2GRLA

Crystal structure of dct/icf10 complex
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
287
structure length
287
Chain Sequence
MFKIGSVLKQIRQELNYHQIDLYSGIMSKSVYIKVEADSRPISVEELSKFSERLGVNFFEILNRAGMNTKSVNETGKEKLLISKIFTNPDLFDKNFQRIEPKRLTSLQYFSIYLGYISIAHHYNIEVPTFNKTITSDLKHLYDKRTTFFGIDYEIVSNLLNVLPYEEVSSIIKPMYPIVDSFGKDYDLTIQTVLKNALTISIMNRNLKEAQYYINQFEHLKTIKNISINGYYDLEINYLKQIYQFLTDKNIDSYLNAVNIINIFKIIGKEDIHRSLVEELTKISAKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords PrgX
publication title Molecular basis for control of conjugation by bacterial pheromone and inhibitor peptides.
pubmed doi rcsb
source organism Enterococcus faecalis
total genus 112
structure length 287
sequence length 287
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2grlA01
1.25.40.400 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2grlA02
2O4AA 3KJXA 4JCXA 2BNOA 1Y7YA 1QP7A 4JQDA 2AWIA 1JH9A 1QP4A 3HZIB 1CQTA 2XJ3A 4X4EA 2EF8A 2MEZA 3OP9A 3EUSA 2B5AA 2XIUA 3ZHIA 1YSEA 2LYQA 3F52A 1QPZA 3QF3A 4YBAA 2XI8A 1ZPQA 1ZZ9A 3VK0A 1Y9QA 2FJRA 2JVLA 1QP0A 1ADRA 2WIUB 4I6UA 2BJCA 1RZSA 1WETA 2PUBA 1R69A 2IV1A 4PU4C 1LCCA 1POUA 1RZRD 2XSDC 2PPXA 2PUAA 3ZHMA 2GRLA 3BDNA 2OFYA 3OQOA 1PRAA 1AU7A 2BNNA 3BS3A 2R1JL 1DWKA 1QQBA 3DNVB 1X2LA 2MQKA 2XCJA 3PXPA 2KEKA 3S8QA 1IC8A 3GBFA 4Z5CA 1HF0A 2EBYA 3LFPA 3D1NI 3GN5B 3OQNA 1L1MA 1RPEL 4GQMA 2CSFA 3JXCL 1WH8A 2LYJA 2IU7A 3QWGA 4J1WA 1CJGA 3G7DA 3TRBA 2PUFA 2D5VA 2KEIA 1JFTA 4O8BA 3MLFA 4YG7B 4PU8A 1LLIA 2IUOA 2PUCA 3JXBC 1ZVVA 4Z58A 4X4IA 2L49A 2R63A 1R63A 2L8NA 4X4FA 4PU7A 4NDWA 3GN5A 3IVPA 1RZRA 2JCGA 1QQAA 4YG1A 5K98B 4YARA 3CROL 4JCYA 1UXCA 3KZ3A 2GZUA 2KEJA 1XWRA 1OCTC 1LQCA 1BDHA 3F51A 4MCXA 2PUDA 3F6WA 1PERL 1S7EA 2OR1L 2AUWA 3KXAA 4IA8A 2LCVA 1PNRA 2PUGA 2AXZA 4X4HA 2LYRA 4J1XA 4Y42A 1UXDA 3SCGA 4PU3C 3UFDA 3RZZA 4X4CA 3JXDL 1ZS4A 1NERA 2CROA 1ZZ7A 2HINA 2LYLA 3OMTA 3U3WA 3SCHA 2LYSA 4MCTA 1LCDA 1ZZ6A 2AXVA 4X4GA 2KZ8A 1UTXA 4I8TA 2HSGA 4Z5DA 4GHJA 1LMB3 2PIJA 3CLCA 1VPWA 2LYKA 4F8DA 3LISA 4FN3A 3OQMA 1DW9A 1O4XA 3ZKCA 3QYXA 3QQ6A 4FBIA 2KPJA 4I6RA 3SCFA 1ZZCA 4Z59A 4Z5HA 1WIZA 3L1PA 1ZAYA 4IWRA 2EWTA 4OB4A 3B7HA 1SQ8A 2AW6A 4X4DA 2ICPA 2GRMA 2O38A 1ZZ8A 3BD1A 1BDIA 4IVZA 1EFAA 2ICTA 4X4BA 1X57A 1ZZBA 5A7LA 1WH6A 3FYMA 2BNMA 2O49A 1PRUA 4YG4A 1NEQA 1ZUGA 1E3OC 3H5TA 1JFSA 3CECA 3G5GA 2PUEA 2H8RA 1JWLA 2IVQA 4I6TA 2AXUA 1B0NA 2LYPA 3O9XA 2PE5A 1RIOA 2IVBA 3FYAA 2WUSR 3FMYA 3R1FA 2IVGA 1GT0C 1PRVA 1OSLA 2A6CA
chains in the Genus database with same CATH superfamily
1SVXA 3AAAC 1D8EA 1JPLA 1MFQC 2MEZA 4C9BB 5CCLA 3PH0C 1D8DA 3ZW3A 4JHRA 1QPZA 4K03A 3ASOE 1HZ4A 2BJCA 2X38A 5G55A 1KZPA 3I4RB 5B3SE 1TJCA 1IYGA 3G2TA 1OXJA 2RFAA 4HNAD 3ZYQA 2R1JL 2J4BA 4FHJA 4W9RA 4ANWA 3DNVB 4EZJA 2OEWA 2CG2A 3HVEB 5FZQA 3JUIA 2J09A 3Q47B 3QB2A 3FEYA 1N0RA 3QKYA 5JJ7A 2FEZA 4GB9A 2PUCA 4K5CA 3SX0A 4APFA 2L49A 1R63A 2VSXE 2NC9A 3HIZA 5HQ8A 4ANXA 2KCVA 4ZFHA 2L0TB 3RO2A 5ANRA 4P29A 4CZ2D 3FTXA 4U95D 3CSTA 3NZLA 2OOEA 4N3BA 3I5PA 2LNMA 3OXGA 4X4CA 3NQPA 3ESLA 4KZ0A 2X3MA 2KZ8A 4ER5A 4G2VA 5EIDA 3HHMA 3URZA 3FUJA 3SCFA 4Z59A 2ZXWE 3JUEA 3QOXA 3ZPXA 3D9HA 2QYUA 4WWPA 3MKQA 2C0MA 4U0SA 3RU0A 4AXHA 4UI9K 1OWOA 2VGYA 1IXVA 3LCAA 4GPKA 3CGHA 2I9CA 1FT2A 1YSEA 4JXTA 5A23A 4ILIA 4UWGA 3NOGD 4I17A 1POUA 3DSWA 5IY5E 1O1SA 4A1GA 1DULA 2OVBA 2M63A 3UUXA 2C2LA 3CKBA 2KEKA 1EPUA 4WNFA 1Z3YA 4HBDA 4L2LA 3KS2A 4RG9A 2JLBA 2ZGGA 4V3IA 3OAWA 3UX4A 2CSFA 2IU7A 1HQ1A 4FA6A 5JUWA 3IBEA 4O8BA 2ZIRA 4OVVA 4YG7B 1E7VA 2ZU6B 4EQZA 5CCMA 2IO3C 4L7TA 3PS6A 4G26A 2F8XK 2B6CA 4O1PA 3ZPJA 3E33A 3FTSA 1KPSB 3UIOC 3CHQA 1SA5A 3F51A 3EIQC 3KXAA 3QDNA 1DNPA 3PZ4A 3APFA 1DVPA 4GU5A 2WQ7A 3SCHA 4MCTA 1LCDA 4CRWA 4Z5DA 4GHJA 3ZYKA 4AY5A 3HXDA 3B13A 4CYMD 1TYQG 3FTYA 2J49A 3L54A 1BD8A 3FYMA 1JCQA 4YG4A 3B7SA 1ZUGA 3PZ2A 3UINC 3JYSA 3E4BA 2XGSA 2DYSE 3PUJA 3IV0A 4B93B 2A6CA 3EJNA 1D9SA 5EX0A 1XGWA 3NB2A 4ANVA 4JEHA 2WXQA 5FWQA 2DBAA 2JEKA 5G2NA 2LO6A 3RKVA 3JCKC 5DTQA 4HI8A 2V5QC 2PUBA 2QY7A 3TWXA 5EIBE 4EZKA 5KBAA 2XPYA 4GTVA 2MQKA 3PXPA 3GZ1A 3GBFA 4I1OB 4YDYA 2EBYA 3D1NI 3KL4A 2PXFA 4HLEA 2H6GA 2LYJA 2XEHA 3QWGA 4BESA 2GRPB 3CHMA 1RZ4A 4DE8A 4HLLA 1NI1A 2IOLA 3BG0B 3IEGA 1UOHA 2ILRA 3FUNA 2LUHA 2FBNA 3TEPA 1QQAA 2ETCA 4U04A 5AQBA 3ZGQA 5M72A 4Q2JA 2KEJA 5AQ9A 2PXBA 1LQCA 2Y3AA 4XKBA 2PXPA 1JWGA 3PNLB 2AXZA 5AN8A 3ME5A 2CFUA 4G8LA 3UPVA 4XX5A 2HINA 2CROA 4J7WA 2BKKB 2IEJA 4QQIA 1U2ZA 3S2AA 2KZTB 4URKA 3AU4A 1IHGA 2CHZA 3RJVA 4AV7A 3PVLA 5HS0A 4X4DA 4I6EA 4EPZA 4JB8P 1ZZBA 4EQFA 1YYHA 4Z68A 3E30A 4NIKA 4DLOA 2AXUA 1B0NA 1JWFA 1HF8A 2XPIA 3Q49B 3FULA 3CIAA 4L2YA 2BNOA 4F3VA 1B89A 1N11A 2XIUA 3TJPA 1S64A 4B94A 5DRTA 2HFZA 2XRZA 2E2EA 5GAHi 4I43A 3DSSA 2IV1A 4PU4C 1LCCA 1O1RA 4CDMA 1RZRD 3AS8A 2WXPA 3LVQE 1PRAA 3SNXA 4LCTA 3PZ1A 3WXXA 2L6BA 3OXLA 1HF0A 2Y1LE 1L1MA 1WH8A 3CQGB 3CKCA 4HOQA 3Q7FA 2XXQA 3S7FA 4ER7A 3JXBC 3W9GA 1ZBPA 3LY8A 2XXAA 3HVEA 3IVPA 3ABLE 3DSTA 1IHBA 2ODRD 5ARGA 3ZNGA 4YARA 4JCYA 4X8QA 3ABKE 5BNWA 3CHRA 3BU8A 1S7EA 2PUGA 4BSXA 5BXUA 5LX8A 3HXBA 4PU3C 5LOZA 2V3CC 4TXQA 2R17C 2WXGA 3OMTA 1S70B 3QNKA 1MYOA 2ETBA 4I9EA 5FTPA 4MKTA 1O4XA 2LLVA 3R9MA 2NSZA 4BWRA 5BXOA 3B7BA 4JD2G 4PUCA 3ASDA 5A7LA 3CEQA 3DRAA 3OTNA 1E3OC 4ER6A 3C3OA 3T8MA 4HRNA 2PE5A 1OY3D 5ENPD 3PREA 1NL4A 5CECB 4GZCA 4BT9A 1QP7A 1KT0A 4GTPA 2EINE 4N39A 3C98A 1KZOA 1O5MA 4GAAA 4FADA 2XS1A 2PUAA 5DTMA 3F6QA 4BFRA 5ENOD 2LAIA 1PY1A 2BNNA 1N4SA 4BSZB 4A3VA 5DRYA 4LSZE 4CDRA 1QYMA 4I2WA 5FJYA 2UWJG 3OQNA 2A5UA 1TN7A 2AJAA 4UWKA 3CK8A 3JXCL 2ONDA 3QWWA 3PRZA 3UM3A 5DT2A 4I9CA 1V55E 2X6JA 4XKCA 3UT8A 2XCCA 4G1TA 4DPRA 5EN5D 5KJLA 2WXNA 4IN3B 1MZCA 4PU7A 4IYPA 4NDWA 3VLEA 2J08A 3EHMA 1N4RA 5JHBA 3G2WA 4U8YD 3DEOA 2E0IA 5EYPF 3CQCB 3E34A 2LNIA 5BV0A 1XNFA 3TWRA 2LYRA 3UFDA 4U7EB 1SA4A 1Y8MA 4DRXE 3T5VA 2KXPC 2V8SE 3G0TA 4X4GA 3SFYA 3KSQA 3AJIA 1OCCE 4XI9A 3PZDA 5E75A 1ZZCA 2GRNB 4J0UA 5AARA 4J6IA 1X57A 4XIFA 3U64A 2VTBB 4J8SA 1HXIA 4ILHB 2RKKA 3Q15A 2J8SD 3R1FA 4EKGA 5CRUA 3FU6A 4L23A 2O4AA 1Z3XA 1H6OA 1AP7A 3VLDA 1JH9A 2MHKA 4MS6A 1UJKA 1X81A 3MX3A 5AIJA 3QF3A 2AVPA 3S7JA 3E32A 3PUKA 1TJFA 1OT8A 4R7LA 3DSXA 4KT6B 4BEPA 1DWKA 5T4YA 4UI9C 4TXRA 5FZSA 3AS4A 4JA7A 1RPEL 2WB2A 2WXLA 3APDA 3IXEA 3JXJA 4ZHBA 5FINA 2LSVA 4LNBA 4B8AA 4X4IA 2PNNA 2VYIA 2P9NG 3RRMB 4A63B 5ENTD 4YG1A 2WM9A 4MRUA 3RSEG 1HE8A 1N94A 3L13A 3F6WA 5G05J 4CGWA 3D9JA 3L16A 1G3NB 