2GRLA

Crystal structure of dct/icf10 complex
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
287
structure length
287
Chain Sequence
MFKIGSVLKQIRQELNYHQIDLYSGIMSKSVYIKVEADSRPISVEELSKFSERLGVNFFEILNRAGMNTKSVNETGKEKLLISKIFTNPDLFDKNFQRIEPKRLTSLQYFSIYLGYISIAHHYNIEVPTFNKTITSDLKHLYDKRTTFFGIDYEIVSNLLNVLPYEEVSSIIKPMYPIVDSFGKDYDLTIQTVLKNALTISIMNRNLKEAQYYINQFEHLKTIKNISINGYYDLEINYLKQIYQFLTDKNIDSYLNAVNIINIFKIIGKEDIHRSLVEELTKISAKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PrgX
publication title Molecular basis for control of conjugation by bacterial pheromone and inhibitor peptides.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Transcription
total genus 112
structure length 287
sequence length 287
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2grlA01
1.25.40.400 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2grlA02
4J1WA 1Y9QA 2LYLA 1CQTA 2PUAA 1CJGA 4MCXA 1BDIA 3UFDA 3VK0A 3BS3A 1QP7A 2FJRA 3TRBA 3OP9A 1LCCA 3ZKCA 3PXPA 4X4HA 1X2LA 3OQOA 5K98B 3DNVB 1QP4A 3QYXA 3O9XA 4YG4A 2L8NA 1LQCA 3BD1A 2EWTA 2KEIA 1WH8A 2LYKA 3CECA 1WH6A 3SCFA 3JXDL 4X4GA 1BDHA 1OCTC 2LYJA 3G5GA 2GZUA 3QQ6A 2HSGA 4FBIA 1IC8A 2OR1L 3H5TA 2PIJA 2ICTA 2MQKA 2AWIA 2L49A 3QWGA 2R1JL 1RZSA 2MEZA 4Z5DA 1E3OC 4PU8A 4X4FA 2R63A 2AXVA 4IA8A 3OQMA 2LYPA 4Z5HA 1RZRA 1YSEA 2PPXA 4YBAA 1JWLA 1WETA 2B5AA 4X4BA 1R63A 2KPJA 4IWRA 2PUCA 2D5VA 1DWKA 4JCYA 2WIUB 1QP0A 3L1PA 1VPWA 2HINA 1RPEL 4OB4A 3F52A 2PUEA 4JCXA 4X4CA 1NEQA 3FYAA 3FYMA 1RIOA 2O4AA 2IV1A 1QQAA 1POUA 3F6WA 2AXUA 2WUSR 3HZIB 3JXCL 1RZRD 1O4XA 1ZS4A 2AW6A 3EUSA 1JFSA 2JVLA 3ZHMA 2O49A 1ZZ7A 2XI8A 4PU4C 1ZZ6A 3KXAA 1JH9A 2LCVA 3LISA 1LLIA 4YARA 1ADRA 3FMYA 1DW9A 4X4IA 4X4DA 1ZZCA 2XJ3A 4Y42A 1UXCA 1LCDA 1PRAA 3CROL 1Y7YA 2JCGA 3IVPA 1ZAYA 2LYRA 2IUOA 3G7DA 4PU3C 2OFYA 2XSDC 2IVGA 1XWRA 2BNNA 2CSFA 3F51A 1LMB3 3JXBC 4NDWA 3SCHA 1JFTA 3GN5A 3MLFA 1L1MA 1S7EA 4F8DA 2XCJA 1ZPQA 2BNOA 2LYSA 3CLCA 3KZ3A 2GRMA 1NERA 1X57A 4GHJA 4MCTA 1PNRA 4X4EA 4O8BA 1PRVA 4GQMA 2IVQA 4I6UA 1R69A 3OMTA 1GT0C 3R1FA 4J1XA 3RZZA 4YG7B 1B0NA 2PUFA 2BJCA 2LYQA 4Z59A 2CROA 2H8RA 1ZZBA 2EBYA 3QF3A 1PERL 3BDNA 2PUGA 2A6CA 1PRUA 2AUWA 2AXZA 2KEJA 2IU7A 3OQNA 4I6RA 4Z5CA 3S8QA 2O38A 4YG1A 2IVBA 3U3WA 3SCGA 1ZZ9A 4IVZA 1QPZA 4PU7A 2KEKA 3ZHIA 2PUBA 4I6TA 3LFPA 1OSLA 4FN3A 1EFAA 3GN5B 1ZVVA 2PE5A 2XIUA 4JQDA 2PUDA 1ZZ8A 4I8TA 3B7HA 2KZ8A 1QQBA 3D1NI 1SQ8A 3GBFA 2BNMA 2ICPA 1UTXA 2EF8A 5A7LA 4Z58A 1WIZA 1AU7A 2GRLA 1HF0A 1ZUGA 1UXDA 3KJXA
chains in the Genus database with same CATH superfamily
2Y4UA 2C0MA 4J7WA 4ER0A 1K3ZD 1MZCA 2JEKA 2XRZA 2LXMA 3DBSA 4N2QA 3DSXA 2X6KA 1EF1C 3TWRA 3JXDL 5EILA 4XIFA 4TRQA 3ZNGA 1X5BA 3G5GA 4EZJA 3P2BA 3HDXA 1IC8A 5DT2A 2QY7A 1NW3A 3ZN3A 3TG4A 3ABKE 4X4FA 2KZTB 3IHVA 2PXBA 1O1RA 1WETA 4HFGA 2QC9A 3ABLE 2VSNA 4JHRA 4A3TA 4APOA 5JJTA 2P9IG 2XPIA 4O6FA 5BPPA 3E30A 2Y69E 3BQOA 4LNUD 1N94A 2WUSR 2V5FA 1O4XA 3DSWA 2CFZA 1N4SA 5ARGA 1JFSA 2JVLA 1E8WA 3EIQC 4GA2A 2WXLA 1LLIA 3ME5A 4CGWA 2WXGA 2BKKB 1BU9A 2GRQB 1P5QA 1LCDA 4GZ5A 4FA6A 2LYRA 5AIJA 1IXVA 4YDOA 2LXLA 3QWWA 1HXIA 3RU0A 4BT9A 3CLCA 1MQSA 3T9KA 4PS8A 3PNLB 1SZ9A 1NERA 4UI9J 4HQDA 4GHJA 4O1PA 3VLFA 3UINC 2H6IA 2I1JA 1QBQA 3D9JA 3ZVVA 4BWRA 3L82A 4YVQC 2V8SE 1E8ZA 4BX8A 4DLOA 3ASOE 4L9PA 2PXKA 4OYSA 2MYOA 4UWHA 2I2OA 4GTVA 1JPLA 3B7HA 3PE3A 3NZUA 1UTXA 3Q78A 2LYLA 3A9XA 2XPYA 4Q69A 4IULA 2FJRA 2P9PG 3D9IA 5K98B 3I4RB 2GW1A 3R9AB 3UUXA 5JUWA 1ZU2A 3GYZA 3X2QE 4AV7A 1TN6A 2HCSA 4I1AA 1QZXA 3FHEA 2KBXA 1XGWA 2LYPA 4TXPA 4QFVA 5CECB 4WUYA 3ZU7B 1RIOA 2Y3AA 3EU9A 1DC2A 2AW6A 2XI8A 4YARA 3FMYA 1ZZCA 3CV0A 3PVLA 4HORA 3V30A 3TWQA 3E4BA 5KJNA 4GTQA 2CSFA 2BNNA 2X6HA 1QQEA 3GN5A 1FVFA 1WAO1 3KS2A 3DSSA 4BY6A 5CBOA 1PAQA 5AQ9A 4DX5D 3KL4A 1R69A 3OMTA 1GT0C 2R03A 3Q9UC 3R1FA 3PDNA 1PRUA 4GTPA 1BLXB 4EZKA 5FZQA 5LOZA 3D9NA 2PUBA 3PZDA 3W9GA 1NI1A 3JXIA 5AN8A 1UN9A 1IYGA 2L6JA 3LY9A 3GZDC 3DSVA 2RG8A 3ZKCA 4X4HA 4UWLA 2DZOA 3ML8A 2R59A 4PUCA 4HI8A 3GUUA 1H0AA 2ETCA 3JQ0A 2F37A 3IEGA 1LTXA 2WXIA 4FBIA 4AXHA 1TNOA 2XGSA 3FUEA 4E6HA 4HRLA 2YQ8A 3CR3A 2ETAA 5KJLA 2LUHA 4JD2G 4UQYA 4WVLA 3SHFA 4C9BB 3ZUVB 4APFA 4I9EA 3PZ4A 3DSUA 4HLEA 4LNGA 1ELKA 1EYHA 3DM5A 3CHOA 2KCVA 3DXMG 2VGYA 3FTYA 2XXPA 3TWWA 3SR4A 1HH8A 4MRUA 1ZAYA 4ATZD 3L6AA 3JXBC 4NDWA 1JFTA 3L9TA 4BT8A 2VEOA 1JUQA 3E37A 3KZ3A 3U64A 2CHZA 1PRVA 5AJLA 3ZPJA 3T5VA 4YG7B 1S70B 2R02A 5CRVA 4EBAG 4RLYA 4DX6D 1OWNA 3ZHIA 3EUVA 4A3VA 1OSLA 1Y8MA 3LKUA 4R7LA 3GN5B 3FWVA 3ZFWA 1SW6A 5KCMA 4WNEA 2GRPB 5D0OD 4BTBA 2EF8A 3NQPA 1WIZA 5M72A 4B0ZA 3TWSA 3VK0A 1JWGA 2OEVA 3SBTB 1MFQC 1UN8A 3UQ3A 2LYKA 4BSZB 2LSUA 3CVQA 1WH6A 4FLBA 2LYJA 3PZ3A 4GTTA 1U3CA 3S7FA 2MRIA 2B0OE 4BTAA 3ASFA 1PC2A 3MA5A 3FH5A 2RKKA 2QFCA 2HCNA 3JXJA 3V2XA 2WIUB 3U4TA 2WXFA 2BF0X 3FULA 4WNFA 2VYIA 5BNWA 2WMOA 4XZ4A 2UY1A 2FFHA 4OAUC 5KNHD 4DJAA 4PU3C 3HVEB 1TEZA 3GZCA 3CK7A 4M7CA 3SGHA 1S64A 4EK9A 1LMB3 2IOSA 4B8AA 1N54A 2I1KA 1SA5A 5AJDA 4GTSA 4ACLA 3CIAA 2X6FA 3ONLA 2VTBB 2CROA 1ZZBA 3QF3A 3OQNA 5AQ7A 1K8KG 2LAHA 2VJ8A 4YG1A 4U7EB 5ENTD 2P9SG 5BV0A 3D3MA 3ZYQA 3V31A 5EIDA 4FHJA 3D1NI 1SQ8A 3URZA 4JA9A 4DI3A 4DX1A 4GPMA 1UXDA 4GZ6A 4J6IA 1RZ4A 4JHKA 3UPVA 3UTMA 1K1AA 3FEYA 4ER7A 1E8XA 2XCCA 3DEOA 4C0MA 3ML9A 2WXKA 3ASDA 3FH7A 4HRNA 4G26A 4HI9A 4LUNU 3CKCA 3G2TA 3CECA 3FFLA 4FP7A 2RFMA 3I3NA 4CDNA 4Y6WA 3AS4A 2ICTA 3SO8A 3RO3A 2IO3C 2PXFA 3J5PA 4AIFA 3RK6A 3CEQA 5DBKA 3AG2E 4J8EA 2DIWA 2O4AA 4KZ0A 2R2LA 5AYWD 5G04C 5G05J 4GA1A 1DULA 2WXMA 5BXUA 2PNNA 2ZGDA 4GTRA 2R5SA 2J4BA 1WDYA 4GPKA 3HYMB 4WWPA 2DBAA 3GZ2A 4EHMA 5FJYA 1TNUA 4DPRA 3CVYA 1IHBA 5LCWJ 3E34A 2WQ6A 5FINA 4Y6CA 3L22A 2UY1B 2GROB 1H2VC 5BV1A 4UI9K 3KEZA 4I6TA 4GTMA 3C72A 4JQDA 2DCPA 1QQBA 2ETBA 3A9ZA 4XKCA 3LJNA 4JEUA 2WXNA 3KJXA 1CQTA 4MCXA 4I2ZA 4PH4B 1NA0A 1OY3D 3PH0C 1X2LA 4I1OB 5D0QD 3MJWA 3NAWA 5C1DA 3TJPA 3RRMB 3DWLG 2J7UA 5EKQD 3V2OA 5J08A 3CK8A 3MCXA 2MQKA 4BEPA 4UQZA 1TNYA 1KLXA 3T8KA 1YA0A 4Z5HA 2VSXE 4U0ZA 1RW2A 4HNAD 5EX3A 2KPJA 3CVUA 3ONKA 3L1PA 1RPEL 4GYYA 1Z3YA 3FYMA 4GZDA 1QQAA 2AXUA 3TWUA 1ZS4A 1U2ZA 3UWPA 4HRAA 3SF4A 3B7UX 3V79K 2WMNA 4GA0A 2CHXA 3QFIA 4DE9A 3LY8A 4DRXE 4U8YD 4MBGA 3QARA 4U96D 2H6GA 3APFA 1QYMA 2M4HA 1X57A 5HS0A 4XE0A 4GQMA 2XEHA 3QAQA 1E7VA 4ATGA 3RZZA 1W3BA 3R7RA 2UWJG 2PUGA 4PDXA 5FT9A 4P29A 2LLWA 3DPYA 4Q96A 4GMLA 1ZZ9A 4DX2A 4O60A 3QDNA 3S2AA 1OCCE 5H7PA 4L7TA 2F8YA 1HO8A 3ESKA 3C5RA 1KPSB 