2PUGA

Crystal structure of the laci family member, purr, bound to dna: minor groove binding by alpha helices
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
338
structure length
338
Chain Sequence
TIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAAYFAEIIEAVEKNCFQKGYTLILGNAWNNLEKQRAYLSMMAQKRVDGLLVMCSEYPEPLLAMLEEYRHIPMVVMDWGEAKADFTDAVIDNAFEGGYMAGRYLIERGHREIGVIPGPLEQNTGAGRLAGFMKAMEEAMIKVPESWIVQGDFEPESGYRAMQQILSQPHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEVHPRLIERRSVADGPFRDYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*TP*AP*CP*GP*CP*AP*AP*AP*CP*GP*TP*TP*TP*GP*CP*GP*T
publication title Structure-based redesign of corepressor specificity of the Escherichia coli purine repressor by substitution of residue 190.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription/dna
total genus 119
structure length 338
sequence length 338
ec nomenclature
pdb deposition date 1997-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00356 LacI Bacterial regulatory proteins, lacI family
A PF13377 Peripla_BP_3 Periplasmic binding protein-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2pugA01
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2pugA03
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2pugA02
1ZITA 3GBVA 1Z13A 1FSPA 3GN5B 4Q6WA 3MMNA 2E4VA 2IPLA 5FWXA 4EGSA 3DNVB 2IPAB 3FDFA 4WWHA 1BDHA 1JLKA 4RY0A 1ZH4A 3H5IA 5TQ0A 4Q7EA 3QYXA 1ZESA 3TB6A 2MYNA 2NZVG 4Z4GA 1UDRA 4G0YA 1RZRA 3LUKA 1YSEA 2FEPA 4MS1B 4YG4A 2PIJA 1AB6A 3JXCL 2N9UA 4FE7A 2ID7A 3GT7A 1USIA 2IPMA 3QLVC 1UXDA 1JWLA 2FEKA 3H6HA 1L5YA 3HK2A 4YV7A 1PRUA 5HM6A 3RVNA 1S8NA 2M98A 3F6PA 3L6UA 1ISSA 1U04A 4IMIB 2VUIB 5IEJA 3H5OA 3HO1A 3A3KA 2OFYA 4EVQA 2L17A 2WY2D 4YO7A 1DRJA 4F12A 1X2LA 3KXAA 1B00A 5DCLA 5TPZD 2L18A 5IUJC 1K66A 2IUOA 2BJCA 4N03A 1Z15A 3EDCA 2FN9A 3NHMA 4GPAA 1Z17A 3ROFA 3URMA 3EUSA 1NXPA 1JFTA 1NXVA 1U2QA 3JVIA 3L49A 1RXIA 2GX6A 4HNRA 2FMIA 4W5QA 2A9OA 2KEIA 1U8TA 2CHFA 5JNTA 1QPZA 3Q41A 4JCXA 4OBBA 4ML3A 4I6TA 3CS3A 1M5UA 3N0XA 4HNSA 4MLDA 5DTEA 3KKEA 1DBPA 4LE2A 1PNTA 1M2EA 4O1HA 3LUDA 4IA8A 3KJXA 4PE5B 3HM9A 1TM2A 4N76A 4O5AA 3EULA 3HSYA 4Z5CA 4QPJC 4GQMA 4MRMA 5IBQA 1CHNA 3HDGA 2KPJA 1LCCA 4HNQA 3GBPA 2MSKA 2NUBA 1YMUA 1M5TA 1UTXA 1CQTA 2AYXA 3JTEA 1DCMA 4XAQA 4OLBA 1C4WA 3MF4A 3KZ3A 1ZUGA 3G7DA 1O4XA 1CJGA 3T8YA 4NCAA 3KYIB 1LJUA 2V0NA 3LKBA 5EWLA 3QELA 3EQZA 3SM9A 4W5OA 4KZKA 4ETMA 2LIVA 3O1IC 2KEJA 5DKFA 4IGAA 1JBEA 5ED4A 4D6XA 2W42A 2IYNA 5TQ2B 3F6CA 6ABPA 1OCTC 4RU1A 4Z9BA 3MM4A 3LKVA 1Y7YA 1KGSA 1D1QA 1Z25A 3QLUA 5HQJA 2WRZA 4OG2A 1ABFA 4JA2A 2WIUB 3O74A 4RK4A 4I6UA 2PE5A 2IV1A 3CKMA 3NNNA 4UHKA 2L8NA 1W9HA 5CNMA 4UHJA 3H75A 2GRMA 1BA2A 1KMIY 1ZAYA 4IILA 1P6QA 4F8DA 1FFWA 5F64A 3RVKA 1Z2DA 5BRJA 3M6MD 3HJFA 1YK0A 4RZSA 2AXUA 1PNRA 1L5ZA 2QV0A 1E3OC 2R47A 3G85A 4MR8B 4MQFB 5BR1A 5B3JA 3G5GA 2L2QA 2IKSA 3H5VA 1EHCA 4ZMSA 2XIUA 1EFAA 1EAYA 1EWTA 1QKKA 4RS3A 4DN6A 3CHYA 2E4YA 2FLWA 2E4UA 3KTOA 1MIHA 4MS3B 4MQEA 4KK4A 4LDZA 2IDMA 1ZZBA 3RVMA 1P6UA 2ZAYA 4KFCA 4F8JA 3OO0A 3UUGA 2QXYA 5EWJA 1JHZA 1ABEA 1JYEA 4MR9A 4KPYA 4NV3A 4EVRA 2WMYA 3EAFA 4JB0A 2H3HA 3MQ4A 2VUHB 2LYJA 5KI6A 3OMWA 2FEWB 2FQYA 2YHAA 1LQCA 2OR1L 3B7HA 1ADRA 2H8RA 1YS6A 2ID9A 2NT3A 7ABPA 3O9XA 2E4XA 1GT0C 3F51A 3O2QB 2KYRA 5CHYA 4E7PA 4NDWA 1R63A 3MA0A 1Z18A 1E6KA 4FN3A 1AU7A 2PJUA 2PUAA 1TVMA 1YVUA 4RDCA 4D74A 4NCBA 2PUFA 4Z9AA 5TE9A 3LUAA 1WH6A 2FVYA 2VYCA 3N0RA 3HXMA 4G0PA 1JH9A 3CZCA 3HUUA 2FMKA 2FTKE 2H0AA 4P1ZA 2HINA 3SCFA 1QQAA 4Z4HA 3Q7RA 1DZ3A 3BILA 2FMFA 1ZZ8A 3NHZA 4MR7A 1USKA 4YP9A 1QO0A 4EYKA 1NXTA 1PHRA 3IP7A 2JCGA 1SXIA 2QSJA 4RK7A 3RVSA 3TX6A 5KC8A 3TRBA 2PAFA 3KS9A 6CHYA 5EWMB 5K98B 3FYAA 1SXHA 3M9XA 4YGXB 2FXIA 2O20A 4LZLA 4YS6A 1WH8A 4IMJB 1PRVA 3G1WA 1FFGA 4PU7A 3CFYA 2PUDA 5FWXB 4RY9A 4YRZA 3SY8A 2FMHA 1ZDMA 1ZGZA 2QW1A 3QEMA 3HS3A 4Z5HA 2XI8A 1A0OA 4KMRA 4MAAA 3CRNA 2HQBA 4JAVC 3DGFC 5TQ0B 4ZJPA 4S04A 1DC8A 2KZ8A 4G86A 3LFTA 4ZPJA 5KQMA 1CEYA 1L1MA 3Q7TA 3QLUC 1BDIA 5IUKC 3GYBA 2IPNA 1FFSA 4JQDA 3PXPA 2R25B 1LK0A 1PUXA 2B4AA 2JVJA 5KQLA 3FFWA 1LLIA 4F11A 3E61A 3CG4A 4ETIA 1BVHA 2AXZA 1OXBB 2O49A 5FWYA 3BD1A 4JB2A 2MEZA 2BGGA 1ZPQA 2JRLA 3LMKA 1ZZ6A 5IULC 1K68A 4IF4A 4YARA 1RPEL 1Z2EA 2FSPA 3CLKA 3Q9SA 4LDAA 4YCSA 5B3JC 2JVLA 4LE0A 1YTUA 2CSFA 2RDMA 1ISRA 4Q6BA 3RH0A 1NTRA 3GA5A 3FYMA 3O1JC 2NT4A 4KK3A 4N0PA 1NERA 1RXEA 1NATA 4HYEA 3TMYA 2FN8A 5JNRA 5CNJA 1ZZ9A 4D6YA 1ZVVA 3OP9A 1ZS4A 2R48A 1KRXA 3N6VA 2LYKA 1USGA 3OLZA 4RWEA 3ILHA 3ZHMA 2VK2A 4O1IA 5CNIA 2AW6A 5JNUA 1S7EA 4J1WA 3KYJB 1TLFA 5IX8A 2CHEA 3C3KA 4EY3A 4WXEA 1GUBA 1U0SY 5FBKA 2O38A 2MYPA 3LOPA 2LYSA 1POUA 1KRWA 3OMXA 3Q7SA 1D2AA 3ZKCA 1DJMA 3BBLA 3GL9A 2FJRA 3CNBA 3CZ5A 2JBAA 1AB5A 1PERL 4MRMB 3OM1A 2CWDA 2AUWA 4LE1A 3ROTA 3O1HB 2BNOA 3HV2A 5E3JA 3EGCA 4S05A 3EODA 1NEQA 2JK1A 3BDNA 3OLYA 5EWLB 2OENG 1TMYA 3HDVA 3KHTA 2FKAA 3QELB 3QX8A 4MPTA 3QEKA 5TPWA 1R8JA 2GRLA 4WT7A 5C5CA 8ABPA 4N47A 2EWTA 1DCFA 2F8SA 3RQIA 1A2OA 4X4BA 4QYMA 5KQPA 3T95A 3I42A 4TMYA 2QVGA 1PRAA 3S8QA 2P4UA 4QICA 1JFVA 4G0OA 2TMYA 3QX9A 2PKXA 3M9WA 3T38A 1ZZCA 1ZH2A 3RVOA 2EF8A 