2GRLA

Crystal structure of dct/icf10 complex
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
287
structure length
287
Chain Sequence
MFKIGSVLKQIRQELNYHQIDLYSGIMSKSVYIKVEADSRPISVEELSKFSERLGVNFFEILNRAGMNTKSVNETGKEKLLISKIFTNPDLFDKNFQRIEPKRLTSLQYFSIYLGYISIAHHYNIEVPTFNKTITSDLKHLYDKRTTFFGIDYEIVSNLLNVLPYEEVSSIIKPMYPIVDSFGKDYDLTIQTVLKNALTISIMNRNLKEAQYYINQFEHLKTIKNISINGYYDLEINYLKQIYQFLTDKNIDSYLNAVNIINIFKIIGKEDIHRSLVEELTKISAKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis for control of conjugation by bacterial pheromone and inhibitor peptides.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Transcription
molecule keywords PrgX
total genus 112
structure length 287
sequence length 287
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2grlA01
1.25.40.400 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2grlA02
2HSGA 2XI8A 4I8TA 2AUWA 3O9XA 3JXBC 1ZS4A 4Z59A 4PU4C 3RZZA 2LYQA 3D1NI 1JFSA 1AU7A 2EF8A 2BJCA 3SCGA 2BNOA 2KEKA 3JXCL 1Y7YA 1VPWA 4I6TA 1BDHA 2XIUA 2XSDC 1DW9A 2L8NA 1RZSA 1OCTC 1WH6A 4YBAA 1GT0C 3BDNA 1UTXA 3MLFA 3KZ3A 2GRLA 2LYPA 3TRBA 4I6UA 1EFAA 5K98B 2PUBA 3BD1A 3G7DA 4GHJA 3F6WA 2O4AA 2O38A 1ZZCA 4O8BA 1ADRA 1UXDA 2PE5A 1QPZA 3OQMA 2AWIA 3R1FA 3F51A 4PU3C 1IC8A 4Z5DA 2PUEA 2CROA 3QF3A 3FYMA 2LYJA 1ZZBA 3FMYA 1XWRA 1QP4A 1ZAYA 4YARA 1POUA 4JQDA 2R63A 2PUAA 4X4BA 4X4EA 1LLIA 2BNMA 1X57A 2JVLA 2PUCA 1PNRA 2WUSR 4MCTA 4X4CA 3H5TA 2HINA 2EWTA 1HF0A 1QP0A 2AXUA 3OP9A 2O49A 2D5VA 1R63A 3JXDL 4PU8A 2BNNA 2XJ3A 1NEQA 2H8RA 1RZRD 2PUDA 3EUSA 1UXCA 2WIUB 3LFPA 1B0NA 3OQNA 1RIOA 2PUGA 4JCYA 4X4FA 4IWRA 2CSFA 2PUFA 1WIZA 3UFDA 2PPXA 1JFTA 2LYSA 2A6CA 2XCJA 1ZPQA 3CECA 4YG4A 1WETA 2L49A 3DNVB 1PRAA 4FN3A 2ICPA 3OMTA 4I6RA 1CJGA 1ZZ7A 4JCXA 1ZUGA 3ZHIA 3BS3A 4Y42A 1RPEL 1LQCA 1Y9QA 3LISA 3CROL 1JH9A 4MCXA 4IA8A 3CLCA 2LCVA 3PXPA 1RZRA 1LCDA 1E3OC 4X4DA 1JWLA 3IVPA 4OB4A 3VK0A 4FBIA 2R1JL 2IVQA 4J1XA 1DWKA 1ZZ6A 2LYKA 1WH8A 2MEZA 1BDIA 4Z58A 1QQAA 2OR1L 3QQ6A 3ZKCA 2JCGA 2B5AA 1PRUA 2ICTA 3F52A 3KJXA 2IUOA 3S8QA 2LYLA 5A7LA 1R69A 2KZ8A 1QP7A 1ZVVA 3GN5A 2IV1A 1ZZ8A 2IVBA 1SQ8A 1PRVA 4PU7A 2AXZA 4IVZA 4X4HA 4F8DA 1ZZ9A 2LYRA 4YG1A 1L1MA 1PERL 1QQBA 2EBYA 3ZHMA 4YG7B 3KXAA 2GZUA 3OQOA 2IVGA 3GN5B 3L1PA 2MQKA 2AXVA 2PIJA 2KEIA 3SCFA 3QYXA 1LMB3 2GRMA 4X4GA 2KEJA 3HZIB 1LCCA 4J1WA 2OFYA 4GQMA 4Z5CA 3G5GA 3U3WA 1OSLA 1CQTA 4X4IA 3SCHA 3QWGA 1X2LA 2AW6A 1S7EA 1NERA 2KPJA 3FYAA 1O4XA 4Z5HA 2IU7A 4NDWA 1YSEA 2FJRA 3B7HA 3GBFA
chains in the Genus database with same CATH superfamily
2GROB 3NB2A 2HSGA 2AUWA 1Q2ZA 2IEJA 2PXUA 5C1DA 4L7TA 4RG6A 1TNBA 3L16A 3PUKA 1LTXA 1Y7YA 5E75A 1O1RA 4RLYA 1MJ0A 5LFAA 2Y4TA 2PNNA 4Q94A 1EFAA 2EILE 3LJ3A 1AP7A 4O1PA 4EKGA 2PE5A 1WAO1 4XIFA 4KT6B 4EZLA 1MX6A 3L17A 3GZDA 3FYMA 4CGWA 5LOZA 1BLXB 1OCRE 2OEVA 2VGXB 3QWWA 3QJZA 2L1PA 1HF0A 4TRQA 4JPSA 1HF8A 3TG5A 1DULA 5FJYA 1WDYA 1UJKA 3UI2A 4LNUD 4NRHB 3DSSA 4DLOA 1OXJA 5CECB 3EHQA 2YBDA 2X6JA 1NW3A 3SO8A 1TYQG 3UT8A 5FQ8A 4EZIA 4RQIA 2M4HA 2MHKA 3UPVA 4OVUA 4JB8P 2WB2A 4K5BA 5AJDA 2MEZA 2IU1A 5FQ7A 4HRNA 2DIWA 1OY3D 4HI8A 1BPOA 3EIQC 3LKUA 3GN5A 3VWSA 1DNPA 3WG7E 4ILIA 3V79K 3CV0A 3I4GA 3JXJA 1PAQA 4TXQA 2P9SG 2RFAA 1Y8MA 2GZUA 1N11A 2WXHA 3TEPA 4TXRA 4J1WA 5ARFA 2OFYA 1QB2A 2ZGGA 2XPZA 2DWZA 3IBEA 4XX5A 2CG3A 4DX5D 2XGMA 3FUEA 4K0RA 2PXVA 3E30A 4Z59A 2LYQA 3CSTA 4GA2A 4DI3A 2EF8A 1E90A 5T4YA 3CVQA 4A1GA 2XIUA 5A7DB 3EHMA 2RG8A 5CRVA 4GTPA 4GZCA 3DXKG 4GMRA 2LNMA 5ITZF 4GHJA 4PS8A 5ARGA 4NIKA 1IHGA 4PDXA 3FFLA 1IC8A 3HIZA 2QFCA 4HBDA 4ER5A 3Q7FA 2DCPA 2WXKA 2R63A 4ER3A 2XCCA 5IY5E 4X4EA 2HFZA 2WUSR 3PNTB 3ZW3A 1TNYA 4EBAA 3UX4A 3UKRG 3IXEA 3IEGA 1R63A 3CR3A 3ZGQA 2CSFA 3CVXA 2PUFA 1HO8A 3C5RA 2L49A 2KC7A 3EDTB 3Q79A 4W9RA 4Y6WA 4AV7A 4Y42A 1JH9A 4MCXA 5CRUA 4JHJA 3QKYA 1OCCE 1BDIA 4CDMA 2L9BA 2B5AA 2Y3AA 2KBXA 5GAGi 2PXQA 3KD7A 2KZTA 3TXMA 5CEDB 2R02A 1ZZ9A 2LLWA 1N4PA 1MX4A 3NBNB 2VTBA 3MX3A 4IYPA 2VGEA 2X3MA 1E7UA 1Z6TA 3SCHA 5CEAA 2ONDA 3FH7A 4V3IA 3TFLA 4EHMA 1TEZA 3SGHA 5FZQA 5JUWA 2BNOA 4I6TA 1IQUA 1MQSA 1WH6A 1JWGA 2CG2A 3AS5A 3C3QA 5DTMA 4ATGA 4LERA 1N54A 3R1FA 5DBKA 3MEKA 1H0AA 3AS4A 3UT4A 3QOXA 2YHCA 3L82A 4FU3A 4J7WA 4HNAD 3UXGA 1BI8B 1JCQA 1N4SA 3EIJA 1PNRA 4L1BA 3CQCB 3SNXA 4MCTA 3UMVA 1KT1A 4O1OA 2HINA 2F37A 4G8LA 3SX0A 4JHRA 4C48B 1FPPA 2PXLA 3BG1B 3HVEB 4U7EB 1PY1A 5BNWA 1E96B 2CHZA 3G2TA 5JA4D 2R59A 1WETA 2Y4UA 3LPZA 1YYHA 3JQ0A 2WXQA 3PVLA 5D0OD 3PXPA 4OB4A 5ENSD 1QBQA 3QOWA 2WXGA 3B13A 1NL4A 4G24A 3KL4A 4K5AB 2LNIA 3ISMC 2V5QC 3L9TA 1DCEA 1HZ4A 1QQEA 5JHBA 2P2CP 1OCZE 4WNFA 3TWSA 3QNKA 1UN9A 3DSWA 4WNDA 4F1SA 3O9XA 5HRYA 4GA0A 2CFZA 1SA4A 4F53A 1ELRA 3I4RB 3OXGA 1UTXA 4APFA 5J08A 1MX2A 3QARA 2XGSA 3UM1A 3LVQE 5J90A 3PZ3A 4BT9A 4H7XA 1S70B 2LLVA 1JUQA 5EIDA 3FTXA 2J9QA 2DVWA 3HRAA 4DX7D 4F3VA 1QP4A 4CGVA 2DZNA 5D2MC 2PUCA 2VYIA 3MKRA 1WY6A 2EWTA 4U63A 2XJ3A 3GZDC 4ER7A 1H6OA 2EINE 3C98A 3DSVA 3KSLA 4ILHB 2F8YA 2MRIA 3U66A 1UN8A 3CVWA 3QWPA 4FJZA 3L6AA 3EHNA 5EKQD 3S7JA 1N52A 4JEHA 3RO2A 1OT8A 4EPZA 3Q47B 4Q2JA 1H6PA 3ZRHA 5DTRA 4FLBA 3LEWA 2XXQA 3VLFA 4ZFHA 4F8DA 3FY4A 3RKVA 3ABKE 2FF4A 4YDYA 2JLBA 2ZU6B 2KEIA 1H2UA 5LX8A 4N3AA 1TJCA 3G5GA 2AW6A 2KPJA 1NZNA 2MYOA 2QC9A 3RSEG 3DEPA 4EKIA 3NQPA 2XI8A 2WQ6A 3FU5A 3QDNA 1TR4A 4M3OA 3OWQA 3BUAA 1VDYA 3SY2A 2PXEA 2HO1A 3BDNA 3MLFA 2IOSA 3RRUA 2KATA 3Q78A 2O4AA 3F6WA 1V54E 1E8XA 5FINA 2C0MA 1UXDA 5ENRD 3OQMA 4P29A 4KVOA 1H6KA 3LYAA 4CCAA 5FIOA 4WWOA 3LXUX 2V3CC 3D9IA 3D9JA 5CCLA 1S64A 3FH8A 2BNMA 3RO3A 1JWFA 3FDHA 1SVXA 1YMPA 3JUEA 2J09A 4LUNU 3L54A 4GU5A 5D0QD 3CKBA 4OBMA 3SFXA 3IKOB 4CRWA 2IF4A 4UWHA 3T8KA 4JCXA 4ABNA 2H6FA 3DXMG 2I9CA 4FHJA 4A3TA 5BV1A 4EECA 3VK0A 2IVQA 4WNEA 1OWNA 5BV0A 1PRUA 3EU9A 2P9IG 3ZXPA 5ANRA 2J7UA 3KAEA 4N39A 4U95D 2VSXE 2WXNA 3T5VA 4YG7B 