2PUGA

Crystal structure of the laci family member, purr, bound to dna: minor groove binding by alpha helices
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
338
structure length
338
Chain Sequence
TIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAAYFAEIIEAVEKNCFQKGYTLILGNAWNNLEKQRAYLSMMAQKRVDGLLVMCSEYPEPLLAMLEEYRHIPMVVMDWGEAKADFTDAVIDNAFEGGYMAGRYLIERGHREIGVIPGPLEQNTGAGRLAGFMKAMEEAMIKVPESWIVQGDFEPESGYRAMQQILSQPHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEVHPRLIERRSVADGPFRDYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords DNA (5'-D(*TP*AP*CP*GP*CP*AP*AP*AP*CP*GP*TP*TP*TP*GP*CP*GP*T
publication title Structure-based redesign of corepressor specificity of the Escherichia coli purine repressor by substitution of residue 190.
pubmed doi rcsb
source organism Escherichia coli
total genus 119
structure length 338
sequence length 338
ec nomenclature
pdb deposition date 1997-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00356 LacI Bacterial regulatory proteins, lacI family
A PF13377 Peripla_BP_3 Periplasmic binding protein-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2pugA01
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2pugA03
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2pugA02
5IULC 2MYPA 1FQWA 4H3HB 5I4CA 3O74A 3KXAA 3NNNA 5F64A 1QQAA 3HUUA 2PKXA 4J1WA 4QPJC 2O38A 4WWHA 5EWLB 3ROTA 5HKOA 3F6WA 4HYEA 3CLKA 2B5AA 4MR8A 3IP6A 4S04A 1K68A 2LYRA 5K98B 3IDOA 2WWVD 3OQNA 4Q7EA 3EUSA 5IUJC 5TPWA 1ZUGA 1TLFA 1NXPA 2JRLA 4LRQA 3FDFA 1JHZA 1E6KA 1GCAA 5IUKC 4YRZA 1JBEA 3H5WA 1NXWA 4XAQA 3FMYA 3QLUC 1ZVVA 2NUBA 3DGEC 1XHEA 5BRJA 3N75A 3I42A 3T38A 4Z5CA 3HJFA 4MCTA 1ZZ8A 4MR7A 3LOPA 1DC8A 4KK3A 3CKMA 3QLTA 3VNBA 3LUFA 1WETA 2RJOA 4HNSA 3M9WA 3OLYA 3SG0A 4EVSA 4F11A 3K9CA 2B1JA 4N47A 5KQLA 4KNYA 2XI8A 2WMYA 3CG0A 1QO0D 5B3JA 4PEVA 2PUCA 3GL9A 2L2QA 2OQRA 2WY2D 2R4QA 5JS2A 4F8JA 4YCSA 2KPJA 4MR9A 5IC5A 4KREA 4Z4CA 5D2CA 2E4XA 3IP9A 3RVLA 3CU5A 3I45A 3MQ4A 4O5AA 2WJWA 2Q5CA 3RQIA 3OM0A 1GT0C 4I6RA 2HQBA 1JLKA 2R48A 5TPZD 3K4HA 2IYNA 1NEQA 1TM2A 4H60A 3VNAA 1D1QA 1NATA 2ID7A 3GRCA 4RK1A 3O2JA 3LMKA 3UUGA 3HXMA 1EFAA 2PUGA 2LP4Y 3OQOA 3HDGA 3KLNA 3A0RB 1DWKA 3KZ3A 3QF3A 1AB6A 4OATA 4GQMA 3FFWA 3F6PA 1S8NA 1ZGGA 4TLLB 4Z99A 3RVNA 4YG1A 2QSJA 1JL3A 2JBAA 3O2QB 4JAVC 5IEJA 4X4EA 2FEKA 2IPMA 5KWSA 2GZUA 2PLNA 4RKRA 1Z17A 3OLZA 3C6QA 1PRUA 3CECA 4D74A 2CHEA 2KEKA 2DRIA 3HZHA 1ZZ6A 3H1GA 4L85A 4MQEA 2NT4A 3FFXA 3W9SA 4Z4GA 2LYQA 1YIOA 2FLKA 3H6GA 2D5VA 1URPA 1Z15A 4ETNA 4PU8A 1LCCA 1IC8A 1BA2A 1PUXA 2RGYA 3SY8A 4N41A 1KRWA 4KFCA 1ZY2A 1BVHA 4X4CA 5EWJA 1YK0A 1L1MA 1L5YA 6CHYA 4I6UA 1SXGA 2EF8A 2LPMA 1Z25A 2O4AA 4MQFA 4OTZA 1F4VA 4W5NA 3RVSA 1YMVA 3TB6A 2GRMA 4MS3A 5HM6A 5A7LA 4W5OA 3JTEA 4X4GA 4ML3A 3TRBA 1R8JA 1MAVA 4NV3A 3QELA 3LUDA 3RZZA 3H5IA 2KZ8A 2CD7A 4OG2A 5DKFA 2AXVA 1ZDMA 3BS3A 2JVKA 1U2QA 3KKEA 5BR1A 1M2EA 2HSGA 3IPCA 1OXBB 2H3HA 3CNBA 3OMXA 2HINA 2F8SA 5FWYA 1GLGA 2O20A 4YS6A 3KYIB 1QNLA 2QZJA 2GRLA 4Z4FA 1Z16A 4Q6WA 2M1ZA 4X4HA 4YGXB 3OO1A 5JNWA 1LBHA 2FLWA 3UK0A 4MRMA 1M5TA 4JA2A 1TJYA 1A2OA 4MCXA 2PUDA 3KYJB 5PNTA 2X7XA 2FW0A 3KS9A 4IMIB 1DBWA 3LTEA 3FGZA 2AW6A 3FFTA 3JPWA 4G0QA 2XJ3A 3O1IC 4RS3A 3QWGA 3JXCL 1UTXA 3TO5A 4FB4A 3Q41A 4RWEA 4IRXA 4Z0NA 3HCWA 3N6VA 3N8IA 4EY3A 5KQMA 2B4AA 3ROFA 3CG4A 2LYPA 5E3JA 2CWDA 5KC9A 2A6CA 3H5OA 3Q9SA 4MR8B 4F06A 4ZJPA 4KVFA 2JVIA 1DZ3A 1PEAA 3GA5A 1C0EA 4RK0A 2ICTA 5T3YA 1P6UA 3LUCA 4GHJA 2AWIA 4JCYA 3D02A 1P6QA 1YK1A 5IUNC 3LFPA 2JVJA 1EWKA 3DLHA 1FFGA 4MS4B 4UHJA 1R69A 4TMYA 5CNMA 3T95A 1LMB3 2TMYA 4G0ZA 1Z26A 2GI4A 1QP0A 3MF4A 4D6XA 2R47A 2FJRA 3RVRA 3BBLA 4RXTA 4JCXA 5DLEA 1O4XA 1Y7YA 2RDMA 3OMTA 1NXOA 1P8AA 1CEYA 1VLZA 4G0PA 4F12A 4IILA 1DBPA 4EGSA 3FYAA 1SXHA 4FBIA 2V0NA 4YLEA 4TLMB 3G7DA 3A3KA 2QU7A 3BREA 3E3MA 3OLVA 2WJAA 2LIVA 3KJXA 3IPAA 1OSLA 1QMPA 1BDHA 1Z13A 2NT3A 3OLXA 4KMRA 3ZHMA 3L6UA 1E3OC 2P9HA 2BJCA 4PZ0A 8ABPA 3GN5A 2MQKA 4RXMA 2PL1A 4ETMA 4Z58A 1UXDA 2XCJA 1CJGA 3CROL 2HJ9A 1NERA 3BILA 3O21A 3OLWA 1FFSA 2PIJA 4PU3C 1SQ8A 1DW9A 3DZDA 1RZSA 4YG7B 3RVOA 3Q15C 5B3JC 3JVIA 4KQ9A 5GOTA 3FYMA 5TQ2A 3LUGA 2FEWB 2KEIA 1KGSA 3CLCA 2WUSR 2H0AA 2IPLA 3DBIA 3GYBA 1E6MA 2PL9A 5HQJA 3GBFA 4L4UA 2O49A 1LK0A 1LLIA 1W9HA 1ISRA 2XDYA 4GNRA 4XFKA 2GWRA 1K66A 5EWLA 1IIBA 2IVBA 3B7HA 1S7EA 2E4ZA 4RU1A 5ABPA 3DNVB 3S8QA 1MB0A 1W25A 1ZHHA 3HVRA 4FN3A 1F51E 2JBAB 2M98A 3GV0A 1LJUA 2AXZA 2JK1A 4JB2A 1RZRD 1SD5A 3H6HA 2IVQA 3UKJA 4EYQA 4F3TA 1X57A 5DGCA 1HF0A 2IKSA 3MLFA 2FN8A 4XARA 3SAJA 2YHBA 3QK7A 4MQEB 3VK0A 1Y1LA 3L49A 3NNSA 1Z2DA 4EYKA 5JNRA 2IVGA 1QO0A 1KMIY 3H5TA 3G85A 4NQRA 4MLDA 3SCFA 4N76A 4IA8A 1QP4A 3GBPA 1USIA 1USKA 3LKVA 3N0WA 1DRKA 3A0UA 4OBBA 5EWMA 5FWXA 3ILYA 4FE7A 2PJUA 4DN6A 5EWJB 1ZPQA 1HEYA 3LUJA 2FMHA 2CHFA 3OQMA 3EQZA 4H3KB 1PNRA 1T34A 1ABFA 2L18A 1P2FA 4MQFB 1DG9A 2OENG 4YO7A 5TPZA 2FSPA 2IUOA 2LYSA 3QQ6A 4J1XA 3M6MD 3HS3A 4MS3B 4XXHA 4UHKA 5C5CA 5JNSA 4MPTA 4LDZA 3GBVA 1LJLA 3U3WA 2PAFA 2QR3A 4YWHA 1RPEL 2GKGA 3QELB 1OCTC 1WH6A 3N0XA 1Z12A 5T7BA 4XLTA 3L1PA 3O9XA 1KRXA 3MMNA 3QEMA 2L17A 2FMFA 1EHCA 3H1FA 