2V5FA 4O6FA 4F6RD 3U3WA 2DYRE 2GW1A 3TFLA 2AXVA 2F8YA 4ILGA 3LYAA 3LY7A 3QWPA 5HRYA 1QBQA 4GTQA 3GZDA 1JCSA 3U9WA 4MLPA 4F8DA 3IKOB 3GUUA 3RK6A 3LEWA 4JHJA 4IWRA 2AW6A 3TAXA 1BDIA 4UWFA 1N95A 1WH6A 2KZTA 3FP3A 5LFAA 3PDNA 2IY0C 3S7BA 4GMRA 4FP7A 3DPDA 4GTTA 2YHCA 1QP4A 2KCLA 4Q69A 3UTMA 2KATA 3KEAA 4KZCA 4RQIA 5ANLA 4DI4A 1ADRA 3AS5A 3DWLG 4Y6WA 3TXMA 4M3OA 3EHQA 3FUHA 3PE3A 1FT1A 4ER3A 3FTZA 2P9SG 2RFMA 3DXMG 3FFLA 5CHEE 2DVWA 1X2LA 2I6HA 1HG5A 4Z5CA 3B7UX 1LD7A 3SF4A 4RSYA 3SR4A 2OEVA 3SGHA 2BUGA 2BEDA 3OXFA 2LLWA 4GZ6A 3MLFA 4H7YA 2IUOA 1SW6A 3EU5A 1OWNA 3ZRHA 3A9ZA 2PM6A 3X2QE 4HS2A 2JQEA 4EBAA 1E7UA 2QFCA 3CK9A 3ZU7B 2NXPA 3DPYA 4IA8A 5GAGi 2WQ6A 2UY1B 2J7WA 3SCGA 3L82A 3MEKA 3SD5A 4DJAA 4PS7A 3AG1E 2P9IG 3SFXA 3LY9A 1W3BA 3FY4A 4G11A 2CHXA 3D9IA 1BU9A 5AJLA 5ENNA 3FTVA 4A1SA 4OVUA 3EHNA 1BI8B 2J7UA 2VQ2A 4LNUD 3RRNB 3VLFA 3QWVA 3H5TA 1JFSA 1U3CA 4HVBA 3CECA 4FLBA 1ELWA 3DM5A 2IVBA 1Y6IA 3V2XA 4PS8A 1Y7YA 2IJGX 2MYOA 3V30A 1HS6A 3TG5A 2J4DA 5CRVA 4FC8A 3MZLB 3F52A 3VK0A 3FUMA 2XQ0A 1R69A 4M7CA 4TRQA 2HM8A 4BX9A 4J8YA 5G04J 1K1BA 3M9LA 4N3CA 3FDHA 3SBSA 1HO8A 3B7RL 3J5PA 4XE0A 2LAHA 3MYVA 3UXGA 5FIOA 3A9XA 4U07A 3R7RA 3GZSA 3NROA 3NAWA 3KD7A 2IF4A 4FHKA 2GRRB 2PUDA 4QFVA 2LCVA 3KSLA 3Q5MA 1NERA 3SY2A 3TWUA 1ZZ6A 3FH7A 5CBOA 2I1KA 4AM9A 5AENA 2Y4UA 2VGXB 3QFIA 3LISA 2PXQA 2R03A 2KCKA 3AG4E 3ZKCA 2PXVA 1NP7A 2WXKA 2WXMA 1ZAYA 5FQ4A 3GZ2A 4I1MA 2XRYA 2ETAA 2L1PA 2Y69E 2BNMA 2H6HA 2IO2C 2WMOA 2PUEA 3TELA 2DWZA 4D10C 1JWLA 4FULA 1V54E 2JABA 1MQSA 3ZHMA 3Q7AA 1PRVA 1OSLA 2HYZA 5AAOA 2P2CP 4N3AA 1JCRA 1K3ZD 2C0LA 2WXOA 3LKUA 4RVBA 2PQRA 4DX5D 3LDZA 5E76A 4E6HA 3BDNA 1BPOA 3BUAA 1AU7A 3IHVA 4EZIA 1HG2A 2F0YA 1LD8A 2BKGA 4XZ4A 1FVHA 3EUVA 4HOSA 2V0PA 4CCAA 3O4ZA 5DSXA 4E85A 4C0MA 1N9AA 3UKUG 3ZXPA 1INZA 3W9FA 2V4LA 4YNDA 2XS8A 4PU8A 3PE4A 3MKQB 3JQ0A 2JCGA 4DLQA 2GZUA 1NA3A 4ACKA 5T8IA 3D9LA 2J07A 3QJZA 3GW4A 4J1XA 2P9UG 4U0UA 4KMOA 3UT4A 3C3QA 1ELKA 2WXIA 3UT7A 2EILE 1N0QA 2VSYA 4C0EA 3CLCA 3PEVB 4KXKB 2ZISA 4WAFA 4FN3A 2A4ZA 4UWLA 3LVRE 4L9PA 3ASGA 2PXKA 4EZLA 3I3NA 4GTSA 3ZUVB 3U66A 3TG4A 3L08A 2HCSA 4YVOA 2X6IA 3L17A 4APOA 1OCRE 4HQDA 3MJWA 5JMND 1S63A 5CEDB 2YNQA 3VTXA 1MJ0A 2CHWA 2WUSR 2P58C 3L22A 3FUFA 4JQDA 3CVVA 4LRZA 5CMYA 4WNGA 1N4QA 4GA0A 4AOFA 4JPSA 3MA5A 4AJWA 4EKIA 2PXDA 3QOWA 1QZ2A 3NZUA 4DX1A 5B1AE 2X6HA 4ME2A 3S8QA 4PH4B 3CHSA 4DX2A 5EX3A 1JUQA 3J5QB 4JEUA 3UI2A 3RAUA 4RG6A 3TRBA 1MHQA 3OKZA 4F7AA 2R63A 3E37A 4KBQA 3Q78A 5KJNA 2P9LG 3HG0D 2R05A 1OCOE 1EDUA 3EU9A 3CROL 3LPZA 5FQ6A 1H0AA 5G05C 1PERL 3FU5A 4K5BA 3Q4AB 3HXFA 4FJYA 4UQZA 4DX7D 3JXDL 2FF4A 1ZZ7A 2VEOA 4K0RA 4HRMB 1E8WA 3HXCA 3Q9NC 3BQOA 2X6FA 4K5AB 4ATGA 2KM4A 2WXJA 3ZYMA 2KPJA 3UKRG 3L1PA 3CV0A 4HB5A 2NYJA 1UW4B 3T5XA 4YDEA 3SHFA 4MBGA 3C5RA 4GZ3A 1RIOA 4PDXA 3V79K 5FQ8A 4GYWA 1IQUA 1HU3A 1QQEA 1FPPA 3ZIMA 1WY6A 3HDXA 1ZB1A 4GYYA 3SI5A 1A17A 4U0ZA 4G25A 1FVFA 3B7TA 4X4EA 5ENQD 2HCNA 3MV3B 5ENRD 4JC8A 2I2OA 2PXLA 4DE9A 3FH5A 3GZDC 1Y9QA 5LCWJ 2EIJE 2XEVA 3JXIA 2A5EA 2LSUA 5LP0A 3OQOA 4B89A 3D9KA 2ZGDA 2HO1A 3WG7E 5ARFA 4LEUA 2L6JA 3FH8A 1IKND 2OCCE 1H2VC 3ZKJA 1U3DA 5KJMA 4C48B 4EBAG 4EHMA 3DXKG 2Q7FA 4LUNU 1P5QA 1OCZE 1H2UA 5AQAA 1LF8A 4CT4A 2X6KA 4N2SA 4BT8A 1OCTC 5KNGA 3LJ3A 4J8EA 1OWPA 2AUWA 4EECA 1PNRA 4A3TA 1UXDA 2J9QA 3ULQA 3QC1A 4BTBA 4HOTA 4HI9A 4I1AA 2QZAA 3QYXA 1TNYA 2L9BA 4N5CA 3CHPA 1FCHA 4Z5HA 4OB4A 1IQRA 3ONKA 2VGXA 1TEZA 4FLHA 1BLXB 5CBNA 3LJNA 1K1AA 3O9XA 1NZNA 4BETA 2R2LA 2YBDA 2YQ8A 1YMPA 4BY6A 2MRIA 2AWIA 3A9YA 3TL5A 3R9AB 3EUSA 4KVOA 4GPMA 3ZHIA 1DC2A 1U2VG 4YBAA 5JA4D 4OBMA 5BW8C 4JVSA 4B0ZA 4GMJA 3ASHA 4F1PA 3R09A 4CEMA 3FU0A 5FZRA 2PPXA 5FQ7A 5G04C 5EYLA 3BS3A 2WVIA 1QQBA 1GW6A 3ULYA 5AJDA 3GN5B 4Q94A 3NDBB 2Y4TA 5C1DA 1TNZA 4J1WA 4AVXA 2PUFA 5JJ6A 2D5VA 1E8YA 3PEUB 3L6AA 4ABNA 3CK7A 4UUCA 3ZHEB 3EHRA 1LLIA 2R02A 3UM1A 5JHAA 1ZVVA 3NXHA 4U8VD 1N4PA 2XXPA 4TUMA 3ENEA 3K9IA 2I1JA 3DSUA 1K8KG 2GRQB 5K98B 1UXCA 3KZ3A 1XWRA 3PE5A 2XEEA 4HRLA 3EDTB 4WVLA 2LXLA 4OAVB 1UN9A 5A6CA 1L5JA 3TWTA 5C2YA 2LYSA 3C3RA 3UMVA 1E8XA 4LNGA 5A7DB 1MX2A 4I8TA 4NRHB 5HI7A 4KYOB 4FBIA 5FT9A 3ABME 3FTWA 2EIME 3BD1A 2PXTA 2IOSA 2O49A 4JL0A 4TV3A 3RO3A 1SQMA 4JW1A 3RIBA 3CVXA 2H8RA 2EIKE 4UQXA 2EQXA 4OYSA 2IVGA 3SFZA 1RW2A 2XGOA 4U96D 1QZXA 3KJXA 4I6JA 4AIFA 4UI9J 4CGVA 2XJ3A 4F1SA 3TWSA 2LYQA 2XI8A 1ZZ9A 4JA9A 3GZCA 3SBTB 1QB2A 3P2BA 1RZSA 1N52A 5EDSA 4IULA 1WETA 3C72A 2PL2A 5D2MC 2XSDC 4JZYA 3HRAA 3V2OA 3UQ3A 3GYZA 2IU1A 2KBXA 3FEXA 2GROB 1IC8A 5DIZA 3DSVA 2GGFA 3ISMC 1YCSB 5AQ7A 1TR4A 1KT1A 2F37A 4ANUA 1JFTA 3ZXSA 3PZ3A 1NFIE 4O1OA 5DBKA 3ZN3A 3APCA 3UM2A 4X4FA 1DCQA 1E96B 4HRAA 4F53A 3ZYLA 5KNHD 3Q79A 1WM5A 3QAQA 4GYOA 2XCBA 3LS8A 2OR1L 4YDWA 2V4HC 1VDYA 3CVUA 2P9KG 3D9NA 2Y0BG 3SZ7A 2XZDG 4Y42A 3OWQA 1SZ9A 2H6IA 3UIPC 3PNTB 3MV2B 2PIJA 4GCOA 5D0OD 3OQMA 4BX8A 4GTRA 4I6RA 2L0IA 4Y6CA 5ENSD 3P1UA 1SQ8A 4B8CB 4J8FA 4IVZA 2BTDA 3FUEA 3ML9A 1NEQA 3CLJA 3D9MA 4CT0A 3L9TA 3AU5A 2PZIA 3HXEA 1Q2ZA 3VTYA 5BT1A 5J08A 4NACA 2BF0X 4A55A 3JQ1A 3B7HA 5CERB 2XENA 5CMWA 2CFZA 1OWLA 4LERA 4U8HA 4KVMA 1WG0A 2RG8A 4PS3A 2HR2A 4WWNA 2B5AA 1TN8A 4BERA 5H7PA 2FJRA 1QP0A 4AP2A 4I6UA 2OV8A 1O1TA 4HORA 5DTRA 1Z5SC 4TUUA 3EIJA 1LTXA 2WXFA 2YINA 5B1BE 2GRLA 3FHEA 4DK5A 2OFYA 3ML8A 3N71A 2IONA 3SQVA 4I6GA 3CVNA 2VTBA 1UG3A 5BPPA 1CJGA 3AG2E 4OAUC 4GA2A 1H6PA 3CR3A 3T8KA 3ASNE 4Z58A 4AY6A 4GZDA 2FFHA 4HFGA 2PXUA 4U63A 3T9KA 3CSFA 3FUIA 2VSOE 2XHEA 3TWWA 2MXDA 2VJ8A 3SO8A 3QARA 3QOUA 4L1BA 3NF1A 3RZZA 1E90A 3D9OA 2R59A 4FU3A 1UTXA 1OUVA 1LMB3 5ITZF 3FUKA 4N2QA 5HKPA 2IQCA 4DUIA 3DBSA 4J8DA 1S0PA 2EWTA 4FJZA 2MOWA 2ICPA 2GRMA 3NBNB 3B95A 3ZEFA 5D0QD 3FUDA 1PRUA 3MKRA 1WDYA 2PM7A 4O60A 1Z6TA 2WXRA 5BUZA 3KAEA 2IVQA 4I6TA 3FTUA 4XEIG 1WAO1 4ER0A 2FO7A 4WNDA 1E8ZA 3MEJA 2FO1E 5T3RA 3HZIB 1CQTA 5KJKA 1BI7B 3TXNA 5LCWC 4WWOA 5J90A 2JVLA 2WIUB 1UJJA 3I4GA 3QK0A 3CHOA 2FULA 4ATZD 2CG3A 4GMLA 3TGOA 1TNUA 1EYHA 3CVYA 4NURA 4UWHA 3LFPA 5D66A 4GQMA 3G7DA 5EILA 4H7XA 2KEIA 1HX8A 4BTAA 1YA0A 3MCXA 4GTMA 3ZFWA 4DX6D 2DZOA 3R7QA 2L8NA 3UWPA 1AWCB 3GN5A 4G24A 1N54A 1PAQA 1H19A 3D9PA 3NOCD 3ZHEA 5EKQD 1ZU2A 3V31A 1TNBA 2DCPA 3O48A 1H2TC 1A5EA 2HSGA 4GTOA 5JJTA 3TWVA 1VPWA 1DW9A 3QQ6A 2VGEA 5KCMA 1WIZA 3G2SA 2HE0A 4YVQC 2O38A 1EFAA 1SZAA 2ICTA 4X4BA 2OVFA 1UN8A 2XPZA 1NW3A 4ACLA 3RRUA 3LQXA 3ONLA 4WUYA 3VWSA 4UQYA 3FMYA 3ASFA 3Q9UC 1TNOA 3G5GA 4YDOA 4JCXA 3CVPA 2UY1A 2DZNA 2R5SA 1QNFA 2XZTG 2EF8A 3OP9A 5BV1A 1ZPQA 3LXUX 4CDNA 3ESKA 4TXPA 3Q75A 2DIWA 1PC2A 5AYWD 3CVQA 3IHYA 1NA0A 1ELRA 3BEEA 4JHKA 4IRUA 4NQ0A 1HFAA 2WXHA 2XCJA 3D3MA 2LXMA 4N5QA 1HH8A 3ZVVA 5KWDA 2KC7A 2M4HA 4G23A 4RLYA 1TN6A 3MGBA 2WQHA 4GCNA 1OWMA 2P9PG 3G2UA 4HOUA 2VSNA 3G2VA 4DI3A 3FU3A 3U4TA 4HXIA 3DEPA 1RZRA 1DCEA 3FWVA 3TWQA 3CVWA 4Q96A 1BDHA 2PXEA 4MCXA 1MX6A 3CVLA 3UM0A 3NZSA 2B0OE 1X5BA 4X4HA 1ZS4A 3KEZA 2RD0A 2LYLA 3HYMB 4AEZC 1H6KA 2PQNA 2H6FA 4WNEA 2LYKA 3S7DA 3AG3E 1MX4A 4LG6A 5CEAA 1ZZ8A 2YHEA 2FI7A 3ULEG 1KLXA 2WMNA 4EK9A 1EF1C 2IFUA 3BG1B 4I2ZA 3Q73A 4XI0A 4G8KA 2WPVA 2QC9A 2XGMA 2LYPA 2QYJA 3FYAA 1GT0C 4GA1A 4GZ5A