3DSXA 2A5EA 1MZCA 3DEOA 3Q15A 4WUYA 2DYSE 2WXMA 3HZIB 1OWMA 3QWGA 1X2LA 3HHMA 3BU8A 5DSXA 4NACA 5B1BE 4U07A 2IQCA 3ESLA 4ER0A 3JXBC 3HXBA 2KXPC 1JFSA 3G2UA 2BJCA 3G2WA 4FULA 4U0ZA 5A6CA 1FVHA 3FU6A 4G8KA 4I17A 2L8NA 5DTQA 4DI4A 4YBAA 2MXDA 4KYOB 4A1SA 2BTDA 2X6IA 3TWWA 3ZPJA 1ADRA 3QWVA 3CHSA 4I2ZA 2LUHA 2ZISA 4F7AA 3F51A 3LY8A 4U8VD 2GRNB 5CMWA 3HXEA 5M72A 2LYJA 2XPYA 3NAWA 5AQBA 2XS1A 1QNFA 4ME2A 1TJFA 3DWLG 4G1TA 5AN8A 5AJLA 4U96D 1EDUA 2ODRD 2KCLA 2Y1LE 5FQ6A 1B0NA 2PXBA 3CQGB 4ANXA 3ML9A 4HI9A 3E4BA 2J07A 3OAWA 3MJWA 3FUMA 1HXIA 3LVRE 4GTRA 3RU0A 2LYKA 3QFIA 3BG0B 5H7PA 2P9LG 2IV1A 5LP0A 3E32A 1PRVA 3MYVA 4PU7A 4IVZA 1PERL 3ASOE 1L1MA 3C3RA 3ASFA 4UI9J 5G55A 3L1PA 2PIJA 3UM0A 5AAOA 4IULA 2WXLA 4DRXE 4UWGA 3FUNA 1OSLA 2F8XK 4EK9A 4LSZE 1NERA 1LD7A 2XZDG 1N94A 1ZU2A 1W3BA 1HQ1A 2DBAA 3UKUG 1AU7A 2X6HA 3SHFA 4GB9A 3CGHA 3SZ7A 4HS2A 4AXHA 2J49A 3QB2A 3ZIMA 2CHWA 4JA7A 3CVLA 2O38A 4YVQC 3HXFA 3FTSA 5CERB 1P5QA 3PNLB 3SBSA 5AYWD 4L2LA 4LEUA 1NP7A 3CVUA 3FMYA 4HRAA 5G05J 4ILGA 4HLEA 3HYMB 4BX8A 2WXRA 5HQ8A 5KJKA 1TNOA 4JEUA 3V2OA 3TWVA 4FA6A 4GA1A 3K9IA 2X6KA 4NURA 2PUDA 4BY6A 4IWRA 4H7YA 2ETAA 3TXNA 2YINA 2BEDA 2ICPA 1JCRA 5HKPA 4HFGA 2ETCA 3J5PA 3PE5A 2WMNA 5CHEE 1ZB1A 3PDNA 3JCKC 1N4QA 4HOUA 4LNBA 2I1KA 3ZYQA 5C2YA 2LAHA 2LYRA 3PZ4A 4E85A 3MEJA 1LMB3 3TELA 4FADA 1LD8A 4ER6A 3ZVVA 3Q49B 2UWJG 4X4IA 3Q73A 4N3BA 2IU7A 2J4BA 4L23A 1WM5A 2ZGDA 3SI5A 4B94A 2I2OA 1QZ2A 4WAFA 4JZYA 4OYSA 4MKTA 1FT2A 3CIAA 4XZ4A 3GZCA 3FWVA 5ANLA 2RKKA 4BWRA 1HH8A 1HS6A 4FC8A 5HI7A 2Y69E 5BT1A 1TNUA 3J5QB 1IQRA 1OUVA 1O1SA 2R2LA 3NOGD 2PUEA 2V8SE 1TN7A 3ZFWA 3OXLA 2VSNA 4N2QA 2J4DA 2XXPA 4L9PA 3NZSA 1ZBPA 3PEVB 3MGBA 3TWRA 3C3OA 4KZCA 5AQAA 3G2VA 5BXOA 4GMJA 2XEHA 4GTQA 4E6HA 5KCMA 4HXIA 2H8RA 2LSVA 2AVPA 1BD8A 5KBAA 4I9EA 2PUGA 1WIZA 4YG4A 1S63A 3TGOA 3W9GA 5G04J 1ZZ7A 3EUVA 3RIBA 1SZ9A 4HQDA 4AEZC 5FTPA 3WXXA 4WVLA 3FHEA 2H6HA 2IOLA 2QYJA 4TXPA 1JWLA 4YDEA 4EBAG 4G2VA 4WWPA 4AVXA 3HXDA 3PZDA 3IHYA 4HLLA 3G2SA 3S8QA 1R69A 1K1AA 4AJWA 2IVBA 4JHKA 1V55E 2AXZA 3ZHMA 4EZJA 2BKGA 3M9LA 4C9BB 3GN5B 4A63B 2GW1A 2JABA 4GTVA 3FH5A 1O4XA 4Z5HA 3ZPXA 3B7HA 3CHQA 3TG4A 2PXTA 3APCA 4PU4C 3KEAA 3MCXA 4JA9A 4BEPA 3AS8A 5JJ6A 3FP3A 2KEKA 1BU9A 1N0QA 2XSDC 3SD5A 1A5EA 2V4HC 2KCVA 3Q9UC 5A23A 3PZ1A 1YA0A 3IHVA 2X38A 2ZXWE 3G7DA 5CCMA 3TWUA 1BI7B 2AWIA 2B6CA 3ZXSA 4J0UA 1G3NB 5KNGA 1UW4B 5DIZA 1XWRA 3TWXA 3UQ3A 3FUDA 4PUCA 4F1PA 3UUXA 4J8YA 2ETBA 3R9MA 4B8AA 3RAUA 2WXIA 4CZ2D 1TNZA 2P58C 4RVBA 3OP9A 2I6HA 4YVOA 3O48A 1RZRD 5CBOA 1WG0A 4AM9A 3CVVA 1KLXA 2IO2C 2XGOA 3UIPC 3FEXA 3D9HA 2PXDA 1HG5A 4JXTA 4MLPA 5EYPF 2FO1E 1KT0A 3AG1E 5G04C 1EYHA 4QQIA 5T3RA 4PS3A 2YHEA 3Q75A 3UWPA 2QYUA 1QP7A 1ZZ8A 4LCTA 2WXFA 3APDA 5DRYA 3CLJA 3TJPA 3S7BA 5HS0A 1OCOE 3P1UA 3D9MA 1U3CA 2HM8A 2VTBB 4O60A 1GW6A 5B3SE 4A3VA 5BXUA 3CK7A 5BPPA 4B8CB 2XXAA 3MV3B 2WVIA 4AP2A 4R7LA 4B89A 4GYYA 1XGWA 3JXCL 4GCNA 4HOSA 4GTTA 1YCSB 2XEVA 1OCTC 1U2ZA 3DSUA 2L0IA 4U04A 2V0PA 3JUIA 2HCNA 1XNFA 4AY6A 2XCBA 1NA3A 1HFAA 1IHBA 4UQYA 2P9NG 4BESA 3ME5A 4G11A 2C2LA 4ANUA 2I1JA 2A4ZA 3Q5MA 2J08A 2IONA 2PUAA 3JYSA 4GZDA 1Y6IA 3FUKA 5EDSA 3HDXA 1O1TA 1QZXA 2KM4A 1ELKA 3GYZA 3LS8A 3QAQA 2PM7A 4C0EA 3FULA 3PEUB 2CHXA 5JHAA 2VJ8A 3EUSA 3BQOA 2F0YA 2H6IA 3ZHEB 4X8QA 3UFDA 3QC1A 4Q96A 3RJVA 2LSUA 4I1OB 5B1AE 2GRPB 3BS3A 3ULYA 3PUJA 2J7WA 5G05C 2LCVA 1RZRA 4C0MA 5ENTD 2ICTA 4Q69A 4LNGA 4N5QA 5KNHD 2DZOA 1QQBA 3GZ2A 3V2XA 3LQXA 4AY5A 1NI1A 3QK0A 5D66A 4KBQA 2PM6A 3LY9A 2IJGX 4BTAA 2VGXA 1H19A 3FYAA 4BTBA 1X5BA 2WPVA 3W9FA 2GRQB 4U0SA 2WMOA 4ACLA 2FULA 4I9CA 4MBGA 4AOFA 3SCGA 1E8ZA 3DBSA 4DE9A 4JL0A 4UI9K 5JJTA 4KVMA 5LCWC 2X6FA 3ONLA 3AU4A 4CDRA 4N2SA 2L6BA 3TWQA 4O8BA 3ULEG 1UG3A 2BUGA 2HCSA 3B7BA 2LXLA 3SFZA 4CYMD 4U0UA 2FEZA 4PH4B 3FU0A 2OCCE 5EYLA 1K8KG 2UY1A 4DUIA 2R5SA 4ANVA 3MKQB 4X4BA 3UM3A 3D9KA 4BERA 3CKCA 1OWLA 4GZ6A 4DX2A 4K03A 2D5VA 3ZN3A 3GZ1A 1QYMA 1K1BA 3KS2A 3ZYMA 3CVYA 2V5FA 2JQEA 3LISA 2GGFA 1N95A 2WXPA 4ANWA 3FUFA 3EHRA 2IO3C 5CBNA 4FBIA 2VQ2A 2OVFA 2XRZA 4BX9A 4GPMA 2IUOA 3SFYA 2NSZA 1JCSA 3DRAA 2R03A 4YG1A 3ZYKA 2YNQA 3T5XA 3PS6A 2WXJA 1Z5SC 4X4GA 2KEJA 1EF1C 3NZUA 2MOWA 4GYOA 4JD2G 4LRZA 2FJRA 4HVBA 1RW2A 3ZYLA 3ZKJA 4OAVB 3NF1A 1OWOA 1IKND 1FT1A 4I6EA 4FLHA 3F6QA 4ACKA 3PE4A 4M7CA 1RZSA 2PQRA 3KZ3A 2XRYA 4GYWA 5K98B 2PUBA 2CFUA 3AG2E 2XQ0A 4HRMB 2E2EA 4BFRA 2YQ8A 4GTMA 4EQZA 3QOUA 3Q4AB 5FZSA 1E8YA 4BETA 3LJNA 5GAHi 1RZ4A 3DPDA 3FTZA 1TN8A 3NZLA 3HXCA 2BF0X 4HORA 4N3CA 3ONKA 3UM2A 5FQ4A 3MV2B 3H5TA 2J8SD 1A17A 3NDBB 3CSFA 2BNNA 3SQVA 4HB5A 4IRUA 4DLQA 2WIUB 3U4TA 3D9OA 1D9SA 3CK8A 1E8WA 5ENOD 2DYRE 3RRNB 1EPUA 3OMTA 3P2BA 1DCQA 5AIJA 3CROL 1DVPA 1SZAA 4DE8A 2HYZA 2IY0C 4X4DA 3IVPA 1OWPA 2HE0A 5DRTA 1QQAA 1WH8A 4RG9A 3FTWA 4XKCA 3QQ6A 3F52A 3ZUVB 1HX8A 3PREA 3KEZA 5AQ7A 3B7RL 3KSQA 2EIKE 4XI0A 2GRMA 2GRRB 5CMYA 2R05A 4UWLA 3TAXA 4I1AA 2JEKA 3V30A 2OOEA 3FUHA 1ZS4A 4I1MA 5EX0A 1MHQA 1O5MA 4UQXA 2FO7A 3D9NA 2EQXA 3ABME 4GMLA 4PS7A 3UINC 2NC9A 3R7QA 3GUUA 1DW9A 2QZAA 5AARA 2GRLA 3OTNA 2ZIRA 3B7UX 1KPSB 4APOA 4KXKB 3NROA 4KMOA 4PU3C 4Z5DA 2XHEA 4I6GA 1ZZBA 1N9AA 4YARA 2KCKA 1Z3YA 3FUIA 4JW1A 3UT7A 5KJMA 5ENNA 2RFMA 4CEMA 3ZNGA 3ZEFA 3IV0A 1NEQA 2B0OE 3I3NA 4F6RD 2NXPA 3LFPA 2VEOA 3FTYA 1UJJA 2WQHA 1H2TC 2XCJA 4FN3A 3JXIA 4I6RA 1U2VG 5EIBE 4ATZD 3E37A 2EIJE 3ESKA 3E34A 3CLCA 2ILRA 2A5UA 2PXFA 2OV8A 2PXKA 4GZ3A 1SQMA 3ASNE 3LCAA 2E0IA 5A7LA 1ZVVA 3FTVA 4XE0A 3R09A 4XEIG 4EZKA 1B89A 4K5CA 2EBYA 2C0LA 3KXAA 3VLDA 5ENPD 2VGYA 4OAUC 1S0PA 3L13A 4GQMA 3CHPA 2P9PG 2UY1B 3AG3E 3UTMA 5E76A 1GT0C 3MKQA 1AWCB 4J8FA 3ZU7B 2WQ7A 3E33A 2P9KG 3N71A 3A9XA 4CT0A 1SW6A 3RZZA 2L0TB 2PQNA 3FUJA 4NQ0A 4TUMA 3NXHA 3ABLE 3SBTB 4RSYA 5AENA 1ELWA 3TRBA 3CEQA 2XPIA 4A55A 4J6IA 1Z3XA 1ZZCA 3X2QE 3AU5A 1HU3A 