3CHYA 1TMYA 4NCAA 2WB4A 2LYJA 3KCNA 2LCVA 3G5GA 1EWTA 1YMUA 3Q7TA 3F51A 4QICA 2OR1L 3O1HB 5FBKA 4JB0A 1B00A 4B09A 4ZYLA 1U2PA 4N03A 4WXMA 2JB9A 2A9RA 2QXYA 4KPYA 4MRMB 1WH8A 3DGFC 4N0PA 4EVRA 2PMCA 3IVPA 2E4VA 2F8TA 1D5WA 3HEBA 1ZS4A 4G0OA 5TQ0A 5JNTA 3FMVA 4KK4A 4LDAA 4E7OA 3HO1A 5CNKA 1DCMA 4ZMRA 5BRAA 4Z4EA 2KYRA 3IP7A 3ILHA 4TN5A 1VPWA 2VUIB 2PUBA 2EBYA 1R63A 1DBQA 1ADRA 4ZMSA 3LUKA 3UFDA 3O2SB 4G97A 3CFYA 3EAFA 3B2NA 3O1JC 5KI6A 4W5TA 1JF8A 2IPNA 4LZLA 1SXIA 3BDNA 4XASA 1LBIA 2QVGA 2VUHB 3GWGA 4WZZA 3HDVA 1FSPA 1XHFA 1ZESA 4KQCA 1A0OA 2QW1A 1POUA 2GBPA 2NZUG 4DQDA 3CZ5A 4IGAA 1VKRA 4Z5DA 2LYLA 3KLOA 2JVLA 3MYYA 4E7PA 6ABPA 4W5RA 4KRFA 5CNJA 2HQOA 5KQPA 4KZKA 1VRVA 2H8RA 4PU4C 2R25B 5CHYA 2MYNA 2GX6A 3I09A 1YS6A 2MYUA 4PU7A 1Z18A 5TPWB 3RVQA 4RK4A 1Z2EA 4YV7A 2JCGA 5C5EA 3IP5A 1ZGZA 4Z9BA 3EQ2A 2BGGA 4RSMA 2MEZA 4IMJB 4G0MA 3SQNA 1Y9QA 3SCGA 4X4DA 3NBMA 4IF4A 3HUTA 4HNRA 3RVPA 5FBHA 4MYRA 2LBPA 3LISA 1JWLA 3C3MA 3GN5B 2WIUB 2N9UA 1APBA 2LYKA 3KHTA 2FMKA 4JP1A 4MR7B 1YVUA 4G86A 4X4IA 1ZZCA 2IU7A 1ZH4A 3EDCA 2I6FA 3NNDA 4JQDA 3QX8A 4ZPJA 1A04A 1EAYA 2E4WA 3OM1A 4RK7A 2PUAA 3HK2A 4NCBA 4Q6BA 1C4WA 4P1ZA 5TQ2B 1CHNA 2FN9A 1JYEA 2AXUA 4Z4HA 2BNNA 4F8DA 4QYMA 1I3CA 4RK6A 4MS1A 2HQRA 4YP9A 3D8UA 3S99A 3F52A 3EGCA 3JPYA 4MR9B 3QLVA 1L5ZA 5KQGA 1PRAA 3OMWA 1DJMA 4MGEA 1JFSA 1NXVA 1OXKB 3CZCA 4RY0A 3EJWA 4N0QA 9ABPA 2VYCA 4MAAA 4PICA 5JNUA 4Z4IA 1ZH2A 1EWVA 4JASB 2AYXA 2E4YA 5TQJA 3HV2A 2FQYA 4YG4A 3O75A 5KC8A 1GUDA 2A9QA 1QQBA 4MS4A 1M2FA 3TX6A 2A9OA 1ZITA 1JYFA 3BRQA 4RY9A 4RZSA 2FTKE 1PRVA 4Z9AA 4NICA 1LQCA 1DCKA 1DRJA 3EULA 3M9XA 1PERL 1M5UA 3E61A 3QLUA 3TMYA 2QV0A 1ZZ9A 5EWMB 5FWXB 3OP9A 2MYTA 2FXIA 3GT7A 3LUHA 3H5VA 1MIHA 1YS7A 3G1WA 3Q7SA 3I5AA 4CBVA 3A10A 7ABPA 1PHRA 3T8YA 3MA0A 1D1PA 3HM9A 2FMIA 5ED4A 4FE4A 3CTPA 1PEYA 2IDMA 2PE5A 1RPJA 1U0SY 3QLVC 2ICPA 4LX8A 5IX8A 4I6TA 3TD9A 3URMA 1RXIA 3C97A 3D1NI 1X2LA 3SCHA 1MVOA 4WXEA 1DP4A 2MSLA 4YARA 5GQSA 4RK5A 4G0XA 1J56A 4RXUA 1RNLA 1ZZBA 2IV1A 1JFTA 1AB5A 2E4UA 2L8NA 2MSKA 5BQ3A 2ZWMA 4RY8A 2R63A 3QEMB 4RKQA 4OB4A 1YTUA 2YHAA 4O1IA 1JFVA 2XSDC 1RZRA 1QKKA 2P4UA 5HSGA 4W5QA 1GUBA 4EVQA 2PUEA 4WT7A 3C3WA 3C3KA 4PYRA 4OLAA 5IEBA 1FFWA 4D6YA 5DTEA 3SNKA 1JDPA 2CROA 2IPAB 1U8TA 3MM4A 4IVZA 3P9YA 3QX9A 4Z5HA 3JS5A 4JOQA 3KG2A 2PPXA 4Y9TA 4S05A 1JX6A 2XIUA 5DCLA 1ABEA 1CYEA 2BNOA 3JXBC 5FWYB 3RVMA 3JVDA 4YBAA 3LFTA 1H9CA 4LE0A 1DC7A 2FQWA 1SRRA 1QP7A 2FEPA 4MLCA 2KEJA 3BD1A 3F73A 2FKAA 3BRSA 3EODA 4OLBA 3QEKA 1WIZA 3LKBA 4Y42A 1RXEA 5JNVA 1XWRA 4EUKA 3R1FA 3ZHIA 2FQXA 4O8BA 4I8TA 2WRZA 4LE2A 2FVYA 1BDIA 2ID9A 1ZZ7A 1PNTA 4HNQA 3JXDL 1GCGA 3KTOA 1BAPA 4EYGA 1XWWA 2CSFA 4P98A 3SM9A 3Q7RA 4EYOA 1D4ZA 3NHMA 2AYZA 3CS3A 1NY5A 1B0NA 3H75A 5TQ0B 1LCDA 4IWRA 3HSYA 2AUWA 4X4BA 3MIZA 3RVJA 5JS1A 1NXTA 3HZIB 2LUOA 3KSMA 3PXPA 3T6KA 1ZAYA 3OO0A 3N0RA 2RJNA 4NDWA 1CQTA 1JH9A 1NXSA 2A9PA 4G0YA 4WUTA 5CNIA 1UDRA 2J48A 4GPAA 2HPHA 3H5LA 3CRNA 1DCFA 2OFYA 1NTRA 4QYWA 3F6CA 1U04A 1JDNA 3R0JA 2R1JL 2W42A 1E2BA 1USGA 3F7NA 4RV5A 2ZAYA 3DLBA 4X4FA 1RIOA 1AU7A 4PE5B 2BNMA 1ISSA 3H1EA 1BDJA 2EWTA 3N53A 5IBQA 1YSEA 3LUAA 4RDCA 3RH0A 2PUFA 4YR7A 4Z59A 4O1HA 4MS1B 3ZKCA 2NZVG 1TVMA 2QVCA 4ETIA 1E6LA 2L19A 1NXXA 3JY6A 1QPZA 3RVKA 2VK2A 1MB3A 4KV7A 2L49A 3QYXA 1D2AA 4M88A 4LE1A 1ZN2A 2IOYA 3NHZA 4DADA 2MSWA 5TE9A 1UXCA
chains in the Genus database with same CATH superfamily
4XDHA 5IULC 2Q2WA 2PCJA 5AM0A 4ZK6A 3PVZA 3GCWA 1F3LA 2GRUA 3AILA 3O74A 3C4QA 2IXEA 3REGA 1RQRA 3AEUA 3B7WA 3KALA 2C9ZA 3HYSA 4U3JA 5F5XA 4AKSA 3UAVA 5HKOA 1ZR2A 4R2XA 3ETDA 3CH4B 3WAKA 4C7OB 4MR8A 1P18A 1K68A 5K98B 1RRVA 3HNOA 1EB9A 3LLCA 4ZARA 4WBNB 1XVVA 3GDGA 2PXVA 3EUSA 4CKXA 3A6FA 1U8FO 2SNIE 1TLFA 4C14A 1PJ8A 1GNPA 3CEPB 3TCKA 1I7LA 2RC5A 4BQOA 5LL6P 3KYDA 3R8XA 1SM4A 2GHRA 1CIJA 3KJFA 2FFBA 2XKAA 4Q9JA 1GZDA 2FZWA 4O4IA 4EB3A 4HH4A 4P7FA 1TAQA 3HJFA 1Q19A 5FUMA 4UNPA 4ZIRB 2PRJA 3KTFA 4WOKA 4X20A 4CM1A 2CMDA 3LP5A 3CX4A 4LRXA 1SUSA 4CMGA 1UKVY 3M9WA 1TCBA 2O3JA 4J03A 5DK6A 1G21A 1SCBA 3L6DA 1M6VA 3G5AA 1EFPA 1XVUA 1UOPA 3LVQE 2OXTA 4K40A 3RYCA 5KNDD 4X1YA 4RUKA 5LFAA 4X3OA 1MC8A 1DOZA 2HCRA 2PANA 1Q16A 5F4BA 1P5FA 1XZGA 3RSQA 3GDWA 4LWQA 2CV1A 1TKCA 4NFLA 1D3AA 4ZTZB 5ANRB 1KI6A 3UMMA 3NBQA 2JJ2D 2IYXA 4K2AA 1J2JA 3KQLA 4NXNB 5FUWA 1E62A 1ZW6A 3SFZA 3K8ZA 1K4YA 1RYFA 5CVVA 2XVZA 5AI8A 1P72A 4X62B 2PL5A 3MRSA 4R3WA 1XNQB 4IDAA 3DL2A 1ZWLA 1XDDA 3PJRA 1CDEA 3BIXA 1MJHA 3I61A 4LWPA 2H7XA 4W5NA 3HBLA 4DGQA 1JGTA 1CNFA 2JFHA 4RJKA 3RVNA 1JL3A 4AFNA 1HLGA 2FEKA 3X1WA 4N0DA 3JZIA 3PNKA 4OK3A 5ARDA 3Q98A 4UMFA 3R7WB 3TTWA 5I7VA 3SQWA 3JZFA 1IHYA 3QE0A 3E9YA 4PZDA 1GG8A 3HZHA 3RSSA 1ZZ6A 4A6XA 2NP7A 4Z4GA 2LYQA 1YIOA 3V4SA 2IITA 5FFNA 4ISCA 3K70C 3UHFA 1A82A 3TG2A 5DIZA 2NU9B 3TL3A 4K6HA 1S8AA 2P4EA 2W6CX 1Q0SA 1O6BA 1V1MB 2BBOA 2WAOA 2IXTA 4UAGA 2Y27A 3ZBQA 2EBUA 2PO7A 4N01A 4CM6A 4CMIA 3GEHA 4PONA 3L5OA 2OBBA 1YB2A 3QIVA 4I1SA 4CM8A 1ODTC 1A9YA 4J91A 5A7LA 4WKGA 3A9VA 4E2WA 5JCOC 2E5FA 4YMTA 1T26A 2GJKA 1MAVA 3MYRA 2JANA 2QUBA 3BA6A 2A1TS 5SY9A 1QV7A 3LL4A 4QXRA 2Z3ZA 4TRRA 1TKBA 1J7JA 1I6WA 1Q7GA 1C3JA 1FU7A 2NTVA 3HGQA 5U9CA 