 5FWAA 3LGSA 1ITZA 5SY4A 2PX0A 3G2PA 2FZVA 5LZ7A 3K9WA 4N3AA 5BWCA 3AHIA 1DQZA 3DL0A 3E23A 4P3KA 4R81A 3C8UA 4QT0A 4UVIA 4FW8A 4ZI5A 5KCMA 2I4OA 1KY2A 3H65A 4DLZA 2GAIA 5ADUS 2OWEA 4CMGA 4EFLA 1V26A 1CRZA 1S2OA 4FVTA 4F38A 2HV8A 5AM1A 4MAMA 2PZAA 1PGOA 5I5GA 4RMJA 4DPKA 3EPKA 1YI0A 3HU5A 4TQGA 1Y1KE 5CEJA 4INZA 2V59A 3D7MA 1QC5A 3S7TA 4ADSG 3GDGA 5DLDA 4BQSA 4A27A 2HIGA 5DIFA 5ISMA 1V6CA 2VDOB 1S4MA 4QYIA 1C7JA 3HQ4O 3MYRA 1D4FA 1O95A 4DCVA 3WL4A 1XFDA 3I6YA 3RS3A 4MS4A 1H9AA 1ES9A 2H18A 3MG9A 4LJ8A 4IDOA 3FDIA 4KV9A 4WLVA 3OX2A 4FFNA 5DH9A 4ARAA 4R1TA 4JU8A 3UB2A 1DFIA 5JCPA 1JGTA 4ZVOA 1SKUA 5DLQC 1Y4SA 1IJBA 2XEDA 2ZRAA 4K9MA 4DLBA 3KCQA 3RTDA 1PAUA 4MKFA 2CLOB 1F60A 1T2DA 3TLCA 4K5QA 4BJ3A 3AG6A 4W99A 4X62B 3GMIA 4CDGA 3ZDEA 3ZZMA 1VXRA 3JYOA 1XE3A 3CN9A 3PNPA 1K66A 1RJ9A 1GGEA 3KUKA 3QJYA 1QAMA 2J7PA 2GCOA 3EJWA 1Z0KA 1UZMA 3LCRA 4R9SA 5FDFA 2EZ9A 1L6RA 1OTYA 4YBRA 3AZOA 4TKMA 3U31A 4OBWA 1Z3CA 1VJDA 3GEIA 4XLZA 4F6RB 1E2EA 2A92A 1RHJA 4CG3A 5KU1A 3PWKA 4RFVA 4IIYA 4L5CA 1CJCA 1WHTB 3OCUA 1OI4A 3BQ9A 4Q47A 2QJWA 2XITA 2KSQA 3BFVA 3VC1A 2IXTA 4AM8A 3CRZA 1DAMA 4V0NA 2QAGA 2AWIA 4I8TA 4BIMA 1M72A 2IUTA 3P1JA 2VF5X 5G3ZA 5AI8A 5SZHB 2RHCA 4J0CA 3AJAA 4J1XA 1U4SA 4JOSA 4QUIA 2C1XA 4N7RA 1U99A 3RGGA 3UOAB 1ZM4A 4X93A 3O47A 3OPYB 3BF7A 4X3CA 3UFXA 1DO0A 4JR0A 4PQGA 1A9SA 1TVCA 2H2FA 3EF1A 2CC2A 3PQ7A 2VATA 5HR5A 3EZFA 1GVNB 3IULA 4BAUA 2RK3A 1WZIA 3FR8A 1AZSC 3KLOA 2QUJA 2P79A 1E1CA 3CIFA 3B70A 5BSHA 4Q02A 1JBQA 1GP2A 1UMKA 3UATA 1W0JD 3JARB 4Q9NA 2R62A 4N18A 2JCYA 4N9WA 4R8KA 2RGWA 3OLVA 5HIJA 5JO9A 3HO1A 2DETA 3RVKA 1J4AA 1MEOA 5EE5B 4BN0A 2GZ3A 4GSKA 4DSUA 4BXOB 1M2EA 3GGDA 4PIMA 1DC5A 4GZMA 3ETLA 1Y37A 3ZZNA 4AN1A 4B3GA 3DE2X 1REQA 3O92A 1MB0A 2AMJA 3N6XA 1KTIA 1YB2A 2BMAA 4TKVB 2X77A 4Q7QA 1W8DA 2UUOA 2ZDHA 4IIJB 2JKVA 4NBNA 3O1IC 1GZ5A 3KVRA 4H16A 1XT6A 3TR0A 4AKSA 2NSHA 1SQ5A 2QR3A 4XIFA 4GX1A 3GCGA 3CYFA 1UINA 5ALUA 3SQWA 2YR0A 4E12A 2W2KB 3UK6A 1PIWA 2RBGA 1P7PA 5JCOC 2X5XA 1XRNA 2FMFA 4JXXA 1UC8A 4YR9A 1O9BA 4HZUA 1XLUA 3KM0A 1VC2A 1VPTA 2G82A 5FNVB 3SBOA 3EXG2 3VVMA 3CROL 1N2GA 4ITRC 1CFJA 1OI7A 4BKRA 5ALRA 2RD2A 2Q3FA 3RIMA 4TV8B 3HUTA 4HWTA 2FW6A 2W83A 5G0UA 3TLAA 2FSFA 2JIBA 4M86A 1H2WA 1NNEA 4HMPA 3MUEA 5MFPA 5ILGA 2YC2C 3ND8A 1QQAA 2BGUA 2C20A 4ENRA 1X38A 3ZHMA 2VP9A 4B3MB 4MR7B 2YINC 4MKGA 1KOFA 4JR2A 1V16B 1Q3HA 1NBWB 2CXNA 1XN4A 4PFQA 3RAEC 4ROTA 4BNLA 5CDGA 2B6HA 3IXMA 4IGIA 3TYXA 4AJ9A 2VKQA 3F7TA 4FN3A 1P0FA 4GKKB 1KYQA 3AVPA 2V8OA 2I6FA 3BIWA 1X2LA 1P1HA 2MSKA 3ZTTA 2IELA 3O3CA 3KR1A 2ECPA 3BN3A 4H08A 3M8KA 5DXAA 1V1MA 3IVGA 4X00A 5JI2E 1GFWA 3A2LA 3GRFA 4LK2A 4LOLA 3WC4A 4X8HA 2QSUA 2G9VA 2R6ZA 3CUTA 3LY8A 1DJQA 3QP9A 4LJAA 3C3DA 4IJWA 5FYDA 1XD2A 3U7QA 1E3SA 1AK2A 2DSTA 3D64A 5E6UA 4WOBA 2ZATA 3TTTA 3F1KA 3NANA 4K9QA 1JFTA 4TTRA 5F7XA 3DHVA 1CUIA 4YAWA 2I2XB 2PL3A 1JEQB 3DEHA 