1FVHA 3M9LA 3UT7A 4GZ3A 3KEAA 1UG3A 4BESA 4YDWA 4HOSA 2FULA 3QYXA 5EYLA 4NIKA 3EHRA 2L8NA 3NZSA 2KEIA 3VLEA 3APCA 3QKYA 2JABA 3O4ZA 2MOWA 4B8CB 1FCHA 1DVPA 5AENA 2WXOA 3D9OA 2OR1L 1ZB1A 1ZBPA 2V0PA 3PEUB 3QWGA 3ZIMA 4PU8A 1KZPA 3MX3A 1H6KA 1JCSA 2PXQA 2D5VA 4J8DA 3SFYA 1H6PA 1IKND 1VDYA 4U8HA 5A23A 2V4LA 4EQZA 1Q2ZA 4F53A 3CVNA 2A5EA 1QZ2A 1DNPA 4JVSA 1WY6A 3LCAA 2OFYA 3PE5A 2ZU6B 1H2TC 3B7SA 3LS8A 2LLVA 4RG6A 3FUDA 4ANVA 3LVRE 5CCMA 4RSYA 4FHKA 3D9KA 3UIPC 1X81A 3MGBA 3NF1A 3ZW3A 4XKBA 2WXPA 5CERB 4LERA 4U63A 3VWSA 2KEJA 4N5CA 3LEWA 2VSYA 2O38A 1DCQA 1INZA 3ZPXA 2XEVA 3E33A 3FH8A 1U2VG 1HQ1A 2LAIA 3C3QA 3FU0A 4UUCA 5T8IA 1ZVVA 2XS8A 4MS6A 4WWOA 3TG5A 4HB5A 2Y1LE 1ELWA 3TWTA 4GTOA 2BNMA 5D66A 3RO2A 4C48B 1H2UA 4CDMA 3ABME 5ITZF 3R9MA 3FUHA 4CEMA 4J1WA 3LPZA 4FADA 1LCCA 5KJKA 3OQOA 3DNVB 2ZGGA 4U8VD 3Q79A 3ZHEA 2XRYA 3ASHA 2L49A 1RZSA 4Z5DA 5DTQA 4ABNA 3OKZA 3QOXA 3S7BA 3UXGA 4BSXA 4OB4A 3GZSA 4URKA 3KSQA 1NEQA 3CHSA 3FTXA 3HZIB 3JXCL 3DPDA 2FO7A 4PU4C 4OBMA 3LISA 1O5MA 2LNMA 5E75A 2OV8A 3HVEA 3EHNA 3OXGA 2IUOA 5ENPD 3ULEG 4F7AA 2HE0A 5B1BE 1Z5SC 1L1MA 1S7EA 4CYMD 1E90A 2VTBA 4N3AA 4EZIA 2BJCA 4UI9C 5G2NA 3U9WA 2EBYA 5LFAA 4G25A 4CDRA 1GW6A 2IU7A 4TXQA 3SCGA 2M63A 4J8SA 3RRUA 3BG0B 3TL5A 2KXPC 1EFAA 4H7XA 3OAWA 3R7QA 2J08A 4YVOA 5ENOD 1Z6TA 3FTVA 4XI9A 5BXOA 2VGXA 5A7LA 2NSZA 3PZ1A 2WXHA 4WAFA 4N2SA 3DEPA 3CVLA 4I6GA 4FJZA 3ZEFA 3GW4A 2F8XK 4CRWA 4U04A 4YDEA 5B1AE 5JMND 1AWCB 4K5CA 5DRYA 4QQIA 3NOGD 5KNGA 2FEZA 4KZCA 4IYPA 4GMJA 2VSOE 2HSGA 2L0TB 3I4GA 2FF4A 4ANXA 3TELA 2ZXWE 2MEZA 1HX8A 4L1BA 5IY5E 3PUJA 2XQ0A 3SX0A 4DX7D 5ENNA 5J90A 3L16A 2XGOA 3DRAA 2PXEA 3B13A 2X3MA 5BUZA 2XXAA 5HQ8A 4KXKB 3ZHMA 3UKRG 3FU5A 3ZHEB 2GGFA 2P9NG 2CFUA 3BUAA 4UQXA 5AAOA 1MX2A 3IVPA 1O1TA 5FZSA 3CHQA 3QOUA 4AM9A 4OVUA 2EIJE 3F51A 4CCAA 3SCHA 4AY5A 2BTDA 2WQHA 1BPOA 2ZISA 3EHQA 3JQ1A 1V55E 3SI5A 4ANWA 2X6IA 4X4EA 4FLHA 3AU4A 4L23A 3D9LA 1A17A 3Q7FA 2LYQA 2KATA 3CKBA 3ZXSA 2AUWA 1EDUA 2C2LA 3PEVB 2PXVA 1OT8A 3TWVA 4HOUA 1OCRE 4N3BA 1N0RA 4G2VA 1FPPA 4D10C 2LO6A 5CCLA 4K5AB 1NL4A 1LD7A 2PXPA 4B93B 3NB2A 1E7UA 3AG4E 3SBSA 2KM4A 5JJ6A 3UM1A 2YHCA 1BDIA 2ILRA 2XGMA 3MEKA 4ILGA 3HHMA 4I9CA 4LCTA 1A5EA 4KBQA 5C2YA 2PXUA 3NBNB 1OWOA 5HRYA 1LQCA 4GAAA 3CHMA 3JUEA 1PY1A 5GAHi 4J8YA 3FUFA 2IQCA 4AY6A 4F1PA 1TN7A 3FUMA 3LY7A 2VGXB 4A1GA 1H19A 4YBAA 3CGHA 4U95D 2B5AA 1R63A 2FI7A 4JCYA 4JPSA 4CT0A 3HRAA 2HINA 4F6RD 2X38A 3FYAA 1TNZA 1SQMA 4CGVA 1FT2A 3AG1E 4HRMB 5EIBE 4N5QA 2HYZA 1UXCA 3APDA 1Y7YA 4KVMA 4NACA 3LQXA 3ZKJA 2IVGA 2HO1A 1XWRA 4ANUA 2RFAA 1FT1A 3ASGA 5T3RA 2B6CA 3G0TA 4ZFHA 1BI8B 4DI4A 1UOHA 3MKQA 3BG1B 3ZXPA 5T4YA 2PXTA 1B0NA 2PUFA 4JA7A 4EECA 3CVXA 1TN8A 4I6RA 1IHGA 2J07A 2IF4A 1OWLA 3Q49B 4DLQA 4PU7A 3FU3A 4K0RA 3FDHA 3RKVA 2P9KG 4I8TA 3C3OA 3UT8A 4EBAA 2R17C 3TXNA 2V5QC 4LG6A 3B7BA 4ME2A 5EDSA 1Y9QA 4A55A 1UW4B 3UKUG 3WG7E 4AVXA 1YYHA 1QP7A 4I1MA 2X6JA 2PXLA 4I43A 3ZRHA 3T8MA 1MX6A 4ER6A 2DYRE 2XS1A 4G1TA 3G2UA 1V54E 4XX5A 1BDHA 3IKOB 2GZUA 5A6CA 2P58C 3H5TA 2VGEA 4PS7A 1E3OC 2IJGX 2RD0A 3PREA 4AOFA 3OQMA 3L13A 4A63B 1JCQA 1OWPA 4X4BA 5JHAA 1DWKA 2LNIA 3CVVA 1QP0A 3PRZA 1N95A 4RQIA 1D8DA 2PUEA 2FO1E 4X4CA 5EX0A 1MJ0A 1KZOA 3QOWA 2IV1A 1N11A 4IRUA 4BFRA 1POUA 3F6WA 3D9MA 3EUSA 1ZZ7A 2LCVA 3CVPA 3JUIA 2Q7FA 1N52A 3QK0A 4RVBA 2MXDA 3G7DA 1D8EA 4ZHBA 3P1UA 3FTUA 3OWQA 4Q2JA 2XPZA 1TJCA 5ANLA 4G8KA 3G2SA 4HS2A 1O1SA 2A4ZA 4O8BA 5ENQD 4AEZC 1IQUA 2OEWA 4Z59A 2H8RA 5FWQA 4F1SA 2OVBA 3PUKA 4N39A 4IVZA 4HOTA 2KEKA 2CG3A 3U66A 4H7YA 3LFPA 3RIBA 4GZCA 2XIUA 4YDYA 5AQAA 1U3DA 3MZLB 4BX9A 3EIJA 4I6EA 1YMPA 5HKPA 3WXXA 1ZUGA 3MKQB 2YBDA 3CLJA 2PUAA 1S0PA 1CJGA 1TR4A 4AJWA 3TRBA 2FBNA 3NXHA 4JC8A 3PXPA 3MKRA 2MHKA 4NRHB 1L5JA 4UWKA 2OVFA 2PQRA 3BU8A 3SZ7A 2WPVA 1BI7B 3AAAC 4F3VA 4ILIA 3IV0A 1OCOE 5CMWA 3CQCB 3CHPA 2AWIA 3ZYLA 5D2MC 2I6HA 4XI0A 3TGOA 1G3NB 3AG3E 4LEUA 1HZ4A 4JCXA 3DSTA 4TXRA 4EKGA 4CZ2D 3SNXA 2XHEA 5JJ7A 2O49A 4JB8P 5ANRA 3O48A 1DW9A 1PRAA 4Q94A 5G05C 2QYUA 2ODRD 4JL0A 3Q15A 1SVXA 2E2EA 2J7WA 3VTYA 4CT4A 5CMYA 4KVOA 2YNQA 2EINE 5G55A 2LYSA 3KAEA 1PNRA 3R09A 3PS6A 5B3SE 4J1XA 2AVPA 3ZYMA 3SFZA 1Z3XA 2E0IA 3SD5A 1NFIE 3FP3A 5LCWC 4Z5CA 4KMOA 3U3WA 2AJAA 5E76A 4TUMA 5FTPA 4U0UA 5KWDA 4FULA 5CEDB 3IXEA 2DYSE 4JW1A 3FTSA 3UI2A 2L0IA 4M3OA 2I9CA 3BS3A 3OP9A 3J5QB 3HIZA 1E96B 1QP4A 1MX4A 3O9XA 4YG4A 5CEAA 2H6FA 2EWTA 1WM5A 1K1BA 4X4GA 3IBEA 3IHYA 3KSLA 2OCCE 1HG2A 3B7RL 4HLLA 1RZRA 4O1OA 1YSEA 1JWLA 1JWFA 1UJKA 2PUCA 3AS5A 3ESLA 2YHEA 3E32A 1TYQG 4G24A 1HE8A 5GAGi 3MV3B 4WNDA 4WWNA 4G8LA 3ENEA 4UWFA 3RAUA 3LXUX 3LVQE 3ULYA 2L9BA 2XJ3A 2QYJA 2JQEA 2XSDC 4GYOA 4TUUA 2P9LG 4XEIG 3MLFA 3MV2B 3D9HA 4G11A 3MYVA 5DTRA 3EJNA 3HXDA 1HF8A 4DE8A 3TXMA 3BDNA 3VTXA 2A6CA 4K5BA 4GB9A 4WNGA 2CG2A 5EYPF 3L54A 1HFAA 5JHBA 2IO2C 3OXFA 3PZ2A 4EPZA 2A5UA 4KT6B 3TWXA 2WQ7A 4AP2A 5AARA 1AU7A 4I2WA 3K9IA 3UMVA 5DIZA 4W9RA 1KT0A 2J9QA 1Y6IA 2XCBA 2PL2A 1LD8A 2EILE 4JZYA 3QC1A 3UT4A 2R05A 3JCKC 1WH8A 4TV3A 1OCTC 4J8FA 2PQNA 3TFLA 2PIJA 4GMRA 3FEXA 1AP7A 4L2YA 2R63A 4IA8A 1TJFA 2PPXA 2WXQA 3CQGB 3SQVA 2EIKE 1E8YA 1NA3A 2WXRA 1HS6A 4G23A 4K03A 1VPWA 5G04J 5LP0A 3F52A 1S63A 3B95A 3RSEG 1OXJA 1UJJA 4X8QA 4B94A 3KXAA 5DTMA 2V4HC 4OAVB 1IQRA 1H6OA 2JLBA 3HXEA 2BKGA 2JCGA 5BT1A 3Q73A 1DCEA 3SY2A 2IY0C 5EN5D 2HFZA 2XCJA 4GU5A 3TAXA 5KBAA 4EKIA 5KJMA 3LYAA 2GRNB 3F6QA 2HR2A 3Q4AB 2IVQA 4FJYA 4I6UA 3FUJA 3ASNE 2F0YA 5CHEE 5BW8C 1N4PA 3UX4A 4HVBA 3BEEA 1SA4A 4IN3B 2H6HA 1ZZ8A 4FC8A 2J4DA 4Z58A 2GRRB 2GRLA 4J0UA 4HXIA 1NP7A 3HXCA 3L17A 3FUNA 4FU3A 3FTZA 2J09A 1XNFA 2XZDG 3CVWA 3S7DA 1SZAA 3ZYKA 4ACKA 3KD7A 5LX8A 4U07A 4BETA 3L08A 3QQ6A 2V3CC 2IFUA 3RRNB 3UM2A 3OXLA 2EQXA 2R1JL 2C0LA 2VQ2A 3Q5MA 3FTWA 2AXVA 1LF8A 5CBNA 2IONA 4B89A 5HI7A 4IWRA 1HG5A 1QB2A 3QWVA 3HXFA 2DVWA 4UWGA 2NYJA 5CRUA 5ENSD 4LNBA 3NZLA 1RZRD 3NDBB 2J49A 4JXTA 1JH9A 1JCRA 1ZZ6A 1TNBA 3NROA 1ADRA 4X4IA 2XZTG 4A1SA 4Y42A 3CROL 1YCSB 2EIME 2IEJA 1MYOA 3ISMC 2OOEA 4DUIA 2J8SD 2P2CP 2BEDA 1OUVA 4Z68A 2YINA 2NXPA 4F8DA 2P9UG 1ZPQA 3PE4A 5FZRA 3LJ3A 5JA4D 4C0EA 4DK5A 4ER5A 2DWZA 3NOCD 1QNFA 3EDTB 4KYOB 2PZIA 3UIOC 2QZAA 2Y0BG 3T5XA 3RJVA 2WM9A 3Q47B 1QPZA 4N3CA 3S7JA 4HBDA 3N71A 3MEJA 2L1PA 3Q75A 3SFXA 3ULQA 4I6JA 3EHMA 3FU6A 2KZ8A 1ELRA 4NURA 5FQ7A 1N4RA 3GBFA 2PXDA 2ICPA 1OCZE 2WVIA 2CHWA 4LRZA 2KZTA 4YNDA 4GYWA 3G2WA 3UFDA 2HM8A 3C98A 4L2LA 3A9YA 4U0SA 3UM3A 3AS8A 3AU5A 3HG0D 5DSXA 3Q9NC 3BD1A 2ONDA 2KC7A 4HOQA 3CSFA 3SCFA 4ILHB 2Y4TA 1OWMA 1KT1A 2XENA 3QWPA 2NC9A 2WXJA 4E85A 3W9FA 1EPUA 3LDZA 3OTNA 4OVVA 5ENRD 4LSZE 3FY4A 2PM6A 3EU5A 4MLPA 2DZNA 4GCNA 4EZLA 1HU3A 3CK9A 4NQ0A 3CHRA 3D9PA 3CSTA 2KCLA 5DRTA 2WB2A 3QB2A 4RG9A 3I5PA 2XXQA 2LSVA 4JHJA 1N9AA 1B89A 1N0QA 4PS3A 3QJZA 3Q7AA 4X4DA 2IOLA 5FQ8A 4JEHA 3UM0A 4BERA 5A7DB 2L6BA 3DXKG 1MHQA 5FIOA 3FUIA 1N4QA 3JYSA 4V3IA 2PM7A 3FUKA 2IU1A 1D9SA 2BNOA 5FQ4A 2GRMA 2XEEA 3AJIA 4ER3A 4MCTA 3G2VA 3PNTB 3VLDA 1BD8A 3B7TA 1PERL 3C3RA 2AXZA 1NZNA 4GCOA 3GZ1A 4MKTA 2KCKA 3S8QA 2IVBA 5ARFA 4EQFA 5FQ6A 3GZDA 5AQBA 4FN3A 2PE5A 2PUDA 3QNKA 3HXBA 3TEPA 1WG0A 2ZIRA 3ZGQA 1HF0A 2BUGA 4I17A
chains in the Genus database with same CATH topology
4N2SA 2Y4UA 4GZ6A 4J6IA 2C0MA 4JHKA 2L0IA 3CVLA 4I6GA 4M3OA 3UPVA 4FJZA 2I9CA 3BS3A 3FEYA 3ZEFA 3OP9A 2JEKA 2XRZA 1E8XA 3GW4A 3DBSA 2XCCA 3HIZA 4C0MA 4U04A 1E96B 3ML9A 2WXKA 3ASDA 4CRWA 1QP4A 5T8IA 4N2QA 3FH7A 3O9XA 4YG4A 4G26A 4LUNU 2EWTA 3CKCA 1WM5A 3G2TA 3CECA 1EF1C 2FEZA 2X6KA 3FFLA 3JXDL 4X4GA 3IBEA 4FP7A 4XIFA 3IHYA 3I3NA 4KZCA 4TRQA 1X5BA 3G5GA 4IYPA 4EZJA 4GMJA 2VSOE 3P2BA 2HSGA 2L0TB 3HDXA 4CDNA 1IC8A 2QY7A 3I4GA 2FF4A 4Y6WA 3AS4A 2ICTA 4ANXA 1HG2A 3ZN3A 2MEZA 1HX8A 4L1BA 3TG4A 3RO3A 3PUJA 4X4FA 2XQ0A 3B7RL 1RZRA 2KZTB 3IHVA 1YSEA 1JWLA 1WETA 4HFGA 4AIFA 2VSNA 4JHRA 1JWFA 1UJKA 2PUCA 3AS5A 3ESLA 3L16A 2YHEA 5ENNA 3RK6A 4APOA 5JJTA 5J90A 2XGOA 3CEQA 2XPIA 4O6FA 5DBKA 4J8EA 4G24A 2DIWA 5BUZA 3B13A 2X3MA 2O4AA 1HE8A 5BPPA 3MV3B 4WNDA 4WWNA 4KZ0A 3ENEA 4UWFA 2WUSR 2V5FA 1O4XA 5HQ8A 4KXKB 2CFZA 5ARGA 5AYWD 1JFSA 2JVLA 3ZHMA 1E8WA 3FU5A 5G05J 3EIQC 4GA1A 3LXUX 4GA2A 2WXLA 3LVQE 1LLIA 3ZHEB 4CGWA 2GGFA 2L9BA 2WXGA 2CFUA 2XJ3A 1P5QA 4UQXA 1LCDA 2WXMA 4GZ5A 4FA6A 3IVPA 5FZSA 2LYRA 3CHQA 3QOUA 4AM9A 4OVUA 5AIJA 2XSDC 4GYOA 3F51A 4CCAA 3SCHA 4AY5A 2R5SA 2BTDA 2J4BA 3QWWA 1HXIA 4TUUA 2WQHA 3MLFA 1BPOA 4GPKA 3RU0A 3MV2B 3JQ1A 4BT9A 3HYMB 3CLCA 1MQSA 2DBAA 4PS8A 4WWPA 3PNLB 1SZ9A 3GZ2A 5FJYA 1NERA 4UI9J 3SI5A 4ANWA 4GHJA 4DPRA 2X6IA 3CVYA 4X4EA 4FLHA 4G11A 3MYVA 3AU4A 4L23A 3EJNA 3D9LA 1A17A 5LCWJ 3VLFA 2WQ6A 2LYQA 1HF8A 2KATA 4Y6CA 3CKBA 3TXMA 3BDNA 2I1JA 3D9JA 3VTXA 3ZXSA 2A6CA 2AUWA 4YVQC 3ZVVA 4BWRA 5A6CA 1EDUA 2C2LA 2V8SE 3PEVB 4GB9A 4WNGA 1E8ZA 2CG2A 3L22A 2UY1B 4BX8A 4DLOA 4HOUA 3L54A 1H2VC 5BV1A 4UI9K 4OYSA 4UWHA 1HFAA 5JHBA 3KEZA 4I6TA 3OXFA 4N3BA 2I2OA 4G2VA 4EPZA 5CCLA 4D10C 2LO6A 4JQDA 2A5UA 1JPLA 2DCPA 5G04C 3B7HA 1QQBA 4KT6B 3PE3A 3NZUA 4XKCA 1UTXA 2WQ7A 4AP2A 4R7LA 1AU7A 4JEUA 4I2WA 1E7UA 2WXNA 3KJXA 3K9IA 3SBSA 2KM4A 3UMVA 5JJ6A 2LYLA 1CQTA 2XPYA 5DIZA 2YHCA 4MCXA 4W9RA 4Q69A 1BDIA 2ILRA 2XGMA 1KT0A 2J9QA 3MEKA 4ILGA 4I2ZA 4IULA 2FJRA 1Y6IA 2XCBA 3D9IA 4PH4B 3HHMA 1NA0A 3PH0C 4I9CA 1X2LA 2PL2A 4I1OB 4LCTA 5D0QD 5K98B 4KBQA 4JZYA 3QC1A 3MJWA 5C2YA 3UT4A 1OWOA 1LQCA 5C1DA 3I4RB 3JCKC 4GAAA 1WH8A 3RRMB 3TJPA 2GW1A 4TV3A 3R9AB 1OCTC 3CHMA 5EKQD 3UUXA 1ZU2A 3GYZA 4J8FA 5J08A 1PY1A 2PQNA 3CK8A 3FUFA 4AV7A 2IQCA 4AY6A 3MCXA 3FUMA 2PIJA 3LY7A 2MQKA 4I1AA 4UQZA 2VGXB 3FEXA 3FHEA 4L2YA 1KLXA 4A1GA 2R63A 1H19A 4IA8A 1TJFA 2LYPA 4Z5HA 1XGWA 2PPXA 1YA0A 2VSXE 4YBAA 2WXQA 3CGHA 4U0ZA 2B5AA 3CQGB 4QFVA 1R63A 2FI7A 5EX3A 2KPJA 1E8YA 1NA3A 4JCYA 2WXRA 4JPSA 3CVUA 3ONKA 1HS6A 4CT0A 3L1PA 4G23A 1VPWA 2HINA 4K03A 4WUYA 1RPEL 5G04J 5LP0A 3F52A 4GYYA 1Z3YA 2X38A 3FYMA 3FYAA 1RIOA 4GZDA 1QQAA 2Y3AA 2AXUA 1SQMA 4CGVA 1ZS4A 1UJJA 2AW6A 2XI8A 4B94A 3KXAA 4YARA 3FMYA 1IQRA 2JLBA 3SF4A 1ZZCA 2HYZA 3CV0A 3PVLA 1UXCA 3APDA 1Y7YA 2JCGA 3B7UX 4HORA 4KVMA 3E4BA 4NACA 5BT1A 2WMNA 4GA0A 5KJNA 2CHXA 2IVGA 2HO1A 1XWRA 2BNNA 2CSFA 3LY8A 2X6HA 4ANUA 1QQEA 3GN5A 1FVFA 3QARA 1WAO1 3KS2A 3ASGA 3APFA 2XCJA 4GU5A 5T3RA 3TAXA 4BY6A 5KJMA 3LYAA 1PAQA 1X57A 4XE0A 4DI4A 4GQMA 2HR2A 3Q4AB 3QAQA 2IVQA 4I6UA 3BG1B 1R69A 3OMTA 1GT0C 1E7VA 3MKQA 4FJYA 5T4YA 3R1FA 3RZZA 4ATGA 1W3BA 3FUJA 1B0NA 2PUFA 4JA7A 3R7RA 4EECA 2UWJG 2PUGA 4PDXA 5FT9A 4P29A 3CVXA 3PDNA 1PRUA 4EZKA 5CHEE 4I6RA 5FZQA 1IHGA 2J07A 5BW8C 3UX4A 4HVBA 4Q96A 4GMLA 2IF4A 1ZZ9A 1OWLA 3BEEA 3Q49B 4PU7A 3D9NA 3FU3A 4IN3B 2PUBA 5LOZA 3PZDA 4K0RA 3FDHA 3RKVA 3QDNA 1ZZ8A 4I8TA 4FC8A 3S2AA 4L7TA 1HO8A 1UN9A 3UT8A 4EBAA 2R17C 3ESKA 1IYGA 2J4DA 4Z58A 3TXNA 2GRLA 4J0UA 4HXIA 2L6JA 4ME2A 1NP7A 3LY9A 1FVHA 5EDSA 1Y9QA 4A55A 3L17A 3FUNA 3UT7A 1UW4B 4GZ3A 1UG3A 4AVXA 4FU3A 1QP7A 2RG8A 2X6JA 4I1MA 3FTZA 3ZKCA 2J09A 4X4HA 1XNFA 4I43A 4UWLA 3T8MA 3ML8A 3ZRHA 3S7DA 3CVWA 4HOSA 2FULA 3QYXA 1SZAA 2R59A 4G1TA 3ZYKA 4PUCA 2L8NA 3NZSA 2KEIA 3G2UA 3APCA 3VLEA 1H0AA 4XX5A 1BDHA 3IKOB 3JQ0A 3IEGA 3KD7A 3QKYA 3O4ZA 2MOWA 4U07A 4ACKA 4B8CB 5LX8A 1FCHA 3L08A 2GZUA 1DVPA 3QQ6A 2WXOA 2IFUA 2WXIA 3D9OA 4FBIA 3RRNB 2OR1L 4AXHA 5AENA 2P58C 3OXLA 3H5TA 1ZBPA 2V0PA 3PEUB 4PS7A 2EQXA 2XGSA 3QWGA 2R1JL 2C0LA 2YQ8A 2VQ2A 1E3OC 3FUEA 2IJGX 3Q5MA 3ZIMA 3CR3A 2RD0A 3FTWA 3PREA 4PU8A 3OQMA 4AOFA 2AXVA 3L13A 5KJLA 4UQYA 1LF8A 1OWPA 3MX3A 2IONA 4X4BA 3SHFA 1H6KA 4B89A 5HI7A 4C9BB 4IWRA 1HG5A 5JHAA 2D5VA 1DWKA 2LNIA 4I9EA 3QWVA 1QP0A 4J8DA 4UWGA 4APFA 3CVVA 3PRZA 2PUEA 4HLEA 4X4CA 1VDYA 5EX0A 2IV1A 4IRUA 1ELKA 4U8HA 1POUA 3F6WA 1EYHA 2V4LA 3D9MA 4BFRA 5A23A 3CHOA 2KCVA 1RZRD 2VGYA 2J49A 3EUSA 4JXTA 1ZZ7A 1JH9A 1ZZ6A 2LCVA 1ADRA 3CVPA 4X4IA 3JUIA 4F53A 3FTYA 3CVNA 4A1SA 4Y42A 2Q7FA 3CROL 1HH8A 1N52A 1DNPA 1QZ2A 3QK0A 4JVSA 4RVBA 4MRUA 1WY6A 1ZAYA 3G7DA 3LCAA 2OFYA 2OOEA 2ZU6B 1H2TC 3B7SA 3P1UA 3FTUA 3JXBC 3L6AA 4NDWA 1JFTA 1OUVA 3LS8A 2XPZA 2YINA 4BT8A 1JUQA 1TJCA 2NXPA 4F8DA 1ZPQA 3PE4A 5ANLA 4RG6A 5FZRA 3KZ3A 3LJ3A 3G2SA 3FUDA 3U64A 4HS2A 4ANVA 2A4ZA 3LVRE 2CHZA 4O8BA 5CCMA 4RSYA 1PRVA 5AJLA 3ZPJA 4AEZC 4FHKA 1IQUA 4C0EA 3D9KA 4DK5A 3T5VA 4YG7B 1QNFA 3EDTB 3MGBA 3NF1A 4KYOB 4Z59A 2PZIA 3ZW3A 2H8RA 4EBAG 4XKBA 2WXPA 5FWQA 4F1SA 4LERA 4U63A 4N5CA 2KEJA 3LEWA 2OVBA 3PUKA 2VSYA 3T5XA 2O38A 3RJVA 4N39A 2WM9A 1INZA 2XEVA 3Q47B 4IVZA 1QPZA 2KEKA 1OWNA 2CG3A 3FH8A 3ZHIA 3U66A 4HOTA 4N3CA 4A3VA 2LAIA 3S7JA 4H7YA 3LFPA 1OSLA 1Y8MA 3FU0A 3LKUA 3GN5B 3N71A 1ZVVA 3FWVA 2XIUA 4GZCA 4MS6A 4WWOA 3TG5A 3ZFWA 3ULQA 4I6JA 3EHMA 1ELWA 3FU6A 2KZ8A 1ELRA 4NURA 5FQ7A 5KCMA 4WNEA 1U3DA 3GBFA 3MZLB 4BX9A 3EIJA 2BNMA 4I6EA 5D0OD 4BTBA 3RO2A 2ICPA 2EF8A 1H2UA 2WVIA 1WIZA 3NQPA 3WXXA 4CDMA 2CHWA 5M72A 4LRZA 3FUHA 1ZUGA 2KZTA 3MKQB 4B0ZA 4YNDA 4CEMA 4J1WA 3CLJA 4GYWA 3G2WA 2PUAA 1S0PA 1CJGA 3LPZA 3UFDA 4AJWA 3VK0A 2HM8A 4FADA 1JWGA 3TRBA 