2CROA 3QF3A 2PL2A 4J8SA 2VSYA 4OVVA 5BW8C 3FTUA 1LLIA 1DC2A 1X57A 1FVFA 3VTXA 4X4CA 1H2VC 3ENEA 3SR4A 3DSTA 4PU8A 3L08A 4DPRA 4FHKA 3D9LA 1IXVA 3CHMA 1UXCA 1RIOA 3OQNA 3T8MA 3DM5A 3A9ZA 4QFVA 2PPXA 2OEWA 1ZPQA 3CECA 2WXOA 2BKKB 4GZ5A 2QY7A 1KZOA 2RD0A 3D3MA 1LQCA 2OVBA 4IA8A 1TN6A 3ASDA 1LCDA 1E3OC 3U9WA 4MS6A 2KZTB 1PC2A 2L6JA 3D9PA 2OR1L 3KJXA 4HOTA 5EILA 2LYLA 3EJNA 3ML8A 2KZ8A 3DPYA 1NA0A 3OKZA 4B0ZA 4UWKA 1SQ8A 3NOCD 3LDZA 5G2NA 2IVGA 4URKA 3ASGA 3QYXA 4FJYA 1FCHA 3Q7AA 3CHRA 3CVPA 4GTSA 1LF8A 3GW4A 3S7DA 1S7EA 2V4LA 3PE3A 2LO6A 4UQZA 4J8DA 5KJLA 3GBFA 4L2YA 3V31A 5EX3A 1JPLA 3D1NI 1UOHA 3A9YA 3G0TA 5JJ7A 1KZPA 5FWQA 3OXFA 2XEEA 1VPWA 4WWNA 1BDHA 3APFA 2LXMA 2LYPA 5ENQD 4FP7A 3BD1A 5JMND 3T9KA 1HE8A 2H6GA 4U8YD 4GAAA 2VSOE 3JQ1A 4GTOA 1L5JA 3B7SA 4JC8A 3AG4E 4CDNA 2FFHA 4GCOA 3U64A 3MA5A 2JVLA 5KWDA 1SA5A 3HVEA 5EN5D 1D8DA 3I5PA 2WM9A 4AIFA 4B93B 3PZ2A 2O49A 1K3ZD 4IN3B 4XI9A 2AJAA 2XS8A 3B7TA 4JCYA 1IYGA 3RRMB 4GPKA 4X4FA 4TV3A 4DJAA 4DX6D 2EIME 1U3DA 1HG2A 1JFTA 4J8EA 4D10C 4BT8A 1PRAA 1CJGA 1ZUGA 2XENA 4UWFA 3ZHIA 2PZIA 3R9AB 1Y9QA 4DK5A 4Y6CA 1NFIE 1N0RA 3CHOA 2R1JL 3FU3A 2LAIA 4YDWA 4Z58A 3ZKCA 4ZHBA 3ULQA 2R17C 4I2WA 3LY7A 4HRLA 4U8HA 1E7VA 3OQOA 2MQKA 2AXVA 4KZ0A 3URZA 3RK6A 4BSXA 4Z5CA 3GZSA 1CQTA 4BSZB 4DX1A 3L22A 1N4RA 1YSEA 4I8TA 5FZRA 3C72A 4UUCA 2Y0BG 4G23A 4I6UA 3PRZA 3VLEA 3UIOC 1MYOA 3CVNA 2XZTG 1QPZA 3CK9A 4EQFA 3EU5A 5FT9A 3B95A 2Q7FA 2M63A 3ASHA 4I43A 1ZAYA 4O6FA 4JQDA 1POUA 3S7FA 4JVSA 1INZA 3R7RA 4CT4A 5DT2A 2P9UG 2PXPA 3AAAC 1QP0A 2AXUA 3JXDL 3PH0C 4MRUA 4Z68A 3TL5A 3MZLB 3VTYA 4UI9C 4HOQA 4I6JA 4YNDA 4TUUA 4LG6A 2FBNA 2IFUA 4G25A 2LYSA 2A6CA 5T8IA 3BEEA 3DNVB 3Q9NC 1RPEL 5AQ9A 4N5CA 1D8EA 1X81A 3SF4A 3HG0D 2HR2A 4J1XA 1DWKA 5KJNA 1ZZ6A 2JCGA 2FI7A 1MFQC 4G26A 4XKBA 4X4HA 4YDOA 3O4ZA 4WNGA 3FEYA 3SCFA 1LCCA 3S2AA 3U3WA 2NYJA 3AJIA 3ZHEA 4NDWA 5BUZA 5LCWJ 3TWTA
chains in the Genus database with same CATH topology
3TG4A 2HSGA 2XI8A 3NQPA 2AUWA 1ZS4A 5C1DA 2WQ6A 3APCA 4PU4C 4I1MA 3MCXA 3FU5A 1MHQA 4L7TA 4JA9A 4RG6A 5EX0A 5JJ6A 3AS8A 4UQXA 3QDNA 2FO7A 3D9NA 2EQXA 3FP3A 4GMLA 4M3OA 2KEKA 2NC9A 4PS7A 3R7QA 3L16A 3PUKA 1Y7YA 1VDYA 5E75A 2XSDC 3SD5A 1DW9A 5LFAA 2HO1A 3BDNA 2KCVA 3MLFA 5A23A 2GRLA 2Y4TA 3OTNA 1YA0A 4Q94A 3IHVA 1EFAA 2IOSA 3RRUA 2X38A 2KATA 3LJ3A 3G7DA 2O4AA 3F6WA 3B7UX 5CCMA 1E8XA 2C0MA 1UXDA 4APOA 2PE5A 1WAO1 3OQMA 2AWIA 4KT6B 4XIFA 4KXKB 3ZXSA 4KMOA 4P29A 4EZLA 4PU3C 3L17A 4J0UA 4Z5DA 2XHEA 1UW4B 4KVOA 3FYMA 1H6KA 3LYAA 4I6GA 1ZZBA 5DIZA 4WWOA 1XWRA 4CCAA 3LXUX 3UQ3A 3FUDA 4PUCA 4CGWA 3D9IA 4YARA 5LOZA 3UUXA 2KCKA 1Z3YA 3D9JA 3FUIA 5CCLA 2VGXB 4JW1A 3UT7A 3FH8A 3QWWA 3QJZA 5KJMA 2BNMA 4B8AA 5ENNA 3RO3A 1JWFA 2WXIA 3FDHA 4CEMA 3ZEFA 2P58C 4RVBA 4TRQA 1HF0A 3TG5A 4JPSA 1HF8A 2J09A 4LUNU 3L54A 3OP9A 2I6HA 3IV0A 4YVOA 5FJYA 1NEQA 3O48A 1RZRD 3I3NA 1UJKA 2NXPA 3LFPA 4GU5A 5D0QD 3FTYA 3CKBA 4NRHB 4AM9A 4DLOA 3IKOB 3CVVA 1KLXA 4CRWA 1UJJA 2IF4A 2WQHA 1H2TC 2XCJA 4UWHA 2XGOA 4FN3A 4JCXA 4I6RA 3FEXA 2X6JA 3UT8A 5FQ8A 4ABNA 1HG5A 4JXTA 4MLPA 2I9CA 3ESKA 2MHKA 4FHJA 3UPVA 3CLCA 4A3TA 5BV1A 1KT0A 2ILRA 2A5UA 5G04C 4EECA 3VK0A 4OVUA 2IVQA 2OV8A 4WNEA 2WB2A 1OWNA 1EYHA 5BV0A 5AJDA 2MEZA 2IU1A 4GZ3A 4PS3A 1SQMA 5FQ7A 3LCAA 5T3RA 2DIWA 1PRUA 2YHEA 2E0IA 1BPOA 5A7LA 5ANRA 3EIQC 1QP7A 1ZVVA 3FTVA 3GN5A 1DNPA 3KAEA 3LKUA 1ZZ8A 4ILIA 3CV0A 4LCTA 4N39A 4XE0A 4EZKA 1B89A 2WXFA 3APDA 3I4GA 2VSXE 2WXNA 2EBYA 3CLJA 2C0LA 1PAQA 3TJPA 3T5VA 4YG7B 3KXAA 3VLDA 1Y8MA 2GZUA 3Q15A 3S7BA 2WXHA 2VGYA 4WUYA 2WXMA 3HZIB 3P1UA 3D9MA 1U3CA 4J1WA 1S0PA 2HM8A 3L13A 2OFYA 4GQMA 3CHPA 5ARFA 2UY1B 1OWMA 5E76A 2XPZA 1GT0C 3QWGA 1X2LA 3HHMA 3IBEA 1GW6A 3MKQA 4J8FA 4XX5A 2CG3A 2WQ7A 2XGMA 4A3VA 4NACA 3FUEA 4U07A 3CK7A 4K0RA 2IQCA 3ESLA 3N71A 4B8CB 5BPPA 3JXBC 4CT0A 4Z59A 3RZZA 1JFSA 2LYQA 2L0TB 2PQNA 3CSTA 3G2UA 3FUJA 2EF8A 2BJCA 3MV3B 4GA2A 4DI3A 2WVIA 1E90A 3G2WA 4NQ0A 4R7LA 5T4YA 4AP2A 4B89A 3CVQA 4GYYA 1XGWA 3JXCL 4GCNA 4A1GA 4FULA 4HOSA 4U0ZA 5A6CA 1FVHA 3FU6A 2XEVA 2XIUA 4I17A 5A7DB 2L8NA 1OCTC 4RSYA 3EHMA 3SBTB 2RG8A 4DI4A 4YBAA 5AENA 2L0IA 1ELWA 4U04A 3TRBA 3CEQA 2XPIA 2V0PA 4GZCA 4A55A 4KYOB 3JUIA 4A1SA 4GHJA 4PS8A 2BTDA 2X6IA 3ZPJA 4J6IA 5ARGA 1Z3XA 1ZZCA 1ADRA 1IHGA 1XNFA 4PDXA 2XCBA 4AY6A 1NA3A 3QWVA 3CHSA 4I2ZA 1HFAA 4F7AA 3FFLA 3F51A 3LY8A 4UQYA 1IC8A 3HIZA 5CMWA 2QFCA 1HU3A 2CROA 3AU5A 4G11A 3QF3A 5M72A 2LYJA 2C2LA 4ANUA 2XPYA 2I1JA 2PL2A 2A4ZA 4J8SA 2DCPA 2WXKA 3Q5MA 2J08A 2R63A 2IONA 2VSYA 1QNFA 2PUAA 4OVVA 3JYSA 4GZDA 1Y6IA 3FTUA 4ME2A 5BW8C 2XCCA 1TJFA 4X4EA 1LLIA 3FUKA 3HDXA 4DPRA 5EDSA 1X57A 4G1TA 1FVFA 3VTXA 2WUSR 4X4CA 1H2VC 3ENEA 3PNTB 3ZW3A 2KM4A 4EBAA 3UX4A 1ELKA 3GYZA 3LS8A 5AJLA 3QAQA 2PM7A 4C0EA 3FULA 1R63A 3IEGA 3PEUB 4PU8A 3CR3A 2CHXA 5JHAA 3L08A 3ZGQA 2VJ8A 3EUSA 1EDUA 4FHKA 3D9LA 5FQ6A 2KCLA 1UXCA 1RIOA 3OQNA 1B0NA 3CHMA 2VTBB 3T8MA 3ZHEB 3CQGB 4ANXA 2CSFA 3CVXA 2PUFA 3ML9A 3UFDA 2PPXA 1HO8A 3QC1A 4Q96A 4QFVA 3RJVA 1ZPQA 3CECA 2WXOA 2L49A 2KC7A 3EDTB 4W9RA 3E4BA 2J07A 3OAWA 4GZ5A 2LSUA 2QY7A 4I1OB 4Y6WA 2RD0A 3BS3A 3D3MA 4AV7A 4Y42A 1LQCA 2OVBA 3MJWA 1JH9A 4MCXA 4IA8A 3FUMA 3PUJA 3ASDA 1HXIA 5G05C 2LCVA 1RZRA 1LCDA 1E3OC 3U9WA 4JHJA 3LVRE 4MS6A 2KZTB 3QKYA 3RU0A 4C0MA 1PC2A 2L6JA 2LYKA 1BDIA 4CDMA 3BG0B 2OR1L 3D9PA 2L9BA 3KJXA 2B5AA 2Y3AA 2ICTA 4HOTA 4Q69A 3KD7A 2LYLA 3EJNA 3ML8A 2KZ8A 1NA0A 2KZTA 2IV1A 3TXMA 4B0ZA 4UWKA 1SQ8A 1PRVA 3MYVA 4PU7A 4IVZA 5LP0A 1PERL 1ZZ9A 1QQBA 1L1MA 3GZ2A 3LDZA 4AY5A 5G2NA 2IVGA 3ASFA 4UI9J 4URKA 3ASGA 3L1PA 3QK0A 2PIJA 3MX3A 5G55A 2VTBA 3QYXA 4IYPA 4IULA 2X3MA 2WXLA 4KBQA 2PM6A 3LY9A 2IJGX 4UWGA 4BTAA 1E7UA 1FCHA 1OSLA 3FUNA 1Z6TA 3CHRA 3CVPA 3SCHA 4FJYA 1LF8A 2ONDA 2VGXA 3GW4A 3S7DA 1H19A 1S7EA 1NERA 3FYAA 2V4LA 3PE3A 3FH7A 1X5BA 2LO6A 2WPVA 4V3IA 4BTBA 