3DT9A 1T4GA 5F51A 1J0CA 3UNXA 4DXDA 4PNPA 4FE4A 3OOYA 1LEHA 1BOOA 2Y0BA 3SYLA 3LY5A 2PDAA 3KFVA 3ZWAA 4BL5A 1SXJE 2JGLA 1RYZA 5CNIA 4E1AA 2X22A 5E7QA 3HSKA 4DA7A 1OOEA 3EHDA 2B1RA 5EIHA 3VX4A 2Z56A 2IEIA 3B1KA 2OHXA 1WXDA 1UDAA 2VAXA 1YT5A 1JQDA 4RZUA 3ESYA 4E4RA 1IZ0A 3D81A 2YQ4A 2ICTA 3ZJUA 3FAKA 2X8WA 4EARA 3PUJA 1M54A 2QN9A 3PENA 5JZSA 3RS9A 1SHKA 4F3TA 2PUBA 2X7JA 1MQAA 5LSAA 1RPJA 4EOGA 3DBLA 1YNOA 5IJ0A 3DP7A 3TXXA 3THYA 2G06A 2XXPA 1DKPA 1X70A 2OL4A 3IVXA 4H4CA 2EQ5A 4W5NA 4MRNA 2R0QC 4POAA 1UC9A 4YACA 4WBNA 2Z9BA 3AEYA 2PSEA 2ENWA 3JQRA 1N7HA 3I5XA 1DRJA 4U00A 2QBYA 1HEIA 4WKGA 1NQ5A 1EU1A 4MCJA 1HL3A 3F6RA 5T8KC 3NBFA 1W25A 4X1IA 3UAVA 4Z9BA 4ECEA 2OWDA 4GSYA 3HHPA 5F2KA 3VDXA 2QTVA 4FMCB 1RBYA 4MIEA 1B1CA 4Z1MD 4ZN6A 1QGUA 4DDHA 1NN3A 2XCUA 1IWPB 4CM4B 5JAPA 3K71B 1HNZB 4MDEA 1MOSA 5J5CA 5JANA 3N0XA 2Y92A 3G9QA 4U0JA 5KOHB 2OMEA 2HV9A 3LYUA 2GUWA 3JRXA 4NNJA 1O9GA 1WAMA 1RYYA 1AX9A 4F06A 1YDHA 4M1TA 5FR1A 4ANFA 3P4UA 2OB2A 4M0MA 1SK8A 5CCBA 1T8TA 5G4LA 2HBQA 3TTXA 2M6SA 1TXGA 2ZRMA 3NKLA 4OXRA 1LJ8A 4MR8A 1JAXA 3GJ5A 3CRQA 2AG0A 4AK9A 5EHZA 1B2LA 1NN1A 1CP2A 2QRVA 4IIJF 3FRIA 5FBZA 4WXYB 5FB3A 1U04A 1LTHR 4CIBA 3Q9LA 4DCOA 1GV0A 4JP5A 4NDAA 4Z4IA 3PXDA 4PM4A 3GH1A 5F64A 3SKXA 4ER6A 4RVHA 4TMXA 3H2YA 1EEXB 2BFCA 3FW1A 3JY6A 1SKAA 1WUKS 5CPBA 3KP1A 3QFSA 3QWHA 3JQ7A 4CGZA 5BV8A 4CKCB 2FLVA 4MJXA 4UCXA 4YFVA 3VNSA 4BKOA 1YK1A 3H2ZA 3OHMA 2EJCA 3ORFA 4NBSA 2ZG6A 2YKGA 1QDLB 4GEGA 1A1VA 3D6MA 4L8WB 1AXRA 1C9YA 2AOUA 3FWKA 2IBTA 4K87A 1L7RA 3K7EA 5DGCA 3NONA 2ZJYA 4MGIR 3R5TA 1I51A 4DT1A 3CXRA 3CUWA 3KAJA 5K8UA 3C70A 4O4LB 1G8GA 1GTZA 1WR8A 3LUBA 1OSLA 1RP1A 3NZEA 3TE6A 5LQMA 1XZEA 1JKJB 4OGLA 2MIIA 3NP7A 4GPZA 3CE6A 4HKTA 3TNJA 1PQPA 4RPGA 4XPIA 3SEZA 3Q3VA 3BDNA 1RHQA 3M2TA 1GEGA 2AFIA 4HQFA 5H81A 3ESXA 2Q5CA 2CXRA 4JMPA 4XSVA 2NUAA 1KI9A 1U3CA 2XJ4A 2XTMA 2VDUE 4IJVA 2B2NA 4X4CA 3WS7A 4DSZA 4F2DA 1U65A 2K7ZA 3RTEA 4QJ3A 3NYRA 4D41A 3O3MB 1QCZA 4PZPA 3EXIA 3P32A 4Z5XA 5JATA 4Q9HA 1HETA 1KJ8A 1ORTA 2HMYB 3A2NA 2X6RA 4WV3A 2P69A 5K6TA 5T4FA 3HCDA 4KC0A 4YRPA 3C3PA 4E7OA 5L3QB 3HFSA 4JI6B 1E96A 2R44A 4GGMX 1X7XB 5I47A 1FA9A 2KQUA 4FYVA 4OQQA 3CF0A 4IUCS 1DARA 5B1EA 3FZEA 5F98A 3ORRA 4FGUA 2XXQA 4XH9B 3V4ZA 3KO8A 1DJNA 4G25A 1CCWA 1OC2A 3CLUD 4BVLA 4KAAA 1BCRA 1SK9A 4JJEA 3LDHA 1P3JA 1CUHA 3CT4A 4FGJA 4JHXA 3AIIA 1QRUA 1ADFA 3G1TA 3FRJA 4XCQA 4ER0A 4XKJA 2BF7A 5KTYA 1L1FA 5TS2A 3SIXA 2UVPB 3H05A 3KU1A 3OBIA 3ZZ1A 4PX2A 1VYHA 1WMBA 1WDMA 3E8XA 4LJYA 2RIRA 2IWRA 4M3NA 1KQOA 2R2GA 4NPAA 4FZVA 4MOWA 4CR8A 3QVUA 1ACJA 5EKDA 3V34A 2P9JA 1PNRA 2RGYA 2IOFK 3HY3A 5IXSA 1PGJA 1VDMA 3IMFA 3K2EA 3SKVA 3KQWA 4HDMA 4LDRA 3FUWA 3LYLA 4I6EA 1BG6A 3WNQA 1RWBA 1VIVA 2BP7A 4B5LA 5F4ZA 1QKKA 2PXFA 1NURA 1TJ5A 1ULHA 4KO3S 1AB6A 1J07A 3P0FA 1H1LB 5EAIA 2IGTA 1PT7A 4KE9A 4DIOA 1W88A 1QP4A 2HJVA 1OFGA 4FMCF 1A7UA 2ZBFA 4D5GA 