2NSHA 2ZI5A 2XSZD 3IPCA 2BFCA 3OH8A 3OMXA 3TDKA 4EPWA 1V0JA 3KLMX 3VTAA 4F46A 1BW9A 1CUIA 4JX9A 3LIPA 3P2KA 3A8TA 4RX1A 3FJYA 5EGSA 5H3CA 5JDCC 4BLOA 4EECA 3IL2A 1M2OB 1AQYA 5GADl 1JEYB 3A3PA 3IUYA 3OU7A 4WN9A 2QD3A 5KNCA 3AJRA 3K96A 1P31A 4XH9B 1KJJA 1V9SA 2X7XA 2YTZA 3KB6A 3MMSA 3PC6A 3KLPX 5EE1A 3JPWA 3HM2A 3FFTA 4M76B 3GAZA 4XIFA 2WM2A 3R3UA 4CDNA 2XE7A 3BXOA 1T6XA 1UTXA 2BFEA 2V7XA 3M5WA 1QPBA 3MCVA 3L7IA 1FXUA 1W93A 3NT5A 5DU2A 5DWVA 4CQNA 2JFWA 3VV2A 2YN0A 4WZAA 3QVUA 1CXZA 4LXIA 3B20A 4GP9A 4KFRA 3DAFA 3ZD6A 1MGOA 4HQ6A 4JB8A 4YMLA 4L8WB 4UTRA 1SBHA 3HH8A 3BG5A 2PXPA 3ZX4A 1R6AA 4PPFA 1Y1QA 1P6UA 1Z0ZA 2IX3A 5J2UB 2V4ZA 3KJHA 4HLNA 3SHTA 1VKJA 1OE0A 1YNSA 2I1WA 2XUIA 2C07A 4O0MA 4YRNA 4HDAA 4L22A 1JIJA 1XN4A 2QXUA 3M82A 1W8IA 4ZI2A 3OX3A 4D5GA 2CL0X 3R3WA 3JQGB 1YJBA 3SYLA 1DFIA 4F92B 1YOBA 2X40A 1XZIA 4LJ6A 1B26A 4EGAA 2Q3MA 3WGZA 1EAMA 4D97A 4GZ5A 1RHQA 3L0OA 4X7MA 3F74A 1YDEA 2P3OA 2C99A 2BL4A 1KKUA 2GEDA 2R97A 1RZ3A 3PHIA 2FOLA 1QMPA 4R9NA 3TBFA 3FOWA 4RORA 2P9HA 2BJCA 3MMXA 4CLRB 1N1EA 2CF6A 2X0FA 4XGRA 3C85A 2O2SA 3BD7A 2GPBA 3MLBA 3SFVA 2G9UA 1DBVO 1U0BB 4DMLA 2RH4A 1NX9A 3IUSA 2FPUA 4WL0A 5BSTA 4JBLA 1XCOA 3THWB 2WTXA 3BQMB 1CF2O 2FK8A 3O3CA 5BSMA 4MVWA 4XIGS 3WGTA 1PWHA 1U0GA 3RK1A 4KQ9A 1C9DB 4LHYA 1J07A 2B8WA 2PX0A 3ZZNA 1H05A 3ECCA 3FHJA 2C84A 2VYQA 4R7TA 4NY1A 4JBYA 4GBED 4HJXA 1KO1A 3ML1A 4TSFD 2HT6A 1N9KA 2VBGA 4BMDA 3CVXA 3QLEA 1R9GA 3A2LA 2EV9A 1Y5IA 2JBAB 3BWXA 5A2QA 2EOAA 4ZHSA 2P4HX 3DMHA 3H6HA 3KB8A 3LVBA 3TZ6A 4FWBA 2DUNA 2KPOA 2P8SA 2VPZA 2NN3C 2R7KA 4JUBA 2C7GA 3HN6A 1R8SA 4MKRA 4QUDA 3WZMA 3L93A 3UAWA 4A73A 4N5IX 1WBJB 5EIEA 2DETA 2PZFA 1MAUA 2BBWA 3NI2A 4J07A 3FZQA 3X1XA 2Q9UA 2NNWB 1NW4A 1Z0UA 2VF8A 2J0UA 5DTJA 5AXBA 3ZLUA 4BZWA 3A4NA 1RIIA 2D1RA 5EWMA 1IU9A 4OBBA 3A0UA 1Y4DE 4ZI3A 1WSDA 5DIFA 4ZAGA 3C3DA 1DPFA 4QNMA 5JVDB 3QBEA 1GZ3A 3R9KA 2A0XA 4D25A 2PIAA 3A1WA 1L5KA 3WWPA 2FB9A 4BP9A 4CHGA 5TPZA 3SZLA 2EBHX 3VU0A 2OXFA 3MD0A 1DRUA 4AK9A 5BVGB 1GGMA 3MWLA 3V48A 4XTCS 1L4BA 2VWQA 4QFBA 1I4EB 2HMVA 2HMAA 2ZDGA 2DT5A 5DYGA 3A1UA 2JAHA 4ATNA 1L7DA 1IOVA 3HHEA 1QWSA 2IDJA 1ACMA 2OESA 4PHTA 1YKSA 2B35A 2EJVA 2XHEA 5I4KA 4GL4A 3BDIA 4RZXA 4LX0A 4WZ6A 2IU6A 3MMNA 3AF1A 4YMWA 4A1FA 4CF3A 2ZVQX 3HEAA 5IPFA 1ZXBA 2LYJA 2FUKA 1Z5OA 2GN0A 2GZ3A 3EISA 4ZREA 3OQVA 5FQNA 5HCNA 4YUYA 5CVJA 4B4WA 4ID3A 1L4EA 1ISIA 2R8OA 3RRNA 5KTKA 1MC4A 3G5MA 5L8VA 1E1QA 3T5GA 4AQ7A 1L5QA 2D0PB 2IYYA 5CH5A 5BR7A 4BQFA 1QCYA 4BNDB 5TQ0A 1L4HA 3IUQA 4MIEA 3ORQA 4B82A 3TW0A 1PYGA 3IIKA 3TZCA 2CN1A 2Q7XA 1U5BB 4QRIA 4C7BA 4Y9RA 4TXJA 2XKJE 4NR0A 1A72A 3NVMB 2P2SA 1WXEA 4K1XA 1F5NA 1HDZA 1XL1A 1JDJA 1JDZA 4Y8VA 1ZR4A 3P26A 3AF6A 4HVAA 4F4HA 2VJNA 1F48A 3DC7A 5JAUA 1B74A 3EAFA 4ILKA 5D3MB 4C0SA 1J7KA 1OYVA 4RTMA 2P9QA 1HDXA 2C5HA 4OREX 2XAAA 4MW5A 3GLIE 4MA4A 5JQGA 3TW6A 1GRQA 3ACCA 3JD4A 4NEGA 2ZUEA 3R0VA 4ZVVA 1TUBB 3ZBPA 2WEKA 3CZ5A 2QZZA 3SLRA 3C0KA 3MTEA 4WVFA 4XM0A 2AG5A 3SKXA 4M37A 3A3NA 2DMRA 1M1YA 5CHYA 2J32A 4ZPXA 5CB4A 3DZJA 1G4UR 2HCJB 5LCXA 2VF4X 4IYRA 1Z18A 2CVQA 1GA4A 1T8UA 3K92A 4DNPA 3HB0A 4B31A 4FGJA 4M7RA 3M4JA 2VP0A 1AC5A 4F4UA 3RSHA 3G0GA 5DX1A 1OBFO 4PGGA 2W2MA 5FBHA 2QROA 3AWDA 2B0JA 4TTQA 2C61A 1EGVB 1HFEL 3SBDA 1VP3A 1JU9A 3P27A 1YHNA 5B12A 3K9HA 2GBLA 1Y3CE 1Y1SA 2R1UA 4MR7B 3UV7A 1HNNA 1FDVA 1ZH4A 2IU7A 3EDCA 5JAPA 3PX2A 2RIPA 4KRFA 3KR2A 1OX4A 4Z1MA 4TMFA 3RI3A 5HKKD 4PPGA 2JGLA 2HLPA 2JGDB 4I3GA 4YCJA 1RWVA 5GONA 5C18A 3VH2A 1DAEA 2W2KB 2EZ9A 2FP4B 3GEPA 1KDYA 1JFLA 4NZ9A 4Z4HA 2PWYA 3O8QA 5IXJA 1F1BA 4R1QA 5CIQA 4P0QB 4INJA 2NO9A 2J9XB 1NMYA 4LNUB 3UTCA 3KQHA 3HWRA 4ZQEA 3ED1A 3IX7A 1OXKB 3CUUA 2OOKA 4KQJA 5HRCA 4RF4A 4BO8A 1U9CA 4PICA 3KWJA 4TS1A 2HEIA 4AX4A 2I1QA 3D5TA 1THMA 4D92A 1DAGA 1QHSA 2CLOB 1H2EA 4DLXA 3PGA1 5B1SA 4DLKA 2FPGB 4CQMB 1QS0A 1YONA 3EXAA 3A6PC 2BR3A 4MDYA 1BKDR 4W63A 1UKAA 5EMNA 1QOPB 2CXNA 1PRVA 3I8XA 1WBBA 2QGZA 3AQIA 3OT1A 2I65A 4HB3A 4P83A 1S2GA 4UJ3A 2D1SA 4HEQA 1P19A 1V9LA 2PPLA 4FDLA 3CPJB 1AUPA 2FE4A 3DHEA 2HDWA 3GT7A 5EJ6A 1H4TA 2C2YA 1MIHA 2DKNA 4ZQCB 3TW4A 2FWRA 4L76A 5HX7A 3TNJA 2RG7A 5CPFA 2UXBB 1JDTA 1K63A 2JJ1D 1YCFA 2VTKA 2MJLA 5DM4A 3K8QA 2Z3WA 1EVIA 2NG1A 4DG9A 3ANTA 4JYAB 2IDMA 1H8EA 5HMMA 3AKCA 1CB0A 1U98A 2O1SA 2YASA 1XK6A 2C96A 3IUEA 2O8DB 1VDZA 3PTZA 2HUPA 3DTNA 2FDCA 3K5HA 1JQ3A 2Q5QA 2EFJA 1OLSB 2NXWA 3CUTA 1O5TA 3PC8C 4WNYA 5LYJF 2ATXA 1REQB 2GZMA 3KWLA 2JF0A 4RKQA 5KX5B 1JFVA 1OY1A 2AG1A 2PSSA 3KKPA 4I55F 4KPUB 4JBGA 4R9VA 1CD5A 1FRVA 3IPXA 4IVPA 4IQ4A 3BKWA 5CUQA 1Y8AA 3DWIA 4ON9A 1EUZA 1JIXA 1E18A 1MX9A 2HM7A 4N8SA 3C14C 3FRJA 3O4FA 2IZ7A 3F2IA 4TKVA 3SBOA 3DVLA 2ATEA 2RI1A 4S1WA 1TF7A 2C3OA 4C4PA 4FSDA 1CR4A 1Q0PA 1KF0A 1WAMA 3GAMA 2I80A 3C3PA 4X41A 4ZAWA 2O54A 4EBBA 3WS7A 4OBWA 1IY9A 1KMHA 2DFNA 1H9CA 1HNZB 5A2GA 3GLGB 2QNBA 1UAGA 2NQ2C 3GI1A 3WLMA 2XXJA 3Q5DA 3A9YA 5TB5A 2AQ8A 3JD0A 4FB5A 2VPWA 1QZUA 3BD1A 2CNOA 4TTRA 3T7CA 2G3YA 3VO2A 3ZS8A 4BBJA 4EABA 5JZOA 4PX2A 3FMGA 1BS2A 1JAXA 4ZV4A 1Q22A 3DR3A 4I81A 3H84A 5FEUA 1ADGA 1IZ7A 3CX8A 4WUVA 3AEQA 4ZT2A 3KPJA 4AZ3B 2E5WA 2FVYA 3M0EA 1IUPA 3N74A 1ZZ7A 1Q1GA 2FX5A 4XWTA 4R1SA 