chains in the Genus database with same CATH topology
2HYZA 4GZCA 2XGOA 3KJXA 4BT9A 1QP7A 4I6JA 4AIFA 4UI9J 1JPLA 4CGVA 4N3AA 2XJ3A 1KT0A 2MEZA 2C0LA 2WXOA 4C9BB 3PH0C 4F1SA 5CCLA 3ZW3A 4JHRA 2LYQA 1QPZA 3LKUA 2XI8A 4N39A 1ZZ9A 3C98A 4JA9A 4K03A 4RVBA 3SBTB 2PQRA 1HZ4A 3P2BA 2BJCA 2X38A 1RZSA 1N52A 5EDSA 3LDZA 4IULA 1WETA 5G55A 3I4RB 1TJCA 2PL2A 1IYGA 3G2TA 2XSDC 4GAAA 2PUAA 5E76A 4JZYA 4E6HA 4FADA 3BDNA 1BPOA 3ZYQA 4BFRA 3UQ3A 1AU7A 1PY1A 2BNNA 2LAIA 2R1JL 2J4BA 3GYZA 3IHVA 4FHJA 4W9RA 2IU1A 4ANWA 1HG2A 3DNVB 4A3VA 3FEXA 4XZ4A 4EZJA 2CG2A 3HVEB 1IC8A 1FVHA 4CDRA 4I2WA 4HOSA 2V0PA 5FJYA 2UWJG 3OQNA 2GGFA 3JUIA 5DIZA 2J09A 2A5UA 3Q47B 4CCAA 3O4ZA 3QB2A 4UWKA 3CK8A 3FEYA 3JXCL 4C0MA 2ONDA 4E85A 1KT1A 3QWWA 1INZA 4ANUA 1JFTA 2V4LA 3PRZA 3QKYA 3ZXSA 4YNDA 5JJ7A 2FEZA 4PU8A 4GB9A 5DBKA 2PUCA 4I9CA 4APFA 4XKCA 2X6JA 2L49A 3PE4A 2XCCA 4G1TA 3UT8A 4DPRA 3ZN3A 3APCA 5KJLA 1R63A 2WXNA 4IN3B 4X4FA 2VSXE 3MKQB 3JQ0A 4PU7A 4IYPA 4NDWA 3VLEA 2J08A 2JCGA 3EHMA 4DLQA 2NC9A 1E96B 5JHBA 4F53A 3G2WA 3ZYLA 3HIZA 2GZUA 1NA3A 4ACKA 2E0IA 1WM5A 5HQ8A 4ANXA 3QAQA 2KCVA 2XCBA 4GYOA 5T8IA 4CDMA 2L0TB 3CQCB 4PDXA 3LS8A 3D9LA 4P29A 2J07A 2OR1L 2LNIA 3FTXA 5ANRA 3RO2A 1VDYA 5BV0A 1XNFA 3CSTA 2OOEA 3CVUA 3D9NA 3SZ7A 3QJZA 3GW4A 4N3BA 2LYRA 4J1XA 4Y42A 3UFDA 3I5PA 3OXGA 4X4CA 4KMOA 4U0UA 1Y8MA 3UT4A 3NQPA 3T5VA 3ESLA 4KZ0A 1ELKA 1SZ9A 2V8SE 2X3MA 2WXIA 3UT7A 4X4GA 1MQSA 2KZ8A 2VSYA 4C0EA 3PNTB 3MV2B 2PIJA 3CLCA 3PEVB 4GCOA 4KXKB 4G2VA 4WAFA 5D0OD 4XI9A 4FN3A 3OQMA 2A4ZA 4UWLA 3LVRE 4BX8A 3HHMA 3URZA 3ASGA 3PZDA 3FUJA 4EZLA 3I3NA 5E75A 4I6RA 3SCFA 3U66A 2L0IA 1ZZCA 4Z59A 4Y6CA 3P1UA 3TG4A 3L08A 1SQ8A 4B8CB 4J0UA 4YVOA 2X6IA 4J8FA 3L17A 4IVZA 4J6IA 4APOA 2BTDA 3RO3A 1X57A 3FUEA 3ML9A 4XIFA 3U64A 2VTBB 4WWPA 1NEQA 4J8SA 3MKQA 3MJWA 1HXIA 3CLJA 3D9MA 4ILHB 4CT0A 3AU5A 2PZIA 2C0MA 2YNQA 4U0SA 3RU0A 3VTXA 4AXHA 3VTYA 4UI9K 5BT1A 3Q15A 2CHWA 5J08A 2WUSR 2P58C 2BF0X 3L22A 3R1FA 3JQ1A 3B7HA 4NACA 4A55A 3FUFA 1OWOA 3FU6A 4L23A 2O4AA 5CMWA 1Z3XA 2CFZA 1OWLA 4LERA 4JQDA 5FZQA 3CVVA 2VGYA 4U8HA 4KVMA 2RG8A 3VLDA 1JH9A 4LRZA 4PS3A 2MHKA 3LCAA 4GPKA 4MS6A 2HR2A 1UJKA 4WWNA 5CMYA 3MX3A 3CGHA 2B5AA 4WNGA 5AIJA 2I9CA 1YSEA 4JXTA 5A23A 3QF3A 4ILIA 4UWGA 2AVPA 3S7JA 2FJRA 1QP0A 4GA0A 4AP2A 4AOFA 4I6UA 4JPSA 3SFZA 2OV8A 4HORA 4I17A 4TUUA 3EIJA 3PUKA 1POUA 1TJFA 3MA5A 4AJWA 2WXFA 2YINA 1PRVA 1QZ2A 2GRLA 3FHEA 3NZUA 4R7LA 4A1GA 4DK5A 2OFYA 2OVBA 3ML8A 2M63A 4KT6B 1DWKA 3UUXA 3N71A 2C2LA 3CKBA 2X6HA 4ME2A 2KEKA 3S8QA 1EPUA 5T4YA 2IONA 4PH4B 1Z3YA 3CHSA 4L2LA 4UI9C 4WNFA 5FZSA 5EX3A 4I6GA 1JUQA 3CVNA 3AS4A 3KS2A 2JLBA 4RG9A 4JA7A 1RPEL 3OAWA 4V3IA 2VTBA 3UX4A 2WB2A 2CSFA 1UG3A 2WXLA 4JEUA 2IU7A 1CJGA 4RG6A 4FA6A 3TRBA 3APDA 5BPPA 4GA2A 3IBEA 4O8BA 1MHQA 4OVVA 4DI4A 4YG7B 3CR3A 1E7VA 2LSVA 2ZU6B 4Z58A 4X4IA 4L7TA 4B8AA 5CCMA 4AY6A 4GZDA 4F7AA 3PS6A 2R63A 4G26A 2VYIA 4KBQA 5KJNA 4HFGA 3RRMB 3ZPJA 3FTSA 4U63A 1EDUA 3CSFA 4YG1A 2WM9A 3FUIA 3LPZA 3CROL 3CHQA 4MRUA 2VSOE 2XHEA 2VJ8A 5FQ6A 1H0AA 3F51A 1HE8A 3L13A 5G05C 3F6WA 3QARA 5G05J 1PERL 3EIQC 3FU5A 3QOUA 3Q4AB 3KXAA 4CGWA 3D9JA 1DNPA 3L16A 3QDNA 3APFA 4FJYA 3NF1A 4L1BA 1DVPA 4UQZA 2V5FA 4GU5A 4O6FA 3RZZA 3JXDL 2FF4A 3U3WA 2GW1A 1ZZ7A 2WQ7A 1E90A 3SCHA 4MCTA 3D9OA 4K0RA 2R59A 1LCDA 2AXVA 4FU3A 4ILGA 1E8WA 3LYAA 4CRWA 1UTXA 1OUVA 3LY7A 3QWPA 4Z5DA 4GHJA 3ZYKA 1LMB3 2X6FA 4AY5A 3U9WA 4ATGA 4MLPA 4F8DA 2KM4A 3FUKA 3IKOB 3B13A 4N2QA 2WXJA 3RK6A 3FTYA 3ZYMA 2IQCA 2KPJA 3DBSA 3LEWA 4J8DA 1S0PA 4JHJA 3L1PA 4IWRA 2EWTA 4FJZA 3CV0A 2MOWA 2AW6A 2J49A 2ICPA 2GRMA 3TAXA 1BDIA 3L54A 4UWFA 3ZEFA 5D0QD 1WH6A 3FYMA 2KZTA 3FP3A 1PRUA 3FUDA 4YG4A 3B7SA 1ZUGA 1UW4B 3MKRA 5LFAA 3T5XA 3JYSA 3SHFA 3PDNA 2PM7A 1Z6TA 2WXRA 3E4BA 5BUZA 3KAEA 2IVQA 4I6TA 1RIOA 2XGSA 3FTUA 3PUJA 4GZ3A 4GYWA 1IQUA 1HU3A 1QQEA 1WAO1 3IV0A 2FO7A 4WNDA 1E8ZA 3ZIMA 2A6CA 1WY6A 3EJNA 3HDXA 4GYYA 5EX0A 3S7BA 4FP7A 3SI5A 1A17A 3DPDA 4U0ZA 2YHCA 1QP4A 1XGWA 2KCLA 4G25A 3HZIB 1CQTA 1FVFA 4X4EA 3B7TA 4JEHA 5T3RA 4ANVA 4Q69A 2KATA 3MV3B 4JC8A 4KZCA 5KJKA 2I2OA 3TXNA 3FH5A 2WXQA 5FWQA 5ANLA 5LCWC 1Y9QA 4WWOA 2JVLA 1ADRA 2DBAA 2JEKA 2WIUB 1UJJA 3AS5A 4Y6WA 2LO6A 5G2NA 5LCWJ 3RKVA 3TXMA 3JCKC 3I4GA 2XEVA 4M3OA 3QK0A 2PUBA 2QY7A 3CHOA 3FUHA 3PE3A 2FULA 2LSUA 5LP0A 2CG3A 3FTZA 3OQOA 4EZKA 4GMLA 4B89A 2XPYA 3TGOA 3D9KA 3FFLA 1EYHA 5CHEE 1X2LA 2MQKA 3PXPA 2I6HA 3GZ1A 1HG5A 3CVYA 4NURA 4UWHA 3GBFA 4Z5CA 2HO1A 4I1OB 2EBYA 3LFPA 3D1NI 3B7UX 4GQMA 5ARFA 4LEUA 2L6JA 4HLEA 3FH8A 2LYJA 3SF4A 3QWGA 3G7DA 4RSYA 3SGHA 1H2VC 2BUGA 4H7XA 3CHMA 2KEIA 3OXFA 1HX8A 4GZ6A 4BTAA 3MLFA 4H7YA 1YA0A 3MCXA 2IUOA 1U3DA 5KJMA 3ZFWA 1OWNA 2IOLA 3BG0B 3ZRHA 4EBAG 3IEGA 2ILRA 2PM6A 3FUNA 3R7QA 4HS2A 2L8NA 4EBAA 3GN5A 1E7UA 2Q7FA 4G24A 4GZ5A 4LUNU 1H2UA 2FBNA 1N54A 1QQAA 1PAQA 2QFCA 1LF8A 3CK9A 4U04A 1H19A 3ZGQA 2X6KA 4CT4A 5M72A 4N2SA 2KEJA 2NXPA 4BT8A 1OCTC 3D9PA 1LQCA 2Y3AA 4XKBA 3LJ3A 3ZHEA 4J8EA 1OWPA 1JWGA 2AUWA 4IA8A 3PNLB 4EECA 1PNRA 2UY1B 5EKQD 2WQ6A 1ZU2A 4A3TA 2AXZA 2CFUA 3UPVA 4XX5A 5J90A 1UXDA 3SCGA 2DCPA 2J9QA 3ULQA 2HINA 2CROA 3QC1A 3MEKA 3O48A 3SD5A 1H2TC 4BTBA 4DJAA 4PS7A 4HOTA 4I1AA 2HSGA 3S2AA 3LY9A 2KZTB 5JJTA 4URKA 1VPWA 1W3BA 3FY4A 4G11A 3AU4A 1IHGA 2CHXA 1DW9A 2CHZA 3RJVA 3QYXA 3D9IA 4AV7A 3QQ6A 2L9BA 4N5CA 3CHPA 1FCHA 3PVLA 5AJLA 4Z5HA 1WIZA 3FTVA 5ENNA 5KCMA 4OVUA 4OB4A 3G2SA 3EHNA 4A1SA 4X4DA 4YVQC 4I6EA 2O38A 1EFAA 1SZAA 4EPZA 2ICTA 4X4BA 2OVFA 1IQRA 1UN8A 1ZZBA 4EQFA 2XPZA 2VQ2A 3RRNB 3VLFA 3ONKA 2VGXA 3QWVA 3H5TA 1JFSA 1U3CA 4ACLA 4HVBA 3CECA 4FLHA 3RRUA 1TEZA 4DLOA 3ONLA 4FLBA 3O9XA 4WUYA 2AXUA 1ELWA 1B0NA 1NZNA 1JWFA 2IVBA 1HF8A 4UQYA 3FMYA 3ASFA 2XPIA 3G5GA 3Q49B 1Y6IA 2YQ8A 3FULA 3CIAA 4JCXA 4L2YA 3CVPA 2BNOA 