1QYXA 3MLAA 3OM0A 4DJEC 1V35A 2EEPA 5JASA 5KWJA 3G82C 4MDYA 3RYIB 2OQIA 4HGRA 3DW3X 4D42A 1WPQA 1OXXK 4D43A 4EYSA 1Z35A 1OFTA 1Z39A 2PBRA 4AU1A 4BUCA 1UZNA 1U5AA 3GR6A 3UJPA 3SQNA 2UZ3A 5EMNA 2OVFA 3DCIA 3S1SA 2HJSA 2GUGA 5AKLA 3TSYA 4BGVA 3H8SA 2OZLB 4IHJF 3IDFA 4KBGA 4PRYA 3Q3IA 2HCNA 4ZTUB 3WZ2A 1S5PA 3OZCA 4DYVA 2W6IA 1EX1A 2C1ZA 3IPAA 4IH1A 3I42A 2DWPA 2R7NA 3FX2A 2WAAA 1Y0BA 2EXXA 3T8YA 1H8HA 2AK2A 3G0DA 2OFWA 2F2TA 4EENA 2J0EA 4LMRA 4BIIA 1QU3A 3A32A 1K97A 2GPAA 3FSRA 3I45A 2WVGA 3SX4A 1LH0A 4JC0A 4Y2JA 2HO4A 3HVRA 4MUBA 3HDQA 3A7EA 4GYJA 1ZNWA 5AOBA 3ZK9A 3E5HA 1D5CA 3U09A 2MMGA 3V5NA 4D4IA 4IDGA 3BVPA 4F1WA 1RE0A 4IF4A 1JIVA 4WXHA 4JQYA 3PDUA 4ZTBA 3V1KA 3ENNA 3PICA 4OB8A 4QJ5A 3ZWMA 1EDOA 3IAS1 4EP1A 4KODA 3QMWA 1C29B 4LDZA 4R1SA 3K30A 1F2TA 1V0JA 2QVLA 3MMZA 4FINA 4FYHA 2JD0A 2VDLB 3UMFA 2VC2B 3G79A 3IP8A 4I50A 5G0TA 3ZU6A 4GFDA 2Z09A 1ZK1A 1RW4A 4D9MA 3DYIA 3SQXA 1ZINA 4EHFA 5J2TA 1PRUA 4JLJA 1P4AA 2X3YA 4BVHA 1L1RA 2IUOA 1XDGA 1AZTA 1JJVA 2AHOA 2NG1A 3FCCA 4HAWA 2NUTA 4C7JA 1S01A 5DN6A 2NXCA 1DDGA 3R4CA 3UWSA 3ZWVA 1NW3A 3WRVA 4CMJA 1QNLA 3R74A 5A03A 3BKWA 4Q9JA 3WIUA 3M49A 4LY0A 3J80A 1PG2A 1SKYE 3AJEA 2PAFA 3ZQJA 4BFYA 2FUCA 3MCAA 4LSWA 1FX1A 1S8OA 1VQ1A 3LL4A 2OMKA 4GI3A 4CM8A 3IVRA 4NCAA 4UNRA 1B74A 1NMQA 1WNFA 4Z8XA 2VO1A 5E7MA 4EX6A 2NWQA 3KZKA 1RZRD 3OAAD 4JP2A 2GNOA 4K8OA 4MRMB 4AQDA 1H94A 1HI9A 1BFKA 1C8VB 2ACWA 3B8EA 4N9QA 5DGDA 4YAEA 2QX9A 3KLPX 1FDIA 2QAIA 4TVOA 2G9NA 4AJ4A 4EHJA 5TLSA 3FCXA 1OVGA 2BEVB 4K8RB 1PGNA 5LQAA 4MUEA 2C7VA 3LP5A 1BQEA 3QQ6A 2YOGA 2A86A 3UB4A 1NMYA 1E6MA 1EZ4A 4KHPB 5JJIA 2HFJA 5LZ5A 1R6DA 4OUDB 2AFHE 3HCOA 4CF7A 1ZZ6A 2XOKD 4ZVQA 1XQWA 2VBCA 3LOPA 4QJ4A 4S04A 2FW9A 4NJMA 2RCNA 4IO1A 1G21E 4Z9YA 5ALFA 2VZEA 4Z7JA 1XWFA 1NASA 2QR5A 2YOHA 2C5EA 3HYRA 3QV1A 4FT2A 4CCAA 3DV0A 4H6WA 2C4NA 4HEHA 4EF6A 2DFKB 2H2DA 4FONA 3DCNA 4QUKA 1NVUQ 1T0JB 4X95A 5K3OA 1IZ9A 1J0EA 3AF2A 4X7PA 1I6MA 3U1TA 5KNDA 5C5DA 1KC3A 5AUPB 3B20A 1EFHA 4Y6QA 5EZQA 2XB8A 3ELUA 2MYPA 4H6VA 4RHYA 1DWKA 5AW4A 4AP9A 2AKEA 2AKYA 1AN0A 2B6NA 3P45A 2DJ5A 2FXIA 3EUWA 1P0IA 1I3KA 1R0RE 3QPBA 5CU7A 1X7GA 4YCLA 1ISJA 2V9ZA 4U4AA 3VXKA 5GZ3A 1B6SA 3JQAA 2GJAA 2WYHA 1LPMA 3KAPA 5AKYA 5CCEA 1TKRA 1X1SA 3EZ7A 3QVGA 3PRHA 2O48X 5GOTA 1F0PA 3JSXA 1G291 4RF3A 4YA6A 1ZD5A 1H5QA 5A0TA 3A4LA 1M10A 1XHFA 2AF4C 3C41J 4MVJA 4N54A 1J1ZA 4XIIA 4AIIA 2C5AA 3GMDA 4B34A 3IOCA 4M1SA 1LBSA 4UTZA 4MW4A 5AK3A 2C2MA 4DSNA 4PRKA 3PI7A 4K0KB 4DSOA 4UAUA 1XMJA 2KEJA 4O6VA 3TI7A 5FA6A 3IQDB 3MC1A 1T2VA 1UADA 1TLTA 3AETA 4OHRA 3PQ4A 4QG7A 1PR9A 5A1TA 1M5TA 4RHTA 3J7AC 1QZUA 2UYGA 3TGLA 4KR7A 4JI8B 3TRHA 2AEEA 3GCDA 1EGQA 1OXKB 2VDMB 3V7WA 3WLIA 3WLNA 4C0JA 1ABBA 3Q10A 4DW8A 4A6PA 4KQIA 4M6WB 4Z59A 5T5QA 2ZS7A 4CKEA 1AUXA 3FDFA 4ZAZA 4AVYA 1EDBA 2JBHA 5F23A 1HC7A 4OM8A 3TM5A 1XDZA 4PONA 2C8KA 4BFLA 5AMXA 3KVYA 1N78A 3ZQ4A 