4U0SA 2WMOA 4UQZA 4ACLA 4J8DA 5KJLA 3GBFA 2FULA 4L2YA 4I9CA 1TEZA 1ZU2A 5EX3A 1W3BA 1JPLA 2DBAA 4AOFA 3D1NI 1AU7A 2X6HA 3SHFA 3SGHA 5JJ7A 3SCGA 1E8ZA 5FWQA 3OXFA 5FZQA 3DBSA 4GB9A 2BNOA 4JL0A 3CGHA 3SZ7A 4HS2A 1VPWA 2J49A 3QB2A 4I6TA 4UI9K 1BDHA 1IQUA 4WWNA 3APFA 4AXHA 3ZIMA 5JJTA 1MQSA 4KVMA 5LCWC 1WH6A 1JWGA 2X6FA 3AU4A 3ONLA 2LYPA 2CHWA 4CDRA 4JA7A 4FP7A 2CG2A 4N2SA 3BD1A 3AS5A 1HE8A 3CVLA 2O38A 4O8BA 4YVQC 4ATGA 4LERA 3FTSA 1UG3A 2BUGA 1N54A 3R1FA 5DBKA 1P5QA 3PNLB 3MEKA 4GAAA 1H0AA 2VSOE 5AYWD 4L2LA 3SBSA 3JQ1A 4LEUA 1L5JA 3AS4A 1NP7A 3SFZA 3CVUA 4U0UA 3UT4A 2FEZA 3B7SA 3FMYA 2YHCA 4PH4B 5G05J 4FU3A 4ILGA 4HLEA 3FU0A 3HYMB 4JC8A 4BX8A 2WXRA 2UY1A 4CDNA 5HQ8A 2R5SA 4ANVA 3MKQB 5KJKA 4X4BA 3EIJA 4GCOA 3U64A 3MA5A 2JVLA 1PNRA 3CQCB 3D9KA 3HVEA 4JEUA 4MCTA 3I5PA 4L1BA 3SNXA 1KT1A 2WM9A 2HINA 3CKCA 3UMVA 4AIFA 4FA6A 1OWLA 4GZ6A 2O49A 4GA1A 4JHRA 4K03A 2D5VA 3K9IA 2X6KA 4NURA 4IN3B 3BG1B 3HVEB 2PUDA 4XI9A 3ZN3A 4BY6A 3B7TA 1PY1A 3GZ1A 4JCYA 5BNWA 3RRMB 1IYGA 4GPKA 4X4FA 4IWRA 3KS2A 4H7YA 4TV3A 3ZYMA 4DJAA 1U3DA 1E96B 2CHZA 3G2TA 1HG2A 3TXNA 1JFTA 3CVYA 2R59A 1WETA 2Y4UA 4J8EA 2V5FA 2YINA 3LPZA 4D10C 4BT8A 1PRAA 2ICPA 1CJGA 1ZUGA 4UWFA 3JQ0A 3ZHIA 2PZIA 3R9AB 2WXQA 3PVLA 4HFGA 2GGFA 1Y9QA 3LISA 4DK5A 4ANWA 2WXPA 3FUFA 4Y6CA 5D0OD 3CHOA 3PXPA 2WMNA 4OB4A 4FBIA 2VQ2A 5CHEE 2R1JL 2OVFA 3FU3A 3PDNA 2LAIA 2XRZA 2WXGA 3B13A 4Z58A 3JCKC 4HOUA 3ZKCA 3ULQA 4BX9A 2R17C 4I2WA 2IUOA 3LY7A 2I1KA 3ZYQA 4G24A 2NSZA 5C2YA 2LAHA 2LYRA 4YG1A 3ZYKA 2YNQA 4U8HA 1E7VA 4E85A 3T5XA 3OQOA 3PS6A 2WXJA 1LMB3 2MQKA 2AXVA 2LNIA 4KZ0A 3URZA 4FADA 4X4GA 2KEJA 3RK6A 4BSXA 1EF1C 3ZVVA 4Z5CA 3GZSA 1HZ4A 3Q49B 2UWJG 3NZUA 1CQTA 4X4IA 1QQEA 4WNFA 5JHBA 2MOWA 3L22A 4GYOA 4LRZA 4N3BA 2IU7A 3QNKA 2J4BA 1YSEA 2FJRA 1WM5A 4L23A 1UN9A 4WNDA 4HVBA 3ZYLA 4I8TA 5FZRA 3SI5A 3O9XA 4F1SA 3NF1A 4B94A 1OWOA 2I2OA 1QZ2A 4WAFA 4JZYA 4GA0A 2CFZA 4I6EA 4OYSA 4F53A 4FLHA 4MKTA 1ELRA 3CIAA 4ACKA 3I4RB 3PE4A 4XZ4A 1RZSA 3OXGA 3FWVA 5ANLA 2PQRA 4G23A 1UTXA 4APFA 3KZ3A 5J08A 2XRYA 4I6UA 4GYWA 2XGSA 5K98B 3QARA 2PUBA 1HH8A 1HS6A 2CFUA 3LVQE 3PRZA 4FC8A 5HI7A 4BWRA 5BT1A 3VLEA 5J90A 2XQ0A 2E2EA 4BFRA 2YQ8A 4BT9A 4H7XA 3CVNA 1QPZA 1IQRA 1OUVA 3CK9A 3Q4AB 3QOUA 5FZSA 4EQFA 1JUQA 5FT9A 1E8YA 3FTXA 2J9QA 2PUEA 2Q7FA 2M63A 2V8SE 3ASHA 4F3VA 3DPDA 3FTZA 4I43A 1QP4A 3OXLA 2VSNA 3ZFWA 1ZAYA 2BF0X 4O6FA 4JQDA 1POUA 2J4DA 3S7FA 4JVSA 4N2QA 1INZA 4HORA 4N3CA 4CGVA 3R7RA 3NZSA 4CT4A 1ZBPA 3ONKA 3PEVB 3MGBA 2PUCA 2VYIA 4KZCA 3MV2B 5FQ4A 3MKRA 3H5TA 1WY6A 2EWTA 3G2VA 1QP0A 4GMJA 4U63A 2AXUA 4E6HA 1A17A 5KCMA 3CSFA 3JXDL 3PH0C 4MRUA 2BNNA 4HXIA 2XJ3A 2H8RA 2LSVA 3C98A 3MZLB 4ILHB 2AVPA 3TL5A 4IRUA 3VTYA 2MRIA 4UI9C 4HOQA 4I6JA 4DLQA 3U66A 2WIUB 3U4TA 4YNDA 4TUUA 4I9EA 2PUGA 1UN8A 2FBNA 3CVWA 2IFUA 3D9OA 4G25A 1WIZA 3QWPA 3CK8A 2LYSA 2A6CA 4YG4A 1E8WA 3BEEA 5T8IA 3TGOA 3RRNB 3DNVB 1EPUA 3OMTA 4FJZA 5G04J 1ZZ7A 3P2BA 3RIBA 5AIJA 3L6AA 3EHNA 1RPEL 5EKQD 1SZ9A 3S7JA 1N52A 3CROL 4JEHA 3RO2A 4AEZC 5FTPA 4N5CA 3WXXA 3FHEA 1DVPA 1SZAA 4EPZA 2IOLA 2HYZA 3Q47B 4X4DA 1JWLA 3IVPA 1OWPA 3SF4A 4G2VA 3ZRHA 2HR2A 4EBAG 4J1XA 4WWPA 1DWKA 5KJNA 4AVXA 1ZZ6A 1QQAA 1WH8A 4RG9A 3FTWA 4FLBA 4XKCA 3QQ6A 3PZDA 2JCGA 3F52A 2FI7A 3IHYA 3LEWA 3G2SA 3S8QA 3VLFA 1R69A 4AJWA 4G26A 2IVBA 1HX8A 3PREA 4JHKA 4XKBA 2AXZA 4X4HA 4F8DA 3KEZA 3O4ZA 4WNGA 3ZHMA 3FY4A 3RKVA 4EZJA 2FF4A 3B7RL 3FEYA 2JLBA 2ZU6B 3GN5B 2KEIA 4XI0A 4C9BB 3SCFA 1H2UA 2GRMA 4N3AA 5LX8A 1TJCA 1LCCA 2GW1A 3S2AA 5CMYA 3G5GA 4UWLA 3U3WA 3TAXA 4I1AA 2JEKA 2AW6A 1NZNA 2KPJA 3FH5A 3ZHEA 1O4XA 4Z5HA 4NDWA 2OOEA 3B7HA 5BUZA 3FUHA 3CHQA 5LCWJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HSG A;  2XI8 A;  4I8T A;  2AUW A;  3O9X A;  3JXB C;  1ZS4 A;  4Z59 A;  4PU4 C;  3RZZ A;  2LYQ A;  3D1N I;  1JFS A;  1AU7 A;  2EF8 A;  2BJC A;  3SCG A;  2BNO A;  2KEK A;  3JXC L;  1Y7Y A;  1VPW A;  4I6T A;  1BDH A;  2XIU A;  2XSD C;  1DW9 A;  2L8N A;  1RZS A;  1OCT C;  1WH6 A;  4YBA A;  1GT0 C;  3BDN A;  1UTX A;  3MLF A;  3KZ3 A;  2GRL A;  2LYP A;  3TRB A;  4I6U A;  1EFA A;  5K98 B;  2PUB A;  3BD1 A;  3G7D A;  4GHJ A;  3F6W A;  2O4A A;  2O38 A;  1ZZC A;  4O8B A;  1ADR A;  1UXD A;  2PE5 A;  1QPZ A;  3OQM A;  2AWI A;  3R1F A;  3F51 A;  4PU3 C;  1IC8 A;  4Z5D A;  2PUE A;  2CRO A;  3QF3 A;  3FYM A;  2LYJ A;  1ZZB A;  3FMY A;  1XWR A;  1QP4 A;  1ZAY A;  4YAR A;  1POU A;  4JQD A;  2R63 A;  2PUA A;  4X4B A;  4X4E A;  1LLI A;  2BNM A;  1X57 A;  2JVL A;  2PUC A;  1PNR A;  2WUS R;  4MCT A;  4X4C A;  3H5T A;  2HIN A;  2EWT A;  1HF0 A;  1QP0 A;  2AXU A;  3OP9 A;  2O49 A;  2D5V A;  1R63 A;  3JXD L;  4PU8 A;  2BNN A;  2XJ3 A;  1NEQ A;  2H8R A;  1RZR D;  2PUD A;  3EUS A;  1UXC A;  2WIU B;  3LFP A;  1B0N A;  3OQN A;  1RIO A;  2PUG A;  4JCY A;  4X4F A;  4IWR A;  2CSF A;  2PUF A;  1WIZ A;  3UFD A;  2PPX A;  1JFT A;  2LYS A;  2A6C A;  2XCJ A;  1ZPQ A;  3CEC A;  4YG4 A;  1WET A;  2L49 A;  3DNV B;  1PRA A;  4FN3 A;  2ICP A;  3OMT A;  4I6R A;  1CJG A;  1ZZ7 A;  4JCX A;  1ZUG A;  3ZHI A;  3BS3 A;  4Y42 A;  1RPE L;  1LQC A;  1Y9Q A;  3LIS A;  3CRO L;  1JH9 A;  4MCX A;  4IA8 A;  3CLC A;  2LCV A;  3PXP A;  1RZR A;  1LCD A;  1E3O C;  4X4D A;  1JWL A;  3IVP A;  4OB4 A;  3VK0 A;  4FBI A;  2R1J L;  2IVQ A;  4J1X A;  1DWK A;  1ZZ6 A;  2LYK A;  1WH8 A;  2MEZ A;  1BDI A;  4Z58 A;  1QQA A;  2OR1 L;  3QQ6 A;  3ZKC A;  2JCG A;  2B5A A;  1PRU A;  2ICT A;  3F52 A;  3KJX A;  2IUO A;  3S8Q A;  2LYL A;  5A7L A;  1R69 A;  2KZ8 A;  1QP7 A;  1ZVV A;  3GN5 A;  2IV1 A;  1ZZ8 A;  2IVB A;  1SQ8 A;  1PRV A;  4PU7 A;  2AXZ A;  4IVZ A;  4X4H A;  4F8D A;  1ZZ9 A;  2LYR A;  4YG1 A;  1L1M A;  1PER L;  1QQB A;  2EBY A;  3ZHM A;  4YG7 B;  3KXA A;  2GZU A;  3OQO A;  2IVG A;  3GN5 B;  3L1P A;  2MQK A;  2AXV A;  2PIJ A;  2KEI A;  3SCF A;  3QYX A;  1LMB 3;  2GRM A;  4X4G A;  2KEJ A;  3HZI B;  1LCC A;  4J1W A;  2OFY A;  4GQM A;  4Z5C A;  3G5G A;  3U3W A;  1OSL A;  1CQT A;  4X4I A;  3SCH A;  3QWG A;  1X2L A;  2AW6 A;  1S7E A;  1NER A;  2KPJ A;  3FYA A;  1O4X A;  4Z5H A;  2IU7 A;  4NDW A;  1YSE A;  2FJR A;  3B7H A;  3GBF A; 