1Y7YA 2IJGX 4PS8A 4BY6A 2MRIA 4F3VA 2UY1A 2AWIA 3TL5A 1B89A 3R9AB 1HS6A 2R5SA 3TG5A 1QNFA 2J4DA 2EF8A 3OP9A 5BV1A 3EUSA 4FC8A 4KVOA 3MZLB 2XIUA 3ZHIA 3TJPA 3F52A 4YBAA 4B94A 1ZPQA 3VK0A 3LXUX 5BW8C 4JVSA 3FUMA 4GMJA 4B0ZA 4CDNA 2XQ0A 2XRZA 3ASHA 2E2EA 3ESKA 4CEMA 1R69A 4I43A 2IV1A 4PU4C 1LCCA 1PC2A 2DIWA 4TRQA 3FU0A 1RZRD 2HM8A 3AS8A 2PPXA 2WXPA 3LVQE 3CVQA 5FQ7A 5FZRA 5G04C 4BX9A 3IHYA 1NA0A 5G04J 1PRAA 1ELRA 3BEEA 3SNXA 3BS3A 2WVIA 4LCTA 4JHKA 4IRUA 3WXXA 4NQ0A 1QQBA 1GW6A 1HFAA 2WXHA 3OXLA 2XCJA 3D3MA 5AJDA 1HF0A 4N3CA 3GN5B 1HH8A 1L1MA 4Q94A 3ZVVA 2Y4TA 2KC7A 3FDHA 5C1DA 3SBSA 1WH8A 4J1WA 1HO8A 3B7RL 4AVXA 2PUFA 3CQGB 3CKCA 4G23A 4HOQA 5JJ6A 2D5VA 1E8YA 3MGBA 3L6AA 3PEUB 4XE0A 3CK7A 4ABNA 2LAHA 2WQHA 4GCNA 3ZHEB 1LLIA 3S7FA 1OWMA 3MYVA 3G2UA 3JXBC 4HOUA 2VSNA 3G2VA 1ZVVA 1ZBPA 3FU3A 3LY8A 4DI3A 5JHAA 3U4TA 5AYWD 3HVEA 4U07A 3R7RA 4HXIA 3GZSA 3IVPA 3ENEA 1RZRA 2I1JA 3K9IA 5ARGA 3FWVA 3KD7A 5K98B 4YARA 4JCYA 3CVWA 1UXCA 3KZ3A 2IF4A 4FHKA 1XWRA 4Q96A 5BNWA 1BDHA 4MCXA 3CHRA 2PUDA 3CVLA 1S7EA 3NZSA 3EDTB 2PUGA 4QFVA 2LCVA 4BSXA 5LX8A 1X5BA 1UN9A 5FQ8A 4X4HA 4PU3C 5LOZA 5A6CA 1ZS4A 1L5JA 2R17C 3KEZA 2WXGA 1NERA 2RD0A 2LYLA 3HYMB 3OMTA 3Q5MA 5C2YA 4AEZC 2LYSA 3UMVA 1H6KA 2PQNA 1E8XA 1ZZ6A 3FH7A 3QNKA 2I1KA 5A7DB 4I8TA 4NRHB 5HI7A 4AM9A 4WNEA 5AENA 2Y4UA 4I9EA 4KYOB 5FTPA 2VGXB 2LYKA 4MKTA 3LISA 2KCKA 1O4XA 3ZKCA 1NP7A 3S7DA 4FBIA 5FT9A 2WXKA 2WXMA 1ZAYA 5FQ4A 2NSZA 3FTWA 3GZ2A 4BWRA 4I1MA 2XRYA 1ZZ8A 3BD1A 2YHEA 2FI7A 2IOSA 4PUCA 1KLXA 2WMNA 3ASDA 5A7LA 1EF1C 3CEQA 2BNMA 2O49A 4JL0A 2WMOA 4TV3A 3OTNA 2IFUA 1SQMA 3BG1B 4JW1A 1E3OC 3RIBA 4I2ZA 4XI0A 3CVXA 2PUEA 4D10C 2H8RA 1JWLA 2WPVA 4UQXA 3T8MA 2PE5A 2EQXA 2LYPA 2XGMA 4GA1A 3FYAA 4FULA 4OYSA 3PREA 2IVGA 1GT0C 3ZHMA 1OSLA 1P5QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O4A A;  3KJX A;  4JCX A;  2BNO A;  1Y7Y A;  1QP7 A;  4JQD A;  2AWI A;  1JH9 A;  1QP4 A;  3HZI B;  1CQT A;  2XJ3 A;  4X4E A;  2EF8 A;  2MEZ A;  3OP9 A;  3EUS A;  2B5A A;  2XIU A;  3ZHI A;  1YSE A;  2LYQ A;  3F52 A;  1QPZ A;  3QF3 A;  4YBA A;  2XI8 A;  1ZPQ A;  1ZZ9 A;  3VK0 A;  1Y9Q A;  2FJR A;  2JVL A;  1QP0 A;  1ADR A;  2WIU B;  4I6U A;  2BJC A;  1RZS A;  1WET A;  2PUB A;  1R69 A;  2IV1 A;  4PU4 C;  1LCC A;  1POU A;  1RZR D;  2XSD C;  2PPX A;  2PUA A;  3ZHM A;  2GRL A;  3BDN A;  2OFY A;  3OQO A;  1PRA A;  1AU7 A;  2BNN A;  3BS3 A;  2R1J L;  1DWK A;  1QQB A;  3DNV B;  1X2L A;  2MQK A;  2XCJ A;  3PXP A;  2KEK A;  3S8Q A;  1IC8 A;  3GBF A;  4Z5C A;  1HF0 A;  2EBY A;  3LFP A;  3D1N I;  3GN5 B;  3OQN A;  1L1M A;  1RPE L;  4GQM A;  2CSF A;  3JXC L;  1WH8 A;  2LYJ A;  2IU7 A;  3QWG A;  4J1W A;  1CJG A;  3G7D A;  3TRB A;  2PUF A;  2D5V A;  2KEI A;  1JFT A;  4O8B A;  3MLF A;  4YG7 B;  4PU8 A;  1LLI A;  2IUO A;  2PUC A;  3JXB C;  1ZVV A;  4Z58 A;  4X4I A;  2L49 A;  2R63 A;  1R63 A;  2L8N A;  4X4F A;  4PU7 A;  4NDW A;  3GN5 A;  3IVP A;  1RZR A;  2JCG A;  1QQA A;  4YG1 A;  5K98 B;  4YAR A;  3CRO L;  4JCY A;  1UXC A;  3KZ3 A;  2GZU A;  2KEJ A;  1XWR A;  1OCT C;  1LQC A;  1BDH A;  3F51 A;  4MCX A;  2PUD A;  3F6W A;  1PER L;  1S7E A;  2OR1 L;  2AUW A;  3KXA A;  4IA8 A;  2LCV A;  1PNR A;  2PUG A;  2AXZ A;  4X4H A;  2LYR A;  4J1X A;  4Y42 A;  1UXD A;  3SCG A;  4PU3 C;  3UFD A;  3RZZ A;  4X4C A;  3JXD L;  1ZS4 A;  1NER A;  2CRO A;  1ZZ7 A;  2HIN A;  2LYL A;  3OMT A;  3U3W A;  3SCH A;  2LYS A;  4MCT A;  1LCD A;  1ZZ6 A;  2AXV A;  4X4G A;  2KZ8 A;  1UTX A;  4I8T A;  2HSG A;  4Z5D A;  4GHJ A;  1LMB 3;  2PIJ A;  3CLC A;  1VPW A;  2LYK A;  4F8D A;  3LIS A;  4FN3 A;  3OQM A;  1DW9 A;  1O4X A;  3ZKC A;  3QYX A;  3QQ6 A;  4FBI A;  2KPJ A;  4I6R A;  3SCF A;  1ZZC A;  4Z59 A;  4Z5H A;  1WIZ A;  3L1P A;  1ZAY A;  4IWR A;  2EWT A;  4OB4 A;  3B7H A;  1SQ8 A;  2AW6 A;  4X4D A;  2ICP A;  2GRM A;  2O38 A;  1ZZ8 A;  3BD1 A;  1BDI A;  4IVZ A;  1EFA A;  2ICT A;  4X4B A;  1X57 A;  1ZZB A;  5A7L A;  1WH6 A;  3FYM A;  2BNM A;  2O49 A;  1PRU A;  4YG4 A;  1NEQ A;  1ZUG A;  1E3O C;  3H5T A;  1JFS A;  3CEC A;  3G5G A;  2PUE A;  2H8R A;  1JWL A;  2IVQ A;  4I6T A;  2AXU A;  1B0N A;  2LYP A;  3O9X A;  2PE5 A;  1RIO A;  2IVB A;  3FYA A;  2WUS R;  3FMY A;  3R1F A;  2IVG A;  1GT0 C;  1PRV A;  1OSL A;  2A6C A; 
#chains in the Genus database with same CATH topology
 1SVX A;  3AAA C;  1D8E A;  1JPL A;  1MFQ C;  2MEZ A;  4C9B B;  5CCL A;  3PH0 C;  1D8D A;  3ZW3 A;  4JHR A;  1QPZ A;  4K03 A;  3ASO E;  1HZ4 A;  2BJC A;  2X38 A;  5G55 A;  1KZP A;  3I4R B;  5B3S E;  1TJC A;  1IYG A;  3G2T A;  1OXJ A;  2RFA A;  4HNA D;  3ZYQ A;  2R1J L;  2J4B A;  4FHJ A;  4W9R A;  4ANW A;  3DNV B;  4EZJ A;  2OEW A;  2CG2 A;  3HVE B;  5FZQ A;  3JUI A;  2J09 A;  3Q47 B;  3QB2 A;  3FEY A;  1N0R A;  3QKY A;  5JJ7 A;  2FEZ A;  4GB9 A;  2PUC A;  4K5C A;  3SX0 A;  4APF A;  2L49 A;  1R63 A;  2VSX E;  2NC9 A;  3HIZ A;  5HQ8 A;  4ANX A;  2KCV A;  4ZFH A;  2L0T B;  3RO2 A;  5ANR A;  4P29 A;  4CZ2 D;  3FTX A;  4U95 D;  3CST A;  3NZL A;  2OOE A;  4N3B A;  3I5P A;  2LNM A;  3OXG A;  4X4C A;  3NQP A;  3ESL A;  4KZ0 A;  2X3M A;  2KZ8 A;  4ER5 A;  4G2V A;  5EID A;  3HHM A;  3URZ A;  3FUJ A;  3SCF A;  4Z59 A;  2ZXW E;  3JUE A;  3QOX A;  3ZPX A;  3D9H A;  2QYU A;  4WWP A;  3MKQ A;  2C0M A;  4U0S A;  3RU0 A;  4AXH A;  4UI9 K;  1OWO A;  2VGY A;  1IXV A;  3LCA A;  4GPK A;  3CGH A;  2I9C A;  1FT2 A;  1YSE A;  4JXT A;  5A23 A;  4ILI A;  4UWG A;  3NOG D;  4I17 A;  1POU A;  3DSW A;  5IY5 E;  1O1S A;  4A1G A;  1DUL A;  2OVB A;  2M63 A;  3UUX A;  2C2L A;  3CKB A;  2KEK A;  1EPU A;  4WNF A;  1Z3Y A;  4HBD A;  4L2L A;  3KS2 A;  4RG9 A;  2JLB A;  2ZGG A;  4V3I A;  3OAW A;  3UX4 A;  2CSF A;  2IU7 A;  1HQ1 A;  4FA6 A;  5JUW A;  3IBE A;  4O8B A;  2ZIR A;  4OVV A;  4YG7 B;  1E7V A;  2ZU6 B;  4EQZ A;  5CCM A;  2IO3 C;  4L7T A;  3PS6 A;  4G26 A;  2F8X K;  2B6C A;  4O1P A;  3ZPJ A;  3E33 A;  3FTS A;  1KPS B;  3UIO C;  3CHQ A;  1SA5 A;  3F51 A;  3EIQ C;  3KXA A;  3QDN A;  1DNP A;  3PZ4 A;  3APF A;  1DVP A;  4GU5 A;  2WQ7 A;  3SCH A;  4MCT A;  1LCD A;  4CRW A;  4Z5D A;  4GHJ A;  3ZYK A;  4AY5 A;  3HXD A;  3B13 A;  4CYM D;  1TYQ G;  3FTY A;  2J49 A;  3L54 A;  1BD8 A;  3FYM A;  1JCQ A;  4YG4 A;  3B7S A;  1ZUG A;  3PZ2 A;  3UIN C;  3JYS A;  3E4B A;  2XGS A;  2DYS E;  3PUJ A;  3IV0 A;  4B93 B;  2A6C A;  3EJN A;  1D9S A;  5EX0 A;  1XGW A;  3NB2 A;  4ANV A;  4JEH A;  2WXQ A;  