3C98A 1LCCA 2FBNA 4L2LA 4JC8A 3SBTB 3PXPA 4U0SA 3AS8A 3MKRA 5KJKA 3AU5A 2MHKA 4NRHB 3OQOA 1L5JA 3DNVB 1UN8A 2OVFA 2PQRA 4UWKA 3UQ3A 3BD1A 3SZ7A 2LYKA 2LSUA 2ONDA 2KC7A 2WPVA 1WH6A 3SCFA 3CVQA 3CSFA 3IV0A 4FLBA 4HOQA 4ILIA 4F3VA 2LYJA 4ILHB 3ZHEA 2XRYA 2Y4TA 5CMWA 1OWMA 1KT1A 1U3CA 3ASHA 3QWPA 3CQCB 2NC9A 3S7FA 2WXJA 2MRIA 4E85A 3CHPA 2AWIA 2L49A 1EPUA 3LDZA 2I6HA 3OTNA 1RZSA 4OVVA 3RIBA 4Z5DA 4XI0A 4BTAA 3FY4A 3ASFA 4ABNA 2PM6A 1PC2A 3TGOA 3MA5A 3FH5A 4JW1A 3S7BA 4MLPA 2QFCA 4GCNA 4EZLA 1HU3A 2WIUB 4BSXA 4LEUA 1HZ4A 3CK9A 4NQ0A 4OB4A 2WXFA 3CHRA 3GZSA 4JCXA 3U4TA 4URKA 3D9PA 3CSTA 2BF0X 1NEQA 3CHSA 3FULA 2KCLA 4WNFA 3FTXA 2VYIA 3HZIB 3SNXA 2WB2A 3JXCL 3DPDA 3QB2A 4RG9A 3I5PA 2XHEA 2LSVA 4JHJA 5JJ7A 2O49A 2FO7A 1B89A 4PU4C 5ANRA 3O48A 4PS3A 5BNWA 3LISA 3QJZA 4DLQA 3ZYLA 1DW9A 4X4DA 2WMOA 5E75A 4XZ4A 2IOLA 5FQ8A 1PRAA 4Q94A 2UY1A 4JEHA 2OV8A 5A7DB 3HVEA 3EHNA 3OXGA 1MHQA 2IUOA 4DJAA 4PU3C 5G05C 3HVEB 1TEZA 3CK7A 3Q15A 4JL0A 3FUIA 3SGHA 4B8AA 1LMB3 2E2EA 2IOSA 4F7AA 3VTYA 1N54A 4CT4A 2I1KA 3JYSA 4V3IA 5CMYA 2PM7A 5AJDA 4KVOA 3FUKA 2YNQA 2IU1A 1L1MA 1S7EA 5G55A 4A3TA 2BNOA 2LYSA 5FQ4A 4ACLA 2GRMA 1E90A 3KAEA 4MCTA 3CIAA 1PNRA 2VTBA 2X6FA 3G2VA 3PNTB 4N3AA 3VLDA 3PS6A 3ONLA 3B7TA 2VTBB 4J1XA 2AVPA 3ZYMA 3SFZA 4E6HA 2BJCA 1Z3XA 2E0IA 3SD5A 4UI9C 2CROA 5G2NA 1ZZBA 2EBYA 3QF3A 1PERL 4G25A 3U9WA 5LFAA 3FP3A 4CDRA 2AXZA 1NZNA 4GCOA 1GW6A 2IU7A 3OQNA 3GZ1A 4MKTA 5LCWC 2LAHA 2KCKA 4Z5CA 3S8QA 4YG1A 2VJ8A 2IVBA 4KMOA 3U3WA 3SCGA 2M63A 4J8SA 5ARFA 3RRUA 5E76A 4EQFA 3BG0B 5FQ6A 3TL5A 5BV0A 5FTPA 3D3MA 4U0UA 3ZYQA 4FN3A 1EFAA 4H7XA 2PE5A 4FHJA 3OAWA 2PUDA 3R7QA 3D1NI 1SQ8A 4FULA 2J08A 4YVOA 3URZA 3QNKA 1Z6TA 3FTVA 4JA9A 4XI9A 4DI3A 2VGXA 5A7LA 2NSZA 2WXHA 1HF0A 2BUGA 4WAFA 3ZGQA 4I17A 1UXDA 3FTSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J1W A;  1Y9Q A;  2LYL A;  1CQT A;  2PUA A;  1CJG A;  4MCX A;  1BDI A;  3UFD A;  3VK0 A;  3BS3 A;  1QP7 A;  2FJR A;  3TRB A;  3OP9 A;  1LCC A;  3ZKC A;  3PXP A;  4X4H A;  1X2L A;  3OQO A;  5K98 B;  3DNV B;  1QP4 A;  3QYX A;  3O9X A;  4YG4 A;  2L8N A;  1LQC A;  3BD1 A;  2EWT A;  2KEI A;  1WH8 A;  2LYK A;  3CEC A;  1WH6 A;  3SCF A;  3JXD L;  4X4G A;  1BDH A;  1OCT C;  2LYJ A;  3G5G A;  2GZU A;  3QQ6 A;  2HSG A;  4FBI A;  1IC8 A;  2OR1 L;  3H5T A;  2PIJ A;  2ICT A;  2MQK A;  2AWI A;  2L49 A;  3QWG A;  2R1J L;  1RZS A;  2MEZ A;  4Z5D A;  1E3O C;  4PU8 A;  4X4F A;  2R63 A;  2AXV A;  4IA8 A;  3OQM A;  2LYP A;  4Z5H A;  1RZR A;  1YSE A;  2PPX A;  4YBA A;  1JWL A;  1WET A;  2B5A A;  4X4B A;  1R63 A;  2KPJ A;  4IWR A;  2PUC A;  2D5V A;  1DWK A;  4JCY A;  2WIU B;  1QP0 A;  3L1P A;  1VPW A;  2HIN A;  1RPE L;  4OB4 A;  3F52 A;  2PUE A;  4JCX A;  4X4C A;  1NEQ A;  3FYA A;  3FYM A;  1RIO A;  2O4A A;  2IV1 A;  1QQA A;  1POU A;  3F6W A;  2AXU A;  2WUS R;  3HZI B;  3JXC L;  1RZR D;  1O4X A;  1ZS4 A;  2AW6 A;  3EUS A;  1JFS A;  2JVL A;  3ZHM A;  2O49 A;  1ZZ7 A;  2XI8 A;  4PU4 C;  1ZZ6 A;  3KXA A;  1JH9 A;  2LCV A;  3LIS A;  1LLI A;  4YAR A;  1ADR A;  3FMY A;  1DW9 A;  4X4I A;  4X4D A;  1ZZC A;  2XJ3 A;  4Y42 A;  1UXC A;  1LCD A;  1PRA A;  3CRO L;  1Y7Y A;  2JCG A;  3IVP A;  1ZAY A;  2LYR A;  2IUO A;  3G7D A;  4PU3 C;  2OFY A;  2XSD C;  2IVG A;  1XWR A;  2BNN A;  2CSF A;  3F51 A;  1LMB 3;  3JXB C;  4NDW A;  3SCH A;  1JFT A;  3GN5 A;  3MLF A;  1L1M A;  1S7E A;  4F8D A;  2XCJ A;  1ZPQ A;  2BNO A;  2LYS A;  3CLC A;  3KZ3 A;  2GRM A;  1NER A;  1X57 A;  4GHJ A;  4MCT A;  1PNR A;  4X4E A;  4O8B A;  1PRV A;  4GQM A;  2IVQ A;  4I6U A;  1R69 A;  3OMT A;  1GT0 C;  3R1F A;  4J1X A;  3RZZ A;  4YG7 B;  1B0N A;  2PUF A;  2BJC A;  2LYQ A;  4Z59 A;  2CRO A;  2H8R A;  1ZZB A;  2EBY A;  3QF3 A;  1PER L;  3BDN A;  2PUG A;  2A6C A;  1PRU A;  2AUW A;  2AXZ A;  2KEJ A;  2IU7 A;  3OQN A;  4I6R A;  4Z5C A;  3S8Q A;  2O38 A;  4YG1 A;  2IVB A;  3U3W A;  3SCG A;  1ZZ9 A;  4IVZ A;  1QPZ A;  4PU7 A;  2KEK A;  3ZHI A;  2PUB A;  4I6T A;  3LFP A;  1OSL A;  4FN3 A;  1EFA A;  3GN5 B;  1ZVV A;  2PE5 A;  2XIU A;  4JQD A;  2PUD A;  1ZZ8 A;  4I8T A;  3B7H A;  2KZ8 A;  1QQB A;  3D1N I;  1SQ8 A;  3GBF A;  2BNM A;  2ICP A;  1UTX A;  2EF8 A;  5A7L A;  4Z58 A;  1WIZ A;  1AU7 A;  2GRL A;  1HF0 A;  1ZUG A;  1UXD A;  3KJX A; 
#chains in the Genus database with same CATH topology
 2Y4U A;  2C0M A;  4J7W A;  4ER0 A;  1K3Z D;  1MZC A;  2JEK A;  2XRZ A;  2LXM A;  3DBS A;  4N2Q A;  3DSX A;  2X6K A;  1EF1 C;  3TWR A;  3JXD L;  5EIL A;  4XIF A;  4TRQ A;  3ZNG A;  1X5B A;  3G5G A;  4EZJ A;  3P2B A;  3HDX A;  1IC8 A;  5DT2 A;  2QY7 A;  1NW3 A;  3ZN3 A;  3TG4 A;  3ABK E;  4X4F A;  2KZT B;  3IHV A;  2PXB A;  1O1R A;  1WET A;  4HFG A;  2QC9 A;  3ABL E;  2VSN A;  4JHR A;  4A3T A;  4APO A;  5JJT A;  2P9I G;  2XPI A;  4O6F A;  5BPP A;  3E30 A;  2Y69 E;  3BQO A;  4LNU D;  1N94 A;  2WUS R;  2V5F A;  1O4X A;  3DSW A;  2CFZ A;  1N4S A;  5ARG A;  1JFS A;  2JVL A;  1E8W A;  3EIQ C;  4GA2 A;  2WXL A;  1LLI A;  3ME5 A;  4CGW A;  2WXG A;  2BKK B;  1BU9 A;  2GRQ B;  1P5Q A;  1LCD A;  4GZ5 A;  4FA6 A;  2LYR A;  5AIJ A;  1IXV A;  4YDO A;  2LXL A;  3QWW A;  1HXI A;  3RU0 A;  4BT9 A;  3CLC A;  1MQS A;  3T9K A;  4PS8 A;  3PNL B;  1SZ9 A;  1NER A;  4UI9 J;  4HQD A;  4GHJ A;  4O1P A;  3VLF A;  3UIN C;  2H6I A;  2I1J A;  1QBQ A;  3D9J A;  3ZVV A;  4BWR A;  3L82 A;  4YVQ C;  2V8S E;  1E8Z A;  4BX8 A;  4DLO A;  3ASO E;  4L9P A;  2PXK A;  4OYS A;  2MYO A;  4UWH A;  2I2O A;  4GTV A;  1JPL A;  3B7H A;  3PE3 A;  3NZU A;  1UTX A;  3Q78 A;  2LYL A;  3A9X A;  2XPY A;  4Q69 A;  4IUL A;  2FJR A;  2P9P G;  3D9I A;  5K98 B;  3I4R B;  2GW1 A;  3R9A B;  3UUX A;  5JUW A;  1ZU2 A;  3GYZ A;  3X2Q E;  4AV7 A;  1TN6 A;  2HCS A;  4I1A A;  1QZX A;  3FHE A;  2KBX A;  1XGW A;  2LYP A;  4TXP A;  4QFV A;  5CEC B;  4WUY A;  3ZU7 B;  1RIO A;  2Y3A A;  3EU9 A;  1DC2 A;  2AW6 A;  2XI8 A;  4YAR A;  3FMY A;  1ZZC A;  3CV0 A;  3PVL A;  4HOR A;  3V30 A;  3TWQ A;  3E4B A;  5KJN A;  4GTQ A;  2CSF A;  2BNN A;  2X6H A;  1QQE A;  3GN5 A;  1FVF A;  1WAO 1;  3KS2 A;  3DSS A;  4BY6 A;  5CBO A;  1PAQ A;  5AQ9 A;  4DX5 D;  3KL4 A;  1R69 A;  3OMT A;  1GT0 C;  2R03 A;  3Q9U C;  3R1F A;  3PDN A;  1PRU A;  4GTP A;  1BLX B;  4EZK A;  5FZQ A;  5LOZ A;  3D9N A;  2PUB A;  3PZD A;  3W9G A;  1NI1 A;  3JXI A;  5AN8 A;  1UN9 A;  1IYG A;  2L6J A;  3LY9 A;  3GZD C;  3DSV A;  2RG8 A;  3ZKC A;  4X4H A;  4UWL A;  