#chains in the Genus database with same CATH topology
 2GRO B;  3NB2 A;  2HSG A;  2AUW A;  1Q2Z A;  2IEJ A;  2PXU A;  5C1D A;  4L7T A;  4RG6 A;  1TNB A;  3L16 A;  3PUK A;  1LTX A;  1Y7Y A;  5E75 A;  1O1R A;  4RLY A;  1MJ0 A;  5LFA A;  2Y4T A;  2PNN A;  4Q94 A;  1EFA A;  2EIL E;  3LJ3 A;  1AP7 A;  4O1P A;  4EKG A;  2PE5 A;  1WAO 1;  4XIF A;  4KT6 B;  4EZL A;  1MX6 A;  3L17 A;  3GZD A;  3FYM A;  4CGW A;  5LOZ A;  1BLX B;  1OCR E;  2OEV A;  2VGX B;  3QWW A;  3QJZ A;  2L1P A;  1HF0 A;  4TRQ A;  4JPS A;  1HF8 A;  3TG5 A;  1DUL A;  5FJY A;  1WDY A;  1UJK A;  3UI2 A;  4LNU D;  4NRH B;  3DSS A;  4DLO A;  1OXJ A;  5CEC B;  3EHQ A;  2YBD A;  2X6J A;  1NW3 A;  3SO8 A;  1TYQ G;  3UT8 A;  5FQ8 A;  4EZI A;  4RQI A;  2M4H A;  2MHK A;  3UPV A;  4OVU A;  4JB8 P;  2WB2 A;  4K5B A;  5AJD A;  2MEZ A;  2IU1 A;  5FQ7 A;  4HRN A;  2DIW A;  1OY3 D;  4HI8 A;  1BPO A;  3EIQ C;  3LKU A;  3GN5 A;  3VWS A;  1DNP A;  3WG7 E;  4ILI A;  3V79 K;  3CV0 A;  3I4G A;  3JXJ A;  1PAQ A;  4TXQ A;  2P9S G;  2RFA A;  1Y8M A;  2GZU A;  1N11 A;  2WXH A;  3TEP A;  4TXR A;  4J1W A;  5ARF A;  2OFY A;  1QB2 A;  2ZGG A;  2XPZ A;  2DWZ A;  3IBE A;  4XX5 A;  2CG3 A;  4DX5 D;  2XGM A;  3FUE A;  4K0R A;  2PXV A;  3E30 A;  4Z59 A;  2LYQ A;  3CST A;  4GA2 A;  4DI3 A;  2EF8 A;  1E90 A;  5T4Y A;  3CVQ A;  4A1G A;  2XIU A;  5A7D B;  3EHM A;  2RG8 A;  5CRV A;  4GTP A;  4GZC A;  3DXK G;  4GMR A;  2LNM A;  5ITZ F;  4GHJ A;  4PS8 A;  5ARG A;  4NIK A;  1IHG A;  4PDX A;  3FFL A;  1IC8 A;  3HIZ A;  2QFC A;  4HBD A;  4ER5 A;  3Q7F A;  2DCP A;  2WXK A;  2R63 A;  4ER3 A;  2XCC A;  5IY5 E;  4X4E A;  2HFZ A;  2WUS R;  3PNT B;  3ZW3 A;  1TNY A;  4EBA A;  3UX4 A;  3UKR G;  3IXE A;  3IEG A;  1R63 A;  3CR3 A;  3ZGQ A;  2CSF A;  3CVX A;  2PUF A;  1HO8 A;  3C5R A;  2L49 A;  2KC7 A;  3EDT B;  3Q79 A;  4W9R A;  4Y6W A;  4AV7 A;  4Y42 A;  1JH9 A;  4MCX A;  5CRU A;  4JHJ A;  3QKY A;  1OCC E;  1BDI A;  4CDM A;  2L9B A;  2B5A A;  2Y3A A;  2KBX A;  5GAG i;  2PXQ A;  3KD7 A;  2KZT A;  3TXM A;  5CED B;  2R02 A;  1ZZ9 A;  2LLW A;  1N4P A;  1MX4 A;  3NBN B;  2VTB A;  3MX3 A;  4IYP A;  2VGE A;  2X3M A;  1E7U A;  1Z6T A;  3SCH A;  5CEA A;  2OND A;  3FH7 A;  4V3I A;  3TFL A;  4EHM A;  1TEZ A;  3SGH A;  5FZQ A;  5JUW A;  2BNO A;  4I6T A;  1IQU A;  1MQS A;  1WH6 A;  1JWG A;  2CG2 A;  3AS5 A;  3C3Q A;  5DTM A;  4ATG A;  4LER A;  1N54 A;  3R1F A;  5DBK A;  3MEK A;  1H0A A;  3AS4 A;  3UT4 A;  3QOX A;  2YHC A;  3L82 A;  4FU3 A;  4J7W A;  4HNA D;  3UXG A;  1BI8 B;  1JCQ A;  1N4S A;  3EIJ A;  1PNR A;  4L1B A;  3CQC B;  3SNX A;  4MCT A;  3UMV A;  1KT1 A;  4O1O A;  2HIN A;  2F37 A;  4G8L A;  3SX0 A;  4JHR A;  4C48 B;  1FPP A;  2PXL A;  3BG1 B;  3HVE B;  4U7E B;  1PY1 A;  5BNW A;  1E96 B;  2CHZ A;  3G2T A;  5JA4 D;  2R59 A;  1WET A;  2Y4U A;  3LPZ A;  1YYH A;  3JQ0 A;  2WXQ A;  3PVL A;  5D0O D;  3PXP A;  4OB4 A;  5ENS D;  1QBQ A;  3QOW A;  2WXG A;  3B13 A;  1NL4 A;  4G24 A;  3KL4 A;  4K5A B;  2LNI A;  3ISM C;  2V5Q C;  3L9T A;  1DCE A;  1HZ4 A;  1QQE A;  5JHB A;  2P2C P;  1OCZ E;  4WNF A;  3TWS A;  3QNK A;  1UN9 A;  3DSW A;  4WND A;  4F1S A;  3O9X A;  5HRY A;  4GA0 A;  2CFZ A;  1SA4 A;  4F53 A;  1ELR A;  3I4R B;  3OXG A;  1UTX A;  4APF A;  5J08 A;  1MX2 A;  3QAR A;  2XGS A;  3UM1 A;  3LVQ E;  5J90 A;  3PZ3 A;  4BT9 A;  4H7X A;  1S70 B;  2LLV A;  1JUQ A;  5EID A;  3FTX A;  2J9Q A;  2DVW A;  3HRA A;  4DX7 D;  4F3V A;  1QP4 A;  4CGV A;  2DZN A;  5D2M C;  2PUC A;  2VYI A;  3MKR A;  1WY6 A;  2EWT A;  4U63 A;  2XJ3 A;  3GZD C;  4ER7 A;  1H6O A;  2EIN E;  3C98 A;  3DSV A;  3KSL A;  4ILH B;  2F8Y A;  2MRI A;  3U66 A;  1UN8 A;  3CVW A;  3QWP A;  4FJZ A;  3L6A A;  3EHN A;  5EKQ D;  3S7J A;  1N52 A;  4JEH A;  3RO2 A;  1OT8 A;  4EPZ A;  3Q47 B;  4Q2J A;  1H6P A;  3ZRH A;  5DTR A;  4FLB A;  3LEW A;  2XXQ A;  3VLF A;  4ZFH A;  4F8D A;  3FY4 A;  3RKV A;  3ABK E;  2FF4 A;  4YDY A;  2JLB A;  2ZU6 B;  2KEI A;  1H2U A;  5LX8 A;  4N3A A;  1TJC A;  3G5G A;  2AW6 A;  2KPJ A;  1NZN A;  2MYO A;  2QC9 A;  3RSE G;  3DEP A;  4EKI A;  3NQP A;  2XI8 A;  2WQ6 A;  3FU5 A;  3QDN A;  1TR4 A;  4M3O A;  3OWQ A;  3BUA A;  1VDY A;  3SY2 A;  2PXE A;  2HO1 A;  3BDN A;  3MLF A;  2IOS A;  3RRU A;  2KAT A;  3Q78 A;  2O4A A;  3F6W A;  1V54 E;  1E8X A;  5FIN A;  2C0M A;  1UXD A;  5ENR D;  3OQM A;  4P29 A;  4KVO A;  1H6K A;  3LYA A;  4CCA A;  5FIO A;  4WWO A;  3LXU X;  2V3C C;  3D9I A;  3D9J A;  5CCL A;  1S64 A;  3FH8 A;  2BNM A;  3RO3 A;  1JWF A;  3FDH A;  1SVX A;  1YMP A;  3JUE A;  2J09 A;  4LUN U;  3L54 A;  4GU5 A;  5D0Q D;  3CKB A;  4OBM A;  3SFX A;  3IKO B;  4CRW A;  2IF4 A;  4UWH A;  3T8K A;  4JCX A;  4ABN A;  2H6F A;  3DXM G;  2I9C A;  4FHJ A;  4A3T A;  5BV1 A;  4EEC A;  3VK0 A;  2IVQ A;  4WNE A;  1OWN A;  5BV0 A;  1PRU A;  3EU9 A;  2P9I G;  3ZXP A;  5ANR A;  2J7U A;  3KAE A;  4N39 A;  4U95 D;  2VSX E;  2WXN A;  3T5V A;  4YG7 B;  3DSX A;  2A5E A;  1MZC A;  3DEO A;  3Q15 A;  4WUY A;  2DYS E;  2WXM A;  3HZI B;  1OWM A;  3QWG A;  1X2L A;  3HHM A;  3BU8 A;  5DSX A;  4NAC A;  5B1B E;  4U07 A;  2IQC A;  3ESL A;  4ER0 A;  3JXB C;  3HXB A;  2KXP C;  1JFS A;  3G2U A;  2BJC A;  3G2W A;  4FUL A;  4U0Z A;  5A6C A;  1FVH A;  3FU6 A;  4G8K A;  4I17 A;  2L8N A;  5DTQ A;  4DI4 A;  4YBA A;  2MXD A;  4KYO B;  4A1S A;  2BTD A;  2X6I A;  3TWW A;  3ZPJ A;  1ADR A;  3QWV A;  3CHS A;  4I2Z A;  2LUH A;  2ZIS A;  4F7A A;  3F51 A;  3LY8 A;  4U8V D;  2GRN B;  5CMW A;  3HXE A;  