2MYTA 4OLAA 1YS7A 3RVLA 2RJOA 4L85A 2WUSR 2F8TA 2GI4A 5BQ3A 2IOYA 4W5RA 1IC8A 1DWKA 1Z12A 3Q15C 1LBHA 3LTEA 1LJLA 3QLTA 3GBFA 1OXKB 4MGEA 4JOQA 3B2NA 1JX6A 2FQXA 2OQRA 2QR3A 3O21A 4MS4A 1ZY2A 2QVCA 3JPWA 3LUHA 2R1JL 2FW0A 1LCDA 3N0WA 4Z58A 4MQEB 4H3HB 3I45A 1MVOA 1BDJA 4H60A 2AXVA 2PUGA 3SG0A 2E4WA 3DLBA 5JNWA 3OLXA 1NXXA 4MYRA 4G0ZA 3MLFA 3IPCA 4TLLB 4G0MA 3HEBA 5JS2A 3IPAA 1E2BA 4YWHA 3OQOA 4MR9B 2Q5CA 3CTPA 3JS5A 4RSMA 1JDNA 2GKGA 4X4DA 2RGYA 3N8IA 4LRQA 3CG0A 5HSGA 1DW9A 2AWIA 3C3MA 3KSMA 3VNBA 1QNLA 3H5TA 4QYWA 3RVQA 1RZRD 3SCHA 1DRKA 4MCXA 2LYRA 5KQGA 3W9SA 1C0EA 3CECA 3BREA 2A9QA 3A0RB 3K9CA 3KCNA 2CROA 3D8UA 5CNKA 1JFSA 3I09A 2LYLA 3LUJA 4DADA 3O75A 3NNDA 3QK7A 3GRCA 4I6RA 1NY5A 3IP9A 3KLNA 4KREA 3FFXA 1DC7A 1EWKA 2R4QA 4L4UA 2LCVA 1U2PA 5C5EA 1DG9A 5D2CA 1SQ8A 4ZMRA 5JNSA 3DGEC 3ILYA 4Y9TA 2E4ZA 4X4IA 4N0QA 4YG7B 1Z16A 4RXTA 4YG1A 3OQMA 4NQRA 2WJAA 1QQBA 1MB0A 1XHFA 2PL9A 3OQNA 4MR7B 3C6QA 2WJWA 2DRIA 2D5VA 4FE4A 2IVBA 1DBWA 1VKRA 1VLZA 3GN5A 1B0NA 1PEYA 1Z26A 3KG2A 4FBIA 4RY8A 5GOTA 2AYZA 4OATA 2A6CA 2PPXA 4Z5DA 1JYFA 4PYRA 4KNYA 1P8AA 4PZ0A 4M88A 1UXCA 3QEMB 1I3CA 3TD9A 5IUNC 4Z4FA 4MS1A 5BRAA 3UFDA 2O4AA 3BRSA 3H6GA 5GQSA 3BS3A 1SD5A 2XSDC 2LP4Y 3CROL 3I5AA 5EWMA 4KV7A 3F6WA 2CD7A 3NBMA 1WETA 1YK1A 3JPYA 2GWRA 3JY6A 4RV5A 2BNMA 1XWWA 1M2FA 5FWYB 2MQKA 3IVPA 2LBPA 3F7NA 4NICA 1DP4A 3NNSA 4EVSA 1RZSA 4X4FA 3F52A 4PICA 5JNVA 1XHEA 4TN5A 4JCYA 1JF8A 3DZDA 1E6MA 1APBA 1QMPA 3A10A 3S99A 1GLGA 2XCJA 3SQNA 3N75A 3RVPA 3VNAA 2YHBA 5T7BA 2J48A 4E7OA 4G0XA 3FFTA 4RK0A 5HKOA 3IP6A 2ICPA 4PU8A 2FQWA 1D1PA 2IU7A 4LX8A 3O2SB 4DQDA 4X4EA 4I8TA 5TQJA 3RVRA 4JP1A 2JVKA 4RK1A 4YLEA 5IEBA 3QWGA 2PL1A 1EWVA 3EQ2A 2HSGA 3P9YA 3IP5A 1J56A 1FQWA 1LBIA 1RPJA 4ZYLA 2QZJA 3SNKA 1JL3A 2JVIA 1MB3A 3QQ6A 5DLEA 2EBYA 4EUKA 2JBAB 1YMVA 1ZZ7A 1HF0A 3OLVA 4IRXA 4MLCA 4ETNA 5TPZA 3H1FA 4YR7A 1W25A 9ABPA 3HUTA 1R69A 3OM0A 4WUTA 3L1PA 4IVZA 2P9HA 1WIZA 2PUEA 4X4HA 4IWRA 1Y1LA 3QF3A 4W5TA 4XARA 3UKJA 4EYOA 1LMB3 1DBQA 2HJ9A 4MCTA 4OB4A 5TQ2A 1YIOA 1F4VA 1ZGGA 3KLOA 4RXUA 2L49A 5TPWB 2WB4A 1SRRA 1HEYA 1D4ZA 1GUDA 1NXOA 3JVDA 1X57A 3DBIA 3HZHA 4KRFA 4PEVA 3K4HA 2GBPA 3TO5A 4CBVA 1F51E 2ICTA 3DLHA 2LPMA 4Z59A 4XASA 1GCGA 1Y9QA 2HPHA 3C97A 3IDOA 3N53A 3QLVA 2WWVD 3D1NI 4KQ9A 2XJ3A 1D5WA 1VRVA 4X4CA 2RJNA 4XFKA 3HZIB 3CU5A 4GNRA 2MSLA 5DGCA 3F73A 3LUCA 4Y42A 2PLNA 2BNNA 2IVGA 3FMVA 1NXWA 5FBHA 1DCKA 2X7XA 3ZHIA 5KC9A 5KWSA 1XWRA 2B1JA 2FLKA 2QU7A 4MQFA 4MR8A 4RK6A 4EYGA 5T3YA 3RVJA 4WXMA 1PEAA 3O2JA 2L19A 5IC5A 4MS3A 4Z4IA 1IIBA 3E3MA 4MS4B 1QO0D 1P2FA 4G0QA 4TLMB 4RXMA 5EWJB 2HQRA 2LUOA 4F3TA 4Z0NA 5PNTA 2IVQA 2JB9A 3H5WA 3FMYA 3VK0A 4X4GA 4EYQA 4Z4EA 4W5NA 3RZZA 2M1ZA 2A9PA 2PUBA 4OTZA 2LYQA 1OSLA 2A9RA 3H1GA 3OLWA 4JASB 4N41A 2XDYA 3R1FA 4GHJA 4YBAA 1VPWA 1H9CA 4XXHA 3FGZA 3SAJA 4F06A 1SXGA 2NZUG 1URPA 4H3KB 2PUCA 4KQCA 4RKQA 3HCWA 4Z4CA 3U3WA 3SCGA 3GWGA 2KEKA 4B09A 1BAPA 1ZN2A 2MSWA 2LYPA 2I6FA 3CLCA 3OO1A 1NXSA 5A7LA 3LUGA 1E6LA 1QP7A 1RNLA 1QP4A 1RIOA 3UK0A 1A04A 1TJYA 3MYYA 2R63A 3JXBC 3A0UA 1JDPA 3T6KA 3OMTA 1CYEA 4J1XA 5JS1A 3BRQA 3EJWA 2MYUA 4G97A 3H1EA 4P98A 4XLTA 4WZZA 3LUFA 2PMCA 5I4CA 3JXDL 1MAVA 3LISA 3D02A 3H5LA 4Z99A 3HVRA 3MIZA 4FB4A 2B5AA 1QP0A 2ZWMA 1T34A 4RKRA 1GCAA 3C3WA 2GZUA 3R0JA 4RK5A 4KVFA 4O8BA 4PU4C 4PU3C 2HQOA 3GV0A 3LFPA 1ZHHA 5ABPA
chains in the Genus database with same CATH superfamily
3TBKA 1P0QA 2QW8A 2YCLA 2JLYA 4KZPA 5D51S 4EQ6B 3ZTWA 5BN3B 1YMQA 1XCGB 4FK8A 4AQYB 1A82A 2A7QA 3IJRA 3F98A 1QDLB 1C3JA 4MRPA 4RTOA 2BM9A 2H1HA 1GL6A 1WHTB 1YJXA 3MS7A 3V8EA 4AO7A 1P7PA 2O3JA 3BMNB 2QVBA 3KSZO 5K8CA 3DV9A 4FNGA 1OTHA 1JPUA 4ANFA 2NTVA 4O4JA 1I6KA 2WJ4A 4ZVOA 3UENA 1H0KA 1WZ2A 4O2BB 1JIUA 1J06A 1QF6A 2DUWA 1E9EA 1I7NA 1FMFA 4W1PA 5B1YA 1Y7PA 3L2OB 1VSVA 1B8OA 3NALA 4A4DA 5HDQA 2WF8A 1U04A 1HQYE 3L6CA 2JLVA 2RHMA 4WNIA 3U0BA 5GM1A 1KETA 3NTRA 2AYYA 4UZEA 1LPOA 4KAFA 4C0XA 2BJCA 3C7AA 3UJ6A 3UZUA 3ILVA 4Q4CA 2BT4A 2Q9CA 3JWEA 2GD2A 5BSEA 4D43A 5C4MA 3AOEC 4EIWA 4R6WA 5LDDC 1C9JA 2FG5A 5KPJA 2ZRFA 4JP3A 5TGTA 1P6XA 5B37A 2OV3A 3RFCA 4LWOA 1G60A 1USVA 2ZQYA 1LQTA 4JLUA 4MI9A 4TS3A 4FZ5A 3ZV4A 3FZNA 4CVNA 4BVHA 4IICA 4QPCA 3TTWA 2J46A 3QU9A 5CDGA 1NRIA 2P3QA 1TM2A 4C5AA 3HSYA 4L08A 4OJYA 4HS9A 4PFJA 4QPJC 3IUBA 3CBQA 5TLSA 3UMMA 2WA1A 5GAGi 5KTSA 3IT3A 5ALOA 1E0DA 1P4AA 3O0TA 2FMTA 1JUDA 1YMUA 4XAQA 4C14A 2IDZA 3EZLA 3EQ8A 2NQ8A 3O4FA 2PXAA 3EZYA 1R6TA 3FZYA 4J2TA 1NBWB 2VLBA 3GGCA 4GT1A 3V9AA 1XVAA 2BLNA 3D8HA 1QWSA 1VLMA 3EQZA 4I19A 1A9XB 4RJ2A 5DW0A 4ZT5A 4Z3OA 1MT3A 4D3ZA 4D6XA 4Q19A 4YAGA 5DCWA 1FXSA 1E3LA 2AXPA 1KDRA 3KJQA 5TQ2B 4D4HA 3KJFA 4DV3B 3P2OA 3QLUA 1BRTA 2QU8A 4W8GA 4TKMA 3TNYA 5L45A 1VSUA 4DXDA 1N8KA 3O74A 1L5LA 1VL5A 2XVAA 4P4LA 2PE5A 4RHCA 2PCLA 2QKYA 1KIFA 3VU3A 4UHJA 3BWVA 1X1AA 2ZOSA 2J7PD 3EOBI 1TVKB 3M6MD 3SJZA 2CXXA 2AEEA 2PGIA 2ZUTA 3EF3A 3K0CC 4D82A 4DBLC 1ZI8A 1QGZA 3QPVA 3OZIA 1Z2PX 2OAQ1 4HAXA 4LMAA 1Z0DA 3WYFA 4BO3A 4CTMA 1T5HX 4OQLA 3SBOA 4MI3A 2AD5A 3EVCA 2VYVD 3X1XA 4QD3A 4CTJA 5KO2A 1MXFA 1J7KA 2GB4A 1KY5A 5IM4F 3IA2A 3RFVA 3RVMA 4ZO9A 3NDBB 3ZK8A 3C1AA 4K26A 2AWOA 1MO5A 2Q28A 1YE3A 