3BXZA 4RVFA 3OC6A 3ND5A 4OQZA 2Z58A 4LXXA 3SOPA 1JAYA 2PNFA 3FNFA 1BWPA 4PLZA 2H1FA 4ZQBA 4HEQA 4WBSA 4EHKA 4EG6A 4NEHB 2GRLA 2I78A 4AUKA 1WXHA 5ICGA 4PZUA 3NH6A 4RLFA 4GM1A 1NPDA 1ZP6A 4F9TA 1KDRA 3D31A 1NP6A 1AKWA 1EWQA 1HQCA 4UOEA 1VE3A 4NMLA 4EG7A 5LQUA 1U4OA 1MTZA 3GROA 4ED9A 1QFZA 4PPQA 3KOYA 3FR7A 4OAOA 1HRKA 4WBNB 4ZYVA 3DCYA 1GWNA 4A2PA 1KSFX 1E6KA 2ODNA 1YZLA 1H3EA 3EWIA 1EK0A 5FBHA 2GEJA 5IDQA 4UEKA 3AUFA 5DHTA 1OLXB 5FOTA 3ECCA 1XQYA 1XR3A 2EP7A 4DG9A 3EN0A 5CXUA 3ECSA 2QTVB 1X1TA 1H3NA 1SRQA 1R6AA 3OZEA 4KXVA 4AMBA 5LZ9A 5EC8A 2YY5A 3N05A 2JB9A 5F12A 4XD2A 3G1UA 2NO7A 2WKSA 2ZJFA 2XTAA 3HDTA 3IAM1 3C87A 3FSGA 4I6TA 3N7TA 1R6VA 3TM4A 4BX9A 2ODTX 1QE0A 4I4LA 5AESA 2N47A 2C3YA 1XOIA 3I9V1 3QU7A 4FDTA 5HXAA 2BKXA 3DDHA 3O4GA 3ZDRA 1Z62A 2E2WA 1L5LA 4C6SA 4QWWA 2Q29A 4MCXA 1SMKA 2ZIUB 4CTOA 5K01A 3LZCA 1OXSC 4OGKA 2IUUA 4BC1A 3OOSA 2YV5A 4LZZA 4QREA 4EY4A 3DR5A 1OCTC 4O02B 4OKIA 5E1BA 4CV3A 5JCJD 1OX5A 3LL7A 3FVRA 1Z5GA 2V9PA 2JJMA 3LVQE 3R6GA 4PGFA 3O7MA 1M2VA 2W2MA 2Y99A 4EUSA 2VYVD 3GDWA 4XM2A 3VVBA 2HA5A 3DZFA 4K40A 5FPYA 3QOYA 3WDLA 5LLTA 2N75A 2F90A 4IQ0A 3Q0IA 5AH0A 1B6RA 3C1UA 5JS1A 1LBQA 4J43A 2VCYA 5JQGF 1GADO 2AR9A 1CW2B 4AMZA 2JGDB 5F33A 3G7NA 1RRFA 2HK6A 1D8AA 1RYBA 2IY7A 1GG5A 2R48A 4N01A 5JZOA 1QS0A 3DO8A 3AKDA 4M99A 1QYIA 2P11A 2OGZA 1YL5A 4PSCA 1N8KA 3HLYA 3U4IA 2XVMA 5DYWA 2WIFA 5EQFA 1LTQA 3ROXA 3OU2A 1RVV1 1W5EA 2PL5A 4TYPA 3SI7A 3Q3EA 2GYWA 3U7JA 3L6OO 4IW3B 2O2EA 4ZIRB 5EEGA 1P0MA 3D7RA 4N3NA 5D3QA 3ODGA 3GP5A 3T9FA 1XJCA 4BO6A 1DLIA 1EVYA 3W3AD 3AUXA 3H04A 1YASA 4RUKA 1JKXA 2XB4A 4HR7A 3UG6A 4US0R 2OV1A 3CCBA 2JCGA 2QPTA 3R5SA 4HBZA 4QICA 1SHTX 5E9AA 1ADCA 1RFGE 4P36A 4EKNB 2D1SA 5TB5A 1O03A 1PL0A 1ULTA 3MCTA 2BH9A 3G5AA 1RCFA 4KXFB 1LCCA 4U8HA 2XT9A 4CLOA 1K0FA 1SWVA 3PTZA 2FR8C 4OMDA 5DYNA 2IS6A 3F2IA 4E1VA 3U4MA 1U7XA 1XA4A 4RDHA 2D1YA 3BA6A 4GQAA 1Y9EA 2IIPA 2XSZD 1P1RA 2CLMB 4Q7JB 1JVSA 5JH7F 3V1NA 2GN6A 4AJKA 3PFBA 3GG2A 5JLJA 3QVTA 1R9MA 2B9EA 4WLEA 1E3JA 1KAEA 3R77A 1UWVA 4F11A 4JBXA 1SXIA 1W76A 2XF8A 3SC3A 1O58A 3TDKA 1JLLB 1KVTA 1WCIA 1QIJA 3CKKA 2H16A 1FZQA 1ZICA 2ZSBA 1XDWA 4EUKA 3QNWA 5DBEX 3KLMX 1TECE 2HCBA 1LUAA 3FWPA 4RMHA 3TDMA 4D9JA 4KGZA 4RF2A 2O8DB 2PMEA 2HJRA 1IWBB 1EB9A 1GGHA 3O2NA 3OTIA 4LN1A 2HKIA 2P9BA 1Q0HA 4UD2A 1GUDA 1CEXA 3R9IA 3QSGA 1C1DA 2Y0EA 3DMRA 4S1TA 3GZTB 3OM9A 5A04A 2X9GA 2Z08A 1X87A 3MHPA 2O8FB 1VZ2A 2QRKA 1YQXA 2VUIB 3G85A 3IMCA 1XG5A 2I1WA 2B83A 3JQFA 4HXGA 2QW8A 1THZA 5I9MA 1TZKA 3CXUA 3GY0A 2X0EA 1AZLA 1GAEO 3PFGA 2R1UA 2GHIA 4WOCA 3CBQA 4W5HA 5KNDD 1MO6A 1Y7HA 4IUBS 1FQKA 1G3UA 1XAGA 2JGIA 2Q4EA 3PC2A 4Y9RA 3VH1A 1E1NA 4RA9A 5LLSA 4B3CA 5IBQA 4Q1AA 2ATXA 2XYQA 1OKKA 3MCVA 4QQNA 2XUJA 2VP5A 3RS7A 2GK7A 2AKAB 5ENZA 2CSXA 2Q6OA 2OLJA 2EFCB 1M9NA 1GAJA 2VBIA 3OCJA 3QXCA 3UJ6A 1OBOA 1M34B 5JRJA 1CUCA 5HGJA 1KIFA 3FDXA 3JAKA 1DG1G 