3ERCA 5BWNA 2B2NA 2OQ2A 3WGGA 5BN3B 1COZA 1OX6A 1VQ1A 2ZJAA 3Q7RA 4JL5A 1TYAE 2JAWA 5E4TA 3SEZA 3TRDA 1BOOA 1MW9X 1U8CB 2Z5FA 3IQFA 4Y1FA 5A9RA 3OUTA 1TM4E 4XJSA 3KQQA 5FXMA 1NW3A 2QTTA 2ZIVB 3EGDA 4HNAB 1JIQA 2GM5A 5LKRA 4MWEA 4Z3KA 4NDWA 3IIJA 3TFLA 1OH5A 2ZIXA 3IMCA 1XVLA 1A5TA 4CFYA 1O6GA 1P9RA 4CLOA 5DT9A 4YAUA 1H69A 1ZD3A 3TK1A 1QG4A 1XLTC 4NBTA 4TTTS 2QLBA 4PM4A 2BN4A 3A7EA 5EYPB 4AO6A 1PE0A 1T24A 2V3WA 4CKWB 4OFZA 1EP1B 2BONA 2GDZA 5HDBB 5TNXA 1C9KA 2BNMA 1QONA 1SUIA 3KQPA 1RACA 1ZOIA 2BAGA 3BTSA 2X3UA 4Z59A 2AJBA 1HLPA 2DX7A 1DQRA 2NZVG 4MVJI 1OWOA 3Q3IA 2OEPA 2O23A 3GLHA 1RD4A 4JC8A 4XVRA 5K4HA 1DC5A 4DM4A 1S9HA 2QOEA 4FZJA 2J3DA 2VP2A 1L5HA 4TWRA 2ODAA 4P82A 3VVMA 4Q66C 4RVSA 4TGLA 5LUAA 1NW7A 3Q72A 1A27A 4HBGA 3QU2A 3ZWVA 4DADA 2C4VA 1KAEA 5B2EA 1VTKA 4L8GA 4O4JF 3VNUA 4FXPA 4H3HB 5K4GA 4FYJA 1GAJA 4AECA 2FK7A 3W5SA 1GAEO 5TJHA 1ZIOA 2IT1A 2B4RO 3B6MA 4RF3A 2B3DA 3RC8A 2B5AA 1EFRD 4NEQA 3AX6A 3W8EA 3M6UA 3GJ3A 2R8RA 1NE7A 3D4OA 4YECA 1C2YA 3U48A 4B71A 2IH5A 1AMNA 2FFAA 3BGWA 3UCEA 1HDIA 4PZZA 3PDWA 4XGNA 3SSAA 1B1CA 4RTSA 1QX4A 1GSOA 3CEHA 2OY0A 1V2GA 4XAQA 2BISA 4K9KA 4F84A 1VGRA 5FNZA 3V7NA 3KKOA 3NVKI 3O8BA 1Y3DE 2VJAA 3ER8A 1KEUA 4KQMA 1K97A 3ISVA 5DN6D 2IWHA 1PKEA 2QR2A 2K2QB 4Z0PA 4M1SA 2NPOA 3FLBA 4EI7A 3LUFA 3E9NA 1GO2A 5I9MA 1EEXB 4GMGA 1T0PA 2UVPA 4MCIA 1E1CA 4MWCA 3T3PB 1S02A 1SBYA 1Y5NA 4RNDB 3HU1A 4KAFA 4ODIA 5LC1A 4BEVA 1US8A 2Q0SA 5KQLA 3LK6A 4UAJA 4QUKA 2A5GA 3ZYCA 4IFEA 2XMSA 3BULA 4YQFA 1DKOA 1Z6GA 3CH5A 3DVRX 1P2BA 1VFNA 2H57A 1E61A 3M6AA 5KNCH 1I3OA 4HNVA 5CXUA 1NULA 1SBTA 2CNKA 1A97A 1OHHA 4HK4A 4MUJA 1FTYA 4U5QA 3PHLA 1N3IA 2GASA 4E09A 2Q0QA 1W4AA 1TD1A 3CUVA 1U90A 1NLYA 1T43A 1UMBA 4LDPA 1ZK2A 2C4UA 2GETA 2ID7A 4Q9KA 3U3RA 4CLXA 1JMYA 3TLXA 4E4RA 4F3YA 3G88A 3HLYA 4QSHA 4B48A 3NGLA 4HRXA 3GIWA 3OD1A 3KZ3A 4P5DA 1NI4A 1ZGGA 4E03A 1U0TA 5EGNA 4DARA 4DB4A 3G1TA 4F96A 5AKLA 2CLEB 4B2PA 1QH1B 1U28C 3N3BC 4KBYA 5FO1A 2HNAA 5FUBA 4HNTA 5JS6A 3HXKA 5AESA 2ZE8A 1X77A 2ZJ6A 3DDUA 1OYYA 1II8A 2ETVA 1HTWA 1NN1A 1CR6A 3CPEA 2FLKA 2O6LA 3CCFA 3EPRA 3T52A 3FYUA 3B8EA 3QEOA 3IUJA 4YQZA 5JC1A 4GPBA 1IC8A 4Q00A 1ZJ6A 5LJIA 3I9JA 5U4QA 4YPFA 1IXRC 2AVNA 3PGXA 4GLOA 4RPKA 2ZIFA 4DTIA 1Y1TA 4JYBA 2O4AA 2HFZA 4YJGA 1FEZA 2NXNA 5K51A 4DREA 2ERCA 4NVRA 4D5EA 4LFAB 5LXTF 3AUJB 4UBMA 4NDZA 3PQCA 4FFVA 4J4HA 3ZPXA 2IZZA 3L7KA 5FL7D 1T4CA 1ZXLA 2BMVA 2PKQP 2Y9PB 3MFYA 3N07A 4ER3A 1LPBB 2KZ8A 4FFMA 1G3MA 4KKVA 4NZOA 3RT9A 4UFNA 4ZQIA 5DX0A 1CDZA 4QLBA 3W1VA 3B13B 1W30A 2H3HA 4HDRB 3HA5A 4KXWA 3FKJA 4MW0A 4K28A 4WKNA 3ZWPA 1CQPA 5EMKA 4OXKA 3EZ7A 4RQTA 2EKPA 3V6MA 4X4HA 4E5NA 5JNWA 3BM5A 1RMYA 2HTEA 4NZNA 5DZSA 5HWSA 1Z4IA 2AVDA 2I5PO 3F47A 1QU2A 2W2LA 4Q5IA 3WKBA 1GGJA 1VBFA 1RFLA 4GOLD 3SXUA 3LPMA 1GZ4A 4Z2YA 3UZUA 1CQIB 3T5MA 3O1IC 3O8DA 5DT2A 3AJEA 2XB2A 4EY5A 2O8EA 2FHSA 4WEQA 3M2PA 1X7DA 4TZ0A 4Q9DA 3SF8A 1JB9A 2B4YA 2P67A 3NGMA 1JZSA 3CG4A 3LT0A 3QHQA 1QB8A 4KXUA 1YUNA 2CFCA 3N9IA 3G2IA 1DKUA 4H3SA 4IO1A 5NLLA 3QTLA 3P9KA 3WGLA 4S12A 1G2PA 5F1PA 1NBIA 1AKMA 4RK0A 3WWDA 3ZHZA 3AKZA 4G24A 3FBGA 1OJ7A 3ANNA 1SBIA 3W77A 2N1BA 4WPGA 2DY1A 2J6HA 3UA4A 4BZQA 4RVUA 2VQDA 5K8UA 5HM8A 4BAUA 2OMEA 1NI5A 1LI7A 1R4MB 2JDID 1O9BA 1UJMA 1HLDA 2YW9A 4TTAA 1M7BA 3MTGA 5CYPA 5IN4A 2C83A 1BX3A 4G0PA 2G0AA 4GOJA 3WMRA 4MQMA 3VHXB 2EWMA 3FWPA 4YLEA 3ELDA 3JYLA 2Q1TA 5I47A 4D8YA 1ZW1A 2Q9AA 1B3RA 1P91A 4RHXA 5DXJA 4GEGA 3VH3A 3ZDEA 3ZI7A 1SCAA 1RAAA 4G8CA 4ARCA 1O7JA 1Z5NA 3T9EA 1PZNA 1DRWA 3BMNB 1RMQA 2BEUB 1V4VA 4B3FX 3GN5A 3WICA 2A88A 3P2EA 3NHJA 4N49A 3VOTA 2XKKA 2EFHB 4Z58A 2XCJA 3OLWA 1HT1E 3DM9B 4LYEA 2R79A 5GJWC 5DNUA 3NM6B 4AKHA 3LFUA 4FGSA 1VGVA 2WW8A 4E30A 1W0JA 3T4EA 5C8XA 4LISA 2QI9F 2C59A 3LZCA 4QC2A 2AMVA 2GEUA 4OMCA 2HCNA 3FNIA 4JMLA 4J94A 3W4JA 3OJ0A 4M21A 2WUSR 5D5QA 4NCHA 1OB5A 1O77A 4L4UA 1XKQA 3F3SA 4WLNA 3SNHA 2HMSA 3UCXA 2VAMA 2OFPA 3GRFA 4OLHA 5F77A 5J4HA 4PU0A 4JH0A 1OLUB 3IDFA 2G9VA 3QKIA 2FEAA 3FH0A 1IMOA 1WNTA 3Q6IA 4DEVA 1VPDA 1NOKA 3QPAA 4H35A 3QW4B 1FVXA 1SA0B 2GTIA 1WD7A 3MEQA 3NDIA 4OHCA 4BWGA 3K5WA 1MIOA 3K2IA 10MHA 1H9AA 2FN8A 2P0AA 2RHGB 3CO0S 4X3CA 4XE5A 4CQLB 3EGVA 4DGSA 2UYGA 3ZG6A 4BQSA 3UHAA 2VZEA 3SYKA 2HJWA 1ENYA 5GGXA 1XL0A 3IQZA 3NBZC 2GMWA 4J0KA 1KMIY 1KEKA 4C7JA 5IWAB 4RQUA 1YA6A 4FFPA 3MAJA 4ND8B 3ZDRA 2PZKA 4P4SA 4IA8A 1DT3A 1V8OA 3DTVA 1S96A 2FPOA 1R16A 2ZWOA 3P9NA 4NMLA 5KDLA 4QNNA 3TAXA 5JJ5A 2ZK7A 5JATA 3TRHA 5EHZA 3IH5A 5LMZA 2EP8A 1SUAA 2X0EA 1P2FA 1RVV1 1QHEA 4LYYA 2IV2X 2Y1LA 3KZNA 2VHVA 3HJGA 3MRTA 2QJOA 3HS3A 4QIHA 3NUZA 2PV0A 1GUZA 4MPTA 4MUGA 4LDZA 1CHDA 1GQFA 1LJLA 4CCWA 3I1IA 4CMHA 2PGJA 4RJLA 3DAOA 3GUHA 3PRJA 3O9XA 2CB0A 1ZL2A 5D7NA 4MYSA 5JZ9A 4Z2AA 2YQ4A 1WDTA 4GXNA 1W36B 1V1RA 4IHJB 2VYNA 4YJ3A 4DXHA 1X2EA 1PJ3A 2D1TA 4OHBA 3E9DA 4QQRA 5M34A 2FFRA 2HL6A 2C3PA 4I5GA 4N0PA 4Q05A 1XXHE 3T3GA 3TQFA 4MGHA 5BPFA 3FMVA 1XRLA 2ZTLA 3RTAA 3VVLA 4ZMRA 1QGED 1UM8A 1Q6YA 4JQSA 5TQVA 4S1TA 2A78A 5FBZA 1VMKA 3CKKA 2HO5A 4KN6A 4ZEVA 1Z8FA 2CSXA 2X1MA 2CK3A 2IEBA 3KOYA 2PXKA 3EIHA 4X54A 3BHMA 1ABBA 1YBMA 4RVNA 4IJWA 4ZCPA 2GR9A 4HAIA 4ZVSA 2NQTA 4AY2A 1I2AA 3AR7A 2HF8A 