3AEZA 1P0MA 10MHA 2H4JA 3QFRA 4DSZA 4CGZA 3EQ6A 4B79A 4AIRA 4AP9A 2DHCA 4JB0A 3MQ4A 4BAZA 1JH8A 2JJQA 1GPDG 3OJXA 4L9SA 3ZX4A 3LRTA 4G07A 1TK9A 5JLJA 1KWKA 2UXBB 1G5QA 1UXGA 1MB9A 2C5AA 3D6MA 3K2IA 5CHYA 4YV2A 5GM2A 1R63A 3AETB 3C24A 1M75A 4YJ3F 4TUYB 1E3WB 1JT9A 4CG3A 1UK6A 2C2YA 2NTEA 4GXNA 4CF3A 3ASYA 2BFBB 4RL4A 4PQYA 3T7IA 2CXUA 3V32A 3VO9A 4DJFC 3RADC 1JSLA 1PTJC 2WTEA 4LTNA 1HNZB 4EBFA 2EATA 3O8QB 2PXHA 1VL0A 4XZ3A 3KR9A 3N0RA 3C74A 5L51A 5K2OA 4OXNA 5B3AA 2ASEA 2ZB4A 3DV0B 4M7RA 2FMKA 4TTRA 4OV6B 2P9JA 3X1JA 3BXXA 1DZ3A 1HT1E 2BMFA 2FMFA 2QN1A 3UK6A 2VSFA 3ZDFA 5IJWA 2Z4SA 2VH5R 3BE5A 2Z43A 3PC8C 4US0R 1PHRA 5FPTA 1HMPA 3OETA 3RVSA 2DXIA 4MMYB 1I9CA 1UQTA 3RLFA 5T4FA 4CMEC 1NJ6A 1JIKA 2AKAB 1GTL1 1MIOA 2HPAA 1ZD3A 2I2WA 3A11A 3EXHB 4RKFA 2O14A 4WECA 4YRCA 3W04A 4C05A 3ACBA 4MIEA 1K1EA 1E4VA 1LFDB 2FPGB 4ER0A 3BOSA 3MBKA 2XGJA 1DQNA 1XC7A 3QEMA 1A0OA 3FTEA 2QENA 5JI3E 5IMBA 1ZSVA 2R65A 1P72A 4E0BA 5C53B 2G9QA 5DNYB 2I78A 4PAOA 4PSCA 2REBA 3E58A 4PX2A 3NJ8A 1WG8A 5TS3A 1PUXA 1XJ0A 2PGXA 4CFSA 4V0SA 2FNAA 4ZWNA 4FHFA 3BFVA 3QA3E 4DG8A 1U2DC 2HC9A 5J63A 1Q19A 1OXBB 1WCIB 4URXR 3VH1A 2H57A 1W5FA 1PJBA 2FWPA 3BTSA 3TTTA 1SQGA 4JKYA 3ZKWA 5AUNB 5KX5F 1VCNA 5C31A 2EDCA 1HFEL 2RSLA 4A73A 4BVJA 4M0EA 1QG2A 3H9BA 3K2EA 5AVKA 5TEVA 1DMRA 4N0PA 5AKZA 4P84A 1NERA 1NATA 4UNRA 2GZAA 4FUQA 3KQTA 5HS6A 3OF3A 2V5AA 3I1IA 1F2UA 1BWQA 1HH4A 1NBME 3IMCA 2VA9A 3P32A 4OHBA 1W85A 4RY2A 5A6SA 3RT1A 5BVHB 4NYMQ 3ZV6A 3IC5A 3WDMA 4D7AA 2DHQA 1G0NA 3OJFA 4M76B 4DCCA 1RT9A 4CR7A 3PJEA 3UH0A 2G82A 2CXHA 1L7DA 3PF9A 3NM4A 2C3YA 1XZEA 2J9XB 3CX3A 3VDXA 1EB9A 1MQ9A 3D4OA 2PXLA 4YASA 2ZB2A 5AW4A 1O03A 3B1XA 1SRQA 1BXGA 1O9BA 2VI5A 3F5DA 2ZFUA 3WADA 3MGBA 3HO8A 4ZRMA 3OJCA 1RI2A 3RC3A 1M2VB 3D2CA 4G1BA 4OL9A 4P4TA 5FF9A 1DCFA 4N47A 5JRJA 1FNNA 1TC1A 3BIJA 5KQPA 3CLUC 3N7UA 1AHHA 1JFVA 2SNIE 3CR3C 1DBIA 3TR6A 3U5TA 2P0YA 1V7QA 4HTAA 4QELA 1UMKA 5DXAA 3HVJA 1N1GA 1QHEA 1CTQA 5JECA 5B58C 1V0JA 3WTBA 5E6UA 1Q57A 2A5GA 5CUQA 1JHVA 3R6DA 1JMKC 3WVNA 3DWFA 3L6BA 4XQ0A 1GZ7A 1H5UA 1VRCA 4YV0A 1GAXA 1PVVA 3B2QA 3FYUB 3PPXA 3M6WA 4HSEA 4HQKA 1TU4A 2NVBA 1ZOLA 2BKAA 2Y1WA 4A2QA 4DLYA 3R3YA 1MQAA 4Y1FA 2PVPA 2FW0A 1QK4A 5YASA 1YR7A 4MQLA 1FW6A 2X9QA 3M1LA 3BULA 3PCTA 4XDYA 4KE8A 3TLJA 2Q50A 4JYMA 5DTMA 3UWDA 1TD1A 1F2VA 1ZMXA 3AINA 2PMKA 3QV2A 3JVEA 3R0IA 4EM6A 1C8KA 4M6WB 5AW2A 4LYAA 1U1DA 4TTSA 3TTYA 4TXJA 4X9XA 3L0OA 1D4AA 1MO3A 5K8VA 2QTLA 4MWGA 2AQIA 4IDHA 5HWSA 1ZA1A 4A1FA 1JG3A 1XRJA 3Q5EA 4LGCA 3H5AA 3VPBA 2A0KA 4BZXA 4DWJA 4S2EA 1VE6A 4A15A 5JZOA 4NJEB 1GKUB 5AJTA 4EFLA 4CEHB 1HM5A 3DMNA 3ESXA 3CJQA 4ER7A 3PDHA 3GGDA 3INNA 3QK7A 3B9RA 4I6RA 3DBHA 1CY7A 2UZIR 4PIPA 1AKUA 2ID4A 2XDQA 5IF9A 3KSBC 4BP9A 3NHUA 1U2PA 4DBZA 3I9OA 3LGXA 1W9MA 2ZYAA 1AF7A 3GRKA 1KVRA 3C3DA 1JJBA 2GK4A 2BTQA 2JCXA 3DGEC 3F6YA 3IPRA 4NONA 4X97A 4Y9TA 4YG7B 5CEJA 3EXFB 3GIDA 1CUXA 4IJVA 3ND7A 3CVJA 4FYHA 4J0DA 2ACEA 4MV4A 3ZLTA 3ER6A 1NJ8A 2HKIA 2R5NA 3B3AA 1QTIA 1ZNXA 4DZZA 2WKPA 3MUEA 3R0ZA 3O4HA 1FCJA 2CXRA 2FSVC 1QDUA 1F4LA 1YGYA 4WY5A 4W7IA 1M76A 2B4QA 1BU8A 1E7MA 3TUIC 1EFDN 2WYOA 3G68A 3IXQA 3ZHBA 4Z5DA 1E3JA 1KDPA 1GTMA 3ZV7A 1CE8A 1USUA 1X1EA 3H83A 3S8MA 2J3EA 1IN5A 1I24A 3TD9A 5IUNC 1HSOA 1FJGB 3KDAA 521PA 5BRAA 1EDZA 2NSDA 4OA5A 4Q4HB 3TGWA 4B4KA 3QHPA 1ZOOA 4JEUA 4RZHA 4DA8A 3PGXA 3SYNA 3P0EA 2ECKA 4PPGA 1KMMA 3Q3VA 2VRNA 4C2UA 1QE0A 3DOJA 2VTDA 3NRCA 4JDPA 4P5DA 4AJ9A 3U40A 2BNMA 1WCWA 1DI0A 2R87A 4JBYA 3V48A 3VVBA 4JL6A 5FL7D 3WMWA 5KU1A 1RXWA 2MQKA 1ORIA 2OO3A 3I8XA 2XDWA 4EKIA 3GPCA 3ZY3A 4CM7A 3E7XA 4ZVUA 3AEKB 3IOCA 2ZBRA 1WXEA 2ZEJA 4DV1B 4O6VA 5KSOA 1Y9DA 5KTYA 4G1MB 2ODAA 2DF8A 3RUEA 3TXXA 2LTAA 5I3ZA 2OSBA 4RDXA 4EATA 2WSLA 3IR7A 1EHIA 1H22A 2IBTA 1T15A 2CNNA 1NLZA 2YWCA 3OTIA 4GPIB 5DT9A 1CQJA 2JIBA 1J0BA 4G5QA 1I0ZA 2C1ZA 4AG5A 4RTKA 3IQIX 4Z0PA 3HR7A 3VR2A 5IZCA 3M9LA 3PTZA 3TJRA 5CFPA 3RC1A 3KZMA 2EAUA 1G8PA 4Q7KA 4W1RA 4BE9A 4J0FA 4O2AB 4JLJA 5DBGA 4CEIA 5IP5A 3ZHCA 2XXAA 3E3NA 1IDN1 1U3CA 3EQ7A 2FWBA 4BLOA 4RTMA 1BCSB 4NDNE 1V6AA 2PX3A 4QGFA 2BP7B 2VXCA 3ZPXA 2ONZA 1RBZA 2R8XA 3DEYX 3H5NA 3O6VA 3P71T 4RH1A 1HF0A 5K45A 5E8JA 5EHGA 1YFJA 2Y2UA 2IS4A 3VTKA 1FSSA 1KMHA 4YT4A 1U0JA 1RADA 4YR7A 1W25A 1CUVA 3OX4A 5HNKA 3EE6A 2XNSA 4JLOA 4US2R 2RGGA 4ZT3A 2PWPA 2EIXA 3H2IA 3I2GA 1SXPA 6GPBA 2VHZA 1HWYA 1F4VA 3H4IA 1H2EA 4MVWA 1E61A 4LVNA 2YXPX 1HEYA 2AL7A 4LEIA 4MHOA 4WH0A 1L4MA 2ZWAA 3QVJA 4C6TB 4KJXA 1F51E 4CV1A 1CJSA 3D2AA 1ETHA 2FP4B 2WOJA 1VHQA 3F7OA 3PPVA 5CJJA 3QBJA 2Z56A 4B3SB 3WGZA 1YONA 4D9HA 3M5CA 3S81A 2N0SA 1NDQA 2ZRMA 3IHLA 4RHTA 2EARA 3FPJA 3IDSA 3MSCA 5EP2A 4WZAA 2H1CA 2OQVA 4BLPA 1EDEA 4R3WA 4EG1A 1QRDA 1NXWA 2CBZA 2WJYA 2YYZA 3VU9A 1S2DA 4K81B 2JQEA 2PD6A 121PA 1JQDA 3KVVA 3AL2A 4WZ6A 1B43A 3E7WA 1A9SA 5CX1A 1QVAA 4C22A 3OSUA 5ALSA 3PHBE 1B15A 4M0UA 4YTEA 4X7RA 5FOUA 1X7ZA 4BAGA 5L3SB 1NI5A 3LT5A 5B53A 2PSJA 1G19A 3UCEA 4QUIA 1ADFA 5HX7A 5AK3A 1E64A 1H0SA 3VDMA 5G53C 1GRNA 1XMSA 3GF4A 3QHQA 4H1TA 4YJ3A 1NVVQ 2EYUA 2XYGA 2HO4A 1TCBA 1N5KA 4YRQA 1ZR2A 3FUUA 3LQQA 1EBUA 3RZZA 2Q3JA 3ABZA 3BERA 4M2LA 3VR6H 1AQNA 3REFA 3L7NA 2GJAA 