1EVIA 1S1CA 3T3NA 5FUVA 1WZNA 4Y2XA 4EW6A 1BH6A 4HDSA 1OE0A 3DOIA 5IBCA 1XNRB 3LPMA 2C7OA 3U56A 4P0QB 1QDEA 1QANA 4Q4JB 4EK9A 3OEEA 1UZLA 4U02A 4BU0A 2VUHB 1TEXA 4QQRA 4IDCA 4D9GA 3IE1A 5EL0A 5CFMA 1NN5A 1QAQA 2VKTA 1UKBA 3IP3A 2JDIA 5DHAA 1ZUIA 5ERXA 3ZGNA 4AXXA 5TGZA 1X3LA 1L4FA 2CLLB 1DJPA 1UXOA 5F77A 2YCLA 3UV3A 4I36A 2CNLA 1ZZCA 1FVFA 3DEFA 4Y98A 3RG8A 3IA2A 3W6PA 4C76A 4DE5A 2GO7A 4K9DA 1BKDR 3LGAA 2V1UA 1T5SA 2FVXA 4U2CA 1LSSA 3A4NA 1JWBB 5DXJA 5B5SA 5IDWA 3DOOA 2V7QA 3WBFA 3GRYA 3QA9A 3WRYA 5K3DA 1B00A 1XQ1A 1SHZA 2D2VA 2F6RA 5FOUA 1GJRA 3K9GA 1J8FA 2ZJZA 1XU9A 3B6JA 3PXCX 2P9EA 1Q7RA 2VP3A 2ZE7A 3HKEB 1MAHA 4C0QC 4FM9A 1LLQA 2IUEA 2PUDA 2WZBA 1YHNA 3IAFA 4NATA 1O4VA 1QYRA 1EJ2A 3I2HA 2HBRA 2NTVA 1YMVA 1FTWA 3WLKX 1X2BA 5KQPA 3UT5A 1QZTA 3VHRA 4C7XA 3IJPA 2OT3B 5BXYA 2AVNA 1TQ6A 1ZY2A 5KTKA 1PKXA 2PZFA 2LZ0A 3I34X 1DQRA 2I8CA 2H92A 4KH0A 1E9CA 2VFAA 3GZNB 2FWJA 2LPMA 1GRVA 1K2VN 2CZQA 2FPRA 3NHYA 4UM9D 2O2XA 2EIXA 3QKSA 3CX4A 1YOVA 1R9GA 3EZ9A 4HGYA 4DG5A 3FPCA 3RB8A 4B8ZA 4CODB 3G0IA 2HRBA 5AJHA 2WM3A 5CH5A 4F4UA 3NPMA 4NY1A 3REQA 3V7UA 3EPHA 1K2WA 4PYJA 3NHRA 2JFOA 1D09A 2J9FB 3HJGA 4UHDA 3PQ6A 1FYVA 1VCIA 2II6A 1MAVA 3H9BA 1XN1A 1Z7GA 2B0JA 1C8KA 3E58A 5BMOA 4P4LA 2V3CC 3PFNA 2O6HA 2IHYA 3PCRB 1MLDA 2WNIA 3QYJA 1RC1A 1NKTA 1V95A 1P39A 3HLKA 1I0LA 3ON5A 4ITVA 3ZE9A 1L5WA 2E55A 3DOHA 4A7PA 1QHEA 5KEIA 3ANSA 3VV3A 3N76A 5FLXA 2GX6A 1C7EA 4RHUA 2WM9B 4YJ3F 5AXCA 1KZ6A 4AKEA 4UHEA 1NVWQ 2VP6A 4TRMA 1PFQA 1E92A 1T0UA 3NAZA 2GEDA 1W35A 2EG5A 4R8VA 3FWNA 3E0QA 3SBDA 1PRAA 2D4HA 3GFVA 3WQQA 1EVQA 4GQMA 1XVLA 2WG1A 1C8BA 4FKBA 2REQA 1BJKA 1U3FA 1WHSB 3OIUA 4OHPA 4XVRA 5TPZA 1WKBA 4W9NA 4CLRB 4UFOA 4E03A 4LF7B 4U6SA 5AM4A 2QMQA 1JE0A 2XE6A 2OR1L 4H3VA 1YFJA 2GCNA 1VLVA 3KZ3A 2DPMA 2HJ9A 3I9MA 2AZMA 3IAUA 5AW2A 5DRTA 2BFAA 1EXWA 2PGXA 4MUHA 3TEMA 5EJ9A 5M5BA 4XXHA 3V1MA 4F9EA 3D59A 4I8IA 4EA9A 4IIHA 3IC5A 1EE2A 1SG9A 4HB2A 1R37A 3ZDXB 4YMUA 2ECKA 3HY4A 1O8CA 5ILOA 2FKAA 4DLRA 2I76A 5IUNC 1KI2A 4V0LA 3GBSA 5L4LA 1OBVA 1IHOA 2VRCD 2XXJA 4M38A 4PGAA 3G9TA 1SB9A 4RL6A 1WX1A 5B6PA 1JWAB 1NULA 2JGNA 2HCSA 3B2EA 3ZXSA 2FMTA 2BFWA 2G9UA 4B71A 5HM6A 1U9CA 1NU6A 4W5QA 1E69A 1UT6A 3IUPA 3BWCA 4MRVA 2QY9A 2QX4A 4NG4A 2PXHA 4FR0A 4JJFA 1RQPA 4IX1A 4JSYA 5EGSA 3U19A 1DJOA 1I1NA 2A9QA 3M70A 4PG7A 5C1IA 1PR0A 1Q84A 1NRJB 1E20A 4LXIA 4F5ZA 4RPKA 2YHIB 1WTAA 2FPPB 2ZRBA 3FPAA 3HY6A 1AS3A 5E4YA 3WMEA 4ZFNA 4JOBA 1JDSA 2EU8A 3A4TA 3BBPA 5K8CA 1JAZA 3AKZA 1C41A 3B3FA 2H7XA 1PJQA 1Q83A 1MQ9A 1PR3A 1MEEA 3AI3A 3B2QA 3OMLA 5DWVA 5IC6A 4GMDA 2JA1A 4RK6A 5HF9A 1VE1A 1DZIA 2EFYA 3BGOS 4FDVA 4NE2A 5LYYA 1WUIS 1NSFA 1T15A 1SA0B 1U1DA 3V4FA 1GNLA 4ETNA 3ZWYA 1ID8A 3RYFA 1A77A 4YP5A 3E1KA 3CG4A 4CI9A 4YG4A 1S2NA 4P9NA 3U44B 4BX3A 1L7MA 4WZAA 2ZVPX 2BHRA 4RVSA 3K6SA 1AGNA 2FPOA 1C3OB 2L49A 3HB9A 3VO1A 1S9DA 1DJMA 1Y5RA 2DUWA 4UM5A 5AVUA 