1D1SA 1D2MA 1Z6AA 2DFKB 4ND6A 2ZBPA 4B4UA 3I9LA 4MA0A 5AOAA 4ZYTA 3JW8A 1KIAA 2PM8A 3GGGA 1CJVC 1Z73A 3V6LA 1C0PA 2DECA 2VUHB 1V5GA 1I94B 4YUXA 2QW1A 4P35A 1GZ6A 1YS4A 4FZ5A 1YJ8A 1UEJA 2X8WA 4P33A 3RFXA 2WWYA 3FTPA 2IEDA 4MGZR 3HP4A 2YWDA 1BVRA 1FIUA 3UMSA 4PLVA 4OA8A 5TSDA 3KZXA 5JYEA 1T9BA 1DC6A 3HYNA 3BYZA 2BM0A 3O4GA 5BN1A 1PX0A 1W34A 3K09C 1DKNA 3SVLA 1B16A 3Q3GE 1QG6A 3F3YA 1F12A 4YV7A 4C0LA 1DXYA 3MGBA 5DW3A 3ORHA 5ER6A 4GP7A 5C5EA 2HNBA 2WM8A 3KFXA 5LBIA 5H02A 3TOCA 3KYDB 3RVPA 4YRQA 3HUTA 2NSYA 2OZLB 3B82A 5JSZB 4NFSA 2P8JA 4O0LA 4PLYA 2GBLC 2OLKA 2I4NA 3T4PA 4YRGA 2CJYA 2QUIA 3SE0A 2O0LA 2QY6A 3RUFA 4CETA 3KBOA 1L7QA 1IK4A 1Q1ZA 2G5TA 1ZZCA 2HV9A 3HB1A 2P90A 2OCXA 1U6KA 3RYHB 3BXZA 1TA4A 4X8LA 1C4WA 2ZG6A 2ZBDA 5A5DA 5BV1A 2R8YA 5C1OA 3VR3A 2H4ZA 4IYJA 4Q16A 3RS4A 4XB6B 4OU4A 1P0MA 3D8UA 1QSGA 4TMXA 2DSNA 1CQWA 2XLBA 4JUAA 3GGPA 2WHXA 1N4AA 4QL3A 3ZU2A 5JMOA 5ILOA 3KKZA 4FDUA 1PF7E 4KAXA 1KI6B 3AY3A 5JNUA 4Z4IA 3OA2A 3BJRA 3WGYA 3FOAA 4BIIA 3FCOA 2EQAA 4XTRA 2ZRPA 4IKOA 4BB6A 4YG4A 1EHYA 2X9LA 2PZJA 4UKDA 1ZITA 4BNXA 1IXSB 3V4PB 1PR2A 4I6GA 4IVNA 1CW2B 1M34B 4I1VA 5BMVA 1D2CA 4LMAA 4NICA 2H65A 1Z3IX 2J7PA 3R6DA 4P4LA 2AEJA 4HUTA 1SKMA 4RABA 1V41E 2XNCA 3RTDA 5H0IA 3SJCA 3K70D 2Z43A 3BHNA 2X22A 1IH8A 3WWEA 4U8HA 3GJ4A 1W2GA 1Z8NA 3I5MA 1QGDA 4JBNA 1JHYA 4FDAA 1YZGA 4NPHA 3VZRA 1HYQA 4NZZA 1Z6TA 3GAAA 3GX1A 4MCJA 5CLFA 1J6UA 3T3HA 1P9LA 3T54A 3HM9A 5ITWA 2EFCB 2G04A 1L7NA 4J1TA 1G3RA 1JIUA 2JBWA 3W5IA 1EX9A 4MLPA 4WLFA 3WMGA 1CSEE 1NT4A 4C1BA 1GPLA 2MSLA 4XQGA 1R1DA 4LDQA 3I28A 4HXEB 2I03A 4KH1A 1E8NA 1ESZA 1L1QA 2R63A 1VMIA 3F9RA 2HK6A 1AUVA 4R0VA 2WYUA 3S2YA 3L8YA 3LOUA 1ZIXA 3L40A 2W2QA 1XUOA 1TF5A 5REQB 3E22B 4EMTA 3PKIA 4DMHA 1FY2A 1NL3A 2QMEA 5IAJA 5B4VA 3R3ZA 1D6NA 1FFWA 3OQIB 3CH7A 3QHAA 4IUYA 5E9WA 4UVIA 2P78A 2AFVA 1B6TA 1R0LA 2JLCA 3G68A 1DMSA 2BFCB 1BHJA 3RVMA 5ALKA 3WLAA 1T3HA 5EY5B 1HPLA 2XTZA 4OEHA 5SYNA 2Y76A 4EI9A 1JBQA 1F2TA 4G4JA 1SRRA 4UNRA 4GPIB 3GT3A 2FWPA 4WN9B 2FEPA 4MLCA 3VR2A 4OLBA 4MCHA 1F0YA 3EARA 2I67A 3HPRA 3T7DA 4RVOA 1YWGO 4QAJA 3WIEA 1DKQA 4MGKR 4Q82A 3REFA 4O8BA 1KK0A 2CMFA 2BFEB 5BOSB 2ZSBA 1DAMA 3OSUA 3HB9A 4NRDA 4BTVA 1PJCA 2AR9A 1IZZA 4FEGA 5EP4A 1O2DA 1G5QA 5L3SB 4NATA 4WZAB 5F7ZA 4MVJG 2VPTA 3SOZA 4PG4A 4OO3A 3HKEA 4DLAA 3LCJA 4O4IF 3DP7A 2OBLA 4ZO4A 2CSFA 1KVSA 2HWKA 2XOXA 4D3XA 3KT3A 5FBWB 4D9HA 1JVBA 3UPUA 2X0IA 3PK0A 3WNZA 1NXTA 3OE1A 4ENTA 2OZKA 1GZUA 2RJNA 2QENA 3CSUA 3QY0A 3TBKA 3R74A 3DL7A 1JLMA 2DAPA 3HJNA 1UAAA 3GMSA 1JSCA 3KOXA 1FLDA 2AJLI 3AFGA 5T41A 3ZV7A 4ZZ3A 1ZD1A 2LW7A 2CNWA 3MBIA 3PFHA 2VHTA 3GD7A 2AQIA 1MVNA 1JDNA 2GESA 5AM4A 1NMXA 3GZNB 3PF9A 3CBQA 4D9BA 1K7CA 3KP1A 2IUSA 3H83A 2IHTA 2JH8A 4KQFA 4IRUB 3AETA 5CT8A 2IV7A 3D7KA 4DMMA 3TRKA 4I5EA 3UFXA 2J3JA 3IGFA 2EJCA 5FAKA 2CLLB 3AEXA 3DMYA 3R6GA 4EY8A 3GQBA 3K9GA 5DLYA 3VZCA 1YU6A 5IDXA 2QVCA 4MUXA 1YQQA 4BFSA 3WLLA 4LFCB 3JRWA 3SSNA 4P08A 4GI7A 1BE8A 2ZSAA 2CXSA 4UMDA 3HFRA 4GI3A 2GCNA 1LD3A 4PANA 1YVPA 1FS6A 2CL7X 2VH2A 4HH0A 4INPA 4CM4B 1NN5A 1UXGA 2GEFA 1H3EA 5AJUA 1FQWA 4BVJA 2WJIA 4PY2A 3NNNA 821PA 3H18A 1E2EA 1BWPA 3AI3A 5IKXA 3D4BA 3R23A 3KU1A 3ROTA 2JI7A 1PR3A 3ZV4A 4B84A 4B81A 3VZQA 2QZPA 1R15A 4ZTUB 3JQCA 4FMDB 4EEZA 2W8BA 3RG2A 3RWMB 1BG6A 4XWAA 1RQGA 3ASUA 4N3BA 3U17A 3RS0A 4DG5A 4L95C 1WVMA 1L5OA 1RABA 2KS6A 2AC4A 2WWXA 3KZKA 1PVVA 4YXWA 1L7OA 3C2QA 4AY4A 1X86B 5GM2A 5M2QA 1JEOA 2ZRLA 2NWQA 3KT6A 4YACA 2HYDA 4KSCA 4B2YA 5BV7A 1PGPA 1CULC 2F00A 1ECFA 3B6ZA 2CLDX 2J4FA 1YI8A 2R65A 1CZOA 1NJ5A 2ZXFA 2AN5A 2C5EA 4MB6A 2XWSA 2VVTA 4PQYA 2B1JA 3I0MA 2QLTA 5B3JA 4WW0A 3IAFA 2AMFA 3FPHA 2A1TR 1GM5A 2EX4A 1NFRA 2KPJA 1M0TA 4GI2A 3EA5A 1L8AA 1S3IA 2TSYB 3A31A 3WOHA 1XN1A 4J4BA 4CDMA 3D6UA 5K3FB 1KK3A 3Q8WA 3R6WA 3X3HA 1GT0C 5F4ZA 4I6RA 3T1QA 3ECAA 2EKBA 1C3XA 1N6LA 2R48A 3K4HA 2IYNA 1VPEA 3LJKA 2OV8A 1D1QA 2G07A 4WCFC 4P53A 3ZJYA 3P8ZA 4L50A 3O2JA 1KI7A 4AWBA 4TV9A 3E4DA 2OK7A 4JVSB 1JECA 2QD5A 2ZUDA 3BF8A 2LGJA 3QU5A 1CUSA 1DWKA 3MJSA 5BVHB 4EJMA 1MLDA 1MQ8B 3EB9A 1Q83A 2O8VA 1O58A 3DP9A 4KXMA 4E5KA 5KNBD 1GAWA 4O2RA 5IEJA 1QV6A 4A2CA 1Z17A 2E3JA 2JZNA 3PNLA 4RZHA 4UVEA 4A16A 3IMFA 4MVYA 2IHVA 1SCQA 3HKBB 4FN5A 3STHA 2XCUA 4RV4A 3IO5A 2ZYTX 4TYPA 4ZXFA 1VE9A 3ZTTA 4PR3A 4Y6SA 1J8DA 2C4TA 3GMIA 4RADA 4YYZA 1YL7A 3C1AA 3IE1A 4N40A 3IT2A 4G0WA 1ZY2A 5ICEA 1KZ7B 3A9CA 4ALIA 1EHIA 1QGUA 1Q0UA 3U1BA 1J0XO 4H2DA 1NUTA 4RCZA 5ETJA 5F7JA 3UUFA 3P71T 3I01A 5E3IA 5BRNA 6LDHA 5JYCA 4KMMA 3HCRA 1K75A 4PG6A 4E3ZA 4JQYA 2BGKA 4KQ1A 4Q9AA 4BLSA 1GAXA 5EZQA 4TUYA 2GD6A 1UDAA 2QAGB 4JHLA 3DZBA 3WE7A 2IDKA 3EW9A 3CCCA 3ICCA 1M1YB 3M1AA 4DCCA 5CB4B 3KVNA 1C29B 1CY2A 2CFTA 4OV6B 4N12A 2IYAA 3QELA 4L5YA 3RZZA 1EGQA 1AXGA 4RC9A 2CCKA 3CGGA 4ARZA 3GH3A 4WLEA 2XZPA 5JPIA 2Q46A 1KJ8A 1U3WA 4TV8F 2ZYDA 5DSZA 1ZK4A 4F3RA 4JU9A 2VEOA 4GLBA 4WXHA 4D8TA 1QH9A 5TS3A 1GLGA 2O20A 4ZAYA 3W90A 5A4DA 5B1EA 5B57C 4LQLA 2AFHE 4Q47A 1LLQA 5IC4A 3R41A 3V80A 3OO1A 1ZJZA 1C1DA 4N8DA 5HK8A 1E5QA 2ZBEA 2IUUA 4OGLA 4A0SA 5AD1A 3PNQA 3QU9A 3FJOA 5CITA 2NV0A 3MCWA 4YBRA 2CNNA 1YUBA 4FCWA 1P2SA 4JROA 3EZLA 3VH4A 4O2AA 1COWA 4G0QA 4R0NA 