4KL8S 1TJ4A 5K3CA 3UMGA 4ECEA 3EIWA 4C2AA 5CBPB 4LFBB 4EYEA 1CDDA 2JI6A 1J21A 4H6PA 4KQCA 4KV9A 4N65A 4NU5A 1E2NA 2QLLA 1FLDA 2HNAA 3MPUA 4IWXA 5ALDA 5IN4A 3PL1A 2APJA 4OD0A 5FX2A 4RTPA 4LBWA 5HMMA 2DVMA 4WK6A 3THWB 3LUGA 4AF6A 3WJAA 1R10A 2CMHA 3JQDA 4M38A 2PN1A 3TQQA 2A7XA 2BUAA 2ZULA 5BPHA 4FHZA 1GL3A 3FGOA 2YJ4A 4UUMA 3DZKA 5NULA 4LGVA 3DP9A 4D4GA 2X19A 2N1MA 4EP1A 1LBQA 1ZIXA 3LUFA 4B7ZA 4G56A 4GYKA 5K0LA 2CLHB 1P2SA 3GGJA 3RUAA 1LGYA 2W93A 3AJEA 4MOWA 3TINA 2BGRA 4ID9A 2PUJA 3TDMA 3K70D 3EPKA 2FOLA 2NX2A 3IOYA 1E9BA 3KSRA 4I99A 3BYZA 5GONF 1JEJA 3W78A 4GM1A 4YUWA 3L46A 3GN5B 1XNRB 1XCLA 3DAGA 1M2OA 2JAUA 1L7QA 2XUZA 5JO9A 3QFSA 1ZH4A 4N7RA 5JAPA 3F1KA 1ZESA 3HNPA 3FD8A 2YINC 3FWHA 2Q2VA 5KX5A 1MEOA 1UBRS 4G24A 4LF4B 1QZUA 4LOIA 4F45A 3ENQA 3IDQA 5HJ2A 2COKA 2J7UA 4FR5A 1L4BA 3I1JA 1ZK1A 3L1VA 4IDAA 4ISBA 1OBOA 4E5SA 1QP8A 2Y1XA 4K9KA 1NW9B 2Q6LA 4YV7A 5AI8A 2EWVA 4N18A 1HT0A 1IWBB 3GOHA 1QVZA 4LJYA 4WCFA 3SDSA 2WB2A 3VKGA 1YULA 3KAQA 3I32A 3MWJA 4AS3A 1CUUA 3GU3A 4ZIRB 3E1GA 2PH5A 4MYUA 4OLHA 3TFWA 3FR8A 2QUKA 1JQKA 4IFTA 1DRJA 2H51A 5TMEA 1JEOA 1SA0A 1YQUA 2L18A 4O2BF 2YV1A 2MDTA 5FQNA 5AKGA 2E21A 1OXVA 2CMDA 3OCUA 4KYIB 3WV4A 2YMMA 3DE4X 1F9AA 3N8HA 1UIMA 5DM60 2B99A 1YBVA 1E79D 1E58A 1QE5A 1U6IA 1YDGA 1HFJA 2ODQA 1JVSA 4FPXA 3VAAA 2GZSA 4EPYA 5CK4A 3TH5A 4YPOA 5IVPA 1FK8A 4PYKA 3TRIA 5JYCA 1GU1A 2W83A 1OVMA 1NC3A 3W8NA 4HNSA 1OB2A 3BMOA 3F6EX 1B0PA 1KSFX 1O2DA 1P1RA 4K9PA 3TG2A 4LZWA 1D6JA 4QDXA 2KW5A 2Y1CA 2QX4A 4A8JC 1X7GA 2C78A 1W48A 4LDNA 2XNKA 2VHEA 4H7EA 5CVDA 2ZJ0A 1LCCA 5BSFA 5EKXA 3MXOA 4MW6A 3IO3A 3GX1A 3WA6A 1PWZA 2HNKA 5KWVA 4KAXA 1CQTA 2AYXA 2OD9A 5I9BA 1ESEA 4C4RA 4WNAA 1O4XA 3A9ZA 4KCGA 4EY7A 1K6XA 2VP3A 4JJZA 2V0NA 3AF4A 1HNWB 4MVXA 1PR6A 5TY0A 3VNUA 2W00A 1U9JA 3U3ZA 1UFKA 3ZN2A 4D9JA 1Z3IX 4DLBA 4MVJD 4B46A 1CF4A 2J9ZB 3TRDA 2GN9A 3F6CA 4ZC8A 1FDUA 4WL0A 2IFTA 3C7CB 4TN1A 1II0A 3E9DA 4DIEA 1GPH1 1K0FA 1JZSA 5CLFA 2EKDA 3QF4B 2DTEA 3PXUA 3QNUA 1J0XO 3RWMB 1N32B 1U7XA 2FI1A 1ETUA 4D0GA 5LLDA 2H00A 3U60B 4JD5A 4RTJA 2YIJA 1F6WA 3LECA 4PG7A 2AJCA 1TJNA 3TLCA 4BN0A 3SVTA 3SQXA 2G0TA 5BRJA 2GF9A 1KAEA 2CXOA 3OT1A 3QU4A 5MHTA 2XECA 2OQ2A 1MPXA 4D8TA 2WKRA 2XZPA 2RBEA 2GVDC 1R37A 2D2IA 1NVGA 5I7EA 4YRLA 5B3JA 3DUFA 3H5VA 3DNMA 1EHCA 3OFKA 4DV4B 1EAYA 5CG1A 3FMIA 3ROEA 2E4YA 4LJSA 2XYPA 3DF9A 4MS3B 5BSHA 4E2YA 3ORHA 1ZH8A 4KAAA 4I1PA 1TZBA 3A6LA 3JATA 1Y3BE 5IZ4A 1RXVA 3PIDA 2GQ0A 3GJYA 4FFSA 2BV3A 1YCDA 2C2WA 2V3WA 2XE8A 3FTNA 3IIIA 3IPLA 4N4AA 1ABEA 4DWWA 4YDQA 1SKAA 1UJ5A 2QYHA 3AM4A 4U0KA 5KHOC 1VL8A 3SJ7A 2ZU6A 1LQCA 1EXWA 3Q3CA 3QSYA 4V0ME 3RVDA 4ZXFA 4UE6A 3DONA 2FFJA 2B7BA 2Q3EA 3ZNOA 3DW3X 4LVUA 3I3OA 4PYOA 3M5WA 2EX0A 5IWAB 4O2LA 3IPYA 1MAHA 4MUAA 3GLHA 1IULA 3L8CA 2FSFA 2JHAA 3OF5A 4NH0A 2RONA 1V5WA 2YXBA 1WXFA 1A9PA 3DLAA 3JASA 4O3FA 5BY2A 5LZ9A 3MJ4A 3CZCA 1XXLA 2XGMA 5GMOA 4OXIA 1MJNA 1O94A 2XQGA 4CTKA 1BO6A 4TUYF 4B7XA 1N0VC 3E8XA 1AKQA 1GUFA 3LL4A 1H6CA 3FZQA 4CUKA 2JIPA 2WYIA 5IN5A 3ZR4B 3RS3A 5DTIA 1JXOA 1V3TA 3MN1A 1LNQA 4HB3A 1GRQA 2FXIA 3I2FA 3TFQA 1V43A 3CTMA 1QAOA 1L7AA 3ADCA 1Y5NA 3AHDA 1XZNA 3M1YA 2P2ZA 3PQ3A 4NCBA 2XOEA 3G79A 3FUWA 3B2EA 3FE2A 4NXNB 1GUYA 3G5TA 3QG5A 4HDSA 4P4SA 5LNK6 4PXAA 1CEYA 1SHKA 5EAIA 4RZ3A 1FVHA 3GWZA 4H3VA 3H2YA 4K0RA 2IPNA 3GVPA 5GV8A 2X6RA 1L4HA 1NGSA 4CDGA 1KFJB 1MX3A 3LDAA 4M37A 2HM7A 5SY4A 3ZY4A 1EWYA 1NL3A 3ONVA 1J8QA 2C5HA 3ZDQA 2YVLA 1T2FA 4J3FA 1E5VA 1SFRA 1G4AE 3QUBA 4JB2A 2M6SA 3GLGA 1O8CA 3ICEA 2NO5A 3OZ7A 3R7FA 1BW9B 4WSOA 5E2BA 3UJDA 1XZCA 5AJHA 4J0GA 2W4QA 1IEXA 2FSPA 2R6R1 3CLKA 2GZDA 4OUDB 5TQVA 4B3CA 1PZHA 2DPHA 5IS2A 2HMSA 3EWNA 3W3AH 1ISRA 4DEVA 3KPWA 1IY0A 5T57A 4F3RA 3FPGA 1O1YA 4CIVA 3AG6A 3CLRD 4L4RA 4KK3A 5A9RA 2FW7A 5LC1A 2I7TA 4EPXA 4HLUA 4A10A 3U4QB 3FWPA 1GNLA 4LHYA 3N6VA 2HCBA 5DP1A 4XYGA 2E7ZA 2XBMA 2CJFA 3SJCA 4K05A 4J1WA 2OCAA 4PTYA 4MHSA 5IJ0B 5I4KA 2H2HA 1S02A 1VMIA 4EI8A 4X44A 3TLYA 2GH1A 2CE2X 3ZHOA 3OMXA 3Q7SA 3GLGE 1EFLA 3CT6A 3BBLA 3EXEA 1YB1A 5AK4A 4ROTA 1X9IA 1PERL 1YKSA 2PSHA 3IJPA 1Y7TA 3IUSA 3H9QA 3NR2A 3R3HA 4WEOA 4EB8A 1E89A 4ROSA 2C4VA 1CUDA 1JW9B 1S2MA 4W4TA 4BHTA 4XQCA 2CNBA 2VKQA 2QN6A 2XWJI 3NYIA 3V8NA 3BAFA 3E3LA 2UVDA 2F59A 5CT9A 3WLEA 1XAGA 2Y9PB 3VBEA 1R0YA 1UBOS 1O95D 1E3SA 2EWMA 2BVNA 3QEKA 5LKAA 3T35A 1XJWA 4R9RA 1NYLA 4ZJZA 1RJEA 2CKMA 4ZCLA 3RQIA 3RS4A 4DE5A 1A2OA 4FOPA 5B1IA 3VX3A 3B1VA 4B45A 1S3SA 3BUSA 3H86A 3KPJA 2Z9CA 3QX9A 5KVQA 1XRRA 4TTTS 1ODTC 4IXTA 3HMQA 2OM2A 4G0UA 3ETCA 3I9MA 1GN8A 4N54A 4KQEA 1ODFA 4TMTA 5B1DA 2QYOA 2ZIFA 3GP5A 3CM0A 4HXEB 3SWWA 2OGSA 2QDXA 4Y2PA 4HGPA 2VO1A 2VJQA 5LYYA 1LX7A 1GXSA 1WMSA 1ZXXA 3I4CA 2QN8A 5HIJA 4UC0A 1SUWA 2WUWE 4YRKA 2V8BA 2C7OA 3EVEA 3CLSC 3BT7A 3JPWA 4PSVA 1DBVO 2WT9A 2ZGVA 1S5PA 3JYHA 3HACA 4Z58A 3KQYA 3KUKA 3OQ1A 3AGQA 4R2KA 2BR3A 3I45A 1BDJA 1JG1A 1RE1A 1XCPA 3DE2X 5JNWA 3SF0A 1Y3IA 2HGSA 2GAIA 4MYRA 3FPKA 3FHOA 1A9ZA 3NBAA 3HXPA 4UUNA 4RENA 1KI4A 2ERXA 4RSMA 4KXYA 1R5NA 1JDNA 3LJKA 4Q24A 1WULS 4XM2A 3ADBA 3PKIA 1W36D 4WX2B 5HE9A 3MCZA 2Y05A 4WIAA 5JAIA 1V4VA 4LY6A 4R2HA 5DYTA 3BPSA 3VYSB 3W05A 1W6RA 3RU2A 1WOYA 4ZEVA 4QHYA 4YJHB 