5B3AA 1FVOA 1ZOIA 3OJEA 1N1EA 4HVAA 1FFYA 3IQFA 1KAHA 2NU9A 2J85A 4ZQFA 4RJ2A 4WZZA 3BH6A 3QTTA 4CQMB 3U17A 4TTPA 4QOEA 2IA5A 4RVGA 1ZI6A 4HCJA 2VHUA 5INTA 3KETA 3EEIA 1OFVA 1KBQA 1S2LA 2GQ0A 2EGHA 3IHKA 3S1AA 4DBLE 1L6IA 5L3ZA 1A9YA 1X74A 1N7GA 1ELOA 2OGWA 2IEZA 1W73A 4IIBA 2J4FA 5BOVA 3HYNA 3I1FA 3FPKA 1VCNA 3T3DA 3QKRB 3I9V6 3V2GA 2IDMA 2R00C 4BLWA 1KVQA 2QENA 3LFHA 2IEYA 4K2AA 4CFYA 3PEVA 2WE8A 1IHYA 1GPKA 3GFSA 1CE8A 1VKOA 2A0FA 4LDPA 1AQJA 3BULA 4WXRA 3C3JA 2GESA 2XNCA 3KKNA 4JT2A 2GEFA 3EY4A 1Y82A 5AVJA 5CW2A 5IJ0B 1GQOA 4E2YA 3GZDA 4Q4LA 5C9ZA 2V74B 3GLRA 1JJAA 1E2JA 2FR0A 3AY0A 3D2AA 3F49S 4XCXA 5IK2A 1JPNA 5K3CA 1T5BA 3TXAA 2V6IA 2GK4A 2IITA 3EDQA 2OCGA 3EW9A 5A4MS 1Q74A 1Y9JA 2OY0A 1BN7A 2HDHA 1MN6A 1SXJB 1UQRA 1DBSA 4J7XA 2O5CA 1L2TA 1ZL0A 5AM5A 1P6UA 5SYMA 1WUHS 2Y1EA 4FXOA 4BFWA 2PH1A 2XA9A 3RTAA 3SEFA 3T99A 3VDRA 4OQPA 3ZWBA 3B8HA 3ABRB 5F2EA 3AYZB 4X5OA 4XUEA 3TL3A 1M73E 3EW7A 2GYVA 4QEZA 3SS7X 2AQIA 2BR3A 3E9NA 4UM8B 3A11A 5KHLB 2DWQA 3GMTA 3PUVA 4IJUA 4F5DA 4Z7QB 1A9TA 2X8BA 3IMEA 3LA8A 2H5EA 2PTHA 2QMEA 3EDMA 2QRHA 3GRPA 1IRIA 4HNTA 1E79A 3AR9A 1P5ZB 3KRTA 4RD2A 4RCZA 5KNLA 3WYDA 4TLBA 3OJLA 3GA7A 4P3OA 5M29A 3JYNA 1V8DA 3JS5A 1E4OA 1XMQB 2FFAA 1MQSA 2FFRA 2P4HX 4PU8A 3F52A 2YXLA 3R3JA 4GI2A 2EFDB 3R0XA 2OD7A 1O5IA 1Y1SA 4RU1A 4RD3A 3T4PA 1E4YA 3U4QB 1KDPA 4R71A 1EA5A 1ZM9A 4F56A 1JA9A 5CLQA 1U0HC 2BKVA 4MQMA 2JJ1D 3AUKA 3LXRA 1T0PA 1N9KA 1ZC4A 4MICA 1DFGA 3VAYA 4BDSA 2IIVA 3G6WA 4IOKA 3IVAA 3WZMA 1QCCA 1LI5A 2BDUA 4YP0A 4ZHSA 2BFNA 4ZCQA 3UV6A 2B9VA 3EFBA 4HQKA 4EPRA 1A9ZA 4FCWA 2BSQA 3CZ9A 2IGBA 1J2RA 2LLWA 2VXOA 3INNA 5C7OO 1B8UA 1GT6A 1UC5B 4NHOA 1EMDA 1H23A 2XZDA 1D04A 3IR6A 2NTNA 5IVHA 1MG0A 2RHLA 3N28A 1YDEA 2I7VA 3IBSA 4FKZA 4BBPA 5F5XA 1XRPA 5D7NA 4HAOA 2H85A 4KRFA 2HWKA 5E4TA 1TQDA 3W06A 2PH3A 4FB4A 4QDJA 4BNHA 1KNXA 2ZYDA 2H54A 1N7IA 3R24A 3RC3A 4BWFB 2O2GA 1TNDA 2XGGA 4OU4A 4ZC8A 1GCUA 2E4WA 2XQIA 3U3KA 2ILTA 2Q5HA 5E7IA 4E94A 1FIUA 3AV3A 4R5HA 5EHNA 2VTDA 4FZRA 3QZUA 2CE7A 1Z18A 2OG1A 1ZHOA 1GPMA 3H18A 1PFKA 1D0VA 2OQRA 4NCNA 2G63A 1T3TA 2VHJA 3C3CA 1V4VA 1YB6A 4HRYA 3PPVA 4LZAA 5TIIA 4JVSB 3B3JA 2YY7A 3AVYA 3EMKA 2EQAA 2M98A 3EF3A 5AD1A 421PA 3F47A 5KYXA 1M0SA 3ZE0B 3KSBC 3I32A 1GCIA 1Y8RB 1YL7A 5IMSA 3NWJA 3ONFA 1XQXA 2QB5A 2QRLA 3DHEA 1U0FA 2R7KA 4LJ7A 3INTA 2YS6A 5D2CA 1I0IA 2BELA 1TMYA 2IL1A 2NV6A 3ZY6A 1DADA 1KDVA 1E6LA 1XZIA 1D2HA 1E5LA 2BIFA 1JMYA 4D0LB 4RVDA 8LDHA 2OPBA 4YCBA 2OZVA 4I1OA 3MWEA 1XTQA 3VO9A 1OAAA 1QG2A 1VYUA 3DS8A 3ZUPA 4OREX 4LG1A 4MQ6A 4PYOA 3EWSA 3WGVA 5AKEA 3K70B 4HSEA 2HZ7A 3NAMA 1FNBA 4MQFB 5FUBA 3RKSA 4C7BA 3DC7A 2PPLA 3JQFC 3IUBA 4MV6A 4PBSA 4TYYA 4YG7B 4PYKA 3K0KA 4UHCA 5ERGB 1CR1A 4RZ3A 1II8A 3HDHA 3THOA 4C4RA 2ETXA 4CV1A 2C4UA 2C3MA 4C0KA 5LU9A 3AIKA 2WTMA 1SXGA 3E4DA 4QDUA 2NPFA 1P5JA 4YUAA 4RVOA 3SC2B 2IUFA 2ZIAA 4Z5CA 4MKXA 5BSTA 