5FWQ A;  2DBA A;  2JEK A;  5G2N A;  2LO6 A;  3RKV A;  3JCK C;  5DTQ A;  4HI8 A;  2V5Q C;  2PUB A;  2QY7 A;  3TWX A;  5EIB E;  4EZK A;  5KBA A;  2XPY A;  4GTV A;  2MQK A;  3PXP A;  3GZ1 A;  3GBF A;  4I1O B;  4YDY A;  2EBY A;  3D1N I;  3KL4 A;  2PXF A;  4HLE A;  2H6G A;  2LYJ A;  2XEH A;  3QWG A;  4BES A;  2GRP B;  3CHM A;  1RZ4 A;  4DE8 A;  4HLL A;  1NI1 A;  2IOL A;  3BG0 B;  3IEG A;  1UOH A;  2ILR A;  3FUN A;  2LUH A;  2FBN A;  3TEP A;  1QQA A;  2ETC A;  4U04 A;  5AQB A;  3ZGQ A;  5M72 A;  4Q2J A;  2KEJ A;  5AQ9 A;  2PXB A;  1LQC A;  2Y3A A;  4XKB A;  2PXP A;  1JWG A;  3PNL B;  2AXZ A;  5AN8 A;  3ME5 A;  2CFU A;  4G8L A;  3UPV A;  4XX5 A;  2HIN A;  2CRO A;  4J7W A;  2BKK B;  2IEJ A;  4QQI A;  1U2Z A;  3S2A A;  2KZT B;  4URK A;  3AU4 A;  1IHG A;  2CHZ A;  3RJV A;  4AV7 A;  3PVL A;  5HS0 A;  4X4D A;  4I6E A;  4EPZ A;  4JB8 P;  1ZZB A;  4EQF A;  1YYH A;  4Z68 A;  3E30 A;  4NIK A;  4DLO A;  2AXU A;  1B0N A;  1JWF A;  1HF8 A;  2XPI A;  3Q49 B;  3FUL A;  3CIA A;  4L2Y A;  2BNO A;  4F3V A;  1B89 A;  1N11 A;  2XIU A;  3TJP A;  1S64 A;  4B94 A;  5DRT A;  2HFZ A;  2XRZ A;  2E2E A;  5GAH i;  4I43 A;  3DSS A;  2IV1 A;  4PU4 C;  1LCC A;  1O1R A;  4CDM A;  1RZR D;  3AS8 A;  2WXP A;  3LVQ E;  1PRA A;  3SNX A;  4LCT A;  3PZ1 A;  3WXX A;  2L6B A;  3OXL A;  1HF0 A;  2Y1L E;  1L1M A;  1WH8 A;  3CQG B;  3CKC A;  4HOQ A;  3Q7F A;  2XXQ A;  3S7F A;  4ER7 A;  3JXB C;  3W9G A;  1ZBP A;  3LY8 A;  2XXA A;  3HVE A;  3IVP A;  3ABL E;  3DST A;  1IHB A;  2ODR D;  5ARG A;  3ZNG A;  4YAR A;  4JCY A;  4X8Q A;  3ABK E;  5BNW A;  3CHR A;  3BU8 A;  1S7E A;  2PUG A;  4BSX A;  5BXU A;  5LX8 A;  3HXB A;  4PU3 C;  5LOZ A;  2V3C C;  4TXQ A;  2R17 C;  2WXG A;  3OMT A;  1S70 B;  3QNK A;  1MYO A;  2ETB A;  4I9E A;  5FTP A;  4MKT A;  1O4X A;  2LLV A;  3R9M A;  2NSZ A;  4BWR A;  5BXO A;  3B7B A;  4JD2 G;  4PUC A;  3ASD A;  5A7L A;  3CEQ A;  3DRA A;  3OTN A;  1E3O C;  4ER6 A;  3C3O A;  3T8M A;  4HRN A;  2PE5 A;  1OY3 D;  5ENP D;  3PRE A;  1NL4 A;  5CEC B;  4GZC A;  4BT9 A;  1QP7 A;  1KT0 A;  4GTP A;  2EIN E;  4N39 A;  3C98 A;  1KZO A;  1O5M A;  4GAA A;  4FAD A;  2XS1 A;  2PUA A;  5DTM A;  3F6Q A;  4BFR A;  5ENO D;  2LAI A;  1PY1 A;  2BNN A;  1N4S A;  4BSZ B;  4A3V A;  5DRY A;  4LSZ E;  4CDR A;  1QYM A;  4I2W A;  5FJY A;  2UWJ G;  3OQN A;  2A5U A;  1TN7 A;  2AJA A;  4UWK A;  3CK8 A;  3JXC L;  2OND A;  3QWW A;  3PRZ A;  3UM3 A;  5DT2 A;  4I9C A;  1V55 E;  2X6J A;  4XKC A;  3UT8 A;  2XCC A;  4G1T A;  4DPR A;  5EN5 D;  5KJL A;  2WXN A;  4IN3 B;  1MZC A;  4PU7 A;  4IYP A;  4NDW A;  3VLE A;  2J08 A;  3EHM A;  1N4R A;  5JHB A;  3G2W A;  4U8Y D;  3DEO A;  2E0I A;  5EYP F;  3CQC B;  3E34 A;  2LNI A;  5BV0 A;  1XNF A;  3TWR A;  2LYR A;  3UFD A;  4U7E B;  1SA4 A;  1Y8M A;  4DRX E;  3T5V A;  2KXP C;  2V8S E;  3G0T A;  4X4G A;  3SFY A;  3KSQ A;  3AJI A;  1OCC E;  4XI9 A;  3PZD A;  5E75 A;  1ZZC A;  2GRN B;  4J0U A;  5AAR A;  4J6I A;  1X57 A;  4XIF A;  3U64 A;  2VTB B;  4J8S A;  1HXI A;  4ILH B;  2RKK A;  3Q15 A;  2J8S D;  3R1F A;  4EKG A;  5CRU A;  3FU6 A;  4L23 A;  2O4A A;  1Z3X A;  1H6O A;  1AP7 A;  3VLD A;  1JH9 A;  2MHK A;  4MS6 A;  1UJK A;  1X81 A;  3MX3 A;  5AIJ A;  3QF3 A;  2AVP A;  3S7J A;  3E32 A;  3PUK A;  1TJF A;  1OT8 A;  4R7L A;  3DSX A;  4KT6 B;  4BEP A;  1DWK A;  5T4Y A;  4UI9 C;  4TXR A;  5FZS A;  3AS4 A;  4JA7 A;  1RPE L;  2WB2 A;  2WXL A;  3APD A;  3IXE A;  3JXJ A;  4ZHB A;  5FIN A;  2LSV A;  4LNB A;  4B8A A;  4X4I A;  2PNN A;  2VYI A;  2P9N G;  3RRM B;  4A63 B;  5ENT D;  4YG1 A;  2WM9 A;  4MRU A;  3RSE G;  1HE8 A;  1N94 A;  3L13 A;  3F6W A;  5G05 J;  4CGW A;  3D9J A;  3L16 A;  1G3N B;  2V5F A;  4O6F A;  4F6R D;  3U3W A;  2DYR E;  2GW1 A;  3TFL A;  2AXV A;  2F8Y A;  4ILG A;  3LYA A;  3LY7 A;  3QWP A;  5HRY A;  1QBQ A;  4GTQ A;  3GZD A;  1JCS A;  3U9W A;  4MLP A;  4F8D A;  3IKO B;  3GUU A;  3RK6 A;  3LEW A;  4JHJ A;  4IWR A;  2AW6 A;  3TAX A;  1BDI A;  4UWF A;  1N95 A;  1WH6 A;  2KZT A;  3FP3 A;  5LFA A;  3PDN A;  2IY0 C;  3S7B A;  4GMR A;  4FP7 A;  3DPD A;  4GTT A;  2YHC A;  1QP4 A;  2KCL A;  4Q69 A;  3UTM A;  2KAT A;  3KEA A;  4KZC A;  4RQI A;  5ANL A;  4DI4 A;  1ADR A;  3AS5 A;  3DWL G;  4Y6W A;  3TXM A;  4M3O A;  3EHQ A;  3FUH A;  3PE3 A;  1FT1 A;  4ER3 A;  3FTZ A;  2P9S G;  2RFM A;  3DXM G;  3FFL A;  5CHE E;  2DVW A;  1X2L A;  2I6H A;  1HG5 A;  4Z5C A;  3B7U X;  1LD7 A;  3SF4 A;  4RSY A;  3SR4 A;  2OEV A;  3SGH A;  2BUG A;  2BED A;  3OXF A;  2LLW A;  4GZ6 A;  3MLF A;  4H7Y A;  2IUO A;  1SW6 A;  3EU5 A;  1OWN A;  3ZRH A;  3A9Z A;  2PM6 A;  3X2Q E;  4HS2 A;  2JQE A;  4EBA A;  1E7U A;  2QFC A;  3CK9 A;  3ZU7 B;  2NXP A;  3DPY A;  4IA8 A;  5GAG i;  2WQ6 A;  2UY1 B;  2J7W A;  3SCG A;  3L82 A;  3MEK A;  3SD5 A;  4DJA A;  4PS7 A;  3AG1 E;  2P9I G;  3SFX A;  3LY9 A;  1W3B A;  3FY4 A;  4G11 A;  2CHX A;  3D9I A;  1BU9 A;  5AJL A;  5ENN A;  3FTV A;  4A1S A;  4OVU A;  3EHN A;  1BI8 B;  2J7U A;  2VQ2 A;  4LNU D;  3RRN B;  3VLF A;  3QWV A;  3H5T A;  1JFS A;  1U3C A;  4HVB A;  3CEC A;  4FLB A;  1ELW A;  3DM5 A;  2IVB A;  1Y6I A;  3V2X A;  4PS8 A;  1Y7Y A;  2IJG X;  2MYO A;  3V30 A;  1HS6 A;  3TG5 A;  2J4D A;  5CRV A;  4FC8 A;  3MZL B;  3F52 A;  3VK0 A;  3FUM A;  2XQ0 A;  1R69 A;  4M7C A;  4TRQ A;  2HM8 A;  4BX9 A;  4J8Y A;  5G04 J;  1K1B A;  3M9L A;  4N3C A;  3FDH A;  3SBS A;  1HO8 A;  3B7R L;  3J5P A;  4XE0 A;  2LAH A;  3MYV A;  3UXG A;  5FIO A;  3A9X A;  4U07 A;  3R7R A;  3GZS A;  3NRO A;  3NAW A;  3KD7 A;  2IF4 A;  4FHK A;  2GRR B;  2PUD A;  4QFV A;  2LCV A;  3KSL A;  3Q5M A;  1NER A;  3SY2 A;  3TWU A;  1ZZ6 A;  3FH7 A;  5CBO A;  2I1K A;  4AM9 A;  5AEN A;  2Y4U A;  2VGX B;  3QFI A;  3LIS A;  2PXQ A;  2R03 A;  2KCK A;  3AG4 E;  3ZKC A;  2PXV A;  1NP7 A;  2WXK A;  2WXM A;  1ZAY A;  5FQ4 A;  3GZ2 A;  4I1M A;  2XRY A;  2ETA A;  2L1P A;  2Y69 E;  2BNM A;  2H6H A;  2IO2 C;  2WMO A;  2PUE A;  3TEL A;  2DWZ A;  4D10 C;  1JWL A;  4FUL A;  1V54 E;  2JAB A;  1MQS A;  3ZHM A;  3Q7A A;  1PRV A;  1OSL A;  2HYZ A;  5AAO A;  2P2C P;  4N3A A;  1JCR A;  1K3Z D;  2C0L A;  2WXO A;  3LKU A;  4RVB A;  2PQR A;  4DX5 D;  3LDZ A;  5E76 A;  4E6H A;  3BDN A;  1BPO A;  3BUA A;  1AU7 A;  3IHV A;  4EZI A;  1HG2 A;  2F0Y A;  1LD8 A;  2BKG A;  4XZ4 A;  1FVH A;  3EUV A;  4HOS A;  2V0P A;  4CCA A;  3O4Z A;  5DSX A;  4E85 A;  4C0M A;  1N9A A;  3UKU G;  3ZXP A;  1INZ A;  3W9F A;  2V4L A;  4YND A;  2XS8 A;  4PU8 A;  3PE4 A;  3MKQ B;  3JQ0 A;  2JCG A;  4DLQ A;  2GZU A;  1NA3 A;  4ACK A;  5T8I A;  3D9L A;  2J07 A;  3QJZ A;  3GW4 A;  4J1X A;  2P9U G;  4U0U A;  4KMO A;  3UT4 A;  3C3Q A;  1ELK A;  2WXI A;  3UT7 A;  2EIL E;  1N0Q A;  2VSY A;  4C0E A;  3CLC A;  3PEV B;  4KXK B;  2ZIS A;  4WAF A;  4FN3 A;  2A4Z A;  4UWL A;  3LVR E;  4L9P A;  3ASG A;  2PXK A;  4EZL A;  3I3N A;  4GTS A;  3ZUV B;  3U66 A;  3TG4 A;  3L08 A;  2HCS A;  4YVO A;  2X6I A;  3L17 A;  4APO A;  1OCR E;  4HQD A;  3MJW A;  5JMN D;  1S63 A;  5CED B;  2YNQ A;  3VTX A;  1MJ0 A;  2CHW A;  2WUS R;  2P58 C;  3L22 A;  3FUF A;  4JQD A;  3CVV A;  4LRZ A;  5CMY A;  4WNG A;  1N4Q A;  4GA0 A;  4AOF A;  4JPS A;  3MA5 A;  4AJW A;  4EKI A;  2PXD A;  3QOW A;  1QZ2 A;  3NZU A;  4DX1 A;  5B1A E;  2X6H A;  4ME2 A;  3S8Q A;  4PH4 B;  3CHS A;  4DX2 A;  5EX3 A;  1JUQ A;  3J5Q B;  4JEU A;  3UI2 A;  3RAU A;  4RG6 A;  3TRB A;  1MHQ A;  3OKZ A;  4F7A A;  2R63 A;  3E37 A;  4KBQ A;  3Q78 A;  5KJN A;  2P9L G;  3HG0 D;  2R05 A;  1OCO E;  1EDU A;  3EU9 A;  3CRO L;  3LPZ A;  5FQ6 A;  1H0A A;  5G05 C;  1PER L;  3FU5 A;  4K5B A;  3Q4A B;  3HXF A;  4FJY A;  4UQZ A;  4DX7 D;  3JXD L;  2FF4 A;  1ZZ7 A;  2VEO A;  4K0R A;  4HRM B;  1E8W A;  3HXC A;  3Q9N C;  3BQO A;  2X6F A;  4K5A B;  4ATG A;  2KM4 A;  2WXJ A;  3ZYM A;  2KPJ A;  3UKR G;  3L1P A;  3CV0 A;  4HB5 A;  2NYJ A;  1UW4 B;  3T5X A;  4YDE A;  3SHF A;  4MBG A;  3C5R A;  4GZ3 A;  1RIO A;  4PDX A;  3V79 K;  5FQ8 A;  4GYW A;  1IQU A;  1HU3 A;  1QQE A;  1FPP A;  3ZIM A;  1WY6 A;  3HDX A;  1ZB1 A;  4GYY A;  3SI5 A;  1A17 A;  4U0Z A;  4G25 A;  1FVF A;  3B7T A;  4X4E A;  5ENQ D;  2HCN A;  3MV3 B;  5ENR D;  4JC8 A;  2I2O A;  2PXL A;  4DE9 A;  3FH5 A;  3GZD C;  1Y9Q A;  5LCW J;  2EIJ E;  2XEV A;  3JXI A;  2A5E A;  2LSU A;  5LP0 A;  3OQO A;  4B89 A;  3D9K A;  2ZGD A;  2HO1 A;  3WG7 E;  5ARF A;  4LEU A;  2L6J A;  3FH8 A;  1IKN D;  2OCC E;  1H2V C;  3ZKJ A;  1U3D A;  5KJM A;  4C48 B;  4EBA G;  4EHM A;  3DXK G;  2Q7F A;  4LUN U;  1P5Q A;  1OCZ E;  1H2U A;  5AQA A;  1LF8 A;  4CT4 A;  2X6K A;  4N2S A;  4BT8 A;  1OCT C;  5KNG A;  3LJ3 A;  4J8E A;  1OWP A;  2AUW A;  4EEC A;  1PNR A;  4A3T A;  1UXD A;  2J9Q A;  3ULQ A;  3QC1 A;  4BTB A;  4HOT A;  4HI9 A;  4I1A A;  2QZA A;  3QYX A;  1TNY A;  2L9B A;  4N5C A;  3CHP A;  1FCH A;  4Z5H A;  4OB4 A;  1IQR A;  3ONK A;  2VGX A;  1TEZ A;  4FLH A;  1BLX B;  5CBN A;  3LJN A;  1K1A A;  3O9X A;  1NZN A;  4BET A;  2R2L A;  2YBD A;  2YQ8 A;  1YMP A;  4BY6 A;  2MRI A;  2AWI A;  3A9Y A;  3TL5 A;  3R9A B;  3EUS A;  4KVO A;  4GPM A;  3ZHI A;  1DC2 A;  1U2V G;  4YBA A;  5JA4 D;  4OBM A;  5BW8 C;  4JVS A;  4B0Z A;  4GMJ A;  3ASH A;  4F1P A;  3R09 A;  4CEM A;  3FU0 A;  5FZR A;  2PPX A;  5FQ7 A;  5G04 C;  5EYL A;  3BS3 A;  2WVI A;  1QQB A;  1GW6 A;  3ULY A;  5AJD A;  3GN5 B;  4Q94 A;  3NDB B;  2Y4T A;  5C1D A;  1TNZ A;  4J1W A;  4AVX A;  2PUF A;  5JJ6 A;  2D5V A;  1E8Y A;  3PEU B;  3L6A A;  4ABN A;  3CK7 A;  4UUC A;  3ZHE B;  3EHR A;  1LLI A;  2R02 A;  3UM1 A;  5JHA A;  1ZVV A;  3NXH A;  4U8V D;  1N4P A;  2XXP A;  4TUM A;  3ENE A;  3K9I A;  2I1J A;  3DSU A;  1K8K G;  2GRQ B;  5K98 B;  1UXC A;  3KZ3 A;  1XWR A;  3PE5 A;  2XEE A;  4HRL A;  3EDT B;  4WVL A;  2LXL A;  4OAV B;  1UN9 A;  5A6C A;  1L5J A;  3TWT A;  5C2Y A;  2LYS A;  3C3R A;  3UMV A;  1E8X A;  4LNG A;  5A7D B;  1MX2 A;  4I8T A;  4NRH B;  5HI7 A;  4KYO B;  4FBI A;  5FT9 A;  3ABM E;  3FTW A;  2EIM E;  3BD1 A;  2PXT A;  2IOS A;  2O49 A;  4JL0 A;  4TV3 A;  3RO3 A;  1SQM A;  4JW1 A;  3RIB A;  3CVX A;  2H8R A;  2EIK E;  4UQX A;  2EQX A;  4OYS A;  2IVG A;  3SFZ A;  1RW2 A;  2XGO A;  4U96 D;  1QZX A;  3KJX A;  4I6J A;  4AIF A;  4UI9 J;  4CGV A;  2XJ3 A;  4F1S A;  3TWS A;  2LYQ A;  2XI8 A;  1ZZ9 A;  4JA9 A;  3GZC A;  3SBT B;  1QB2 A;  3P2B A;  1RZS A;  1N52 A;  5EDS A;  4IUL A;  1WET A;  3C72 A;  2PL2 A;  5D2M C;  2XSD C;  4JZY A;  3HRA A;  3V2O A;  3UQ3 A;  3GYZ A;  2IU1 A;  2KBX A;  3FEX A;  2GRO B;  1IC8 A;  5DIZ A;  3DSV A;  2GGF A;  3ISM C;  1YCS B;  5AQ7 A;  1TR4 A;  1KT1 A;  2F37 A;  4ANU A;  1JFT A;  3ZXS A;  3PZ3 A;  1NFI E;  4O1O A;  5DBK A;  3ZN3 A;  3APC A;  3UM2 A;  4X4F A;  1DCQ A;  1E96 B;  4HRA A;  4F53 A;  3ZYL A;  5KNH D;  3Q79 A;  1WM5 A;  3QAQ A;  4GYO A;  2XCB A;  3LS8 A;  2OR1 L;  4YDW A;  2V4H C;  1VDY A;  3CVU A;  2P9K G;  3D9N A;  2Y0B G;  3SZ7 A;  2XZD G;  4Y42 A;  3OWQ A;  1SZ9 A;  2H6I A;  3UIP C;  3PNT B;  3MV2 B;  2PIJ A;  4GCO A;  5D0O D;  3OQM A;  4BX8 A;  4GTR A;  4I6R A;  2L0I A;  4Y6C A;  5ENS D;  3P1U A;  1SQ8 A;  4B8C B;  4J8F A;  4IVZ A;  2BTD A;  3FUE A;  3ML9 A;  1NEQ A;  3CLJ A;  3D9M A;  4CT0 A;  3L9T A;  3AU5 A;  2PZI A;  3HXE A;  1Q2Z A;  3VTY A;  5BT1 A;  5J08 A;  4NAC A;  2BF0 X;  4A55 A;  3JQ1 A;  3B7H A;  5CER B;  2XEN A;  5CMW A;  2CFZ A;  1OWL A;  4LER A;  4U8H A;  4KVM A;  1WG0 A;  2RG8 A;  4PS3 A;  2HR2 A;  4WWN A;  2B5A A;  1TN8 A;  4BER A;  5H7P A;  2FJR A;  1QP0 A;  4AP2 A;  4I6U A;  2OV8 A;  1O1T A;  4HOR A;  5DTR A;  1Z5S C;  4TUU A;  3EIJ A;  1LTX A;  2WXF A;  2YIN A;  5B1B E;  2GRL A;  3FHE A;  4DK5 A;  2OFY A;  3ML8 A;  3N71 A;  2ION A;  3SQV A;  4I6G A;  3CVN A;  2VTB A;  1UG3 A;  5BPP A;  1CJG A;  3AG2 E;  4OAU C;  4GA2 A;  1H6P A;  3CR3 A;  3T8K A;  3ASN E;  4Z58 A;  4AY6 A;  4GZD A;  2FFH A;  4HFG A;  2PXU A;  4U63 A;  3T9K A;  3CSF A;  3FUI A;  2VSO E;  2XHE A;  3TWW A;  2MXD A;  2VJ8 A;  3SO8 A;  3QAR A;  3QOU A;  4L1B A;  3NF1 A;  3RZZ A;  1E90 A;  3D9O A;  2R59 A;  4FU3 A;  1UTX A;  1OUV A;  1LMB 3;  5ITZ F;  3FUK A;  4N2Q A;  5HKP A;  2IQC A;  4DUI A;  3DBS A;  4J8D A;  1S0P A;  2EWT A;  4FJZ A;  2MOW A;  2ICP A;  2GRM A;  3NBN B;  3B95 A;  3ZEF A;  5D0Q D;  3FUD A;  1PRU A;  3MKR A;  1WDY A;  2PM7 A;  4O60 A;  1Z6T A;  2WXR A;  5BUZ A;  3KAE A;  2IVQ A;  4I6T A;  3FTU A;  4XEI G;  1WAO 1;  4ER0 A;  2FO7 A;  4WND A;  1E8Z A;  3MEJ A;  2FO1 E;  5T3R A;  3HZI B;  1CQT A;  5KJK A;  1BI7 B;  3TXN A;  5LCW C;  4WWO A;  5J90 A;  2JVL A;  2WIU B;  1UJJ A;  3I4G A;  3QK0 A;  3CHO A;  2FUL A;  4ATZ D;  2CG3 A;  4GML A;  3TGO A;  1TNU A;  1EYH A;  3CVY A;  4NUR A;  4UWH A;  3LFP A;  5D66 A;  4GQM A;  3G7D A;  5EIL A;  4H7X A;  2KEI A;  1HX8 A;  4BTA A;  1YA0 A;  3MCX A;  4GTM A;  3ZFW A;  4DX6 D;  2DZO A;  3R7Q A;  2L8N A;  3UWP A;  1AWC B;  3GN5 A;  