1CW2B 4BNGA 3GRPA 5JADA 1GTG1 2QUIA 3A0RB 3KCNA 3TXAA 2WMDA 2W0MA 3IEPA 3TDNA 5KVSA 2IELA 5J2UA 4OLFA 1OKKA 4UD2A 2ZRJA 3HZRA 4PO8A 3O75A 4CFZA 1OFHA 3ETLA 3PGMA 5GONA 1FMCA 3WRWA 2FZ5A 4ZQEA 2QM3A 1AK9A 4L4UA 1N3LA 2CNDA 1UZMA 3CUEF 4QQNA 4UUOA 4L9WA 2PX8A 4IAOA 1NR7A 1QZ3A 1SHUX 2P6OA 4DDTA 1WDTA 5J5AA 5J43A 2IS1A 2J32A 2XRMA 2GS9A 1Z16A 2BEUA 3WBKA 2NPOA 4ON9A 2PL9A 4XDHA 4BKRA 1FXWA 1NW5A 1SXJC 4B81A 3NVMB 1YJBA 2NNWB 2GD1O 2GPBA 4FE4A 3LV8A 3LDHA 3KKLA 2YS6A 5BN3A 1ADGA 1C0LA 3L7YA 3S2FA 3TUJC 5E7MA 4CF4A 3GD5A 4OATA 1Z75A 1FMJA 2FJ0A 2JLBA 1GYQA 1WHTA 2OXTA 1ZRMA 2V6IA 3IOBA 3WOHA 3BMNA 3C6ZA 4KQIA 1UXCA 1I3CA 1U1CA 4MLZA 1BMFA 3VZBA 2WUVA 5CFQA 1Q0LA 2CYCA 4O2BA 4QULA 2B4TO 3JXEA 4KG7A 4R71A 3F74A 2PSSA 1RRKA 2R84A 1NUTA 5IDYA 4D9MA 5CA1B 1XLTA 3UMYA 3GJXC 3PZBA 1XL1A 1MOZA 3JD2A 3F6WA 1JU9A 3NBMA 2H52A 2N75A 3HRKA 2J4CA 1QR6A 2QQFA 4FSXA 3WLFA 3SXJA 2DULA 1B8NA 1XOIA 5ESRA 2NZ8A 2ORYA 2JA2A 3E5RA 2VJYA 4NV1A 4B32A 2NADA 5KU7A 5BXQC 3U1VA 2VNIA 4IQ8A 4KQGA 4PICA 4NCHA 1UMDB 3UICA 3ZOZA 4EKNB 1CEEA 1PR3A 1QH1B 1BOOA 4U3JB 3I6QA 1N0IA 1ZI9A 2P11A 4KEAA 1FP2A 3I2YX 2VIIA 5IT5A 3A10A 5DYWA 2E5LB 4JI8B 3LBNA 1GLGA 4LZNA 5KYTA 4ZU1X 3N74A 4RL6A 2JDID 2H1IA 3VNAA 3K70B 1JPJA 1TT5B 2BMVA 2IOHA 3BZWA 3G59A 1TAGA 4JXXA 2Y92A 1F0PA 3SIPA 1WXWA 5C8DA 1J0EA 4M1SA 2PFKA 3IP6A 1XRLA 4C89A 3RFTA 2YY6A 1V9CA 1VPEA 2GEKA 4N6NA 1DQZA 1C3VA 2MTBA 5B36A 1REQB 1U3GA 2JBAB 4ZU6X 1ZZ7A 4BDSA 3E4CA 4HGZA 4RMJA 3PLAE 3DT6A 4ENWA 1I7DA 1A5ZA 1XZDA 2UUPA 1SCJA 1BHJA 2V7XA 4GFDA 1O96B 1T2UA 4NYJR 1XT6A 1Y1LA 4L8FA 1A9XA 4O2AF 5CGQB 4DMFA 5LIPA 1G21B 4L5CA 4RADA 1J4AA 4V2UA 4EYOA 4FDLA 4QBKA 3OWOA 4NTZA 4QOGA 1H85A 5TQ2A 3WGKA 2C7PA 3N0VA 1L5HB 5DO9A 1MCZA 4UE3S 1GRCA 1NLMA 3OU7A 5HCIA 1HEUA 1FP7A 4JVMA 4ZT6A 4R2WA 2R1ZA 4I8XA 1XDBA 4JQCA 3H16A 4EGAA 4L76A 1Z5PA 1PJ4A 4QYTA 2ORIA 2CMFA 4ZZIA 1RFGE 3QLVA 5BQ5A 5EJ6A 1F1BA 4NU0A 2QX6A 1JR3A 2KLBA 3KVYA 3W1WA 1TT7A 3A9TA 4OHCA 2WSIA 3HXTA 4ZAZA 3F73A 4KPGA 5BV1A 3P1JA 3QXGA 4POAA 1A8QA 4D9KA 5AVXA 4B3RB 2ZBGA 1XCOA 1XWRA 5JS7A 4MDFA 1M34E 1LRLA 3QYPA 3ECCA 4C6SA 3CXRA 3I2JA 4WXMA 4XFDA 3PG5A 4IHQA 2AG0A 4M1YA 2NYRA 5DPMA 2F43B 2W5UA 3OESA 3DLPX 5CJ2A 4B1FA 2NAFA 4HLQB 3DNFA 4MJXA 5DK6A 4BBPA 3JQ6A 5EWJB 1I8TA 4Q12A 5AVSA 4RS4A 3KETA 3JRXA 1ZCJA 2XJ4A 5D8DA 3ES9A 2C9BA 2IVQA 2DBRA 3HB0A 3MWFA 4G0VA 2I4IA 4W5NA 3DWEX 4AKEA 1PSZA 4J1TC 3NROA 4Q3AA 4OTZA 4XEHA 1U0TA 1LRKA 2A9RA 4FT4A 3N2IA 4FIDA 4GC9A 4HEHA 3VX4A 1JR3E 1LPAB 3N8NA 4JY7A 4QQRA 4W9NC 2B1RA 3NHPA 3WQSB 4DAOA 3K5PA 1JZQA 4OAPA 3KPUA 3AETA 3REOA 3I61A 3T1YB 1C9EA 3GWGA 4CU5A 4TUYA 1E3WA 1VI2A 2YOFA 2PBLA 1DG1G 1U4NA 3IS3A 4AC9A 4EJ0A 4MW5A 6LDHA 4MMZB 1TM4E 2BFBA 3E9CA 1YF3A 1P2DA 1EGAA 4AJOA 3O8QA 4WFQA 4EMTA 1PS0A 4IJQA 3LO8A 3Q3IA 3PFHA 4J7AA 3DV0A 1LLUA 1N8TA 3NGLA 1ADCA 2E9SA 2O07A 2JIOA 2JZOA 5EE0A 4PV7A 3GDOA 3EUWA 4Q37A 3W6OA 5D7BA 2I7XA 2CV0A 1C41A 3VUEA 1FLAA 3C3WA 4P92A 4Z1MD 2HQOA 4OKSA 3GV0A 4GPZA 1ZHHA 1TUBB 1BIFA 4TWZA 3WISA 4BO8A 4UTPA 3VGJA 4O4IF 3H9CA 4P7FA 2XMPA 5FWAA 4RZIA 2W37A 2FPGA 3DMPA 1V8BA 1M0EA 2QJTA 3T9FA 4FQ8A 1GUZA 5DLDA 1HX7A 4DT1B 3RUDA 2ZVDA 4UUBA 1JBQA 1D0SA 1E4YA 1CRLA 2YW2A 3D6NB 2PH1A 3D6UA 5A06A 3G02A 1CJBA 5KVVA 1RZRA 5DOVA 1YSEA 5JMOA 2CV2A 1ZVMA 2JATA 3HUDA 2K7FA 5JS1A 3JXCL 1COWA 2C61A 2XNDA 4CETA 1D07A 4CXMA 3CNNA 4LBYA 3WLTA 1NT4A 1SUFA 4AB1A 1Y7IA 3H6HA 3MCVA 1NF3A 3MGAA 5H02A 5JDIA 4Z0HO 2BELA 2XTNA 3N59A 1PJ8A 3C16C 1US8B 3LF1A 2ZUUA 1AKVA 4LTDA 3HB5X 5K51A 4CM3A 4AXXA 1WDMA 4F12A 2H1SA 1KBQA 5F1PA 4P80A 5EN4A 2WIDA 3MAAC 4Z9YA 1K66A 1NI3A 2NVWA 4HS4A 3IELA 1COZA 3G9XA 3T06B 3Q98A 1GV0A 3HXLA 5K5EA 3V7WA 3WLIA 4NE9A 4J43A 3BE4A 3JR3A 4H16A 4ZI5A 1BEUB 3T94A 3AONB 2DKOA 4PHCA 1ONNA 4DC0A 3Q41A 3NONA 3JYPA 5CB4B 1GPJA 1DIOB 5JJCA 4IXMA 3VHRA 4YROA 2AFHB 1DLJA 4BV3A 5CG2A 5BVHA 4CKWB 1VHJA 1Y6RA 5DHSA 3K16A 3KKEA 4AUKA 4EG7A 2PXQA 1Z9BA 4UEQA 3X43A 1PBNA 4N76A 2N1BA 4IA8A 3KJXA 1MKYA 1NBEA 1DX6A 3BIFA 4IVNA 2JGAA 4OQFA 2YXLA 1OPRA 4ER6A 1NVKA 5C5IA 1EQAA 3OX1A 4CLRB 4LDRA 1BD4A 1UJBA 3PC6A 2QBYB 2MSKA 1S1MA 2QVZX 3MLAA 1TYAE 2OCKA 2VP5A 3INYA 1C4KA 3KZ3A 4N0EA 4ES6A 3GK3A 2MMCA 1VKNA 1ZINA 2PL5A 1W0JA 3MINB 3N2YA 4KUEA 3DNPA 4KLCA 3RTGA 6ADHA 1V2GA 4RJIA 4ETMA 3M4YA 4B5LA 4S24A 2WKQA 2FQ1A 1M2VA 3IXLA 4KWTA 4Q9IA 1FYVA 4P83A 4UAJA 4YFVA 3I9LA 3ZDCA 4FLEA 4RU1A 4DNFA 1XZQA 5E6SB 1AKNA 1HLDA 1R66A 3GJ4A 3MAJA 4JSRA 5JW6A 1KO5A 2D8AA 3Q7EA 3S1LA 3TEMA 1P2VA 4NG5A 3MWYW 5D5HA 2MSCB 4MYTA 4DMCA 3BK7A 5HIAA 1PRYA 1LRJA 2JFUA 2P2CA 3O92A 2OO5C 1X7HA 2P6PA 4MPPA 4P35A 4WBXC 4A0QA 5C4GB 3I37X 4IQ4A 2QRUA 2XQVA 4QECA 4REQA 5AKKA 1I13A 3AUKA 5IVHA 3K8ZA 4JT8A 3PJRA 5LUBA 1YK0A 3SU8A 1DAKA 2ZJ7A 1DWPA 2H0RA 2QXTA 3FYUA 2EVWX 4IWYA 4Y6GB 1Y6ZA 3G5GA 3EEQA 5FXMA 3ZS8A 2XIUA 2VF2A 3MG9A 1NVDA 1GQ2A 4HDQB 2AF3C 2E2WA 1CNMA 1YOVB 3K4QA 1NRWA 2XZOA 2WUEA 4J0JA 1ZJYA 2V7PA 1RLUA 3Q85A 5CVJA 1P6UA 2HK8A 1LLCA 3G0BA 4ZOCA 1CZUA 1EJBA 1RWQA 4JCOA 5CTJA 4F1JA 2HXYA 3LDFA 5KSWB 2R5FA 4WOKA 1KJ9A 4ADSG 1Z0JA 2EV9A 2E4AA 4LHWA 5KKCA 5FO0A 4BJ3A 1W6UA 4NZ9A 2UDPA 3SQDA 1E6WA 4MJLA 4M0PA 2WWIA 1MR3F 3FHJA 1EZZA 