4DN6A 2P0AA 1R5BA 3N58A 4G4JA 4TVBA 1KEVA 3DV2A 2OXTA 3LBIA 1CUVA 1D6JA 3ETCA 3P0JA 1VL5A 2OESA 2XB6A 3G5LA 5JCXA 1Q1GA 3Q3JB 1W29A 2OHVA 1WEKA 1OAKA 1G2IA 1P29A 2HCTA 2YXDA 1JG3A 3KJQA 1VP3A 3QYPA 4OHKA 1P6XA 3VU8A 3O26A 1ZH2A 3BWYA 4QOJA 1EFRA 3WGGA 4DIUA 4EO4A 1I9CA 1Y7PA 3SEAA 1VGRA 2BRUC 3AU9A 4MLZA 1J5PA 2NZ2A 2GBIA 2YJZA 1VHLA 1A8IA 2MEZA 1UOOA 4O4HB 4OJQA 1B3RA 3CO0S 1U1FA 1LQCA 1Z0AA 4DMKA 2A4MA 2E5LB 3KDSE 1Q0TA 3GJ7A 1NXSA 2VF2A 1ZIPA 4OSEA 2BMWA 1S2MA 4YRSA 5I48A 3AVVA 3OWOA 4LVOA 4M9RA 2FQ1A 2OO5A 3AB8A 2ZCVA 1DBQA 1V71A 1POUA 1HFEL 4EW3A 4HV4A 5MF6A 3AHCA 1BS9A 1K4MA 2PX6A 3U4DA 1D4ZA 4I5IA 1A72A 4BEWA 1RZSA 1AGYA 1Q77A 3KDPA 4G0QA 4YRDA 2YFKA 2ZREA 5EJ2A 3RV3A 1MJFA 4M37A 2G0NA 3W5JA 2V4ZA 1W44A 1QF7A 2ERYA 2Q99A 1JIKA 1QVRA 2J4DA 3IR7A 2P9HA 3P0EA 2QP9X 1CUFA 3IAXA 1FVXA 3ZDBA 2C2BA 4ACBA 2Y6UA 2X58A 3NIFB 2JLCA 3GEHA 3L7DA 4DCJA 3ZNOA 2HXGA 4XM0A 1NUAA 2YN4A 3TZLA 1CYDA 2QL5A 2XMGA 1E4EB 4HDKA 3KQMA 4J6FA 2BM1A 1ZG3A 2V7UA 4KEAA 1KI4A 5KYKA 4RK1A 1FUEA 3TMAA 2R8YA 2Y3IA 2GD1O 2WE7A 2GZ1A 3D02A 3LKVA 4MMYB 5G1OA 2I6TA 3UB3A 3KSAC 2EGGA 2WJ4A 1C1XB 1OLUB 3K8OE 3UJAA 3PHGA 5IKXA 5IEBA 4NYJR 3DR3A 1NYRA 3JARA 1LZLA 5LUBA 2R4TA 4YWHA 3G0BA 2CMFA 1HLFA 1NW8A 3OKAA 2MTBA 2YY6A 1NHGA 3UAZA 4DJAA 1KAGA 3N87A 6CHYA 1BJTA 3T1HB 1CIPA 1U0EA 3RKUA 5KKNB 4PGGA 1JECA 2REQB 3MLFA 3GRRA 3I09A 3V6LA 3V8EA 4LZNA 3S6JA 2WQ6A 1XQ6A 4U5QA 2QYOA 3E53A 2CSFA 1NJGA 1ZXLA 2BTOA 3FHJA 2Q1WA 1KOGA 2PEYA 3HJUA 1NI4B 4AG6A 1IVSA 1LQ2A 1TCBA 2HF8A 1R64A 2A1UB 1DKUA 2PQ0A 3UYKA 1O5OA 2F3RA 1NONA 2J45A 3DBIA 3MLEA 1ODIA 4IIDA 4XEUA 1R0KA 1BD3A 2B4TO 1SKYB 2OR3A 1E9DA 1WDWB 5IUKC 1VL1A 3ZGOA 3KUDA 5AI5A 5CAEB 2Z5FA 3GPCA 2F1OA 4RCYA 1M6EX 1WZEA 2ZWVA 1NI5A 4ERNA 1G7TA 2RC5A 1BS2A 3HADA 3P4XA 4JH0A 2G08A 3WRYC 3GYGA 3IESA 4ZTZB 3BWMA 3UCEA 4A5OA 5LMUB 3R0JA 1G5TA 1NJFA 1SUBA 2XIQA 2HB6A 5H4GA 4AKHA 4J4HA 4I19A 1B7GO 4Y30A 3X1KA 1ONOA 1TGYA 2Z1MA 4IGKA 4TV9F 2FUG1 5JXJA 2ZXFA 1KR2A 4QFDA 3CZ5A 1X7YB 2R1ZA 4GX5A 1CIJA 3PZRA 4YASA 5E7JA 4J49A 3EY9A 3AC0A 1R4ZA 3DBHA 3LCMA 1OPRA 4BDTA 4MULA 4CMAA 3H9UA 2D1QA 2R25B 1M1YA 3I8OA 3PPIA 5CJPA 2H2IA 5A4JA 4L8VA 3KQKA 3L05A 1HDOA 1Z5OA 4EPWA 1GPWB 4RHXA 1L3CA 3HJCA 4V0OA 5GZ6A 1A71A 3PHCA 1CDOA 1OV6A 3LT2A 3C4VA 4ND6A 4M76B 4E11A 1NLFA 2ZYTX 3KFXA 1ML4A 1PR1A 2VAWA 1KH3A 2JHPA 4KN6A 1WMFA 1N5DA 4H18A 4ZJUA 2PX5A 4JQDA 2JFVA 1E8DA 3DF7A 1ID1A 4RDXA 1H2HA 1YVPA 4O4HF 5JZBA 1QOZA 1XCOA 1W9HA 3GIDA 2GKSA 3KD2A 1PBTA 4ZPXA 1S02A 2AFIE 2CVHA 4M6WA 3UTCA 4MP3A 4NQZA 1L7EA 2QVBA 1U8FO 3LM8A 5JO0A 1OILA 1QS0B 2JFPA 2VHWA 3AM5A 3HB7A 5KC8A 3GLGA 4CTMA 5FADA 5CBPB 2VN8A 3H16A 3KBOA 3QHAA 3AKCA 3STVA 4KH1A 4F2PA 1XXHB 2X0KA 1U8EA 4MVCA 1N8SA 3PQ8A 4UQLA 5H83A 2VF7A 2QVGA 5HGXA 1LVHA 3WBBA 4DQXA 3N6RA 2OCAA 5I9TA 3DLIA 2FPGB 3CKLA 1SPXA 3ISVA 4ND7A 4WFJA 1E0SA 4M1QA 4ZO9A 4ZQGA 4QTYA 4CFZA 