5M72 A;  2LYJ A;  2XPY A;  3NAW A;  5AQB A;  2XS1 A;  1QNF A;  4ME2 A;  1TJF A;  3DWL G;  4G1T A;  5AN8 A;  5AJL A;  4U96 D;  1EDU A;  2ODR D;  2KCL A;  2Y1L E;  5FQ6 A;  1B0N A;  2PXB A;  3CQG B;  4ANX A;  3ML9 A;  4HI9 A;  3E4B A;  2J07 A;  3OAW A;  3MJW A;  3FUM A;  1HXI A;  3LVR E;  4GTR A;  3RU0 A;  2LYK A;  3QFI A;  3BG0 B;  5H7P A;  2P9L G;  2IV1 A;  5LP0 A;  3E32 A;  1PRV A;  3MYV A;  4PU7 A;  4IVZ A;  1PER L;  3ASO E;  1L1M A;  3C3R A;  3ASF A;  4UI9 J;  5G55 A;  3L1P A;  2PIJ A;  3UM0 A;  5AAO A;  4IUL A;  2WXL A;  4DRX E;  4UWG A;  3FUN A;  1OSL A;  2F8X K;  4EK9 A;  4LSZ E;  1NER A;  1LD7 A;  2XZD G;  1N94 A;  1ZU2 A;  1W3B A;  1HQ1 A;  2DBA A;  3UKU G;  1AU7 A;  2X6H A;  3SHF A;  4GB9 A;  3CGH A;  3SZ7 A;  4HS2 A;  4AXH A;  2J49 A;  3QB2 A;  3ZIM A;  2CHW A;  4JA7 A;  3CVL A;  2O38 A;  4YVQ C;  3HXF A;  3FTS A;  5CER B;  1P5Q A;  3PNL B;  3SBS A;  5AYW D;  4L2L A;  4LEU A;  1NP7 A;  3CVU A;  3FMY A;  4HRA A;  5G05 J;  4ILG A;  4HLE A;  3HYM B;  4BX8 A;  2WXR A;  5HQ8 A;  5KJK A;  1TNO A;  4JEU A;  3V2O A;  3TWV A;  4FA6 A;  4GA1 A;  3K9I A;  2X6K A;  4NUR A;  2PUD A;  4BY6 A;  4IWR A;  4H7Y A;  2ETA A;  3TXN A;  2YIN A;  2BED A;  2ICP A;  1JCR A;  5HKP A;  4HFG A;  2ETC A;  3J5P A;  3PE5 A;  2WMN A;  5CHE E;  1ZB1 A;  3PDN A;  3JCK C;  1N4Q A;  4HOU A;  4LNB A;  2I1K A;  3ZYQ A;  5C2Y A;  2LAH A;  2LYR A;  3PZ4 A;  4E85 A;  3MEJ A;  1LMB 3;  3TEL A;  4FAD A;  1LD8 A;  4ER6 A;  3ZVV A;  3Q49 B;  2UWJ G;  4X4I A;  3Q73 A;  4N3B A;  2IU7 A;  2J4B A;  4L23 A;  1WM5 A;  2ZGD A;  3SI5 A;  4B94 A;  2I2O A;  1QZ2 A;  4WAF A;  4JZY A;  4OYS A;  4MKT A;  1FT2 A;  3CIA A;  4XZ4 A;  3GZC A;  3FWV A;  5ANL A;  2RKK A;  4BWR A;  1HH8 A;  1HS6 A;  4FC8 A;  5HI7 A;  2Y69 E;  5BT1 A;  1TNU A;  3J5Q B;  1IQR A;  1OUV A;  1O1S A;  2R2L A;  3NOG D;  2PUE A;  2V8S E;  1TN7 A;  3ZFW A;  3OXL A;  2VSN A;  4N2Q A;  2J4D A;  2XXP A;  4L9P A;  3NZS A;  1ZBP A;  3PEV B;  3MGB A;  3TWR A;  3C3O A;  4KZC A;  5AQA A;  3G2V A;  5BXO A;  4GMJ A;  2XEH A;  4GTQ A;  4E6H A;  5KCM A;  4HXI A;  2H8R A;  2LSV A;  2AVP A;  1BD8 A;  5KBA A;  4I9E A;  2PUG A;  1WIZ A;  4YG4 A;  1S63 A;  3TGO A;  3W9G A;  5G04 J;  1ZZ7 A;  3EUV A;  3RIB A;  1SZ9 A;  4HQD A;  4AEZ C;  5FTP A;  3WXX A;  4WVL A;  3FHE A;  2H6H A;  2IOL A;  2QYJ A;  4TXP A;  1JWL A;  4YDE A;  4EBA G;  4G2V A;  4WWP A;  4AVX A;  3HXD A;  3PZD A;  3IHY A;  4HLL A;  3G2S A;  3S8Q A;  1R69 A;  1K1A A;  4AJW A;  2IVB A;  4JHK A;  1V55 E;  2AXZ A;  3ZHM A;  4EZJ A;  2BKG A;  3M9L A;  4C9B B;  3GN5 B;  4A63 B;  2GW1 A;  2JAB A;  4GTV A;  3FH5 A;  1O4X A;  4Z5H A;  3ZPX A;  3B7H A;  3CHQ A;  3TG4 A;  2PXT A;  3APC A;  4PU4 C;  3KEA A;  3MCX A;  4JA9 A;  4BEP A;  3AS8 A;  5JJ6 A;  3FP3 A;  2KEK A;  1BU9 A;  1N0Q A;  2XSD C;  3SD5 A;  1A5E A;  2V4H C;  2KCV A;  3Q9U C;  5A23 A;  3PZ1 A;  1YA0 A;  3IHV A;  2X38 A;  2ZXW E;  3G7D A;  5CCM A;  3TWU A;  1BI7 B;  2AWI A;  2B6C A;  3ZXS A;  4J0U A;  1G3N B;  5KNG A;  1UW4 B;  5DIZ A;  1XWR A;  3TWX A;  3UQ3 A;  3FUD A;  4PUC A;  4F1P A;  3UUX A;  4J8Y A;  2ETB A;  3R9M A;  4B8A A;  3RAU A;  2WXI A;  4CZ2 D;  1TNZ A;  2P58 C;  4RVB A;  3OP9 A;  2I6H A;  4YVO A;  3O48 A;  1RZR D;  5CBO A;  1WG0 A;  4AM9 A;  3CVV A;  1KLX A;  2IO2 C;  2XGO A;  3UIP C;  3FEX A;  3D9H A;  2PXD A;  1HG5 A;  4JXT A;  4MLP A;  5EYP F;  2FO1 E;  1KT0 A;  3AG1 E;  5G04 C;  1EYH A;  4QQI A;  5T3R A;  4PS3 A;  2YHE A;  3Q75 A;  3UWP A;  2QYU A;  1QP7 A;  1ZZ8 A;  4LCT A;  2WXF A;  3APD A;  5DRY A;  3CLJ A;  3TJP A;  3S7B A;  5HS0 A;  1OCO E;  3P1U A;  3D9M A;  1U3C A;  2HM8 A;  2VTB B;  4O60 A;  1GW6 A;  5B3S E;  4A3V A;  5BXU A;  3CK7 A;  5BPP A;  4B8C B;  2XXA A;  3MV3 B;  2WVI A;  4AP2 A;  4R7L A;  4B89 A;  4GYY A;  1XGW A;  3JXC L;  4GCN A;  4HOS A;  4GTT A;  1YCS B;  2XEV A;  1OCT C;  1U2Z A;  3DSU A;  2L0I A;  4U04 A;  2V0P A;  3JUI A;  2HCN A;  1XNF A;  4AY6 A;  2XCB A;  1NA3 A;  1HFA A;  1IHB A;  4UQY A;  2P9N G;  4BES A;  3ME5 A;  4G11 A;  2C2L A;  4ANU A;  2I1J A;  2A4Z A;  3Q5M A;  2J08 A;  2ION A;  2PUA A;  3JYS A;  4GZD A;  1Y6I A;  3FUK A;  5EDS A;  3HDX A;  1O1T A;  1QZX A;  2KM4 A;  1ELK A;  3GYZ A;  3LS8 A;  3QAQ A;  2PM7 A;  4C0E A;  3FUL A;  3PEU B;  2CHX A;  5JHA A;  2VJ8 A;  3EUS A;  3BQO A;  2F0Y A;  2H6I A;  3ZHE B;  4X8Q A;  3UFD A;  3QC1 A;  4Q96 A;  3RJV A;  2LSU A;  4I1O B;  5B1A E;  2GRP B;  3BS3 A;  3ULY A;  3PUJ A;  2J7W A;  5G05 C;  2LCV A;  1RZR A;  4C0M A;  5ENT D;  2ICT A;  4Q69 A;  4LNG A;  4N5Q A;  5KNH D;  2DZO A;  1QQB A;  3GZ2 A;  3V2X A;  3LQX A;  4AY5 A;  1NI1 A;  3QK0 A;  5D66 A;  4KBQ A;  2PM6 A;  3LY9 A;  2IJG X;  4BTA A;  2VGX A;  1H19 A;  3FYA A;  4BTB A;  1X5B A;  2WPV A;  3W9F A;  2GRQ B;  4U0S A;  2WMO A;  4ACL A;  2FUL A;  4I9C A;  4MBG A;  4AOF A;  3SCG A;  1E8Z A;  3DBS A;  4DE9 A;  4JL0 A;  4UI9 K;  5JJT A;  4KVM A;  5LCW C;  2X6F A;  3ONL A;  3AU4 A;  4CDR A;  4N2S A;  2L6B A;  3TWQ A;  4O8B A;  3ULE G;  1UG3 A;  2BUG A;  2HCS A;  3B7B A;  2LXL A;  3SFZ A;  4CYM D;  4U0U A;  2FEZ A;  4PH4 B;  3FU0 A;  2OCC E;  5EYL A;  1K8K G;  2UY1 A;  4DUI A;  2R5S A;  4ANV A;  3MKQ B;  4X4B A;  3UM3 A;  3D9K A;  4BER A;  3CKC A;  1OWL A;  4GZ6 A;  4DX2 A;  4K03 A;  2D5V A;  3ZN3 A;  3GZ1 A;  1QYM A;  1K1B A;  3KS2 A;  3ZYM A;  3CVY A;  2V5F A;  2JQE A;  3LIS A;  2GGF A;  1N95 A;  2WXP A;  4ANW A;  3FUF A;  3EHR A;  2IO3 C;  5CBN A;  4FBI A;  2VQ2 A;  2OVF A;  2XRZ A;  4BX9 A;  4GPM A;  2IUO A;  3SFY A;  2NSZ A;  1JCS A;  3DRA A;  2R03 A;  4YG1 A;  3ZYK A;  2YNQ A;  3T5X A;  3PS6 A;  2WXJ A;  1Z5S C;  4X4G A;  2KEJ A;  1EF1 C;  3NZU A;  2MOW A;  4GYO A;  4JD2 G;  4LRZ A;  2FJR A;  4HVB A;  1RW2 A;  3ZYL A;  3ZKJ A;  4OAV B;  3NF1 