1GOTA 2FW6A 2KYRA 4J0IA 4NJEA 4C0QC 2EG9A 1ZJZA 2P6RA 4CEHA 4JKOA 4UU1A 1GZSA 4RSGA 3UK7A 2Q5FA 4WMLA 2X8WA 2XQIA 3P2KA 5CIWA 4DOMA 4PYJA 4PZYA 3E9YA 4PFQA 4DCOA 3WL5A 2BKLA 2YJ6A 3PNBA 4YDHB 1JAIA 5A7HA 3IALA 2BR5A 4BUZA 5MDHA 5A9SB 4PYMA 1CULC 4IIDA 1OI2A 3K09A 2BCGY 2XMZA 5F7XA 3O03A 5LWQA 3D8BA 5ICMA 3BZUA 4Q05A 3RWOA 2J5BA 1PFGA 4RQAA 3EXFA 1DOAA 3BILA 1W94A 3COYA 4C1NA 1DC6A 1JG6A 1AXEA 3JU3A 1UANA 5DX1A 2C03A 1C29B 3DKPA 1PEKE 3DP7A 3DCIA 2Z5LA 5H3CA 4UMFA 4B71A 3SD7A 4IG9A 3GPBA 3A3NA 4LZLA 1O5IA 1P19A 4EI2A 6Q21A 2NPIA 4LW8A 4ND8B 3EYWA 2JLQA 3RC7A 4NBTA 1V95A 3WICA 4CL2A 1BGVA 1JSCA 2Q46A 3S2EA 5JXIA 4QWMA 4BQEA 1U8CB 3GUVA 5TQ0B 2LDXA 2J3HA 2Y1LA 3DGFC 1W36B 1DXHA 1HKUA 4Q4HA 3UHOA 2QXUA 1TFUA 4CCYB 1G8SA 3RIXA 1E2DA 2X40A 4JQDA 1YZFA 2ZUDA 3T9BA 3EOAI 1F8FA 1BGWA 1SVKA 2FPIA 1OV6A 2I7CA 1N1DA 2VQ6A 4CM4B 5T8KA 1VJ5A 3AKYA 5CJPA 5K09A 4R4JA 2ZRPA 2D2XA 2IEZA 2MEZA 3UANA 3CF4A 3EA4A 2F9MA 2RH4A 3K0KA 3TW0A 1A7JA 2I2XB 1YVRA 1MP0A 3C6BA 4JOSA 4Y6QA 1UEXC 4LDAA 4BOYA 1KYWA 4FZJA 4LBZA 4XQGA 4GMXA 5E1OA 4X00A 4RZUA 5CW1A 5C7OO 4ALMA 2CSFA 1NRJB 3HLYA 3K0HA 4B8ZA 1X38A 4R1MA 3UW1A 3R5FA 3LP8A 3O91A 3HN2A 4LPSA 1Q50A 4OQMA 3UAXA 1P81A 3PFKA 3Q0IA 3ROKA 5JNRA 3BL8A 4RWEA 4GQIA 3NV7A 4U2FA 1HDIA 4M55A 4PLHA 1RLMA 3UJ7A 3VR3D 3EHDA 5CNIA 5A5EA 2PSEA 5JNUA 2FSIA 1Y6FA 3T3NA 2VNJA 2GYVA 1I5OA 1SNYA 1GUBA 4O2AA 2O38A 3MWGA 3E1SA 3ZXXA 1QH8B 1BCSA 1XMQB 3WDLA 2BP7A 2PO5A 3GL9A 3OCYA 4H59A 5M3BA 5ALTA 2BFAA 4ZYWA 1JMYA 1KDOA 4MRMB 5A4MS 2O0KA 5H7XA 4ENUA 3AEQB 5TJ9A 5DEOA 2OYSA 5DJ5A 3U31A 1OYYA 3U3XA 3TLAA 2QTBA 3AM5A 5JD5A 2EKBA 4HDNB 1G20B 3O4VA 3R3XA 1RYBA 1XBTA 1R7RA 1RI3A 1JJIA 2VDMB 2CJPA 3K9HA 3PHGA 4G67A 4LISA 4OO3A 4ZRNA 2FPXA 4JT4A 2HXGA 5BNIA 3QVVA 4GKJB 4MI6A 2GDZA 2QEQA 4Q1VA 1YNSA 4MV8A 5HA5A 3SR3A 1MZVA 1XQXA 2GBGA 5G0UA 3PHLA 4C6TA 5B55A 5LOVB 1PG0A 3KFXA 1A69A 1UR5A 4QE3A 2FP4A 4TMYA 3FYCA 5EIHA 5BV2P 1B73A 3HVKA 4F8EA 4TMKA 4EL5A 1KRHA 3NG1A 2B92A 4L27A 5FBRB 1KI7A 2QTCA 4S1VA 1PR9A 2ADOA 3B53X 3NHJA 3KKMA 4L5BA 2VNHA 4ND6A 4ZCQA 1C9NA 1QCCA 1SQ6A 4R9SA 5KOHB 1CRPA 3DMGA 4OJMX 1RBYA 2FPKA 5CD9A 1K3TA 5F2NA 2H5IA 3C0KA 5FYDA 1YB4A 2F3RA 4G8BA 1IEVA 1OXKB 4OK3A 4A6DA 3GFFA 5L3SA 1Q1ZA 4M0LA 5JXGA 3N6XA 2QVCA 4ITRC 4HWPA 1N5LA 4G8DA 3N0WA 3F0TA 2JLXA 2QI9C 2VBIA 4W99A 4PS0A 4CM6A 1ZNQO 3DLBA 3D81A 4EMUA 3L6DA 3IPCA 3ET5A 3TZQA 3PXCX 4AY3A 4FNAA 1EVYA 5DLQC 3TJMA 4YV1A 3OQOA 5F5NA 3H2BA 5CBPA 1ZGAA 2VCHA 2PXXA 3VM6A 3G5AA 4ZK6A 2OLKA 3LIPA 2D1QA 5IC6A 2C97A 3VNBA 3C3MA 3UXMA 4WLFA 4QX6A 3BC1A 3I9V6 4RNCA 5PGMA 4TRNA 2RGAA 1OFGA 3THWA 1QRTA 3EA5A 1IXYA 5KMGB 1UJCA 1NLUA 2XE7A 4AKIA 3I09A 2WDPA 3BB4A 1FSZA 4NHOA 4U2KA 1FP4B 4Y9UA 1JI3A 1X7WB 1CUIA 3A25A 5F12A 3KLNA 3EIXA 4ACAA 1EWKA 2V03A 2ZI4A 5TX7A 3BS4A 4XD7D 3TOXA 3U17A 1JN0A 4ZEXA 3GT0A 4F6CA 1KQOA 2EX4A 2VYVA 2XZDA 3X1ZA 2HB6A 5I5GA 4D3YA 1DHTA 3HB7A 1SCIA 3OQNA 2FX3A 3HI4A 4R05A 3AVTA 2WJWA 3MTIA 1FU7A 3DDSA 2HYIC 1UT8A 4BNZA 5I9MA 3HYCA 4TX1A 1LDNA 1N4AA 4OK5A 3GN5A 1JHOA 1PT5A 4FBIA 1RZUA 1M6HA 1IG0A 1GKKA 3EPRA 5HTKA 4PYNA 3LKDA 3GQBB 3EBOA 4MRNA 5LP1A 4QHTA 4ARSA 1GZHB 2JGIA 3ABRB 5IKPA 3PBKA 2HH9A 3GGSA 1RPAA 4XIIA 4G23A 3TEPA 2BPOA 4FQ7A 3DOOA 3ENNA 1CFJA 3RKUA 4RSRA 3FUCA 1AGRA 1HZZA 1DV2A 2F9LA 2I6TA 3KEGA 5DTJA 5C51B 3EB9A 4Z5XA 2FCAA 2X4LA 1YKGA 2ZE6A 4JOBA 5FLEX 1U9CA 1SIBE 4ZIRA 1OAAA 4ZOBA 4AY5A 4EW3A 1KEEA 2OGWA 4DUZB 3IVPA 2LBPA 4EVSA 1W1IA 2I5PO 4LMBA 4E2ZA 5ICCA 1I36A 2XF8A 3I8SA 1P62B 3MD9A 3TFLA 3CRVA 4MQ4A 3LYUA 1LEHA 4H27A 1XTJA 2GZMA 4OMDA 1MDFA 3KOWA 5IKOA 3M83A 4TKUB 4CG0A 1Q0QA 2PBFA 1E0KA 3S99A 4CV0A 2EFDB 1G5HA 1ZCZA 4M0DA 1XDWA 3KZOA 5TMBA 3UPTA 3PDUA 4I6GA 4ZTBA 1T3ZA 2RBGA 4H0FA 4BQFA 2GXQA 4A27A 1HYQA 1XI2A 3E53A 5CXXA 2DEUA 2ICPA 1EJ0A 3DWGA 2QE7D 3NEYA 3PE3A 1J0DA 2DJ5A 1HG0A 1S3IA 2W6JA 2B36A 3LO5A 1AO3A 4UM9B 1GQFA 1ISGA 1PYGA 3EZ9A 3CJRA 1RPJA 3QOYA 2QZJA 1QFSA 2ADFA 1E2HA 1DLIA 1SC9A 2B0JA 2PA3A 2RHLA 4GP7A 5EXSA 1X1DA 2PZLA 3LTNC 4J7CA 4ZO6A 2H2WA 4GRDA 1HI9A 4HV4A 1W47A 4WOJA 2VUTA 5KTRA 2FDCA 3A9RA 3ECSA 4CKXA 2VHXA 4ARAA 3G3EA 2F4VB 2Q6VA 4XGNA 2BSAA 2OL4A 1E60A 1KXJA 1PLLA 3QFCA 1RAEA 1R3DA 2AMYA 4HWOA 5D01A 1YIOA 2SCUB 3TL2A 5C1DA 4JLMA 1RQ2A 1C3OB 1XF9A 1Z34A 2CYAA 3CRZA 1W44A 3BJMA 1E32A 4LNHA 4QODA 1ZL2A 4R41A 5DHUA 1ZGBA 4GMHA 5WRFA 1KYZA 3QF4A 5KNDA 3GBSA 3MJFA 2O3RA 3PDWA 4JB8A 3V2HA 3ZY6A 4OM8A 3WLKX 2CL5A 1P1BA 3PNYA 3ZDYB 2V6FA 3N53A 1L7BA 4UFPA 3D4IA 2FCRA 4I4TB 1PJ2A 2LGJA 4GNRA 4EG6A 1NVAA 1VMEA 3B85A 3HJNA 2I1QA 5LU8A 2WJIA 3ZHIA 1ZUHA 3KPVA 3R40A 3HABA 3B6JA 1M8PA 1R9GA 2FLKA 3BCSA 4JI4B 1FF9A 4XTCS 1I3MA 3FI9A 1W5TA 1OFUA 3DBVO 2H4XA 3RV3A 1KP3A 2ZR7A 3VZSA 4FT2A 4D2IA 4F0JA 1PZGA 1WVGA 4MS3A 3CF2A 5A9TA 2HIAA 1TTPB 5CT8A 4IY1A 5EE1A 3SYLA 4RXMA 3HCAA 5EFZA 3N86A 5J4LA 2QTHA 3SS7X 1YQ9A 1MQ8B 4TPKA 1Z36A 1RMQA 4U6NA 2VA8A 1LDGA 1W1UA 3B5JA 3PEFA 4Z6KA 1NVFA 4RVNA 5LQCA 3R20A 2P41A 2EBWA 2QRNA 4D0RA 2RFLA 4GHJA 3JRWA 4R2JA 3SEZA 1N5IA 3AUUA 2QK4A 1II8B 3E5NA 2EKZA 2PUCA 4EAQA 3HCWA 4V0LA 4BTEA 1TI7A 2KE5A 1IATA 2KEKA 4LCEA 3ZDZB 3E9NA 4B09A 2BGMA 1JG7A 1NURA 1JHMA 2P2NA 2J07A 3TMKA 