1RRKA 1E60A 1WDKA 3H4VA 1BE6A 1F9AA 4XYLA 1XU7A 1Z0FA 1MKYA 2PKQO 2XVYA 5MN6A 1Z06A 4D98A 5I4CA 2BMFA 4UTRA 5CDYA 3V32A 5AVVA 1KIMA 2ZRLA 4JB3A 4CUJA 4OMUA 1TUEA 521PA 3AHJA 1GZHB 4ZREA 1IJKA 2WUEA 5FR2A 5B1IA 1YULA 2WVHA 3OO0A 2RKWA 2X6QA 2V7WA 2P7HA 5FUYA 4A8TA 1E2GA 3U3MA 1K0UA 1TE2A 1KQ3A 4GXQA 3WNZA 2HK9A 2JI9A 2WMYA 3FHOA 3ROGA 4GNKA 4UBMA 4XQGA 3TLEA 3CLSC 5JUWA 1NOKA 3HDVA 5D86A 4C9BA 1VXOA 3U3DA 5K03A 1V7QA 2PSJA 3CX8A 3QE0A 4X94A 1ST2A 3UANA 3NKVA 2MCFA 3RR2A 4P2BA 5BNTA 5AVZA 3WXBA 4UNSA 2NXEA 4TKZA 3UJDA 2PUJA 5MN4A 2GRMA 3QLUA 1XL0A 1CS0A 4R2IA 1OCEA 8GPBA 1DL5A 3P9XA 3G8BA 5LA6A 5I9LA 2F9LA 3PFFA 4NAVA 3TTWA 4GEKA 1UFOA 1P74A 1UJ2A 2C92A 2YYAA 2X15A 4ZI7B 1HE2A 1UBOS 2VJCA 3H3JA 5AJXA 3RASA 4ZO7A 3ZHBA 4E13A 5FAKA 1GCGA 4B82A 5TEVA 5AUOB 5C5CA 4CMIB 1VPVA 3WK6A 3OESA 2OEPA 3OCCA 2XYVA 2F1JA 3ZLVA 4C0WA 1RSZA 1Z0UA 1C9DB 4EY8A 1CVRA 1Z6TA 1X94A 4XM1A 3D4IA 3HYSA 5DLEA 4UASA 4LISA 3S1LA 4GRIA 3NCTA 1BGVA 5B3KA 4H17A 3IBGA 4HO1X 2O7RA 4FIZA 2Z5LA 1ACLA 2HK8A 3AQIA 1XJWA 2EBUA 4G63A 4K1LA 4LI3X 2RAVA 1JFRA 3VTAA 4EHLA 1PGPA 3TLKA 4DT1B 2W4IA 3OLWA 4BV2A 5LZ4A 3ZCRA 121PA 1DUVG 4GMHA 1BWQA 4JK3A 4FDUA 1J2TA 2JEZA 3N59A 1R10A 1GARA 1V41E 3DULA 3EHEA 3QWAA 3GT3A 4M46A 2H17A 1UWCA 3FRHA 1WO8A 2GPSA 4KVGA 4BGDA 2IQ5A 4P3XA 1DKOA 2HBZA 1T6BY 3SSAA 4TZ0A 2VAPA 4JFAA 2VQSA 2GAFA 4FSHA 5HRUA 2WUVA 3KIPA 1P2TA 3W9BA 4DIMA 2C2ZA 1JHRA 1FFHA 3MJCA 1IOVA 1DS6A 3HO8A 4IVPA 3JWIA 3ZVKA 3EBOA 1GPAA 2D74A 2Q21A 4KU4A 1KEEA 4F7WA 3TUZC 3FYAA 2NADA 3RYCB 1TPZA 1DHTA 2ZUBA 4ND2A 2QN1A 3BXFA 5B1DA 3IEMA 3AILA 1M2NA 4YK7A 3LQQA 3K72B 4W7IA 2IBMA 1W4ZA 2G1AA 5D5HA 5DOVA 4KPUB 5EHXA 3LPAA 4MW9A 1G9SA 3HFGA 5K0TA 3MFQA 3WNDA 5DHFA 2BZ0A 3OPQA 4DDVA 4EWLA 2HXYA 2WUWE 1T4BA 1QF9A 3A1NA 4FILA 4ARZA 3LWZA 5BOSB 4M87A 4F6LA 2X3FA 2PA3A 1Y8RA 2PJDA 3RUHA 4JCXA 2JASA 2YFQA 4R2XA 4X84A 5JBQA 1JDPA 1L5VA 2F3TA 3A9WA 2Q6VA 5JMPA 2XMQA 5FHRA 1GVHA 2YVAA 3M5WA 3LV8A 4ZEOA 4IVNA 4FDAA 4PU4C 2LCFA 3AHGA 4MW2A 1L8XA 3CH7A 3RJTA 3TUIC 4IS3A 1FYEA 2XGJA 4QLBA 1BHJA 3GVHA 3HA3A 1Y98A 2J5XA 3D8NA 3DT8A 3KEOA 2GBPA 3QENA 4CQMD 4EZEA 2DQ4A 2GF9A 1OH5A 4ZHQF 3HGQA 1I4DD 5E6SA 4Z1OA 3FMYA 1JZQA 1ZCZA 2LVBA 3PUKA 5LCXA 2IHBA 3HZRA 3GRCA 1ZVJA 4WKBA 3WYFA 4BX8A 1X6VA 1N77A 4W5RA 1DHRA 1G0NA 1KVSA 2CNWA 3IX7A 3PJRA 2OV4A 4MV5A 5AKIA 2W6NA 4ZICA 3E9ZA 3K2BA 2AJBA 2AN1A 5HILA 3S2ZA 4YALA 2Q5LA 2PWAA 2Y05A 3JQGA 3Q9UA 2JZCA 1CY6A 4V2UA 1CHDA 3VX3A 3ZXUB 3R9XB 2C3PA 1SEPA 5FQNA 3LT4A 4MUAA 4DE8A 3FB1A 1D0SA 2LP4Y 4ZCLA 4J3NA 4P4UA 2Y2VA 2QG6A 4S35A 3IDSA 1IBKB 4IIGA 3KPWA 3HV2A 3IAM6 5E4JA 3MCUA 5DCYA 5ILQA 1ZM7A 5AHWA 4B81A 3THWB 2OXFA 1T3HA 2A0KA 2Q7OE 4F93B 2A94A 4PAMA 5AKGA 2ZROA 2D7DA 3BK1A 3QH4A 3H75A 3TW8A 1EVKA 2AG5A 4BO1A 5CW1A 2CL5A 3T06B 1S8FA 1ZGGA 5KVSA 3NO4A 4MVJD 4EX7A 5LYJB 1RZUA 1V7ZA 5A7FA 1IY1A 2P3QA 2Y76A 4HQNA 3IIMA 2FRXA 2RC6A