1H5QA 1N57A 1DFGA 4K86A 4PO3X 3VNSA 5JAZA 3EPJA 3BMOA 1SXJA 3CJTA 3O8QB 4IJKA 1FRFS 1ZCAA 2YOHA 5EE9A 3DLBA 1T6BY 3OBBA 3ZVKA 1C3EA 3JYNA 1FPQA 4PZ9A 4QT0A 1XROA 3EG5A 2I2WA 2YYZA 1GPBA 2I22A 2BHLA 4E94A 3H9CA 3SYRA 3PUIA 2X9NA 2FUG1 1E99A 1JZTA 3FSGA 3HWSA 4M9RA 1IWPB 4L2IB 3KK0A 2ZJ3A 3D8NA 3LQQA 3NWBA 1SC4A 5HFNA 4DIFA 3PGLA 3Q3VA 4KO4S 3LFPA 1Q17A 3MJVA 2FG6C 1KQOA 3P9RA 1DKPA 4F2WA 3K9LA 4G0ZA 4Q3DA 1H2XA 1ZH8A 2DEUA 2P11A 4FI3F 2LTAA 3OF2A 3OT1B 4JI4B 1Q77A 1XIVA 1NQUA 2C42A 1QHIA 3D2LA 5E7JA 1BEZA 3ELBA 2GA8A 5HE8A 2G1JA 3FWZA 2ZLBA 3R7FA 1K3UB 2R00A 3B3AA 4DCMA 1EFVA 3IKTA 2ANCA 1SG0A 2F8LA 2X6RA 3NZEA 3T1HB 3C3AA 2WJAA 1CUFA 4HXFB 4KTTE 1OSLA 4M1ZA 4BYGA 2DQYA 1SIOA 3GH1A 4JODA 2FF7A 4PZ0A 4LOKA 1CPYA 1W87A 3MQFA 4K6FA 4DMGA 2MQKA 3V42A 4X97A 4EB6A 1U9YA 4IJ5A 1O54A 1E2JA 4NC9A 3SQLA 2EYQA 2HA5A 2HJ9A 3GVCA 1EUQA 1RIFA 3AC0A 1BE0A 3EY4A 3ZJVA 5F12A 4MVJE 1A5ZA 3D7MA 3DZDA 1IK6A 5AP9A 4YG7B 4BYMA 1MDBA 1MOSA 4YLGA 1TO6A 2XUFA 3PUHA 1KVTA 2V7WA 4G0UA 3LNCA 5LYJB 1ODCA 1VDMA 2ZI9A 3OU2A 2VSXA 4JR2A 1TZBA 1HGXA 1IFXA 3DWFA 3I12A 4EEKA 3AL2A 1O1YA 2FEXA 1X3LA 5DP2A 5EWLA 3AVYA 1K66A 1L6RA 2E49A 3K0FA 4X24A 1NW9B 1SULA 1S7EA 2E4ZA 2IYUA 1DIHA 1W25A 1JLLA 1M8GA 2GEVA 2HK8A 2BBTA 1F51E 1FB5A 2GXUA 4AN4A 1VE3A 4S24A 2HQ1A 1DOAA 1JA0A 2MSCB 2P9FA 4BUCA 3QWHA 4ZI7B 5BSWA 2ORYA 3R09A 2BF7A 2OMKA 1KMHB 3IAS1 4CU2A 4ARAA 3ZIAD 4PYJA 3EEFA 1HRDA 1QQ5A 1J23A 4HAUA 2VRWA 3GMDA 3X1DA 4NQRA 3HXPA 4QTTB 4D56A 4AJHA 5ALDA 5HF6A 8GPBA 5H70A 5JR3A 6Q21A 1ULSA 2R8EA 1OREA 5DF1A 5BORA 1ETHA 4H3KB 3HXLA 3VRHA 2RK6A 1ABFA 1BS1A 3AEQB 4ITUA 4ZEMA 1DIAA 1PP4A 1QFMA 5DHTA 2IUOA 2F1RA 3U49A 5MN4A 2TMGA 4X65B 1W88B 4UM7A 2VJQA 2PQ0A 3GJ0A 3DOFA 3U3WA 4O4HB 1MC1A 1E4OA 4Y1GA 1QH0A 2WF6A 5FTKA 1XCLA 3G2PA 4C06A 1GHTA 4ZKDA 5HW0A 1ZKDA 1YR8A 1VL0A 1DMRA 2C7VA 5T7BA 3HDTA 2MT9A 1XDZA 3LXRA 3KE9A 3QPWA 1CEXA 2R6JA 4X71A 3PUYA 3G5GA 1YMUA 5ALEA 5ES4B 1PNOA 5GONF 2OR1L 3W2IA 4CVNA 3T5PA 1F17A 4MTLA 1T8SA 3GLQA 4NOLA 3GNQA 5EPOA 5TV2A 4N03A 1XTPA 4B3XA 5CFZA 5I4IA 1E4VA 2BGTA 2XTJA 5IH7A 1ODFA 3U4IA 1NVFA 3D8HA 5FOXA 1D0SA 4FDTA 2FN4A 4L7QA 2PSJA 1E3WB 3TIVA 4KK4A 3WL6A 5JV5A 3SHFA 1QVAA 4ZZ1A 5K0CA 1WF3A 3T35A 3RKUA 4IRMA 1ZK0A 2C3UA 4QGGA 3NTQA 4AZ0B 4EA6A 3PR1A 3IP1A 2PUTA 1ELOA 3GN2A 5IAEA 3L7BA 5DXFA 1FZTA 4I6JA 1FFAA 1T0BA 3FTEA 3GGSA 3GLHB 1OXVA 2JIZD 2A92A 4WESA 5ITSA 3CFYA 5DM1A 1H8HD 3RROA 2WF5A 1Q20A 1QQ6A 3B2NA 3I76A 1B0AA 1IBMB 2M32A 4C3UA 4L16A 3TQIA 5A03A 2QVGA 3OZFA 3T3IA 1V8DA 1NASA 4HAVA 1KI2A 2ZYVX 2CXHA 4I5DA 5DHSA 3OEEA 4FILA 1UOOA 4PAQA 4RGVA 6ABPA 4W5RA 1DFHA 4GSYA 5CNJA 5BP7A 3AIIA 1E7RA 1G2QA 1PGOA 3FWYA 3WNCA 5C46F 1KJIA 1HL3A 2VZ0A 1ZUNA 4QPNA 4R2WA 4UHEA 1KYXA 4ZKEA 3RFCA 3QQ5A 1XJ0A 3L6BA 5EJ8A 4HF7A 4NYJR 4C4SA 1VLVA 4KOAA 3X1ZA 1JHXA 2F55A 3WA6A 3HCAA 3E5MA 4JFRA 1PWYE 3EC2A 4YT2A 5AW9A 3TN7A 1KIMA 2J7WA 5KEIA 2YWFA 2JQEA 1W0KD 5ALTA 5JT1A 1A7KA 1SUDA 5ECDA 1UMDA 2IH4A 2C94A 1T9AA 2GF0A 3EPKA 1XPUA 1US8B 2ECQA 4HTAA 4UHDA 5DNYB 5CVUA 4BXOB 3CGWA 4OK6A 2D0OB 1D8TA 1M0WA 4FFLA 4KW7A 4KWEA 2YJGA 5IARA 2V7BA 5FLEX 1QIGA 2ZJ5A 5JG7A 1JFSA 4RLHA 4ZJYA 5L4SA 3UK1A 4AKTA 5AHWA 1IZYA 5GY7A 1PQYA 2CDBA 2QE7D 4HAXA 5KAMA 2WKRA 3CT6A 1UMBB 1GARA 2P6RA 2XA1A 2P65A 3UWKA 1GT6A 1FTQA 2BHTA 1WEHA 4K9DA 9LDBA 3V2IA 3V4RA 1I1HA 4MUHA 1XAHA 1GOTA 2BKXA 2BLLA 2QZSA 2XYHA 4EA9A 3I04A 4IDOA 4L0MA 3WFZA 2NADA 4BL5A 1AK2A 3FLAA 2HW8A 1DIOB 2XADA 5AHRA 5EXEA 1JWAB 1PFKA 1YCGA 3BKXA 3D7LA 4HUQA 3CA8A 4DRYA 1J70A 2MYTA 4E4TA 5KSPA 1GPJA 1GXSB 2VSQA 3I5AA 2ZB3A 1N2SA 4BMCA 2G1PA 2Q5IA 3EXFA 5DLDA 3ZHUA 1II8B 3LGXA 2QTAA 1Y80A 1PW7A 3E5HA 3NROA 2LLVA 4ANFA 5KOIA 5ED4A 5EP3A 3FYUB 1CS4C 3PDIB 2QLJA 4NECA 1IDOA 2QMQA 4JUFA 1GDDA 4LX8A 5IYZA 5JSZA 2XEXA 3R2JA 5J3JA 3V8NA 1NW8A 3R5SA 4AURA 2ZI6A 3MOGA 4QDKA 4BTLA 5J59A 2JHCA 2XCRB 5BWCA 1D0IA 5JBIA 1DTWA 2EJWA 4PWZA 2UXDB 3CH6A 4YJGB 4Z49A 1PS8A 2QORA 5HSGA 3WX0A 2VF2A 4PCUA 1GUBA 1MN6A 3AW9A 2BPOA 3B9BA 1GQYA 4RQBA 4WT7A 1SCDA 3IHLA 3S4YA 3Q10A 1KC1A 1C7EA 3E7PA 3GXOA 4I6EA 4EAQA 4CKZA 4EFNA 3HLKA 4KI7A 4IDGA 1JXAA 3JQFA 3L1IA 3SNKA 4BWFB 4D6YA 2EW1A 4E21A 4RTLA 1NVUQ 2EU8A 3A05A 4EGJA 1RQLA 1O6ZA 2JLWA 3FVRA 4C4TA 4GBMA 2Y0CA 3DYVA 4RGQA 1ABEA 3WYAA 2BNOA 3GQVA 4D3DA 2HDHA 3N86A 5JECA 2XXQA 3LFTA 3SHVA 3Q7PA 3B1YA 2C4WA 2Q9BA 2VZ8A 3MT7A 4JLDA 4Q37A 4XCVA 3FPBA 1VCNA 4Z7QB 1U0JA 3J7TA 3PYXA 4QX6A 1TU0A 2SBTA 1JB1A 3BRSA 3NUQA 4NI5A 4NENB 1BFKA 3GFOA 4M0FA 2P1DA 3NAQA 4LS3A 4XEHA 2QIPA 4YAOA 3V1MA 2O8BB 4UEWA 1WE2A 2O8EB 2IYOA 3DV9A 2OUKA 4UBJA 4B80A 3TLAA 5ALQA 5B6JA 4Z0TA 1V5IA 4DKXA 3WMEA 2EEZA 5TEWA 4MLZA 4OX9B 3H8VA 4K88A 3ZZ0A 1EPUA 1IE3A 3KXPA 4PCLA 4QAQA 5LBUA 4DXDA 2IE8A 4FR2A 3QRWA 1ZH0A 4DSTA 3RABA 1JLRA 5FPKA 4EYGA 2IOQA 3OCCA 2JI8A 5BYJA 1RKUA 2WMNB 4JLMA 1AA6A 4PLZA 4BV9A 3I37X 2Y8EA 3DJFA 3WK9A 3HSYA 4X4BA 1RPTA 2CUKA 2IK8A 4G9EA 2WAXA 3WLOA 1GU7A 4YP1A 3PXPA 1ULAA 5L53A 2CNBA 1PDOA 5I9BA 1Y1PA 3TM4A 5A9SA 3H6KA 2ZB2A 4O4LB 3BFPA 3WIOA 1E3TA 9GPBA 2CLFB 2AS0A 5T57A 2PMKA 5ILQA 1J2EA 1Z68A 4PIMA 3LHKA 3ZWMA 4EZIA 4QYWA 1YV9A 2PGNA 2R62A 3IE0A 4RPLA 2BFDB 2WP0A 1LC3A 2V6JA 