2DZO A;  3ML8 A;  2R59 A;  4PUC A;  4HI8 A;  3GUU A;  1H0A A;  2ETC A;  3JQ0 A;  2F37 A;  3IEG A;  1LTX A;  2WXI A;  4FBI A;  4AXH A;  1TNO A;  2XGS A;  3FUE A;  4E6H A;  4HRL A;  2YQ8 A;  3CR3 A;  2ETA A;  5KJL A;  2LUH A;  4JD2 G;  4UQY A;  4WVL A;  3SHF A;  4C9B B;  3ZUV B;  4APF A;  4I9E A;  3PZ4 A;  3DSU A;  4HLE A;  4LNG A;  1ELK A;  1EYH A;  3DM5 A;  3CHO A;  2KCV A;  3DXM G;  2VGY A;  3FTY A;  2XXP A;  3TWW A;  3SR4 A;  1HH8 A;  4MRU A;  1ZAY A;  4ATZ D;  3L6A A;  3JXB C;  4NDW A;  1JFT A;  3L9T A;  4BT8 A;  2VEO A;  1JUQ A;  3E37 A;  3KZ3 A;  3U64 A;  2CHZ A;  1PRV A;  5AJL A;  3ZPJ A;  3T5V A;  4YG7 B;  1S70 B;  2R02 A;  5CRV A;  4EBA G;  4RLY A;  4DX6 D;  1OWN A;  3ZHI A;  3EUV A;  4A3V A;  1OSL A;  1Y8M A;  3LKU A;  4R7L A;  3GN5 B;  3FWV A;  3ZFW A;  1SW6 A;  5KCM A;  4WNE A;  2GRP B;  5D0O D;  4BTB A;  2EF8 A;  3NQP A;  1WIZ A;  5M72 A;  4B0Z A;  3TWS A;  3VK0 A;  1JWG A;  2OEV A;  3SBT B;  1MFQ C;  1UN8 A;  3UQ3 A;  2LYK A;  4BSZ B;  2LSU A;  3CVQ A;  1WH6 A;  4FLB A;  2LYJ A;  3PZ3 A;  4GTT A;  1U3C A;  3S7F A;  2MRI A;  2B0O E;  4BTA A;  3ASF A;  1PC2 A;  3MA5 A;  3FH5 A;  2RKK A;  2QFC A;  2HCN A;  3JXJ A;  3V2X A;  2WIU B;  3U4T A;  2WXF A;  2BF0 X;  3FUL A;  4WNF A;  2VYI A;  5BNW A;  2WMO A;  4XZ4 A;  2UY1 A;  2FFH A;  4OAU C;  5KNH D;  4DJA A;  4PU3 C;  3HVE B;  1TEZ A;  3GZC A;  3CK7 A;  4M7C A;  3SGH A;  1S64 A;  4EK9 A;  1LMB 3;  2IOS A;  4B8A A;  1N54 A;  2I1K A;  1SA5 A;  5AJD A;  4GTS A;  4ACL A;  3CIA A;  2X6F A;  3ONL A;  2VTB B;  2CRO A;  1ZZB A;  3QF3 A;  3OQN A;  5AQ7 A;  1K8K G;  2LAH A;  2VJ8 A;  4YG1 A;  4U7E B;  5ENT D;  2P9S G;  5BV0 A;  3D3M A;  3ZYQ A;  3V31 A;  5EID A;  4FHJ A;  3D1N I;  1SQ8 A;  3URZ A;  4JA9 A;  4DI3 A;  4DX1 A;  4GPM A;  1UXD A;  4GZ6 A;  4J6I A;  1RZ4 A;  4JHK A;  3UPV A;  3UTM A;  1K1A A;  3FEY A;  4ER7 A;  1E8X A;  2XCC A;  3DEO A;  4C0M A;  3ML9 A;  2WXK A;  3ASD A;  3FH7 A;  4HRN A;  4G26 A;  4HI9 A;  4LUN U;  3CKC A;  3G2T A;  3CEC A;  3FFL A;  4FP7 A;  2RFM A;  3I3N A;  4CDN A;  4Y6W A;  3AS4 A;  2ICT A;  3SO8 A;  3RO3 A;  2IO3 C;  2PXF A;  3J5P A;  4AIF A;  3RK6 A;  3CEQ A;  5DBK A;  3AG2 E;  4J8E A;  2DIW A;  2O4A A;  4KZ0 A;  2R2L A;  5AYW D;  5G04 C;  5G05 J;  4GA1 A;  1DUL A;  2WXM A;  5BXU A;  2PNN A;  2ZGD A;  4GTR A;  2R5S A;  2J4B A;  1WDY A;  4GPK A;  3HYM B;  4WWP A;  2DBA A;  3GZ2 A;  4EHM A;  5FJY A;  1TNU A;  4DPR A;  3CVY A;  1IHB A;  5LCW J;  3E34 A;  2WQ6 A;  5FIN A;  4Y6C A;  3L22 A;  2UY1 B;  2GRO B;  1H2V C;  5BV1 A;  4UI9 K;  3KEZ A;  4I6T A;  4GTM A;  3C72 A;  4JQD A;  2DCP A;  1QQB A;  2ETB A;  3A9Z A;  4XKC A;  3LJN A;  4JEU A;  2WXN A;  3KJX A;  1CQT A;  4MCX A;  4I2Z A;  4PH4 B;  1NA0 A;  1OY3 D;  3PH0 C;  1X2L A;  4I1O B;  5D0Q D;  3MJW A;  3NAW A;  5C1D A;  3TJP A;  3RRM B;  3DWL G;  2J7U A;  5EKQ D;  3V2O A;  5J08 A;  3CK8 A;  3MCX A;  2MQK A;  4BEP A;  4UQZ A;  1TNY A;  1KLX A;  3T8K A;  1YA0 A;  4Z5H A;  2VSX E;  4U0Z A;  1RW2 A;  4HNA D;  5EX3 A;  2KPJ A;  3CVU A;  3ONK A;  3L1P A;  1RPE L;  4GYY A;  1Z3Y A;  3FYM A;  4GZD A;  1QQA A;  2AXU A;  3TWU A;  1ZS4 A;  1U2Z A;  3UWP A;  4HRA A;  3SF4 A;  3B7U X;  3V79 K;  2WMN A;  4GA0 A;  2CHX A;  3QFI A;  4DE9 A;  3LY8 A;  4DRX E;  4U8Y D;  4MBG A;  3QAR A;  4U96 D;  2H6G A;  3APF A;  1QYM A;  2M4H A;  1X57 A;  5HS0 A;  4XE0 A;  4GQM A;  2XEH A;  3QAQ A;  1E7V A;  4ATG A;  3RZZ A;  1W3B A;  3R7R A;  2UWJ G;  2PUG A;  4PDX A;  5FT9 A;  4P29 A;  2LLW A;  3DPY A;  4Q96 A;  4GML A;  1ZZ9 A;  4DX2 A;  4O60 A;  3QDN A;  3S2A A;  1OCC E;  5H7P A;  4L7T A;  2F8Y A;  1HO8 A;  3ESK A;  3C5R A;  1KPS B;  1FVH A;  3M9L A;  3UT7 A;  4GZ3 A;  3KEA A;  1UG3 A;  4BES A;  4YDW A;  4HOS A;  2FUL A;  3QYX A;  5EYL A;  4NIK A;  3EHR A;  2L8N A;  3NZS A;  2KEI A;  3VLE A;  3APC A;  3QKY A;  2JAB A;  3O4Z A;  2MOW A;  4B8C B;  1FCH A;  1DVP A;  5AEN A;  2WXO A;  3D9O A;  2OR1 L;  1ZB1 A;  1ZBP A;  2V0P A;  3PEU B;  3QWG A;  3ZIM A;  4PU8 A;  1KZP A;  3MX3 A;  1H6K A;  1JCS A;  2PXQ A;  2D5V A;  4J8D A;  3SFY A;  1H6P A;  1IKN D;  1VDY A;  4U8H A;  5A23 A;  2V4L A;  4EQZ A;  1Q2Z A;  4F53 A;  3CVN A;  2A5E A;  1QZ2 A;  1DNP A;  4JVS A;  1WY6 A;  3LCA A;  2OFY A;  3PE5 A;  2ZU6 B;  1H2T C;  3B7S A;  3LS8 A;  2LLV A;  4RG6 A;  3FUD A;  4ANV A;  3LVR E;  5CCM A;  4RSY A;  4FHK A;  3D9K A;  3UIP C;  1X81 A;  3MGB A;  3NF1 A;  3ZW3 A;  4XKB A;  2WXP A;  5CER B;  4LER A;  4U63 A;  3VWS A;  2KEJ A;  4N5C A;  3LEW A;  2VSY A;  2O38 A;  1DCQ A;  1INZ A;  3ZPX A;  2XEV A;  3E33 A;  3FH8 A;  1U2V G;  1HQ1 A;  2LAI A;  3C3Q A;  3FU0 A;  4UUC A;  5T8I A;  1ZVV A;  2XS8 A;  4MS6 A;  4WWO A;  3TG5 A;  4HB5 A;  2Y1L E;  1ELW A;  3TWT A;  4GTO A;  2BNM A;  5D66 A;  3RO2 A;  4C48 B;  1H2U A;  4CDM A;  3ABM E;  5ITZ F;  3R9M A;  3FUH A;  4CEM A;  4J1W A;  3LPZ A;  4FAD A;  1LCC A;  5KJK A;  3OQO A;  3DNV B;  2ZGG A;  4U8V D;  3Q79 A;  3ZHE A;  2XRY A;  3ASH A;  2L49 A;  1RZS A;  4Z5D A;  5DTQ A;  4ABN A;  3OKZ A;  3QOX A;  3S7B A;  3UXG A;  4BSX A;  4OB4 A;  3GZS A;  4URK A;  3KSQ A;  1NEQ A;  3CHS A;  3FTX A;  3HZI B;  3JXC L;  3DPD A;  2FO7 A;  4PU4 C;  4OBM A;  3LIS A;  1O5M A;  2LNM A;  5E75 A;  2OV8 A;  3HVE A;  3EHN A;  3OXG A;  2IUO A;  5ENP D;  3ULE G;  4F7A A;  2HE0 A;  5B1B E;  1Z5S C;  1L1M A;  1S7E A;  4CYM D;  1E90 A;  2VTB A;  4N3A A;  4EZI A;  2BJC A;  4UI9 C;  5G2N A;  3U9W A;  2EBY A;  5LFA A;  4G25 A;  4CDR A;  1GW6 A;  2IU7 A;  4TXQ A;  3SCG A;  2M63 A;  4J8S A;  3RRU A;  3BG0 B;  3TL5 A;  2KXP C;  1EFA A;  4H7X A;  3OAW A;  3R7Q A;  2J08 A;  4YVO A;  5ENO D;  1Z6T A;  3FTV A;  4XI9 A;  5BXO A;  2VGX A;  5A7L A;  2NSZ A;  3PZ1 A;  2WXH A;  4WAF A;  4N2S A;  3DEP A;  3CVL A;  4I6G A;  4FJZ A;  3ZEF A;  3GW4 A;  2F8X K;  4CRW A;  4U04 A;  4YDE A;  5B1A E;  5JMN D;  1AWC B;  4K5C A;  5DRY A;  4QQI A;  3NOG D;  5KNG A;  2FEZ A;  4KZC A;  4IYP A;  4GMJ A;  2VSO E;  2HSG A;  2L0T B;  3I4G A;  2FF4 A;  4ANX A;  3TEL A;  2ZXW E;  2MEZ A;  1HX8 A;  4L1B A;  5IY5 E;  3PUJ A;  2XQ0 A;  3SX0 A;  4DX7 D;  5ENN A;  5J90 A;  3L16 A;  2XGO A;  3DRA A;  2PXE A;  3B13 A;  2X3M A;  5BUZ A;  2XXA A;  5HQ8 A;  4KXK B;  3ZHM A;  3UKR G;  3FU5 A;  3ZHE B;  2GGF A;  2P9N G;  2CFU A;  3BUA A;  4UQX A;  5AAO A;  1MX2 A;  3IVP A;  1O1T A;  5FZS A;  3CHQ A;  3QOU A;  4AM9 A;  4OVU A;  2EIJ E;  3F51 A;  4CCA A;  3SCH A;  4AY5 A;  2BTD A;  2WQH A;  1BPO A;  2ZIS A;  3EHQ A;  3JQ1 A;  1V55 E;  3SI5 A;  4ANW A;  2X6I A;  4X4E A;  4FLH A;  3AU4 A;  4L23 A;  3D9L A;  1A17 A;  3Q7F A;  2LYQ A;  2KAT A;  3CKB A;  3ZXS A;  2AUW A;  1EDU A;  2C2L A;  3PEV B;  2PXV A;  1OT8 A;  3TWV A;  4HOU A;  1OCR E;  4N3B A;  1N0R A;  4G2V A;  1FPP A;  4D10 C;  2LO6 A;  5CCL A;  4K5A B;  1NL4 A;  1LD7 A;  2PXP A;  4B93 B;  3NB2 A;  1E7U A;  3AG4 E;  3SBS A;  2KM4 A;  5JJ6 A;  3UM1 A;  2YHC A;  1BDI A;  2ILR A;  2XGM A;  3MEK A;  4ILG A;  3HHM A;  4I9C A;  4LCT A;  1A5E A;  4KBQ A;  5C2Y A;  2PXU A;  3NBN B;  1OWO A;  5HRY A;  1LQC A;  4GAA A;  3CHM A;  3JUE A;  1PY1 A;  5GAH i;  4J8Y A;  3FUF A;  2IQC A;  4AY6 A;  4F1P A;  1TN7 A;  3FUM A;  3LY7 A;  2VGX B;  4A1G A;  1H19 A;  4YBA A;  3CGH A;  4U95 D;  2B5A A;  1R63 A;  2FI7 A;  4JCY A;  4JPS A;  4CT0 A;  3HRA A;  2HIN A;  4F6R D;  2X38 A;  3FYA A;  1TNZ A;  1SQM A;  4CGV A;  1FT2 A;  3AG1 E;  4HRM B;  5EIB E;  4N5Q A;  2HYZ A;  1UXC A;  3APD A;  1Y7Y A;  4KVM A;  4NAC A;  3LQX A;  3ZKJ A;  2IVG A;  2HO1 A;  1XWR A;  4ANU A;  2RFA A;  1FT1 A;  3ASG A;  5T3R A;  2B6C A;  3G0T A;  4ZFH A;  1BI8 B;  4DI4 A;  1UOH A;  3MKQ A;  3BG1 B;  3ZXP A;  5T4Y A;  2PXT A;  1B0N A;  2PUF A;  4JA7 A;  4EEC A;  3CVX A;  1TN8 A;  4I6R A;  1IHG A;  2J07 A;  2IF4 A;  1OWL A;  3Q49 B;  4DLQ A;  4PU7 A;  3FU3 A;  4K0R A;  3FDH A;  3RKV A;  2P9K G;  4I8T A;  3C3O A;  3UT8 A;  4EBA A;  2R17 C;  3TXN A;  2V5Q C;  4LG6 A;  3B7B A;  4ME2 A;  5EDS A;  1Y9Q A;  4A55 A;  1UW4 B;  3UKU G;  3WG7 E;  4AVX A;  1YYH A;  1QP7 A;  4I1M A;  2X6J A;  2PXL A;  4I43 A;  3ZRH A;  3T8M A;  1MX6 A;  4ER6 A;  2DYR E;  2XS1 A;  4G1T A;  3G2U A;  1V54 E;  4XX5 A;  1BDH A;  3IKO B;  2GZU A;  5A6C A;  2P58 C;  3H5T A;  2VGE A;  4PS7 A;  1E3O C;  2IJG X;  2RD0 A;  3PRE A;  4AOF A;  3OQM A;  3L13 A;  4A63 B;  1JCQ A;  1OWP A;  4X4B A;  5JHA A;  1DWK A;  2LNI A;  3CVV A;  1QP0 A;  3PRZ A;  1N95 A;  4RQI A;  1D8D A;  2PUE A;  2FO1 E;  4X4C A;  5EX0 A;  1MJ0 A;  1KZO A;  3QOW A;  2IV1 A;  1N11 A;  4IRU A;  4BFR A;  1POU A;  3F6W A;  3D9M A;  3EUS A;  1ZZ7 A;  2LCV A;  3CVP A;  3JUI A;  2Q7F A;  1N52 A;  3QK0 A;  4RVB A;  2MXD A;  3G7D A;  1D8E A;  4ZHB A;  3P1U A;  3FTU A;  3OWQ A;  4Q2J A;  2XPZ A;  1TJC A;  5ANL A;  4G8K A;  3G2S A;  4HS2 A;  1O1S A;  2A4Z A;  4O8B A;  5ENQ D;  4AEZ C;  1IQU A;  2OEW A;  4Z59 A;  2H8R A;  5FWQ A;  4F1S A;  2OVB A;  3PUK A;  4N39 A;  4IVZ A;  4HOT A;  2KEK A;  2CG3 A;  3U66 A;  4H7Y A;  3LFP A;  3RIB A;  4GZC A;  2XIU A;  4YDY A;  5AQA A;  1U3D A;  3MZL B;  4BX9 A;  3EIJ A;  4I6E A;  1YMP A;  5HKP A;  3WXX A;  1ZUG A;  3MKQ B;  2YBD A;  3CLJ A;  2PUA A;  1S0P A;  1CJG A;  1TR4 A;  4AJW A;  3TRB A;  2FBN A;  3NXH A;  4JC8 A;  3PXP A;  3MKR A;  2MHK A;  4NRH B;  1L5J A;  4UWK A;  2OVF A;  2PQR A;  3BU8 A;  3SZ7 A;  2WPV A;  1BI7 B;  3AAA C;  4F3V A;  4ILI A;  3IV0 A;  1OCO E;  5CMW A;  3CQC B;  3CHP A;  2AWI A;  3ZYL A;  5D2M C;  2I6H A;  4XI0 A;  3TGO A;  1G3N B;  3AG3 E;  4LEU A;  1HZ4 A;  4JCX A;  3DST A;  4TXR A;  4EKG A;  4CZ2 D;  3SNX A;  2XHE A;  5JJ7 A;  2O49 A;  4JB8 P;  5ANR A;  3O48 A;  1DW9 A;  1PRA A;  4Q94 A;  5G05 C;  2QYU A;  2ODR D;  4JL0 A;  3Q15 A;  1SVX A;  2E2E A;  2J7W A;  3VTY A;  4CT4 A;  5CMY A;  4KVO A;  2YNQ A;  2EIN E;  5G55 A;  2LYS A;  3KAE A;  1PNR A;  3R09 A;  3PS6 A;  5B3S E;  4J1X A;  2AVP A;  3ZYM A;  3SFZ A;  1Z3X A;  2E0I A;  3SD5 A;  1NFI E;  3FP3 A;  5LCW C;  4Z5C A;  4KMO A;  3U3W A;  2AJA A;  5E76 A;  4TUM A;  5FTP A;  4U0U A;  5KWD A;  4FUL A;  5CED B;  3IXE A;  2DYS E;  4JW1 A;  3FTS A;  3UI2 A;  2L0I A;  4M3O A;  2I9C A;  3BS3 A;  3OP9 A;  3J5Q B;  3HIZ A;  1E96 B;  1QP4 A;  1MX4 A;  3O9X A;  4YG4 A;  5CEA A;  2H6F A;  2EWT A;  1WM5 A;  1K1B A;  4X4G A;  3IBE A;  3IHY A;  3KSL A;  2OCC E;  1HG2 A;  3B7R L;  4HLL A;  1RZR A;  4O1O A;  1YSE A;  1JWL A;  1JWF A;  1UJK A;  2PUC A;  3AS5 A;  3ESL A;  2YHE A;  3E32 A;  1TYQ G;  4G24 A;  1HE8 A;  5GAG i;  3MV3 B;  4WND A;  4WWN A;  4G8L A;  3ENE A;  4UWF A;  3RAU A;  3LXU X;  3LVQ E;  3ULY A;  2L9B A;  2XJ3 A;  2QYJ A;  2JQE A;  2XSD C;  4GYO A;  4TUU A;  2P9L G;  4XEI G;  3MLF A;  3MV2 B;  3D9H A;  4G11 A;  3MYV A;  5DTR A;  3EJN A;  3HXD A;  1HF8 A;  4DE8 A;  3TXM A;  3BDN A;  3VTX A;  2A6C A;  4K5B A;  4GB9 A;  4WNG A;  2CG2 A;  5EYP F;  3L54 A;  1HFA A;  5JHB A;  2IO2 C;  3OXF A;  3PZ2 A;  4EPZ A;  2A5U A;  4KT6 B;  3TWX A;  2WQ7 A;  4AP2 A;  5AAR A;  1AU7 A;  4I2W A;  3K9I A;  3UMV A;  5DIZ A;  4W9R A;  1KT0 A;  2J9Q A;  1Y6I A;  2XCB A;  2PL2 A;  1LD8 A;  2EIL E;  4JZY A;  3QC1 A;  3UT4 A;  2R05 A;  3JCK C;  1WH8 A;  4TV3 A;  1OCT C;  4J8F A;  2PQN A;  3TFL A;  2PIJ A;  4GMR A;  3FEX A;  1AP7 A;  4L2Y A;  2R63 A;  4IA8 A;  1TJF A;  2PPX A;  2WXQ A;  3CQG B;  3SQV A;  2EIK E;  1E8Y A;  1NA3 A;  2WXR A;  1HS6 A;  4G23 A;  4K03 A;  1VPW A;  5G04 J;  5LP0 A;  3F52 A;  1S63 A;  3B95 A;  3RSE G;  1OXJ A;  1UJJ A;  4X8Q A;  4B94 A;  3KXA A;  5DTM A;  2V4H C;  4OAV B;  1IQR A;  1H6O A;  2JLB A;  3HXE A;  2BKG A;  2JCG A;  5BT1 A;  3Q73 A;  1DCE A;  3SY2 A;  2IY0 C;  5EN5 D;  2HFZ A;  2XCJ A;  4GU5 A;  3TAX A;  5KBA A;  4EKI A;  5KJM A;  3LYA A;  2GRN B;  3F6Q A;  2HR2 A;  3Q4A B;  2IVQ A;  4FJY A;  4I6U A;  3FUJ A;  3ASN E;  2F0Y A;  5CHE E;  5BW8 C;  1N4P A;  3UX4 A;  4HVB A;  3BEE A;  1SA4 A;  4IN3 B;  2H6H A;  1ZZ8 A;  4FC8 A;  2J4D A;  4Z58 A;  2GRR B;  2GRL A;  4J0U A;  4HXI A;  1NP7 A;  3HXC A;  3L17 A;  3FUN A;  4FU3 A;  3FTZ A;  2J09 A;  1XNF A;  2XZD G;  3CVW A;  3S7D A;  1SZA A;  3ZYK A;  4ACK A;  3KD7 A;  5LX8 A;  4U07 A;  4BET A;  3L08 A;  3QQ6 A;  2V3C C;  2IFU A;  3RRN B;  3UM2 A;  3OXL A;  2EQX A;  2R1J L;  2C0L A;  2VQ2 A;  3Q5M A;  3FTW A;  2AXV A;  1LF8 A;  5CBN A;  2ION A;  4B89 A;  5HI7 A;  4IWR A;  1HG5 A;  1QB2 A;  3QWV A;  3HXF A;  2DVW A;  4UWG A;  2NYJ A;  5CRU A;  5ENS D;  4LNB A;  3NZL A;  1RZR D;  3NDB B;  2J49 A;  4JXT A;  1JH9 A;  1JCR A;  1ZZ6 A;  1TNB A;  3NRO A;  1ADR A;  4X4I A;  2XZT G;  4A1S A;  4Y42 A;  3CRO L;  1YCS B;  2EIM E;  2IEJ A;  1MYO A;  3ISM C;  2OOE A;  4DUI A;  2J8S D;  2P2C P;  2BED A;  1OUV A;  4Z68 A;  2YIN A;  2NXP A;  4F8D A;  2P9U G;  1ZPQ A;  3PE4 A;  5FZR A;  3LJ3 A;  5JA4 D;  4C0E A;  4DK5 A;  4ER5 A;  2DWZ A;  3NOC D;  