4G24 A;  1N54 A;  1PAQ A;  1H19 A;  3D9P A;  3NOC D;  3ZHE A;  5EKQ D;  1ZU2 A;  3V31 A;  1TNB A;  2DCP A;  3O48 A;  1H2T C;  1A5E A;  2HSG A;  4GTO A;  5JJT A;  3TWV A;  1VPW A;  1DW9 A;  3QQ6 A;  2VGE A;  5KCM A;  1WIZ A;  3G2S A;  2HE0 A;  4YVQ C;  2O38 A;  1EFA A;  1SZA A;  2ICT A;  4X4B A;  2OVF A;  1UN8 A;  2XPZ A;  1NW3 A;  4ACL A;  3RRU A;  3LQX A;  3ONL A;  4WUY A;  3VWS A;  4UQY A;  3FMY A;  3ASF A;  3Q9U C;  1TNO A;  3G5G A;  4YDO A;  4JCX A;  3CVP A;  2UY1 A;  2DZN A;  2R5S A;  1QNF A;  2XZT G;  2EF8 A;  3OP9 A;  5BV1 A;  1ZPQ A;  3LXU X;  4CDN A;  3ESK A;  4TXP A;  3Q75 A;  2DIW A;  1PC2 A;  5AYW D;  3CVQ A;  3IHY A;  1NA0 A;  1ELR A;  3BEE A;  4JHK A;  4IRU A;  4NQ0 A;  1HFA A;  2WXH A;  2XCJ A;  3D3M A;  2LXM A;  4N5Q A;  1HH8 A;  3ZVV A;  5KWD A;  2KC7 A;  2M4H A;  4G23 A;  4RLY A;  1TN6 A;  3MGB A;  2WQH A;  4GCN A;  1OWM A;  2P9P G;  3G2U A;  4HOU A;  2VSN A;  3G2V A;  4DI3 A;  3FU3 A;  3U4T A;  4HXI A;  3DEP A;  1RZR A;  1DCE A;  3FWV A;  3TWQ A;  3CVW A;  4Q96 A;  1BDH A;  2PXE A;  4MCX A;  1MX6 A;  3CVL A;  3UM0 A;  3NZS A;  2B0O E;  1X5B A;  4X4H A;  1ZS4 A;  3KEZ A;  2RD0 A;  2LYL A;  3HYM B;  4AEZ C;  1H6K A;  2PQN A;  2H6F A;  4WNE A;  2LYK A;  3S7D A;  3AG3 E;  1MX4 A;  4LG6 A;  5CEA A;  1ZZ8 A;  2YHE A;  2FI7 A;  3ULE G;  1KLX A;  2WMN A;  4EK9 A;  1EF1 C;  2IFU A;  3BG1 B;  4I2Z A;  3Q73 A;  4XI0 A;  4G8K A;  2WPV A;  2QC9 A;  2XGM A;  2LYP A;  2QYJ A;  3FYA A;  1GT0 C;  4GA1 A;  4GZ5 A; 
#chains in the Genus database with same CATH homology
 2HYZ A;  4GZC A;  2XGO A;  3KJX A;  4BT9 A;  1QP7 A;  4I6J A;  4AIF A;  4UI9 J;  1JPL A;  4CGV A;  4N3A A;  2XJ3 A;  1KT0 A;  2MEZ A;  2C0L A;  2WXO A;  4C9B B;  3PH0 C;  4F1S A;  5CCL A;  3ZW3 A;  4JHR A;  2LYQ A;  1QPZ A;  3LKU A;  2XI8 A;  4N39 A;  1ZZ9 A;  3C98 A;  4JA9 A;  4K03 A;  4RVB A;  3SBT B;  2PQR A;  1HZ4 A;  3P2B A;  2BJC A;  2X38 A;  1RZS A;  1N52 A;  5EDS A;  3LDZ A;  4IUL A;  1WET A;  5G55 A;  3I4R B;  1TJC A;  2PL2 A;  1IYG A;  3G2T A;  2XSD C;  4GAA A;  2PUA A;  5E76 A;  4JZY A;  4E6H A;  4FAD A;  3BDN A;  1BPO A;  3ZYQ A;  4BFR A;  3UQ3 A;  1AU7 A;  1PY1 A;  2BNN A;  2LAI A;  2R1J L;  2J4B A;  3GYZ A;  3IHV A;  4FHJ A;  4W9R A;  2IU1 A;  4ANW A;  1HG2 A;  3DNV B;  4A3V A;  3FEX A;  4XZ4 A;  4EZJ A;  2CG2 A;  3HVE B;  1IC8 A;  1FVH A;  4CDR A;  4I2W A;  4HOS A;  2V0P A;  5FJY A;  2UWJ G;  3OQN A;  2GGF A;  3JUI A;  5DIZ A;  2J09 A;  2A5U A;  3Q47 B;  4CCA A;  3O4Z A;  3QB2 A;  4UWK A;  3CK8 A;  3FEY A;  3JXC L;  4C0M A;  2OND A;  4E85 A;  1KT1 A;  3QWW A;  1INZ A;  4ANU A;  1JFT A;  2V4L A;  3PRZ A;  3QKY A;  3ZXS A;  4YND A;  5JJ7 A;  2FEZ A;  4PU8 A;  4GB9 A;  5DBK A;  2PUC A;  4I9C A;  4APF A;  4XKC A;  2X6J A;  2L49 A;  3PE4 A;  2XCC A;  4G1T A;  3UT8 A;  4DPR A;  3ZN3 A;  3APC A;  5KJL A;  1R63 A;  2WXN A;  4IN3 B;  4X4F A;  2VSX E;  3MKQ B;  3JQ0 A;  4PU7 A;  4IYP A;  4NDW A;  3VLE A;  2J08 A;  2JCG A;  3EHM A;  4DLQ A;  2NC9 A;  1E96 B;  5JHB A;  4F53 A;  3G2W A;  3ZYL A;  3HIZ A;  2GZU A;  1NA3 A;  4ACK A;  2E0I A;  1WM5 A;  5HQ8 A;  4ANX A;  3QAQ A;  2KCV A;  2XCB A;  4GYO A;  5T8I A;  4CDM A;  2L0T B;  3CQC B;  4PDX A;  3LS8 A;  3D9L A;  4P29 A;  2J07 A;  2OR1 L;  2LNI A;  3FTX A;  5ANR A;  3RO2 A;  1VDY A;  5BV0 A;  1XNF A;  3CST A;  2OOE A;  3CVU A;  3D9N A;  3SZ7 A;  3QJZ A;  3GW4 A;  4N3B A;  2LYR A;  4J1X A;  4Y42 A;  3UFD A;  3I5P A;  3OXG A;  4X4C A;  4KMO A;  4U0U A;  1Y8M A;  3UT4 A;  3NQP A;  3T5V A;  3ESL A;  4KZ0 A;  1ELK A;  1SZ9 A;  2V8S E;  2X3M A;  2WXI A;  3UT7 A;  4X4G A;  1MQS A;  2KZ8 A;  2VSY A;  4C0E A;  3PNT B;  3MV2 B;  2PIJ A;  3CLC A;  3PEV B;  4GCO A;  4KXK B;  4G2V A;  4WAF A;  5D0O D;  4XI9 A;  4FN3 A;  3OQM A;  2A4Z A;  4UWL A;  3LVR E;  4BX8 A;  3HHM A;  3URZ A;  3ASG A;  3PZD A;  3FUJ A;  4EZL A;  3I3N A;  5E75 A;  4I6R A;  3SCF A;  3U66 A;  2L0I A;  1ZZC A;  4Z59 A;  4Y6C A;  3P1U A;  3TG4 A;  3L08 A;  1SQ8 A;  4B8C B;  4J0U A;  4YVO A;  2X6I A;  4J8F A;  3L17 A;  4IVZ A;  4J6I A;  4APO A;  2BTD A;  3RO3 A;  1X57 A;  3FUE A;  3ML9 A;  4XIF A;  3U64 A;  2VTB B;  4WWP A;  1NEQ A;  4J8S A;  3MKQ A;  3MJW A;  1HXI A;  3CLJ A;  3D9M A;  4ILH B;  4CT0 A;  3AU5 A;  2PZI A;  2C0M A;  2YNQ A;  4U0S A;  3RU0 A;  3VTX A;  4AXH A;  3VTY A;  4UI9 K;  5BT1 A;  3Q15 A;  2CHW A;  5J08 A;  2WUS R;  2P58 C;  2BF0 X;  3L22 A;  3R1F A;  3JQ1 A;  3B7H A;  4NAC A;  4A55 A;  3FUF A;  1OWO A;  3FU6 A;  4L23 A;  2O4A A;  5CMW A;  1Z3X A;  2CFZ A;  1OWL A;  4LER A;  4JQD A;  5FZQ A;  3CVV A;  2VGY A;  4U8H A;  4KVM A;  2RG8 A;  3VLD A;  1JH9 A;  4LRZ A;  4PS3 A;  2MHK A;  3LCA A;  4GPK A;  4MS6 A;  2HR2 A;  1UJK A;  4WWN A;  5CMY A;  3MX3 A;  3CGH A;  2B5A A;  4WNG A;  5AIJ A;  2I9C A;  1YSE A;  4JXT A;  5A23 A;  3QF3 A;  4ILI A;  4UWG A;  2AVP A;  3S7J A;  2FJR A;  1QP0 A;  4GA0 A;  4AP2 A;  4AOF A;  4I6U A;  4JPS A;  3SFZ A;  2OV8 A;  4HOR A;  4I17 A;  4TUU A;  3EIJ A;  3PUK A;  1POU A;  1TJF A;  3MA5 A;  4AJW A;  2WXF A;  2YIN A;  1PRV A;  1QZ2 A;  2GRL A;  3FHE A;  3NZU A;  4R7L A;  4A1G A;  4DK5 A;  2OFY A;  2OVB A;  3ML8 A;  2M63 A;  4KT6 B;  1DWK A;  3UUX A;  3N71 A;  2C2L A;  3CKB A;  2X6H A;  4ME2 A;  2KEK A;  3S8Q A;  1EPU A;  5T4Y A;  2ION A;  4PH4 B;  1Z3Y A;  3CHS A;  4L2L A;  4UI9 C;  4WNF A;  5FZS A;  5EX3 A;  4I6G A;  1JUQ A;  3CVN A;  3AS4 A;  3KS2 A;  2JLB A;  4RG9 A;  4JA7 A;  1RPE L;  3OAW A;  4V3I A;  2VTB A;  3UX4 A;  2WB2 A;  2CSF A;  1UG3 A;  2WXL A;  4JEU A;  2IU7 A;  1CJG A;  4RG6 A;  4FA6 A;  3TRB A;  3APD A;  5BPP A;  4GA2 A;  3IBE A;  4O8B A;  1MHQ A;  4OVV A;  4DI4 A;  4YG7 B;  3CR3 A;  1E7V A;  2LSV A;  2ZU6 B;  4Z58 A;  4X4I A;  4L7T A;  4B8A A;  5CCM A;  4AY6 A;  4GZD A;  4F7A A;  3PS6 A;  2R63 A;  4G26 A;  2VYI A;  4KBQ A;  5KJN A;  4HFG A;  3RRM B;  3ZPJ A;  3FTS A;  4U63 A;  1EDU A;  3CSF A;  4YG1 A;  2WM9 A;  3FUI A;  3LPZ A;  3CRO L;  3CHQ A;  4MRU A;  2VSO E;  2XHE A;  2VJ8 A;  5FQ6 A;  1H0A A;  3F51 A;  1HE8 A;  3L13 A;  5G05 C;  3F6W A;  3QAR A;  5G05 J;  1PER L;  3EIQ C;  3FU5 A;  3QOU A;  3Q4A B;  3KXA A;  4CGW A;  3D9J A;  1DNP A;  3L16 A;  3QDN A;  3APF A;  4FJY A;  3NF1 A;  4L1B A;  1DVP A;  4UQZ A;  2V5F A;  4GU5 A;  4O6F A;  3RZZ A;  3JXD L;  2FF4 A;  3U3W A;  2GW1 A;  1ZZ7 A;  2WQ7 A;  1E90 A;  3SCH A;  4MCT A;  3D9O A;  4K0R A;  2R59 A;  1LCD A;  2AXV A;  4FU3 A;  4ILG A;  1E8W A;  3LYA A;  4CRW A;  1UTX A;  1OUV A;  3LY7 A;  3QWP A;  4Z5D A;  4GHJ A;  3ZYK A;  1LMB 3;  2X6F A;  4AY5 A;  3U9W A;  4ATG A;  4MLP A;  4F8D A;  2KM4 A;  3FUK A;  3IKO B;  3B13 A;  4N2Q A;  2WXJ A;  3RK6 A;  3FTY A;  3ZYM A;  2IQC A;  2KPJ A;  3DBS A;  3LEW A;  4J8D A;  1S0P A;  4JHJ A;  3L1P A;  4IWR A;  2EWT A;  4FJZ A;  3CV0 A;  2MOW A;  2AW6 A;  2J49 A;  2ICP A;  2GRM A;  3TAX A;  1BDI A;  3L54 A;  4UWF A;  3ZEF A;  5D0Q D;  1WH6 A;  3FYM A;  2KZT A;  3FP3 A;  1PRU A;  3FUD A;  4YG4 A;  3B7S A;  1ZUG A;  1UW4 B;  3MKR A;  5LFA A;  3T5X A;  3JYS A;  3SHF A;  3PDN A;  2PM7 A;  1Z6T A;  2WXR A;  3E4B A;  5BUZ A;  3KAE A;  2IVQ A;  4I6T A;  1RIO A;  2XGS A;  3FTU A;  3PUJ A;  4GZ3 A;  4GYW A;  1IQU A;  1HU3 A;  1QQE A;  1WAO 1;  3IV0 A;  2FO7 A;  4WND A;  1E8Z A;  3ZIM A;  2A6C A;  1WY6 A;  3EJN A;  3HDX A;  4GYY A;  5EX0 A;  3S7B A;  4FP7 A;  3SI5 A;  1A17 A;  3DPD A;  4U0Z A;  2YHC A;  1QP4 A;  1XGW A;  2KCL A;  4G25 A;  3HZI B;  1CQT A;  1FVF A;  4X4E A;  3B7T A;  4JEH A;  5T3R A;  4ANV A;  4Q69 A;  2KAT A;  3MV3 B;  4JC8 A;  4KZC A;  5KJK A;  2I2O A;  3TXN A;  3FH5 A;  2WXQ A;  5FWQ A;  5ANL A;  5LCW C;  1Y9Q A;  4WWO A;  2JVL A;  1ADR A;  2DBA A;  2JEK A;  2WIU B;  1UJJ A;  3AS5 A;  4Y6W A;  2LO6 A;  5G2N A;  5LCW J;  3RKV A;  3TXM A;  3JCK C;  3I4G A;  2XEV A;  4M3O A;  3QK0 A;  2PUB A;  2QY7 A;  3CHO A;  3FUH A;  3PE3 A;  2FUL A;  2LSU A;  5LP0 A;  2CG3 A;  3FTZ A;  3OQO A;  4EZK A;  4GML A;  4B89 A;  2XPY A;  3TGO A;  3D9K A;  3FFL A;  1EYH A;  5CHE E;  1X2L A;  2MQK A;  3PXP A;  2I6H A;  3GZ1 A;  1HG5 A;  3CVY A;  4NUR A;  4UWH A;  3GBF A;  4Z5C A;  2HO1 A;  4I1O B;  2EBY A;  3LFP A;  3D1N I;  3B7U X;  4GQM A;  5ARF A;  4LEU A;  2L6J A;  4HLE A;  3FH8 A;  2LYJ A;  3SF4 A;  3QWG A;  3G7D A;  4RSY A;  3SGH A;  1H2V C;  2BUG A;  4H7X A;  3CHM A;  2KEI A;  3OXF A;  1HX8 A;  4GZ6 A;  4BTA A;  3MLF A;  4H7Y A;  1YA0 A;  3MCX A;  2IUO A;  1U3D A;  5KJM A;  3ZFW A;  1OWN A;  2IOL A;  3BG0 B;  3ZRH A;  4EBA G;  3IEG A;  2ILR A;  2PM6 A;  3FUN A;  3R7Q A;  4HS2 A;  2L8N A;  4EBA A;  3GN5 A;  1E7U A;  2Q7F A;  4G24 A;  4GZ5 A;  4LUN U;  1H2U A;  2FBN A;  1N54 A;  1QQA A;  1PAQ A;  2QFC A;  1LF8 A;  3CK9 A;  4U04 A;  1H19 A;  3ZGQ A;  2X6K A;  4CT4 A;  5M72 A;  4N2S A;  2KEJ A;  2NXP A;  4BT8 A;  1OCT C;  3D9P A;  1LQC A;  2Y3A A;  4XKB A;  3LJ3 A;  3ZHE A;  4J8E A;  1OWP A;  1JWG A;  2AUW A;  4IA8 A;  3PNL B;  4EEC A;  1PNR A;  2UY1 B;  5EKQ D;  2WQ6 A;  1ZU2 A;  4A3T A;  2AXZ A;  2CFU A;  3UPV A;  4XX5 A;  5J90 A;  1UXD A;  3SCG A;  2DCP A;  2J9Q A;  3ULQ A;  2HIN A;  2CRO A;  3QC1 A;  3MEK A;  3O48 A;  3SD5 A;  1H2T C;  4BTB A;  4DJA A;  4PS7 A;  4HOT A;  4I1A A;  2HSG A;  3S2A A;  3LY9 A;  2KZT B;  5JJT A;  4URK A;  1VPW A;  1W3B A;  3FY4 A;  4G11 A;  3AU4 A;  1IHG A;  2CHX A;  1DW9 A;  2CHZ A;  3RJV A;  3QYX A;  3D9I A;  4AV7 A;  3QQ6 A;  2L9B A;  4N5C A;  3CHP A;  1FCH A;  3PVL A;  5AJL A;  4Z5H A;  1WIZ A;  3FTV A;  5ENN A;  5KCM A;  4OVU A;  4OB4 A;  3G2S A;  3EHN A;  4A1S A;  4X4D A;  4YVQ C;  4I6E A;  2O38 A;  1EFA A;  1SZA A;  4EPZ A;  2ICT A;  4X4B A;  2OVF A;  1IQR A;  1UN8 A;  1ZZB A;  4EQF A;  2XPZ A;  2VQ2 A;  3RRN B;  3VLF A;  3ONK A;  2VGX A;  3QWV A;  3H5T A;  1JFS A;  1U3C A;  4ACL A;  4HVB A;  3CEC A;  4FLH A;  3RRU A;  1TEZ A;  4DLO A;  3ONL A;  4FLB A;  3O9X A;  4WUY A;  2AXU A;  1ELW A;  1B0N A;  1NZN A;  1JWF A;  2IVB A;  1HF8 A;  4UQY A;  3FMY A;  3ASF A;  2XPI A;  3G5G A;  3Q49 B;  1Y6I A;  2YQ8 A;  3FUL A;  3CIA A;  4JCX A;  4L2Y A;  3CVP A;  2BNO A;  1Y7Y A;  2IJG X;  4PS8 A;  4BY6 A;  2MRI A;  4F3V A;  2UY1 A;  2AWI A;  3TL5 A;  1B89 A;  3R9A B;  1HS6 A;  2R5S A;  3TG5 A;  1QNF A;  2J4D A;  2EF8 A;  3OP9 A;  5BV1 A;  3EUS A;  4FC8 A;  4KVO A;  3MZL B;  2XIU A;  3ZHI A;  3TJP A;  3F52 A;  4YBA A;  4B94 A;  1ZPQ A;  3VK0 A;  3LXU X;  5BW8 C;  4JVS A;  3FUM A;  4GMJ A;  4B0Z A;  4CDN A;  2XQ0 A;  2XRZ A;  3ASH A;  2E2E A;  3ESK A;  4CEM A;  1R69 A;  4I43 A;  2IV1 A;  4PU4 C;  1LCC A;  1PC2 A;  2DIW A;  4TRQ A;  3FU0 A;  1RZR D;  2HM8 A;  3AS8 A;  2PPX A;  2WXP A;  3LVQ E;  3CVQ A;  5FQ7 A;  5FZR A;  5G04 C;  4BX9 A;  3IHY A;  1NA0 A;  5G04 J;  1PRA A;  1ELR A;  3BEE A;  3SNX A;  3BS3 A;  2WVI A;  4LCT A;  4JHK A;  4IRU A;  3WXX A;  4NQ0 A;  1QQB A;  1GW6 A;  1HFA A;  2WXH A;  3OXL A;  2XCJ A;  3D3M A;  5AJD A;  1HF0 A;  4N3C A;  3GN5 B;  1HH8 A;  1L1M A;  4Q94 A;  3ZVV A;  2Y4T A;  2KC7 A;  3FDH A;  5C1D A;  3SBS A;  1WH8 A;  4J1W A;  1HO8 A;  3B7R L;  4AVX A;  2PUF A;  3CQG B;  3CKC A;  4G23 A;  4HOQ A;  5JJ6 A;  2D5V A;  1E8Y A;  3MGB A;  3L6A A;  3PEU B;  4XE0 A;  3CK7 A;  4ABN A;  2LAH A;  2WQH A;  4GCN A;  3ZHE B;  1LLI A;  3S7F A;  1OWM A;  3MYV A;  3G2U A;  3JXB C;  4HOU A;  2VSN A;  3G2V A;  1ZVV A;  1ZBP A;  3FU3 A;  3LY8 A;  4DI3 A;  5JHA A;  3U4T A;  5AYW D;  3HVE A;  4U07 A;  3R7R A;  4HXI A;  3GZS A;  3IVP A;  3ENE A;  1RZR A;  2I1J A;  3K9I A;  5ARG A;  3FWV A;  3KD7 A;  5K98 B;  4YAR A;  4JCY A;  3CVW A;  1UXC A;  3KZ3 A;  2IF4 A;  4FHK A;  1XWR A;  4Q96 A;  5BNW A;  1BDH A;  4MCX A;  3CHR A;  2PUD A;  3CVL A;  1S7E A;  3NZS A;  3EDT B;  2PUG A;  4QFV A;  2LCV A;  4BSX A;  5LX8 A;  1X5B A;  1UN9 A;  5FQ8 A;  4X4H A;  4PU3 C;  5LOZ A;  5A6C A;  1ZS4 A;  1L5J A;  2R17 C;  3KEZ A;  2WXG A;  1NER A;  2RD0 A;  2LYL A;  3HYM B;  3OMT A;  3Q5M A;  5C2Y A;  4AEZ C;  2LYS A;  3UMV A;  1H6K A;  2PQN A;  1E8X A;  1ZZ6 A;  3FH7 A;  3QNK A;  2I1K A;  5A7D B;  4I8T A;  4NRH B;  5HI7 A;  4AM9 A;  4WNE A;  5AEN A;  2Y4U A;  4I9E A;  4KYO B;  5FTP A;  2VGX B;  2LYK A;  4MKT A;  3LIS A;  2KCK A;  1O4X A;  3ZKC A;  1NP7 A;  3S7D A;  4FBI A;  5FT9 A;  2WXK A;  2WXM A;  1ZAY A;  5FQ4 A;  2NSZ A;  3FTW A;  3GZ2 A;  4BWR A;  4I1M A;  2XRY A;  1ZZ8 A;  3BD1 A;  2YHE A;  2FI7 A;  2IOS A;  4PUC A;  1KLX A;  2WMN A;  3ASD A;  5A7L A;  1EF1 C;  3CEQ A;  2BNM A;  2O49 A;  4JL0 A;  2WMO A;  4TV3 A;  3OTN A;  2IFU A;  1SQM A;  3BG1 B;  4JW1 A;  1E3O C;  3RIB A;  4I2Z A;  4XI0 A;  3CVX A;  2PUE A;  4D10 C;  2H8R A;  1JWL A;  2WPV A;  4UQX A;  3T8M A;  2PE5 A;  2EQX A;  2LYP A;  2XGM A;  4GA1 A;  3FYA A;  4FUL A;  4OYS A;  3PRE A;  2IVG A;  1GT0 C;  3ZHM A;  1OSL A;  1P5Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...