4ZO7A 2XGJA 1W5FA 3CF6R 1CUZA 2W42A 3QKSB 1O4WA 2F59A 5FLKA 4RV5A 4D45A 4J2OA 4X4FA 1TL7C 4E12A 3JWEA 3MB8A 5A3JA 2O2JA 4IIBA 4R9RA 2PNJA 1LLUA 2ZYWX 3LUAA 3WWZA 4YRAA 5HR5A 1CBUA 3ROMA 5KKNB 2YX1A 1E6LA 1TC2A 2FSVC 4IS3A 4TS4A 4EB8A 1EFHA 3AM3A 5TY0A 2ZP1A 2LWIA 4RS4A 1YB1A 4YCCA 1XDUA 5T67A 3RUDA 1AGPA 4DQ0A 4CPDA 4P7JA 4YJKA 2EYUA 4D3YA 2POCA 4LI0A 3CLRC 1LJ8A 2OB1A 1K4KA 2ZSFA 1B42A 1FMFA 4Z3DA 4CR6A 5JVDF 2ZTMA 3GJQA 1FLNA 3L0DA 4TS3A 1XMJA 1P4JA 3JWPA 1MF7A 2GBIA 1NBMA 3FUVA 3P4UA 1J00A 1FFXA 2A86A 1M7HA 2IZOA 2M9MA 1D8AA 3K3PA 3HKDA 4HYEA 4M9CA 2RIRA 4QBFA 4QHYA 3K53A 3TX2A 3W5VA 3GJXC 3RGWS 1YBAA 3SLKA 3NG1A 2ZROA 3H4MA 2IPOA 1I2CA 3TXAA 4BAZA 4I9UA 5DJ5A 1Z0AA 2YHIB 1E2GA 1ZMBA 2Z8XA 1NRXA 4YONB 4E2ZA 3Q8MA 3L02A 4R1NA 1UDCA 1WCYA 4X0EA 5HJ2A 5DTRA 2NZYA 3Q7IA 2W6OA 3H5WA 4P2GA 4EGCB 3B8HA 5AW6A 2GJ9A 1T2FA 4MW1A 1PQWA 4DZTA 5DHUA 2HSEA 2NUBA 5B7GA 1AZSC 3E23A 1KL7A 5JBQA 1N2CA 4NJMB 1JBKA 5JH7B 3JYOA 1UBNA 1EDEA 1A8QA 3DTVB 4XRRA 5TMPA 4DV4B 3KHSA 1H85A 1TK3A 3C39A 2NXJA 4L74A 5HQ3B 3MS4A 2FN3A 3KUXA 5CX1A 4W1SA 1FP1D 4CQMD 5HS6A 1LU9A 2ZS8A 3K1AA 3K9CA 4W1PA 2LKDA 1ZOOA 3G9UA 4BFXA 4AY6A 4JP2A 1QO0D 4UUBA 4OFWA 2Z0MA 4R41A 4TTJA 1ZMRA 3N59A 2V0CA 3U39A 3GU3A 4INAA 1F4PA 3ROXA 2VNAA 3FMPB 4X6UA 3RLFA 1D2RA 1FZQA 3CU5A 3IJ5A 3O8NA 5K3DA 1I4WA 2CCJA 1WUHS 1JG7A 1U81A 3FTCA 3LX4A 2HA2A 4KIWA 3CJRA 2HQBA 4MJXA 3ZY3A 1YDMA 1EJ6A 3AERA 3OJXA 3NALA 1L3IA 4IUCS 3UB3A 3W6PA 5K8TA 1Y7TA 3QWAA 4TMKA 3WYBA 1B8NA 1WP9A 1M7GA 1U8YA 4FC6A 4J0IA 4YJ3B 3H4IA 3U7JA 4A2WA 3C1UA 3QITA 3N2GA 1JEDA 4U7FA 5D3KA 4F3KA 4B6JA 4X6YA 1KSGA 1SB8A 2WYOA 3FFWA 3LA6A 2OHGA 3O2QB 1VIAA 3AFIA 3CZQA 3FCSB 3PA8A 4GKBA 4P3PA 2R1VB 2VKTA 4QLAA 2C4HA 4ENVA 4Q4AB 3OLZA 4WXRA 2H17A 3OX4A 2JLAA 1U7DA 2E82A 4X1IB 3O1LA 4CIYA 1WUTA 3WRYC 3EWNA 3TDNA 2H4JA 2NT4A 1HFKA 3NIFB 1K08A 1KXJA 4QDOA 2AOUB 1PJZA 2WD8A 4ENRA 3HU3A 4RDXA 2QMUA 4X90A 1Z7YA 2OT3B 3IILA 1NFFA 3ZDZB 3TJZA 1E7YA 2QZ9A 3ND9A 2VF7A 1O0CA 2G80A 3AVOA 4GAEA 1H2BA 2LXNA 3KETA 1WZEA 3DOUA 5DTIA 2UZ0A 3IBTA 5C8ZA 2NO6A 2RBKA 4OTZA 1BQ3A 4FUQA 1ESDA 1OXUA 5B6PA 1GEEA 4IMRA 4F7DA 3JTEA 1W85A 4FQ7A 2ZB7A 3TRBA 4N65A 5L51A 1PLJA 2OP0A 4ESOA 1PK8A 1EP3B 2P27A 4YC7A 3UICA 3NOXA 4BQQA 4JJZA 4S1PA 1WZCA 1Y6FA 4E5YA 3M6WA 5F98A 2HSGA 3GZDC 4CM5A 3THYA 3BGSA 3SC2A 3RCBA 2MMCA 5CFRA 3UATA 4KJZA 1ISFA 2MU1A 4KR9A 3UJNA 2EIXA 4UD2A 4XVHA 1J8QA 1L7MA 1CLEA 3ZIUA 2GERA 2FLWA 4ZDKA 4MYCA 3UK6A 1HDCA 4C0XA 1A2OA 1IXZA 4MCXA 4OCZA 3EVGA 1L9XA 2AMYA 2DLCX 3KWMA 3S3TA 4B35A 2JKVA 2AW6A 1NKTA 4QOIA 3ZY2A 3OOJA 4BMNA 3JXCL 1UKYA 1FMJA 4L5IA 5AW0A 4H17A 1BMTA 4HWPA 1MXHA 4J49A 3TO5A 3WR5A 1PDVA 3S1SA 1ZI8A 5JHGB 2Q3FA 3GLIA 3HNRA 3PDHA 1NBOA 1OBVA 4MQ6A 1OILA 7REQA 2VAXA 2WF8A 4TVSA 1T5DX 2CWDA 1AMOA 1E2DA 1UBFA 3E1SA 3RNLA 1J99A 2JVIA 2EARA 1QNFA 1B4DA 1MEEA 5LQAA 2YVKA 1XZAA 1VYVA 1WUYA 3AGPA 5F21A 4YLYA 1G6Q1 4ASUD 2JVJA 2R8XA 1GRCA 4RPHA 3CLRD 2COKA 5CMLA 4TMYA 4F38A 4U8GA 3EDOA 3OLCX 3EGXA 4RLQA 1K5GA 4L4XA 3SMQA 4OLFA 4X95A 1JJ7A 4LSWA 4D6XA 4DM7A 1G8SA 2HSWA 1VCMA 1SOAA 2J46A 3N87A 5KYUB 4W6ZA 3OMTA 1K6JA 2V45A 5MF6A 1CIVA 5AVQA 3VZSA 1KA9H 4FWIB 1G0OA 1YSCA 2V0NA 1UOQA 1XQ6A 1PWEA 1ZVKA 2BMAA 2WE8A 4HNQA 5F2EA 1GPYA 1NR1A 2JGEA 3L4EA 3SIXA 2WWTA 1YZTA 4WNAA 1R5BA 2I3BA 1UWCA 2BUBA 5GOZA 4F86A 1QO7A 2IXBA 2ZKIA 2FWJA 2P9EA 1XE3A 3GR6A 4L6AA 4LHVA 3B9PA 5AHKA 3EUAA 1T3GA 4D81A 5I8WA 4LFBB 3IMKA 5BT9A 2IZ0A 3FUTA 1KDPA 4YV0A 1EK1A 1QHHA 3I52A 1FBTA 8LDHA 4L0DA 4M2LA 3CONA 5AM1A 1KMQA 1SUEA 3GDFA 3F3MA 1UZNA 4BFYA 2P6OA 4RSHA 3WWOA 4XJXA 2Q2VA 1PJSA 4J76A 2FEMA 4PTZA 4WAUA 1E1RA 1ZK3A 2IPLA 1J97A 3E5RA 4DZZA 1RYHA 5KIAA 2UYYA 3U60B 2YOGA 4KX3A 2O49A 3SSOA 3TUIC 3ZE9A 5LQKA 1R9MA 3M3DA 2E9SA 3T7SA 1G60A 4RHUA 4LNHA 5AW2A 4C7OA 1N5OX 3CF2A 1J49A 2HRZA 3D6JA 4EX6A 4CRWB 3ABOB 3P0HA 3C1OA 3I2FA 5DWDA 4I2NA 2IOHA 1A77A 3EXIB 3QIAA 4D4JA 1RR6A 1XEXA 2PEYA 4TXLA 3D31A 5JWHA 2AK3A 4F3TA 1AKTA 5G4LA 2B4TO 4JUCA 2X0DA 4TT8A 4BKPA 8OHMA 2Q5FA 1F2TB 3L49A 5JU6A 1V71A 1YOVB 3RSLA 4EVIA 5J1SB 5KYKA 2Q6KA 2P77A 5BSGA 3GZJA 2G0TA 2R60A 1DDOA 4LXYA 3HCCA 1BXRA 5TT1A 1PD1A 1YJCA 2HIAA 2JCSA 3GBPA 1CRQA 1IHUA 1YQ9A 2QV7A 2V6GA 3GRAA 4KWHA 3WMWA 2XJ9A 3GG2A 3OPXA 4URWR 3C41J 1PV2A 4E4YA 2YZ7A 3RBAA 2ERYA 3WLTA 2XCIA 4C0BA 3P7MA 3RQSA 5C3UA 2I8CA 4ZODA 1I2ZA 2EWVA 1MABB 1DG3A 4HDKA 1BX0A 1ZM3A 2CBXA 4JNKA 4MS3B 4ND7A 4QGFA 1KWKA 3GBVA 3SJUA 2PAFA 2EFEB 2VTDA 1RPEL 3CX3A 1VMEA 1KAOA 3BOSA 2H8GA 1YIAA 2CJXA 3KOMA 3PDCA 3S44A 2IEYA 2PBFA 3DMTA 4BJ5A 3UAZA 2WB4A 3UPDA 3ETJA 1M1NA 4RJTA 1EX6A 2Q07A 3WDKA 4LXQA 5KTTA 3FKSA 3MT8A 5FBVB 3NLLA 3PHJA 1PTJC 3ZIDA 4KPYA 3NHFA 1XT6A 5A3RA 2OHOA 1I4LD 1WB6A 3JD1A 2HU2A 1WCXA 3AM5A 3EVFA 3MMPA 1W36C 1MTZA 2R84A 2ZTVA 3P9CA 1OFTA 3TZKA 1E7MA 3OCYA 3DBLA 2VKQA 3B3QA 3WRXA 3ETCA 3AETB 3DV2A 2PBZA 2RFLA 2KYRA 2Y92A 1LLCA 1J8VA 1G5FA 1NBHA 1U3CA 2NU8A 2FR0A 2FRDA 3MFQA 5BXYA 4DNOA 4DA8A 4MUMA 3MINB 1QE5A 4Y98A 4UXHA 4XKJA 3R7BA 3GLFE 4GOOD 3UJDA 5BR4A 3OU6A 1VSVA 3TOVA 4KPEC 5BMVF 1OH7A 3D0RA 3DKRA 4RW0A 2HWXA 2IPNA 7GPBA 1GQ2A 4R9SA 4L73A 1FDIA 4J4TA 1A8UA 3REQA 1ONPA 1MNAA 1EEHA 3E7FA 2Z8ZA 