1QNF A;  3EDT B;  4KYO B;  2PZI A;  3UIO C;  2QZA A;  2Y0B G;  3T5X A;  3RJV A;  2WM9 A;  3Q47 B;  1QPZ A;  4N3C A;  3S7J A;  4HBD A;  3N71 A;  3MEJ A;  2L1P A;  3Q75 A;  3SFX A;  3ULQ A;  4I6J A;  3EHM A;  3FU6 A;  2KZ8 A;  1ELR A;  4NUR A;  5FQ7 A;  1N4R A;  3GBF A;  2PXD A;  2ICP A;  1OCZ E;  2WVI A;  2CHW A;  4LRZ A;  2KZT A;  4YND A;  4GYW A;  3G2W A;  3UFD A;  2HM8 A;  3C98 A;  4L2L A;  3A9Y A;  4U0S A;  3UM3 A;  3AS8 A;  3AU5 A;  3HG0 D;  5DSX A;  3Q9N C;  3BD1 A;  2OND A;  2KC7 A;  4HOQ A;  3CSF A;  3SCF A;  4ILH B;  2Y4T A;  1OWM A;  1KT1 A;  2XEN A;  3QWP A;  2NC9 A;  2WXJ A;  4E85 A;  3W9F A;  1EPU A;  3LDZ A;  3OTN A;  4OVV A;  5ENR D;  4LSZ E;  3FY4 A;  2PM6 A;  3EU5 A;  4MLP A;  2DZN A;  4GCN A;  4EZL A;  1HU3 A;  3CK9 A;  4NQ0 A;  3CHR A;  3D9P A;  3CST A;  2KCL A;  5DRT A;  2WB2 A;  3QB2 A;  4RG9 A;  3I5P A;  2XXQ A;  2LSV A;  4JHJ A;  1N9A A;  1B89 A;  1N0Q A;  4PS3 A;  3QJZ A;  3Q7A A;  4X4D A;  2IOL A;  5FQ8 A;  4JEH A;  3UM0 A;  4BER A;  5A7D B;  2L6B A;  3DXK G;  1MHQ A;  5FIO A;  3FUI A;  1N4Q A;  3JYS A;  4V3I A;  2PM7 A;  3FUK A;  2IU1 A;  1D9S A;  2BNO A;  5FQ4 A;  2GRM A;  2XEE A;  3AJI A;  4ER3 A;  4MCT A;  3G2V A;  3PNT B;  3VLD A;  1BD8 A;  3B7T A;  1PER L;  3C3R A;  2AXZ A;  1NZN A;  4GCO A;  3GZ1 A;  4MKT A;  2KCK A;  3S8Q A;  2IVB A;  5ARF A;  4EQF A;  5FQ6 A;  3GZD A;  5AQB A;  4FN3 A;  2PE5 A;  2PUD A;  3QNK A;  3HXB A;  3TEP A;  1WG0 A;  2ZIR A;  3ZGQ A;  1HF0 A;  2BUG A;  4I17 A; 
#chains in the Genus database with same CATH homology
 4N2S A;  2Y4U A;  4GZ6 A;  4J6I A;  2C0M A;  4JHK A;  2L0I A;  3CVL A;  4I6G A;  4M3O A;  3UPV A;  4FJZ A;  2I9C A;  3BS3 A;  3FEY A;  3ZEF A;  3OP9 A;  2JEK A;  2XRZ A;  1E8X A;  3GW4 A;  3DBS A;  2XCC A;  3HIZ A;  4C0M A;  4U04 A;  1E96 B;  3ML9 A;  2WXK A;  3ASD A;  4CRW A;  1QP4 A;  5T8I A;  4N2Q A;  3FH7 A;  3O9X A;  4YG4 A;  4G26 A;  4LUN U;  2EWT A;  3CKC A;  1WM5 A;  3G2T A;  3CEC A;  1EF1 C;  2FEZ A;  2X6K A;  3FFL A;  3JXD L;  4X4G A;  3IBE A;  4FP7 A;  4XIF A;  3IHY A;  3I3N A;  4KZC A;  4TRQ A;  1X5B A;  3G5G A;  4IYP A;  4EZJ A;  4GMJ A;  2VSO E;  3P2B A;  2HSG A;  2L0T B;  3HDX A;  4CDN A;  1IC8 A;  2QY7 A;  3I4G A;  2FF4 A;  4Y6W A;  3AS4 A;  2ICT A;  4ANX A;  1HG2 A;  3ZN3 A;  2MEZ A;  1HX8 A;  4L1B A;  3TG4 A;  3RO3 A;  3PUJ A;  4X4F A;  2XQ0 A;  3B7R L;  1RZR A;  2KZT B;  3IHV A;  1YSE A;  1JWL A;  1WET A;  4HFG A;  4AIF A;  2VSN A;  4JHR A;  1JWF A;  1UJK A;  2PUC A;  3AS5 A;  3ESL A;  3L16 A;  2YHE A;  5ENN A;  3RK6 A;  4APO A;  5JJT A;  5J90 A;  2XGO A;  3CEQ A;  2XPI A;  4O6F A;  5DBK A;  4J8E A;  4G24 A;  2DIW A;  5BUZ A;  3B13 A;  2X3M A;  2O4A A;  1HE8 A;  5BPP A;  3MV3 B;  4WND A;  4WWN A;  4KZ0 A;  3ENE A;  4UWF A;  2WUS R;  2V5F A;  1O4X A;  5HQ8 A;  4KXK B;  2CFZ A;  5ARG A;  5AYW D;  1JFS A;  2JVL A;  3ZHM A;  1E8W A;  3FU5 A;  5G05 J;  3EIQ C;  4GA1 A;  3LXU X;  4GA2 A;  2WXL A;  3LVQ E;  1LLI A;  3ZHE B;  4CGW A;  2GGF A;  2L9B A;  2WXG A;  2CFU A;  2XJ3 A;  1P5Q A;  4UQX A;  1LCD A;  2WXM A;  4GZ5 A;  4FA6 A;  3IVP A;  5FZS A;  2LYR A;  3CHQ A;  3QOU A;  4AM9 A;  4OVU A;  5AIJ A;  2XSD C;  4GYO A;  3F51 A;  4CCA A;  3SCH A;  4AY5 A;  2R5S A;  2BTD A;  2J4B A;  3QWW A;  1HXI A;  4TUU A;  2WQH A;  3MLF A;  1BPO A;  4GPK A;  3RU0 A;  3MV2 B;  3JQ1 A;  4BT9 A;  3HYM B;  3CLC A;  1MQS A;  2DBA A;  4PS8 A;  4WWP A;  3PNL B;  1SZ9 A;  3GZ2 A;  5FJY A;  1NER A;  4UI9 J;  3SI5 A;  4ANW A;  4GHJ A;  4DPR A;  2X6I A;  3CVY A;  4X4E A;  4FLH A;  4G11 A;  3MYV A;  3AU4 A;  4L23 A;  3EJN A;  3D9L A;  1A17 A;  5LCW J;  3VLF A;  2WQ6 A;  2LYQ A;  1HF8 A;  2KAT A;  4Y6C A;  3CKB A;  3TXM A;  3BDN A;  2I1J A;  3D9J A;  3VTX A;  3ZXS A;  2A6C A;  2AUW A;  4YVQ C;  3ZVV A;  4BWR A;  5A6C A;  1EDU A;  2C2L A;  2V8S E;  3PEV B;  4GB9 A;  4WNG A;  1E8Z A;  2CG2 A;  3L22 A;  2UY1 B;  4BX8 A;  4DLO A;  4HOU A;  3L54 A;  1H2V C;  5BV1 A;  4UI9 K;  4OYS A;  4UWH A;  1HFA A;  5JHB A;  3KEZ A;  4I6T A;  3OXF A;  4N3B A;  2I2O A;  4G2V A;  4EPZ A;  5CCL A;  4D10 C;  2LO6 A;  4JQD A;  2A5U A;  1JPL A;  2DCP A;  5G04 C;  3B7H A;  1QQB A;  4KT6 B;  3PE3 A;  3NZU A;  4XKC A;  1UTX A;  2WQ7 A;  4AP2 A;  4R7L A;  1AU7 A;  4JEU A;  4I2W A;  1E7U A;  2WXN A;  3KJX A;  3K9I A;  3SBS A;  2KM4 A;  3UMV A;  5JJ6 A;  2LYL A;  1CQT A;  2XPY A;  5DIZ A;  2YHC A;  4MCX A;  4W9R A;  4Q69 A;  1BDI A;  2ILR A;  2XGM A;  1KT0 A;  2J9Q A;  3MEK A;  4ILG A;  4I2Z A;  4IUL A;  2FJR A;  1Y6I A;  2XCB A;  3D9I A;  4PH4 B;  3HHM A;  1NA0 A;  3PH0 C;  4I9C A;  1X2L A;  2PL2 A;  4I1O B;  4LCT A;  5D0Q D;  5K98 B;  4KBQ A;  4JZY A;  3QC1 A;  3MJW A;  5C2Y A;  3UT4 A;  1OWO A;  1LQC A;  5C1D A;  3I4R B;  3JCK C;  4GAA A;  1WH8 A;  3RRM B;  3TJP A;  2GW1 A;  4TV3 A;  3R9A B;  1OCT C;  3CHM A;  5EKQ D;  3UUX A;  1ZU2 A;  3GYZ A;  4J8F A;  5J08 A;  1PY1 A;  2PQN A;  3CK8 A;  3FUF A;  4AV7 A;  2IQC A;  4AY6 A;  3MCX A;  3FUM A;  2PIJ A;  3LY7 A;  2MQK A;  4I1A A;  4UQZ A;  2VGX B;  3FEX A;  3FHE A;  4L2Y A;  1KLX A;  4A1G A;  2R63 A;  1H19 A;  4IA8 A;  1TJF A;  2LYP A;  4Z5H A;  1XGW A;  2PPX A;  1YA0 A;  2VSX E;  4YBA A;  2WXQ A;  3CGH A;  4U0Z A;  2B5A A;  3CQG B;  4QFV A;  1R63 A;  2FI7 A;  5EX3 A;  2KPJ A;  1E8Y A;  1NA3 A;  4JCY A;  2WXR A;  4JPS A;  3CVU A;  3ONK A;  1HS6 A;  4CT0 A;  3L1P A;  4G23 A;  1VPW A;  2HIN A;  4K03 A;  4WUY A;  1RPE L;  5G04 J;  5LP0 A;  3F52 A;  4GYY A;  1Z3Y A;  2X38 A;  3FYM A;  3FYA A;  1RIO A;  4GZD A;  1QQA A;  2Y3A A;  2AXU A;  1SQM A;  4CGV A;  1ZS4 A;  1UJJ A;  2AW6 A;  2XI8 A;  4B94 A;  3KXA A;  4YAR A;  3FMY A;  1IQR A;  2JLB A;  3SF4 A;  1ZZC A;  2HYZ A;  3CV0 A;  3PVL A;  1UXC A;  3APD A;  1Y7Y A;  2JCG A;  3B7U X;  4HOR A;  4KVM A;  3E4B A;  4NAC A;  5BT1 A;  2WMN A;  4GA0 A;  5KJN A;  2CHX A;  2IVG A;  2HO1 A;  1XWR A;  2BNN A;  2CSF A;  3LY8 A;  2X6H A;  4ANU A;  1QQE A;  3GN5 A;  1FVF A;  3QAR A;  1WAO 1;  3KS2 A;  3ASG A;  3APF A;  2XCJ A;  4GU5 A;  5T3R A;  3TAX A;  4BY6 A;  5KJM A;  3LYA A;  1PAQ A;  1X57 A;  4XE0 A;  4DI4 A;  4GQM A;  2HR2 A;  3Q4A B;  3QAQ A;  2IVQ A;  4I6U A;  3BG1 B;  1R69 A;  3OMT A;  1GT0 C;  1E7V A;  3MKQ A;  4FJY A;  5T4Y A;  3R1F A;  3RZZ A;  4ATG A;  1W3B A;  3FUJ A;  1B0N A;  2PUF A;  4JA7 A;  3R7R A;  4EEC A;  2UWJ G;  2PUG A;  4PDX A;  5FT9 A;  4P29 A;  3CVX A;  