A;  1OWO A;  1IKN D;  1FT1 A;  4I6E A;  4FLH A;  3F6Q A;  4ACK A;  3PE4 A;  4M7C A;  1RZS A;  2PQR A;  3KZ3 A;  2XRY A;  4GYW A;  5K98 B;  2PUB A;  2CFU A;  3AG2 E;  2XQ0 A;  4HRM B;  2E2E A;  4BFR A;  2YQ8 A;  4GTM A;  4EQZ A;  3QOU A;  3Q4A B;  5FZS A;  1E8Y A;  4BET A;  3LJN A;  5GAH i;  1RZ4 A;  3DPD A;  3FTZ A;  1TN8 A;  3NZL A;  3HXC A;  2BF0 X;  4HOR A;  4N3C A;  3ONK A;  3UM2 A;  5FQ4 A;  3MV2 B;  3H5T A;  2J8S D;  1A17 A;  3NDB B;  3CSF A;  2BNN A;  3SQV A;  4HB5 A;  4IRU A;  4DLQ A;  2WIU B;  3U4T A;  3D9O A;  1D9S A;  3CK8 A;  1E8W A;  5ENO D;  2DYR E;  3RRN B;  1EPU A;  3OMT A;  3P2B A;  1DCQ A;  5AIJ A;  3CRO L;  1DVP A;  1SZA A;  4DE8 A;  2HYZ A;  2IY0 C;  4X4D A;  3IVP A;  1OWP A;  2HE0 A;  5DRT A;  1QQA A;  1WH8 A;  4RG9 A;  3FTW A;  4XKC A;  3QQ6 A;  3F52 A;  3ZUV B;  1HX8 A;  3PRE A;  3KEZ A;  5AQ7 A;  3B7R L;  3KSQ A;  2EIK E;  4XI0 A;  2GRM A;  2GRR B;  5CMY A;  2R05 A;  4UWL A;  3TAX A;  4I1A A;  2JEK A;  3V30 A;  2OOE A;  3FUH A;  1ZS4 A;  4I1M A;  5EX0 A;  1MHQ A;  1O5M A;  4UQX A;  2FO7 A;  3D9N A;  2EQX A;  3ABM E;  4GML A;  4PS7 A;  3UIN C;  2NC9 A;  3R7Q A;  3GUU A;  1DW9 A;  2QZA A;  5AAR A;  2GRL A;  3OTN A;  2ZIR A;  3B7U X;  1KPS B;  4APO A;  4KXK B;  3NRO A;  4KMO A;  4PU3 C;  4Z5D A;  2XHE A;  4I6G A;  1ZZB A;  1N9A A;  4YAR A;  2KCK A;  1Z3Y A;  3FUI A;  4JW1 A;  3UT7 A;  5KJM A;  5ENN A;  2RFM A;  4CEM A;  3ZNG A;  3ZEF A;  3IV0 A;  1NEQ A;  2B0O E;  3I3N A;  4F6R D;  2NXP A;  3LFP A;  2VEO A;  3FTY A;  1UJJ A;  2WQH A;  1H2T C;  2XCJ A;  4FN3 A;  3JXI A;  4I6R A;  1U2V G;  5EIB E;  4ATZ D;  3E37 A;  2EIJ E;  3ESK A;  3E34 A;  3CLC A;  2ILR A;  2A5U A;  2PXF A;  2OV8 A;  2PXK A;  4GZ3 A;  1SQM A;  3ASN E;  3LCA A;  2E0I A;  5A7L A;  1ZVV A;  3FTV A;  4XE0 A;  3R09 A;  4XEI G;  4EZK A;  1B89 A;  4K5C A;  2EBY A;  2C0L A;  3KXA A;  3VLD A;  5ENP D;  2VGY A;  4OAU C;  1S0P A;  3L13 A;  4GQM A;  3CHP A;  2P9P G;  2UY1 B;  3AG3 E;  3UTM A;  5E76 A;  1GT0 C;  3MKQ A;  1AWC B;  4J8F A;  3ZU7 B;  2WQ7 A;  3E33 A;  2P9K G;  3N71 A;  3A9X A;  4CT0 A;  1SW6 A;  3RZZ A;  2L0T B;  2PQN A;  3FUJ A;  4NQ0 A;  4TUM A;  3NXH A;  3ABL E;  3SBT B;  4RSY A;  5AEN A;  1ELW A;  3TRB A;  3CEQ A;  2XPI A;  4A55 A;  4J6I A;  1Z3X A;  1ZZC A;  3X2Q E;  3AU5 A;  1HU3 A;  2CRO A;  3QF3 A;  2PL2 A;  4J8S A;  2VSY A;  4OVV A;  5BW8 C;  3FTU A;  1LLI A;  1DC2 A;  1X57 A;  1FVF A;  3VTX A;  4X4C A;  1H2V C;  3ENE A;  3SR4 A;  3DST A;  4PU8 A;  3L08 A;  4DPR A;  4FHK A;  3D9L A;  1IXV A;  3CHM A;  1UXC A;  1RIO A;  3OQN A;  3T8M A;  3DM5 A;  3A9Z A;  4QFV A;  2PPX A;  2OEW A;  1ZPQ A;  3CEC A;  2WXO A;  2BKK B;  4GZ5 A;  2QY7 A;  1KZO A;  2RD0 A;  3D3M A;  1LQC A;  2OVB A;  4IA8 A;  1TN6 A;  3ASD A;  1LCD A;  1E3O C;  3U9W A;  4MS6 A;  2KZT B;  1PC2 A;  2L6J A;  3D9P A;  2OR1 L;  3KJX A;  4HOT A;  5EIL A;  2LYL A;  3EJN A;  3ML8 A;  2KZ8 A;  3DPY A;  1NA0 A;  3OKZ A;  4B0Z A;  4UWK A;  1SQ8 A;  3NOC D;  3LDZ A;  5G2N A;  2IVG A;  4URK A;  3ASG A;  3QYX A;  4FJY A;  1FCH A;  3Q7A A;  3CHR A;  3CVP A;  4GTS A;  1LF8 A;  3GW4 A;  3S7D A;  1S7E A;  2V4L A;  3PE3 A;  2LO6 A;  4UQZ A;  4J8D A;  5KJL A;  3GBF A;  4L2Y A;  3V31 A;  5EX3 A;  1JPL A;  3D1N I;  1UOH A;  3A9Y A;  3G0T A;  5JJ7 A;  1KZP A;  5FWQ A;  3OXF A;  2XEE A;  1VPW A;  4WWN A;  1BDH A;  3APF A;  2LXM A;  2LYP A;  5ENQ D;  4FP7 A;  3BD1 A;  5JMN D;  3T9K A;  1HE8 A;  2H6G A;  4U8Y D;  4GAA A;  2VSO E;  3JQ1 A;  4GTO A;  1L5J A;  3B7S A;  4JC8 A;  3AG4 E;  4CDN A;  2FFH A;  4GCO A;  3U64 A;  3MA5 A;  2JVL A;  5KWD A;  1SA5 A;  3HVE A;  5EN5 D;  1D8D A;  3I5P A;  2WM9 A;  4AIF A;  4B93 B;  3PZ2 A;  2O49 A;  1K3Z D;  4IN3 B;  4XI9 A;  2AJA A;  2XS8 A;  3B7T A;  4JCY A;  1IYG A;  3RRM B;  4GPK A;  4X4F A;  4TV3 A;  4DJA A;  4DX6 D;  2EIM E;  1U3D A;  1HG2 A;  1JFT A;  4J8E A;  4D10 C;  4BT8 A;  1PRA A;  1CJG A;  1ZUG A;  2XEN A;  4UWF A;  3ZHI A;  2PZI A;  3R9A B;  1Y9Q A;  4DK5 A;  4Y6C A;  1NFI E;  1N0R A;  3CHO A;  2R1J L;  3FU3 A;  2LAI A;  4YDW A;  4Z58 A;  3ZKC A;  4ZHB A;  3ULQ A;  2R17 C;  4I2W A;  3LY7 A;  4HRL A;  4U8H A;  1E7V A;  3OQO A;  2MQK A;  2AXV A;  4KZ0 A;  3URZ A;  3RK6 A;  4BSX A;  4Z5C A;  3GZS A;  1CQT A;  4BSZ B;  4DX1 A;  3L22 A;  1N4R A;  1YSE A;  4I8T A;  5FZR A;  3C72 A;  4UUC A;  2Y0B G;  4G23 A;  4I6U A;  3PRZ A;  3VLE A;  3UIO C;  1MYO A;  3CVN A;  2XZT G;  1QPZ A;  3CK9 A;  4EQF A;  3EU5 A;  5FT9 A;  3B95 A;  2Q7F A;  2M63 A;  3ASH A;  4I43 A;  1ZAY A;  4O6F A;  4JQD A;  1POU A;  3S7F A;  4JVS A;  1INZ A;  3R7R A;  4CT4 A;  5DT2 A;  2P9U G;  2PXP A;  3AAA C;  1QP0 A;  2AXU A;  3JXD L;  3PH0 C;  4MRU A;  4Z68 A;  3TL5 A;  3MZL B;  3VTY A;  4UI9 C;  4HOQ A;  4I6J A;  4YND A;  4TUU A;  4LG6 A;  2FBN A;  2IFU A;  4G25 A;  2LYS A;  2A6C A;  5T8I A;  3BEE A;  3DNV B;  3Q9N C;  1RPE L;  5AQ9 A;  4N5C A;  1D8E A;  1X81 A;  3SF4 A;  3HG0 D;  2HR2 A;  4J1X A;  1DWK A;  5KJN A;  1ZZ6 A;  2JCG A;  2FI7 A;  1MFQ C;  4G26 A;  4XKB A;  4X4H A;  4YDO A;  3O4Z A;  4WNG A;  3FEY A;  3SCF A;  1LCC A;  3S2A A;  3U3W A;  2NYJ A;  3AJI A;  3ZHE A;  4NDW A;  5BUZ A;  5LCW J;  3TWT A; 
#chains in the Genus database with same CATH homology