1LSSA 1OJ7A 1BDMA 4EARA 1JEQB 2FUKA 3S68A 5C8XA 4FMCB 3IIMA 4KFSA 4HR7A 1L8AA 4MVJF 2X2FA 2OGUA 3ZWAA 2HTFA 1N2ZA 3Q12A 4UPEA 3NBQA 1CYEA 3E4DA 2J85A 3CN9A 1YV9A 4ENQA 4DV6B 4R84A 2ZIGA 1WV1A 2HBQA 3TLZA 1Y6GA 2GRJA 3IBYA 4BKUA 1XLUA 4OFWA 5FOSA 4MCAA 3D02A 4ZQBA 4KHPB 1EUCB 1YB7A 2X42A 5HKLA 621PA 2Q4BA 1T34A 2J5RA 4QYXA 4EA7A 2RKBA 4OI0A 3NFYA 4RK5A 4GEKA 1TXGA 1BQEA 1LY1A 1FDTA 3A1TA 3OFNA 4MYCA 2A4KA 4HZGA 1F20A 4ID3A 2VTVA 3L7JA 4M1EA 3TIVA 3SXUB 3G7UA 2A30A 1V8FA 4RTNA 8MHTA 5H82A 4L9RA 5EJMA 4ICIA 3MWLA 1NPYA 1QHFA 5KAMA 4ZGWA 1ELOA 2HRQA 1FFXB 2ZCUA 3A3PA 4G0NA 4M36A 4ZVRA 2OYCA 2XUGA 3C45A 3FHLA 3A3OA 3SKVA 1GNRA 3OHMA 2Q9AA 3ZHRA 1U2GC 3DAPA 2N9UA 4BNDB 3VYVA 3GJ7A 5DISB 3AQIA 3MMZA 3R3JA 3AUFA 3O2NA 1L5YA 1Q21A 4QFDA 4ZQGA 2GO7A 3ZI0A 3L8EA 5TRTA 5D86A 5DF1A 4XJVA 4FC6A 3IIKA 1BW9A 3DMRA 4S1PA 1T4BA 1JIXA 3MCUA 3R7SA 1Y3CE 4GSKA 4OUDA 1SCNE 2EP7A 3A9WA 3QX3A 4X1OA 4ZT7A 2Y0PA 2IV7A 3EDCA 2FN9A 5G0TA 4BFWA 2ODEA 2WIKA 1HR0B 3MGCA 4RUKA 1SHTX 2OAP1 1U2QA 1WJGA 1RKUA 3IBGA 3U4QA 2B82A 5F2OA 1Z33A 3WK8A 3AJAA 3EGXB 1B0ZA 1ZSNA 1ZIYA 3KJIA 4N5MA 5IVIA 5IJ0A 2YQ4A 2PMWB 3O73A 3C15C 3WDKA 4CMAA 2RG7A 3ZVNA 3FNEA 1SY7A 2HW8A 4BB9A 1ZGCA 5HIKA 4IEFB 1XD8A 4RULA 4UTRA 1M6VA 1DIHA 2DWCA 3KALA 4Q34A 1JSXA 1NUHA 2B8JA 3VPSA 1Y5RA 3INRA 3CVWA 4Z5CA 2IF2A 2AN5A 4S1TA 1Z8HA 3D3EA 5EHXA 3ZDDA 4RE6A 3SSAA 3WHLA 1XFDA 2XNHA 3I04M 5CB4F 2RGXA 1JQ3A 1O5OA 4D99A 1PR2A 1UTXA 1A9QA 2WAAA 3L8MA 5L4LA 1DGQA 1EMDA 4UASA 5FL7A 1Y7LA 2XYQA 1W4CA 4EPTA 4YRIA 1QV9A 3R9WA 5DU2A 1TQ4A 1U4OA 1SCQA 3K1TA 3WYBA 3SM9A 1YFKA 4EPRA 2A0WA 1E2QA 1QWOA 2KEJA 3O1IC 2ZSUA 4IGAA 4RPJA 3ZVMA 4R5MA 5DV9A 1GAQA 3TW8B 3TAUA 1MABA 1FIUA 1FPQA 2AK3A 3I53A 4TZKA 4X6XA 3ZE9A 1GA1A 4I4NA 2WZDA 1RWWA 2HMVA 1ZGJA 4IIHA 1HDEA 5AT1A 1J1UA 3K9QO 2YV5A 3ROGA 3GY0A 1GG2A 4MUXA 3M1IA 3TIFA 1QB7A 1A5BB 4YDSA 5G2OA 1I7SB 2HA4A 1XCBA 1ZOSA 2H5JA 3A4VA 2BHSA 3K3PA 4NK4A 3U19A 1OQAA 2ZR9A 1YZGA 4DWVA 5DTRA 1J1IA 2FFHA 3AHCA 3ZE1B 4LQCA 4EFNA 3RYCB 2B2CA 4PLFA 1EVLA 4AZ0B 3W4JA 4NF2A 5FQOA 4OBXA 4YRRA 1VMDA 5IK2A 1TADA 4R5HA 1PNRA 2BR4A 1AS0A 2ODNA 3RSFA 3C6MA 3HCPA 3O8CA 3OFJA 1NNEA 4G1FA 1Q83A 3CWZA 3FMPB 1QGAA 4NBSA 4RS3A 5JR3A 3QVTA 3WGMA 4KUHA 3TKYA 5AP9A 3U7FB 4OJKA 2ODRD 1PK9A 2W2VA 4KK4A 1ZZBA 1I9GA 4KFCA 1SOWA 3F90A 4RMGA 4B2IA 4Q4LA 2WU0A 1SJ9A 4MKIA 5FUBA 4B82A 1BWRA 4C4ZA 4AJKA 1G6Q1 4IW3B 4ZGBA 4P81A 2ZYGA 3CCBA 4X1KA 3UMSA 1GAWA 4DIKA 1A76A 2JC3A 4TZTA 4E31A 4OSEA 5CAEB 1P2GA 3PXBA 2TYSB 5DNCA 2BFPA 2AOWA 2VPQA 4ND4A 3B7HA 3BFXA 5C8YF 1U7UA 4X84A 3C5EA 3F51A 1Z4NA 4QM6A 1GT91 4ERXA 1IBKB 2ZJYA 4LYGA 4EB0A 1TGVA 4FFOA 3VU0A 4FN3A 3ANYB 3WWOA 1J70A 3W34A 1Q0RA 1I4DD 5L40A 3TSWA 1BE8A 1XK7A 1QLWA 2AW3A 2WM2A 3FWZA 4PGGA 1M2HA 3WK5A 2YIVX 3LX6A 4R3UC 1NUUA 2QUAA 3BWBA 2FVYA 2JANA 3U3OA 3A28A 3AEXA 4Y2QA 2H0AA 4BP3A 4HNVA 3GZCA 2QQEA 1X1BA 4DMKA 1PX0A 3ZWKA 4LXQA 5BT9A 3L6EA 1YU9A 1IUKA 3NBXX 3Q2KA 4BRSA 3O94A 5KC8A 4RLQA 4ZPXA 2H5EA 1N6KA 2OMEA 4UBOA 3K9BA 3FYAA 4FCWA 4YGXB 4KN6A 2J3KA 2BEWB 5C0OE 1BS1A 3IQWA 1F5SA 4I1RA 5AVWA 1RLIA 2P4QA 3KUXA 4PU7A 1RRGA 2V6MA 2ZVPX 4TL7A 3ND8A 4CKCA 5DE3A 1KDYA 2FMHA 1HURA 1TQDA 3EZGA 3AYXB 1GIAA 3AJ8A 2YRWA 4S04A 1T91A 1D09A 4ZJPA 1QYDA 3EEBA 2HFZA 4FW8A 1JDBB 3IUYA 2QTFA 2MSEB 3O47A 4JFRA 2ZSDA 5AH0A 5K0ZA 1DWQA 1KO7A 3BXFA 2C1EA 5DK4A 2R25B 4KH0A 2D3TA 1MUUA 1TM3E 1HBJA 3H04A 1E77A 4RMNA 2ONCA 3WYDA 5CFZA 1HOTA 2BONA 1XJQA 2OP1A 3D8NA 4IIBA 3HADA 1GR0A 4RZXA 5ENDA 2PS0A 4DFDA 1ZD8A 4JI1B 5CB0A 4FN5A 4P3NA 4BCCA 4Q02A 5TEWA 2ISCA 3MB5A 3V8MA 1L8LA 2O2XA 1ZR4A 4GKAA 3VC2A 1F6DA 1VHWA 1QHXA 1UMDA 3GFVA 3K1ZA 4MIKA 5T67A 3UM9A 1QH1A 4RPKA 3OIYA 3D7LA 1ZAKA 4LE0A 2WP8J 4PZ9A 4XGIA 4Q6BA 2X0NA 2ZTUA 1UPCA 2IODA 4HWSA 4Q5IA 4QOHA 2VYNA 2HMTA 1Q7RA 2V0CA 2ZRIA 4RD4A 3FYMA 3MC1A 3ETJA 1CR6A 3T3EA 2PYDA 1XDGA 1TT5A 1MENA 4G26A 3RSHA 1H4SA 5A2GA 1JGTA 1KQPA 3OLZA 2LYKA 2HUNA 4LYDA 5JJBA 1ML3A 1ID1A 4WV3A 5BSVA 1P0FA 2HF7A 3G2OA 2ZSJA 2AC7A 4OXKA 2X2PA 3V00A 2ZYUX 4E12A 4YAUA 1WKCA 4Z3KA 5EQDA 4F60A 3MBOA 1CZHA 3U7QB 3K0BA 4V24A 1J8DA 1PWXA 1REQA 2WG1A 3EF0A 3R5KA 1Y1PA 4RTQA 2JBAA 5GAHi 3NYWA 2PNFA 1PWEA 1AKMA 1B76A 4DCNA 1AHIA 1PNQA 5D6OA 4CR8A 5E3JA 4YCNA 1O96A 1VJ0A 5IU6A 4Z86A 3TVDA 4KR6A 1H2AS 3PI7A 4X60A 1SQ0A 4JXZA 1DC5A 2R11A 2Z2IA 3CLHA 1PW5A 1IPHA 4FOLA 4ZVTA 1L5HA 3RE1A 3S0JA 4IUBS 2FPSA 3JCZA 5E8RA 5JZMA 3PTLA 4YAOA 2C5SA 3I1YA 2D1TA 3U7HB 3A4IA 2G5CA 4AY4A 1VKJA 4G4SO 2QOEA 3OWHA 1E79A 3CPJB 4X3PA 4BLWA 4RTSA 2P4UA 2HFKA 4TTVA 3VGPA 3A2MA 1U2RA 4Y1RB 4F84A 1PJTA 4XB2A 1ZRHA 4IDOA 5I9NA 5KSZA 1X7YB 2JGKA 3L7OA 3T7SA 3KFVA 3HWX1 3RVOA 4AJPA 4C7XA 4RPCA 3G7SA 4CLXA 3H4VA 2R7MA 2WUSR 1E9FA 1EXMA 1TD9A 2BHLA 1V6SA 4TXHA 1OB5A 1FFEA 2E55A 2VCYA 3P2EA 3T4UA 1KI9A 5LOVF 1T1RA 3VR5A 2GPWA 4UEKA 4A36A 3HR4A 1G21E 2NZ2A 2F43A 3AY6A 1W75A 2C5FA 2DFDA 2FQXA 3GVCA 2QR3A 4FFRA 3DDZX 4PYQA 3OCCA 3W5UA 1AA6A 2GZ3A 4YBZA 1J5XA 2R1JL 2R60A 1CC1S 3FB1A 4DE8A 3PQ2A 5DVZA 1RI5A 2RIPA 3TEFA 2VP0A 2BZSA 3FB4A 1P3Y1 4DM7A 3QIAA 1R2QA 4UXIA 3AC0A 4DSNA 4MDEA 5AHKA 4QTUB 3K5IA 4GL2A 3R24A 4QXAA 1TRKA 4MV7A 3WIUA 4TLLB 1MX9A 4KO4S 5GIOE 4G0MA 