3PDN A;  1PRU A;  4EZK A;  5CHE E;  4I6R A;  5FZQ A;  1IHG A;  2J07 A;  5BW8 C;  3UX4 A;  4HVB A;  4Q96 A;  4GML A;  2IF4 A;  1ZZ9 A;  1OWL A;  3BEE A;  3Q49 B;  4PU7 A;  3D9N A;  3FU3 A;  4IN3 B;  2PUB A;  5LOZ A;  3PZD A;  4K0R A;  3FDH A;  3RKV A;  3QDN A;  1ZZ8 A;  4I8T A;  4FC8 A;  3S2A A;  4L7T A;  1HO8 A;  1UN9 A;  3UT8 A;  4EBA A;  2R17 C;  3ESK A;  1IYG A;  2J4D A;  4Z58 A;  3TXN A;  2GRL A;  4J0U A;  4HXI A;  2L6J A;  4ME2 A;  1NP7 A;  3LY9 A;  1FVH A;  5EDS A;  1Y9Q A;  4A55 A;  3L17 A;  3FUN A;  3UT7 A;  1UW4 B;  4GZ3 A;  1UG3 A;  4AVX A;  4FU3 A;  1QP7 A;  2RG8 A;  2X6J A;  4I1M A;  3FTZ A;  3ZKC A;  2J09 A;  4X4H A;  1XNF A;  4I43 A;  4UWL A;  3T8M A;  3ML8 A;  3ZRH A;  3S7D A;  3CVW A;  4HOS A;  2FUL A;  3QYX A;  1SZA A;  2R59 A;  4G1T A;  3ZYK A;  4PUC A;  2L8N A;  3NZS A;  2KEI A;  3G2U A;  3APC A;  3VLE A;  1H0A A;  4XX5 A;  1BDH A;  3IKO B;  3JQ0 A;  3IEG A;  3KD7 A;  3QKY A;  3O4Z A;  2MOW A;  4U07 A;  4ACK A;  4B8C B;  5LX8 A;  1FCH A;  3L08 A;  2GZU A;  1DVP A;  3QQ6 A;  2WXO A;  2IFU A;  2WXI A;  3D9O A;  4FBI A;  3RRN B;  2OR1 L;  4AXH A;  5AEN A;  2P58 C;  3OXL A;  3H5T A;  1ZBP A;  2V0P A;  3PEU B;  4PS7 A;  2EQX A;  2XGS A;  3QWG A;  2R1J L;  2C0L A;  2YQ8 A;  2VQ2 A;  1E3O C;  3FUE A;  2IJG X;  3Q5M A;  3ZIM A;  3CR3 A;  2RD0 A;  3FTW A;  3PRE A;  4PU8 A;  3OQM A;  4AOF A;  2AXV A;  3L13 A;  5KJL A;  4UQY A;  1LF8 A;  1OWP A;  3MX3 A;  2ION A;  4X4B A;  3SHF A;  1H6K A;  4B89 A;  5HI7 A;  4C9B B;  4IWR A;  1HG5 A;  5JHA A;  2D5V A;  1DWK A;  2LNI A;  4I9E A;  3QWV A;  1QP0 A;  4J8D A;  4UWG A;  4APF A;  3CVV A;  3PRZ A;  2PUE A;  4HLE A;  4X4C A;  1VDY A;  5EX0 A;  2IV1 A;  4IRU A;  1ELK A;  4U8H A;  1POU A;  3F6W A;  1EYH A;  2V4L A;  3D9M A;  4BFR A;  5A23 A;  3CHO A;  2KCV A;  1RZR D;  2VGY A;  2J49 A;  3EUS A;  4JXT A;  1ZZ7 A;  1JH9 A;  1ZZ6 A;  2LCV A;  1ADR A;  3CVP A;  4X4I A;  3JUI A;  4F53 A;  3FTY A;  3CVN A;  4A1S A;  4Y42 A;  2Q7F A;  3CRO L;  1HH8 A;  1N52 A;  1DNP A;  1QZ2 A;  3QK0 A;  4JVS A;  4RVB A;  4MRU A;  1WY6 A;  1ZAY A;  3G7D A;  3LCA A;  2OFY A;  2OOE A;  2ZU6 B;  1H2T C;  3B7S A;  3P1U A;  3FTU A;  3JXB C;  3L6A A;  4NDW A;  1JFT A;  1OUV A;  3LS8 A;  2XPZ A;  2YIN A;  4BT8 A;  1JUQ A;  1TJC A;  2NXP A;  4F8D A;  1ZPQ A;  3PE4 A;  5ANL A;  4RG6 A;  5FZR A;  3KZ3 A;  3LJ3 A;  3G2S A;  3FUD A;  3U64 A;  4HS2 A;  4ANV A;  2A4Z A;  3LVR E;  2CHZ A;  4O8B A;  5CCM A;  4RSY A;  1PRV A;  5AJL A;  3ZPJ A;  4AEZ C;  4FHK A;  1IQU A;  4C0E A;  3D9K A;  4DK5 A;  3T5V A;  4YG7 B;  1QNF A;  3EDT B;  3MGB A;  3NF1 A;  4KYO B;  4Z59 A;  2PZI A;  3ZW3 A;  2H8R A;  4EBA G;  4XKB A;  2WXP A;  5FWQ A;  4F1S A;  4LER A;  4U63 A;  4N5C A;  2KEJ A;  3LEW A;  2OVB A;  3PUK A;  2VSY A;  3T5X A;  2O38 A;  3RJV A;  4N39 A;  2WM9 A;  1INZ A;  2XEV A;  3Q47 B;  4IVZ A;  1QPZ A;  2KEK A;  1OWN A;  2CG3 A;  3FH8 A;  3ZHI A;  3U66 A;  4HOT A;  4N3C A;  4A3V A;  2LAI A;  3S7J A;  4H7Y A;  3LFP A;  1OSL A;  1Y8M A;  3FU0 A;  3LKU A;  3GN5 B;  3N71 A;  1ZVV A;  3FWV A;  2XIU A;  4GZC A;  4MS6 A;  4WWO A;  3TG5 A;  3ZFW A;  3ULQ A;  4I6J A;  3EHM A;  1ELW A;  3FU6 A;  2KZ8 A;  1ELR A;  4NUR A;  5FQ7 A;  5KCM A;  4WNE A;  1U3D A;  3GBF A;  3MZL B;  4BX9 A;  3EIJ A;  2BNM A;  4I6E A;  5D0O D;  4BTB A;  3RO2 A;  2ICP A;  2EF8 A;  1H2U A;  2WVI A;  1WIZ A;  3NQP A;  3WXX A;  4CDM A;  2CHW A;  5M72 A;  4LRZ A;  3FUH A;  1ZUG A;  2KZT A;  3MKQ B;  4B0Z A;  4YND A;  4CEM A;  4J1W A;  3CLJ A;  4GYW A;  3G2W A;  2PUA A;  1S0P A;  1CJG A;  3LPZ A;  3UFD A;  4AJW A;  3VK0 A;  2HM8 A;  4FAD A;  1JWG A;  3TRB A;  3C98 A;  1LCC A;  2FBN A;  4L2L A;  4JC8 A;  3SBT B;  3PXP A;  4U0S A;  3AS8 A;  3MKR A;  5KJK A;  3AU5 A;  2MHK A;  4NRH B;  3OQO A;  1L5J A;  3DNV B;  1UN8 A;  2OVF A;  2PQR A;  4UWK A;  3UQ3 A;  3BD1 A;  3SZ7 A;  2LYK A;  2LSU A;  2OND A;  2KC7 A;  2WPV A;  1WH6 A;  3SCF A;  3CVQ A;  3CSF A;  3IV0 A;  4FLB A;  4HOQ A;  4ILI A;  4F3V A;  2LYJ A;  4ILH B;  3ZHE A;  2XRY A;  2Y4T A;  5CMW A;  1OWM A;  1KT1 A;  1U3C A;  3ASH A;  3QWP A;  3CQC B;  2NC9 A;  3S7F A;  2WXJ A;  2MRI A;  4E85 A;  3CHP A;  2AWI A;  2L49 A;  1EPU A;  3LDZ A;  2I6H A;  3OTN A;  1RZS A;  4OVV A;  3RIB A;  4Z5D A;  4XI0 A;  4BTA A;  3FY4 A;  3ASF A;  4ABN A;  2PM6 A;  1PC2 A;  3TGO A;  3MA5 A;  3FH5 A;  4JW1 A;  3S7B A;  4MLP A;  2QFC A;  4GCN A;  4EZL A;  1HU3 A;  2WIU B;  4BSX A;  4LEU A;  1HZ4 A;  3CK9 A;  4NQ0 A;  4OB4 A;  2WXF A;  3CHR A;  3GZS A;  4JCX A;  3U4T A;  4URK A;  3D9P A;  3CST A;  2BF0 X;  1NEQ A;  3CHS A;  3FUL A;  2KCL A;  4WNF A;  3FTX A;  2VYI A;  3HZI B;  3SNX A;  2WB2 A;  3JXC L;  3DPD A;  3QB2 A;  4RG9 A;  3I5P A;  2XHE A;  2LSV A;  4JHJ A;  5JJ7 A;  2O49 A;  2FO7 A;  1B89 A;  4PU4 C;  5ANR A;  3O48 A;  4PS3 A;  5BNW A;  3LIS A;  3QJZ A;  4DLQ A;  3ZYL A;  1DW9 A;  4X4D A;  2WMO A;  5E75 A;  4XZ4 A;  2IOL A;  5FQ8 A;  1PRA A;  4Q94 A;  2UY1 A;  4JEH A;  2OV8 A;  5A7D B;  3HVE A;  3EHN A;  3OXG A;  1MHQ A;  2IUO A;  4DJA A;  4PU3 C;  5G05 C;  3HVE B;  1TEZ A;  3CK7 A;  3Q15 A;  4JL0 A;  3FUI A;  3SGH A;  4B8A A;  1LMB 3;  2E2E A;  2IOS A;  4F7A A;  3VTY A;  1N54 A;  4CT4 A;  2I1K A;  3JYS A;  4V3I A;  5CMY A;  2PM7 A;  5AJD A;  4KVO A;  3FUK A;  2YNQ A;  2IU1 A;  1L1M A;  1S7E A;  5G55 A;  4A3T A;  2BNO A;  2LYS A;  5FQ4 A;  4ACL A;  2GRM A;  1E90 A;  3KAE A;  4MCT A;  3CIA A;  1PNR A;  2VTB A;  2X6F A;  3G2V A;  3PNT B;  4N3A A;  3VLD A;  3PS6 A;  3ONL A;  3B7T A;  2VTB B;  4J1X A;  2AVP A;  3ZYM A;  3SFZ A;  4E6H A;  2BJC A;  1Z3X A;  2E0I A;  3SD5 A;  4UI9 C;  2CRO A;  5G2N A;  1ZZB A;  2EBY A;  3QF3 A;  1PER L;  4G25 A;  3U9W A;  5LFA A;  3FP3 A;  4CDR A;  2AXZ A;  1NZN A;  4GCO A;  1GW6 A;  2IU7 A;  3OQN A;  3GZ1 A;  4MKT A;  5LCW C;  2LAH A;  2KCK A;  4Z5C A;  3S8Q A;  4YG1 A;  2VJ8 A;  2IVB A;  4KMO A;  3U3W A;  3SCG A;  2M63 A;  4J8S A;  5ARF A;  3RRU A;  5E76 A;  4EQF A;  3BG0 B;  5FQ6 A;  3TL5 A;  5BV0 A;  5FTP A;  3D3M A;  4U0U A;  3ZYQ A;  4FN3 A;  1EFA A;  4H7X A;  2PE5 A;  4FHJ A;  3OAW A;  2PUD A;  3R7Q A;  3D1N I;  1SQ8 A;  4FUL A;  2J08 A;  4YVO A;  3URZ A;  3QNK A;  1Z6T A;  3FTV A;  4JA9 A;  4XI9 A;  4DI3 A;  2VGX A;  5A7L A;  2NSZ A;  2WXH A;  1HF0 A;  2BUG A;  4WAF A;  3ZGQ A;  4I17 A;  1UXD A;  3FTS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...