3HJBA 3ZE6A 3I53A 3B89A 1R0YA 1T3ZA 3VPCA 1T0UA 2OUIA 5FV7A 4R1MA 3KLOA 3FNHA 2V7PA 1GYRA 3ZE0B 1XTVA 4RA6A 1G20A 3UJ7A 3RIYA 4URFA 2IYSA 3ZV3A 4YO8A 4D02A 1VRVA 1OBHA 3IVAA 4LY6A 1I9CA 2JNWA 1CJKC 2C77A 3KEQA 4Q4DA 4Q21A 2GCOA 4IUBS 3C7KA 1XLWA 2F9LA 1KK1A 1E2LA 5FTMA 2QPTA 2GD0A 1XELA 1ESMA 1U1IA 2W8BB 3SHOA 1JJBA 1RDFA 3FUCA 4LK3A 3KXIA 1X1SA 2Z95A 4AICA 1J0CA 4H1WA 4DUZB 1NT2A 3JYPA 1TEZA 4HGOA 2D7CA 3IHWA 4IF4A 4KRGA 5A1TA 4OXQA 2RGDA 2QAJA 3MWGA 5H9WA 3C16C 3VUEA 2OM2A 3OQ6A 1A4RA 1TRKA 2RG1A 3UEOA 1Z08A 1KFBB 2IHUA 2FMKA 1YQGA 3HFJA 1R0XA 3CRZA 4M0EA 3DD1A 5IK2A 3IQIX 3ZGXA 1A4UA 2GSDA 2I6FA 4I4NA 1L7BA 5LWQA 3NWJA 1T15A 5H81A 3SGLA 4RK7A 4TROA 3VPBA 1VJRA 1RKQA 3PEWA 4Q6BA 2ONYA 2V8BA 1ILEA 3HK2A 3TQHA 1AN9A 1YRHA 4F8DA 1T4MA 1I51A 4YP9A 4C6HA 5AW8A 4XVCA 1N78A 1LSSA 4XB1A 3VMMA 3O83A 4KJXA 4G9GA 2YJ4A 1XG5A 3DDOA 1Z28A 5KQGA 4A8JC 3FDZA 2AH5A 2R3SA 3U7QA 1ZM4A 4MGEA 1GT91 1C3LA 1XKLA 2QTWB 5HILA 4BMZA 4NPAA 5K01A 5LLSA 2OORA 3A70A 4B3MB 1ZH2A 1HFWA 4N4AA 4F3NA 5IZCA 5GZ3A 4F6RA 5BMOA 5G3YA 1U7HA 4CE6A 3FJ1A 4MW6A 4IDQA 3KDAA 3VSDA 2FZ5A 3KZ1E 5BV2P 4QXAA 1UP4A 3UANA 2NO5A 5J4KA 1W94A 4CLHA 5JEDA 5I7SA 3KQUA 3CLVA 2HHCA 4Q3EA 5LA6A 3KSZO 4HRAA 1WXFA 1AGXA 5KPJA 3NBAA 2I87A 4DKJA 3H5VA 4QEKA 3BC1A 1L5MA 2EBWA 3D8TA 3DDNA 3CXRA 1U4SA 3IE2A 1HDEA 1J21A 3KKQA 4G5RA 4Z8XA 7ABPA 2W83A 1UKEA 1D1PA 3QXJA 2G1AA 3DMPA 3P5BA 3OUUA 3EZ2A 4N18A 5FNVF 3SP1A 1YAHA 2I3DA 4D3SA 1PEYA 4I4TA 1C7ZA 1MOZA 1NQTA 3DDCA 5HBRA 5LIRA 1X9HA 3A1EA 3KYCA 2O5RA 4K5QA 4LJYA 5DBOA 4ZYYA 4TLCA 3A28A 2W6JA 3FWNA 5GQSA 1E3JA 1SVNA 2ZSUA 3G6KA 2CDRA 1UODA 1KJYA 2VZ9A 4KUEA 4CKEA 4QBKA 5EC8A 5T6MA 3SS9X 3TM5A 4D7AA 2CYCA 2WB2A 2GAOA 4OB4A 4ER5A 2VYVD 3JASA 4O1IA 4YCNA 2XSDC 3K05A 4HGPA 1RC8A 1AD2A 4HR7A 2A0KA 2PUEA 4YP6A 2IVZA 4EJ6A 1JLSA 3VXKA 3F7TA 3Q87B 2C8JA 4MO9A 3W1WA 3ZVNA 3DEFA 3EZGA 3DFUA 3LKZA 4IGEA 3O91A 4IR7A 1YKGA 2NYRA 5DEOA 4B2LA 1HE3A 1HM5A 3WFJA 4D99A 2ZWAA 2YW2A 2YFHA 3KG2A 3L43A 3L8ZA 3LPDA 5BUZA 2FA9A 2WPNA 4IIJB 4Q7MB 5SY6A 1KK2A 2FG7C 2WU0A 3DMFA 3UXHA 1NW6A 2ZAIA 5JZVA 3ZGZA 2BHRA 3FFBA 1VLHA 5DTMA 1JVNA 4N7RA 3WJ2A 3LY5A 4NCKA 2IXGA 1QLWA 2BFNA 2QJRA 2B5OA 1UL1X 1Y7HA 5CLHA 5ECYA 4D9NA 4E2XA 1XJ5A 2BCJQ 2FVXA 4QULA 3RB8A 2QQFA 1W36D 1CTQA 1QHXA 2PX5A 3M89A 4C7MA 3C5CA 3LRPA 2HTFA 2VP4A 2AFIE 2P7IA 1KOJA 1M8FA 2FSSA 2PJDA 3TTYA 1VJ1A 1BDIA 4QG7A 1OBOA 4U2DA 1QVVA 2BFBA 4ISBA 2JIDA 1NRIA 1OC4A 4NEHB 4Y2UA 5SZIA 4AG6A 4US2R 5AIAA 2C4NA 2CE2X 4IDPA 2WVAA 4BNMA 4XX1A 2WZDA 3HGTA 2PXLA 3CS3A 5FTJA 4D9IA 4EF6A 3BMQA 2BEWA 1B0NA 3AWIA 3UAGA 3W2TA 5BOSA 2XYGA 4ME6A 1ZRMA 4PZCA 4MI6A 4PLHA 1KFEB 1RWWA 5IDVA 5B53A 1E7SA 3SOPA 5HQTA 5MGBA 1H4SA 3I6YA 2J48A 4Q03A 4XYBA 5AM2A 3T99A 4G4IA 1QU3A 4AF7A 3H16A 4EMSA 1POWA 2GK4A 1Z0SA 1BCSB 4FHCA 1UDXA 1F06A 2H3EA 2A0WA 1X8KA 1EFVB 2D2VA 2P9ZA 1W19A 3X1JA 1PG0A 1JSZA 3NYQA 4OJNA 5A0VA 1VMAA 4PNPA 3FIUA 1ISSA 1DG1G 1I8TA 1HDGO 3CZ9A 3AKYA 4WK6A 4LYHA 1YSEA 1FVOA 2JAOA 4PBRA 4ARUA 4LA4A 3ZKCA 4EB6B 4QT4A 1TVMA 4L15A 2Z98A 5DISB 3RUEA 3NRJA 4POAA 4TV9F 3W9YA 1BMFA 1P1RA 3ZHCA 3JARB 2ZUWA 3QOXA 4IDBA 2DUWA 4KV7A 1RQ2A 2L49A 1N1GA 2HX1A 2PU7A 2FZ4A 3VJMA 2O1EA 1E64A 2IOYA 3QBVA 4JV5B 4D9CA 1BXZA 1PG5A 3NVDA 2K4MA 4WIAA 5I7OA 3D3JA 2FSFA 3EIFA 1JTEA 1BFDA 2FXVA 2G7ZA 4IIHA 4TTPA 4JI3B 2PKXA 4P3KA 5FFMA 3UJ6A 3A2MA 1TZKA 2F3UA 4WWHA 5EWLB 5IJWA 1A8IA 4YJHB 4O59O 1UDWA 3GCZA 1KO5A 3ER9A 4M1OA 3IOCA 4G37A 3RBVA 2VP3A 1ZUGA 1G7RA 4X64B 2PJRA 1TYDE 3RJ5A 2WTEA 1RRMA 4Q4HA 5LQNA 1I3NA 1JHZA 5IUKC 3E84A 4BQIA 1QAQA 4C7KA 3OIGA 3ENZA 4JLSA 4FHZA 5EKUA 3QVVA 4HFMA 4TUYF 4EP1A 1C8BA 1X38A 5IBPA 1G21E 3IHTA 1C1HA 3BL6A 2N46A 3FHCB 3LQFA 4UTXA 4GNKA 2VHYA 3KT8A 4AKEA 4EUNA 4RTRA 2C7PA 3R0IA 1ISPA 3RTBA 3RFUA 4Z0HO 4RD6A 4F11A 1XA4A 1XQVA 3BBPA 2E2WA 4XQ0A 1W48A 1YQUA 3BXXA 1UXJA 3AI7A 1HZZC 2JC3A 3IAM6 2DG2A 2L2QA 1I1OA 2OQRA 1SQ0A 3HCFA 3RIXA 4X85A 3T1NA 4DA6A 1BN6A 1ND5A 2AOXA 4PAOA 3VZPA 5BNWA 3E7WA 2ZYAA 2AKEA 1U5CA 1SUFA 2HMWA 2ZBQA 3IKJA 1MB9A 3OM0A 1CZLA 2YRFA 1CZUA 4I7EA 3GRVA 5CCXA 1AH2A 2X0RA 3MD9A 4XFJA 1TW2A 1NC3A 1Z33A 1ZGBA 1T0IA 1BC5A 5JZSA 1JAZA 4KGDA 4MWOA 3PUJA 3NH6A 1VYTA 3R20A 3MWDB 5AI5A 1HYHA 1XKXA 1B43A 1H22A 1AB6A 1OLXA 4GQMA 1W4BA 2QD1A 2VUUA 4GX2A 4BVHA 3VI3B 4CMEA 4E1AA 4RDIA 3O8OA 1LRJA 5G1PA 3C3JA 1N5KA 2GEKA 4XPZA 1FUUA 3NOOA 1PRUA 4DZRA 1P44A 5JWRA 1UPTA 2FZEA 2H16A 1JQBA 3E70C 1N33B 5AK0A 4YREA 3ZUPA 1SPXA 3DEIA 2YFKA 3K35A 3E9RA 3G9QA 4WESB 3T3EA 2WICA 1QYVA 1WMEA 2CUTA 1EB8A 1FMLA 1XRRA 2NW6A 3PZBA 4JLWA 1M6NA 1TU4A 1PFYA 4X4CA 2D6FA 4KLZA 4LOLA 4WK0B 1GADO 1N1MA 1VI6A 1XNGA 2ZIAA 3ENKA 4OLJA 1WUIS 2Q2QA 4ND4A 4TYNA 1LPAB 4ZCRA 3A9UA 5I7UA 3STUA 1SBQA 4YT5A 2AX3A 3TB6A 1WZUA 2Z2YA 3LW8A 4HWTA 4K6OA 3BERA 1TTHA 4GXRA 1ZN8A 3H5IA 3LUDA 1SHZA 3PSAA 4L8FA 5A62A 1PS0A 2BMEA 1SQGA 3B2EA 1FQOA 2HO4A 2QAGC 4HQRA 4ZC8A 1OXBB 2F8SA 3K4QA 3JAWA 5HP4A 1R2QA 3DUFA 2AYYA 5EHIA 1W6RA 3D81A 3E0XA 3G8YA 3HUFA 4DR1B 4N7BA 4TZKA 2O14A 5H3LA 3QVKA 4MRMA 1X92A 1ODIA 3EEIA 3DYBA 4KEAA 4IXDA 2G9NA 4BX2A 5DOVA 4ZI5A 4BX8A 4RDHA 1GSAA 5EP2A 4YDSA 2PQ6A 5EE0A 1NWHA 5ALLA 1RI1A 4HUJA 4E2FA 1UQRA