3W77A 4DJEC 4MVJA 3HFGA 5CXQA 3ZU6A 4LF5B 1X7DA 4QKQA 3KAJA 1RWKA 3OZTA 4WY2A 1DW9A 4IJWA 1VB3A 2IPOA 2IP1A 2X76A 3DKKA 5DSZA 2V4MA 1DRKA 1N9ZA 1K4MA 4JX9A 4Q4DA 4RGYA 3H4MA 4BWVA 5KB3A 4W9MC 1U28A 1ECCA 2A9QA 3PLRA 2J0UB 2AUMA 2FZCA 4BIMA 4LYEA 4Z4QA 4ILKA 1FFAA 2V4UA 3IRVA 1K75A 1Q3HA 2LYLA 3IVCA 3LQFA 4JBNA 5G0WA 1KE2A 4YCMA 3FCYA 3IP9A 2QPLA 3T5AA 3HBJA 3B3GA 4RIIA 2WNSA 3PIRA 1QONA 2JL1A 4EZIA 1RS0A 1PW7A 3QJGA 2PMFA 5FJIA 1XA0A 4AYXA 2E4ZA 2HIGA 2KWIA 1UBUS 1UADA 4XFJA 5FTNA 4HYYA 2DHDA 4GKBA 4MUMA 3ZCTA 2FF7A 4LC0A 4HEJA 4NZZA 1NVWQ 4MUYA 3T1VA 4V39A 3W3AD 4D8VA 4B44A 4EUEA 3GR6A 1TUBA 3DPSA 5BW4A 1VKRA 1WUJS 5JBQA 4RW0A 3L79A 5HFJA 1I3OA 1H94A 4DM3A 3ZEIA 1XKQA 4DT1A 2IEDA 3KJNA 3LCMA 2W6PA 3EAQA 1Z38A 3SE0A 3F6RA 4OB6A 1J2JA 2QG4A 2V74B 1G16A 1WS6A 3BH0A 3PNLA 4IO1A 2AMJA 4QRIA 1J09A 4ZVMA 3OEED 4P6VF 5IKXA 1RTTA 1K7YA 2DPLA 3WYGA 1S0UA 1GTZA 2HRRA 2J9FB 1NMQA 3EMDA 4O59O 4C4YA 5AQEA 4EZEA 2JAXA 3WL8A 1OILA 2Q41A 4WXHA 5LMZA 2EHDA 1WETA 3JPYA 3UBTA 3TQOA 4XSHA 3ZIAD 1US8A 4WKPA 2JHCA 1JTFA 3IIEA 3STUA 3CH5A 1RKBA 4QUKA 2DBVO 3BQMB 3NNSA 1E2UA 1ZMOA 3VNSA 2B1GA 3Q3JB 5LPNA 3AU9A 4J8PA 4US1R 3PXEA 2RK6A 4CIAA 2GJ9A 3GPIA 4PBSA 1MAWA 3WRVA 3QOWA 5CLIA 4DA9A 3HSSA 3FIUA 3IKVA 4RCYA 3E0XA 1K0UA 1ZL0A 4TWRA 3VVLA 3W06A 1DKQA 1RMTA 1G3MA 2CNLA 3C3CA 5LA6B 3J7AC 1TF2A 2P4SA 2O59A 1CEXA 1QUFA 2RI1A 4LHSA 4PAGA 3EARA 1A2KC 4QFCA 2AFHA 3IE2A 3P9CA 4BCDA 5A4DA 4CKWA 5BO5A 2R8RA 1EQUA 1EVEA 2CN1A 4UJ3A 4J7XA 3DCJA 2X9NA 4YLEA 3FXAA 4Y0AA 4GF5A 4KXLA 2HSGA 4MB0A 3WMXA 4EF5A 3IO5A 5B5SA 4B5KA 5AUPB 3SNKA 2Q99A 4CLRA 1TJPB 3QV1A 2Q0QA 1G7TA 3NQ41 1MB3A 3QQ6A 4H9GA 5IBPA 2QBYA 3QRWA 5DNUA 1J99A 5EG5A 2QG6A 1UBFA 4GECA 3WLRA 4AJJA 1GQRA 1CYDA 1UPXA 2NTNA 9ABPA 1QTQA 3N8DA 2B2XA 4F7DA 4R1UA 4IWRA 1JG2A 2DMRA 1YHYA 1EFPB 3A04A 3AXTA 3FTQA 2ZYHA 3HKBB 3L07A 3QBTA 2HJ9A 1ZLXA 2L42A 3ADDA 1LK7A 2ZJBA 1NM5C 3UYLA 1ZGHA 2WTBA 3OPNA 4HEA1 2WB4A 4DSOA 4ZYVA 1BMQA 4GG1A 5G0VA 2AJBA 1MJFA 1BEZA 1E5TA 2ESRA 4FR2A 4IVPA 4MTLA 5B1SA 4B0PA 3C4JA 2GESA 1M8KA 2KMLA 2LPMA 2WYHA 1BVRA 2XE4A 1E1KA 1D5WA 4IM7A 1PO7A 4XFKA 2WPNA 1TYZA 1WXXA 5DGCA 4XYLA 2OSVA 4L3OA 1KFCB 4P38A 2ZJ1A 2PLNA 3W6NA 2H59A 5EMJA 2X7XA 3N5KA 4TWIA 2O8DB 1WRBA 4PX3A 2IEIA 4KSYA 3VR4D 1RM4A 2Y9MB 3MTEA 1XALA 3OD1A 1HDRA 3V1LA 1PT8A 3CY6A 3UAOA 2G70A 2CEAA 5IC5A 1YOVA 5C8YA 4OGLA 1YZUA 4D4KA 1LSOA 1JVNA 2QRZA 3L4EA 3JTMA 2R97A 4I4TF 4UUAA 5CXSA 3RUHA 1JG4A 1YS9A 2XV1A 3TS1A 3GLIB 1B4DA 5EKSA 1K9VF 4L0DA 4IDFA 3W5VA 3F9RA 3CXUA 5C32A 2VBGA 2EJCA 1LPPA 1NR1A 2BFCA 3OLWA 2AHRA 5LQNA 4NS1A 4OA8A 2X1VA 2FF5A 1GILA 1YUBA 3JD0A 3ADOA 4XYMA 5JZ9A 3FVVA 3GAMA 4HLDA 5EJIA 4WASA 3L4KA 1ORWA 2W7TA 5CLGA 1GHTA 1OYWA 2QL5A 4FFLA 4CMHA 1UAAA 1QIKA 1TNDA 4XWYA 1FTWA 1W2HA 5CLQA 4CT5A 3AB3A 4QU8A 4EDFA 4C4TA 4E11A 4LNAA 5A9SA 3P19A 4ZVNA 3S5UA 2C5EA 2XRZA 3Q11A 3O3OB 3BRQA 3PUHA 1DXQA 4HKTA 4XLTA 2QHXA 2FZKA 1DX9A 3LISA 1ZD1A 4Z99A 3V2UA 5JYEA 4EDHA 4FB4A 3GEMA 2RAVA 4B31A 2C3MA 4FMCF 1JAYA 9MHTA 1A9RA 2HF9A 5ABPA 1OLSB 2QJFA 2AMVA 1HDCA 1TYBE 3FNHA 3IHTA 4BBAA 4BX0A 5JSHA 1ZA2A 4YJ2B 3P4UA 1C9MA 5EKTA 2I6XA 3PTAA 4ND8A 2E4VA 4Q9AA 4G5SA 4I1UA 3IHWA 1XPJA 3IAHA 5IH7A 3OA2A 1BDHA 2WV9A 5TQ0A 3H5IA 4LAFA 4UCXA 3QF7A 1DKPA 4NCJA 1E1NA 2POQX 5BUQA 2MYNA 4WXYB 3H97A 3LUKA 1UKZA 2EBHX 3B51X 1JLRA 1CUYA 1UC4B 2VZ8A 2X1MA 1CIJA 1N9KA 1IAVA 2B69A 3R76A 4C7JA 5EMKA 2GXUA 2IPMA 4CM4A 3TELA 1FL9A 4BZQA 1E1MA 1S8AA 2OY0A 1LI7A 1ISSA 3B36A 4I5IA 4G5OA 3NHBA 2O6HA 1H6AA 3ILXA 4W5WA 1LW7A 4LZPA 1MFPA 1ZUD1 2FLVA 3D6VA 3HDYA 3WMRA 1SG9A 5AFSA 4HX5A 5IUJC 3O7MA 4ZAXA 1KI3A 2VYFA 2C2MA 3ZQJA 3QLEA 3NHMA 1NNI1 4P5EA 1GGHA 3EVNA 5AJUA 5CRIA 3IV6A 1NXPA 3GGGA 3HA7A 5B64A 2GLTA 4CLOB 1EX9A 2V9CA 3T7JA 4CCWA 5E9WA 2O48X 1VTKA 3SIWA 4ETWA 3RAFC 2VF5X 3IMEA 2ZSFA 1SKUA 3RJ5A 1SVUA 4EHAA 1CY0A 3DE1X 1EUQA 1AQ6A 2OK8A 3TIIA 3BMXA 1IAQA 2PMBA 2X0RA 3QE3A 4XX0B 4YMVA 3E7DA 2Q6TA 4GPTA 1QH8A 4Y6SA 3TNDA 1PNTA 3UTCA 1VL6A 1X1TA 1KIAA 2YYSA 7YASA 1FEZA 1SXJB 2I4TA 4KFRA 2FUCA 2BEVB 4MRMA 3LY5A 2L1PA 4N3GA 3ROQA 3AEQA 4EGQA 3OLQA 3JTEA 4HDNA 1G20A 1WSAA 2QRQA 3ETHA 2JK0A 1H2WA 1GSAA 2Q4TA 3OZXA 3H7AA 2V96A 4DR4B 4RH0A 1C3XA 2W2KB 3WRXC 4ZAYA 4HSGA 4WBNB 3H17A 3JAMA 1GU7A 3T1HB 3FJ1A 3S2YA 5ED4A 2HCNA 1TF5A 2IYNA 3B6KA 1H6BA 3WL7A 3L0IB 2I2DA 4H1UA 1N6HA 5LOVA 4O3MA 2C4MA 4I9FA 4L02A 2MWMA 7REQB 3L93A 3F3SA 3SVLA 2JDIA 1OXXK 4KYTA 3D9QX 3BK1A 3EISA 4XPZA 3LNCA 3MWEA 5CNMA 3O4IA 5EZYB 2XWPA 4Q1DA 2CBGA 4KE9A 5KOHA 4NAHA 4HFMA 4FD3A 1ATZA 3KLBA 1FFWA 3ZW8A 2ZBDA 3UPUA 1UWCA 5EWLB 2FRDC 5F9FA 4P34A 2HR1A 1G1MA 1G20E 1PUJA 3FNQA 2ATVA 1EA7A 3UMCA 2FSUA 2GAFA 2R47A 3A7DA 5J5CA 3AHGA 1G38A 1EG2A 1I30A 1SUBA 1G55A 1G2PA 4K7JA 1L7PA 1VHTA 4MYDA 4WEQA 5ETJA 5ULLA 3U44B 1PJRA 3GEBA 3CA8A 4B85A 4ENPA 3L0PA 2G1KA 2V7TA 4J2HA 3KVOA 4ZALA 4JVLA 2FETA 4I3FA 4CJXA 3JWGA 3USCS 2Y0DA 2VDWB 1N5OX 3U62A 1KA9H 3TDKA 4WINA 2ZWIA 4K6CA 2OBXA 3ZDEA 2WF9A 1EYZA 2DU8A 2JBWA 4NYMR 4I3HA 4C4OA 2O6LA 1XNJA 2V45A 2VUHB 4IKEA 2AG8A 5KNCD 2A84A 2YHAA 2AOXA 3TE6A 2Z04A 2YBDA 3AHEA 4FZRA 1VYUA 5BSKA 4LN1A 3NPMA 5KMGA 1KEKA 1Z18A 2CLDX 5KAPA 2J5KA 4ZCRA