 3TG4 A;  2HSG A;  2XI8 A;  3NQP A;  2AUW A;  1ZS4 A;  5C1D A;  2WQ6 A;  3APC A;  4PU4 C;  4I1M A;  3MCX A;  3FU5 A;  1MHQ A;  4L7T A;  4JA9 A;  4RG6 A;  5EX0 A;  5JJ6 A;  3AS8 A;  4UQX A;  3QDN A;  2FO7 A;  3D9N A;  2EQX A;  3FP3 A;  4GML A;  4M3O A;  2KEK A;  2NC9 A;  4PS7 A;  3R7Q A;  3L16 A;  3PUK A;  1Y7Y A;  1VDY A;  5E75 A;  2XSD C;  3SD5 A;  1DW9 A;  5LFA A;  2HO1 A;  3BDN A;  2KCV A;  3MLF A;  5A23 A;  2GRL A;  2Y4T A;  3OTN A;  1YA0 A;  4Q94 A;  3IHV A;  1EFA A;  2IOS A;  3RRU A;  2X38 A;  2KAT A;  3LJ3 A;  3G7D A;  2O4A A;  3F6W A;  3B7U X;  5CCM A;  1E8X A;  2C0M A;  1UXD A;  4APO A;  2PE5 A;  1WAO 1;  3OQM A;  2AWI A;  4KT6 B;  4XIF A;  4KXK B;  3ZXS A;  4KMO A;  4P29 A;  4EZL A;  4PU3 C;  3L17 A;  4J0U A;  4Z5D A;  2XHE A;  1UW4 B;  4KVO A;  3FYM A;  1H6K A;  3LYA A;  4I6G A;  1ZZB A;  5DIZ A;  4WWO A;  1XWR A;  4CCA A;  3LXU X;  3UQ3 A;  3FUD A;  4PUC A;  4CGW A;  3D9I A;  4YAR A;  5LOZ A;  3UUX A;  2KCK A;  1Z3Y A;  3D9J A;  3FUI A;  5CCL A;  2VGX B;  4JW1 A;  3UT7 A;  3FH8 A;  3QWW A;  3QJZ A;  5KJM A;  2BNM A;  4B8A A;  5ENN A;  3RO3 A;  1JWF A;  2WXI A;  3FDH A;  4CEM A;  3ZEF A;  2P58 C;  4RVB A;  4TRQ A;  1HF0 A;  3TG5 A;  4JPS A;  1HF8 A;  2J09 A;  4LUN U;  3L54 A;  3OP9 A;  2I6H A;  3IV0 A;  4YVO A;  5FJY A;  1NEQ A;  3O48 A;  1RZR D;  3I3N A;  1UJK A;  2NXP A;  3LFP A;  4GU5 A;  5D0Q D;  3FTY A;  3CKB A;  4NRH B;  4AM9 A;  4DLO A;  3IKO B;  3CVV A;  1KLX A;  4CRW A;  1UJJ A;  2IF4 A;  2WQH A;  1H2T C;  2XCJ A;  4UWH A;  2XGO A;  4FN3 A;  4JCX A;  4I6R A;  3FEX A;  2X6J A;  3UT8 A;  5FQ8 A;  4ABN A;  1HG5 A;  4JXT A;  4MLP A;  2I9C A;  3ESK A;  2MHK A;  4FHJ A;  3UPV A;  3CLC A;  4A3T A;  5BV1 A;  1KT0 A;  2ILR A;  2A5U A;  5G04 C;  4EEC A;  3VK0 A;  4OVU A;  2IVQ A;  2OV8 A;  4WNE A;  2WB2 A;  1OWN A;  1EYH A;  5BV0 A;  5AJD A;  2MEZ A;  2IU1 A;  4GZ3 A;  4PS3 A;  1SQM A;  5FQ7 A;  3LCA A;  5T3R A;  2DIW A;  1PRU A;  2YHE A;  2E0I A;  1BPO A;  5A7L A;  5ANR A;  3EIQ C;  1QP7 A;  1ZVV A;  3FTV A;  3GN5 A;  1DNP A;  3KAE A;  3LKU A;  1ZZ8 A;  4ILI A;  3CV0 A;  4LCT A;  4N39 A;  4XE0 A;  4EZK A;  1B89 A;  2WXF A;  3APD A;  3I4G A;  2VSX E;  2WXN A;  2EBY A;  3CLJ A;  2C0L A;  1PAQ A;  3TJP A;  3T5V A;  4YG7 B;  3KXA A;  3VLD A;  1Y8M A;  2GZU A;  3Q15 A;  3S7B A;  2WXH A;  2VGY A;  4WUY A;  2WXM A;  3HZI B;  3P1U A;  3D9M A;  1U3C A;  4J1W A;  1S0P A;  2HM8 A;  3L13 A;  2OFY A;  4GQM A;  3CHP A;  5ARF A;  2UY1 B;  1OWM A;  5E76 A;  2XPZ A;  1GT0 C;  3QWG A;  1X2L A;  3HHM A;  3IBE A;  1GW6 A;  3MKQ A;  4J8F A;  4XX5 A;  2CG3 A;  2WQ7 A;  2XGM A;  4A3V A;  4NAC A;  3FUE A;  4U07 A;  3CK7 A;  4K0R A;  2IQC A;  3ESL A;  3N71 A;  4B8C B;  5BPP A;  3JXB C;  4CT0 A;  4Z59 A;  3RZZ A;  1JFS A;  2LYQ A;  2L0T B;  2PQN A;  3CST A;  3G2U A;  3FUJ A;  2EF8 A;  2BJC A;  3MV3 B;  4GA2 A;  4DI3 A;  2WVI A;  1E90 A;  3G2W A;  4NQ0 A;  4R7L A;  5T4Y A;  4AP2 A;  4B89 A;  3CVQ A;  4GYY A;  1XGW A;  3JXC L;  4GCN A;  4A1G A;  4FUL A;  4HOS A;  4U0Z A;  5A6C A;  1FVH A;  3FU6 A;  2XEV A;  2XIU A;  4I17 A;  5A7D B;  2L8N A;  1OCT C;  4RSY A;  3EHM A;  3SBT B;  2RG8 A;  4DI4 A;  4YBA A;  5AEN A;  2L0I A;  1ELW A;  4U04 A;  3TRB A;  3CEQ A;  2XPI A;  2V0P A;  4GZC A;  4A55 A;  4KYO B;  3JUI A;  4A1S A;  4GHJ A;  4PS8 A;  2BTD A;  2X6I A;  3ZPJ A;  4J6I A;  5ARG A;  1Z3X A;  1ZZC A;  1ADR A;  1IHG A;  1XNF A;  4PDX A;  2XCB A;  4AY6 A;  1NA3 A;  3QWV A;  3CHS A;  4I2Z A;  1HFA A;  4F7A A;  3FFL A;  3F51 A;  3LY8 A;  4UQY A;  1IC8 A;  3HIZ A;  5CMW A;  2QFC A;  1HU3 A;  2CRO A;  3AU5 A;  4G11 A;  3QF3 A;  5M72 A;  2LYJ A;  2C2L A;  4ANU A;  2XPY A;  2I1J A;  2PL2 A;  2A4Z A;  4J8S A;  2DCP A;  2WXK A;  3Q5M A;  2J08 A;  2R63 A;  2ION A;  2VSY A;  1QNF A;  2PUA A;  4OVV A;  3JYS A;  4GZD A;  1Y6I A;  3FTU A;  4ME2 A;  5BW8 C;  2XCC A;  1TJF A;  4X4E A;  1LLI A;  3FUK A;  3HDX A;  4DPR A;  5EDS A;  1X57 A;  4G1T A;  1FVF A;  3VTX A;  2WUS R;  4X4C A;  1H2V C;  3ENE A;  3PNT B;  3ZW3 A;  2KM4 A;  4EBA A;  3UX4 A;  1ELK A;  3GYZ A;  3LS8 A;  5AJL A;  3QAQ A;  2PM7 A;  4C0E A;  3FUL A;  1R63 A;  3IEG A;  3PEU B;  4PU8 A;  3CR3 A;  2CHX A;  5JHA A;  3L08 A;  3ZGQ A;  2VJ8 A;  3EUS A;  1EDU A;  4FHK A;  3D9L A;  5FQ6 A;  2KCL A;  1UXC A;  1RIO A;  3OQN A;  1B0N A;  3CHM A;  2VTB B;  3T8M A;  3ZHE B;  3CQG B;  4ANX A;  2CSF A;  3CVX A;  2PUF A;  3ML9 A;  3UFD A;  2PPX A;  1HO8 A;  3QC1 A;  4Q96 A;  4QFV A;  3RJV A;  1ZPQ A;  3CEC A;  2WXO A;  2L49 A;  2KC7 A;  3EDT B;  4W9R A;  3E4B A;  2J07 A;  3OAW A;  4GZ5 A;  2LSU A;  2QY7 A;  4I1O B;  4Y6W A;  2RD0 A;  3BS3 A;  3D3M A;  4AV7 A;  4Y42 A;  1LQC A;  2OVB A;  3MJW A;  1JH9 A;  4MCX A;  4IA8 A;  3FUM A;  3PUJ A;  3ASD A;  1HXI A;  5G05 C;  2LCV A;  1RZR A;  1LCD A;  1E3O C;  3U9W A;  4JHJ A;  3LVR E;  4MS6 A;  2KZT B;  3QKY A;  3RU0 A;  4C0M A;  1PC2 A;  2L6J A;  2LYK A;  1BDI A;  4CDM A;  3BG0 B;  2OR1 L;  3D9P A;  2L9B A;  3KJX A;  2B5A A;  2Y3A A;  2ICT A;  4HOT A;  4Q69 A;  3KD7 A;  2LYL A;  3EJN A;  3ML8 A;  2KZ8 A;  1NA0 A;  2KZT A;  2IV1 A;  3TXM A;  4B0Z A;  4UWK A;  1SQ8 A;  1PRV A;  3MYV A;  4PU7 A;  4IVZ A;  5LP0 A;  1PER L;  1ZZ9 A;  1QQB A;  1L1M A;  3GZ2 A;  3LDZ A;  4AY5 A;  5G2N A;  2IVG A;  3ASF A;  4UI9 J;  4URK A;  3ASG A;  3L1P A;  3QK0 A;  2PIJ A;  3MX3 A;  5G55 A;  2VTB A;  3QYX A;  4IYP A;  4IUL A;  2X3M A;  2WXL A;  4KBQ A;  2PM6 A;  3LY9 A;  2IJG X;  4UWG A;  4BTA A;  1E7U A;  1FCH A;  1OSL A;  3FUN A;  1Z6T A;  3CHR A;  3CVP A;  3SCH A;  4FJY A;  1LF8 A;  2OND A;  2VGX A;  3GW4 A;  3S7D A;  1H19 A;  1S7E A;  1NER A;  3FYA A;  2V4L A;  3PE3 A;  3FH7 A;  1X5B A;  2LO6 A;  2WPV A;  4V3I A;  4BTB A;  4U0S A;  2WMO A;  4UQZ A;  4ACL A;  4J8D A;  5KJL A;  3GBF A;  2FUL A;  4L2Y A;  4I9C A;  1TEZ A;  1ZU2 A;  5EX3 A;  1W3B A;  1JPL A;  2DBA A;  4AOF A;  3D1N I;  1AU7 A;  2X6H A;  3SHF A;  3SGH A;  5JJ7 A;  3SCG A;  1E8Z A;  5FWQ A;  3OXF A;  5FZQ A;  3DBS A;  4GB9 A;  2BNO A;  4JL0 A;  3CGH A;  3SZ7 A;  4HS2 A;  1VPW A;  2J49 A;  3QB2 A;  4I6T A;  4UI9 K;  1BDH A;  1IQU A;  4WWN A;  3APF A;  4AXH A;  3ZIM A;  5JJT A;  1MQS A;  4KVM A;  5LCW C;  1WH6 A;  1JWG A;  2X6F A;  3AU4 A;  3ONL A;  2LYP A;  2CHW A;  4CDR A;  4JA7 A;  4FP7 A;  2CG2 A;  4N2S A;  3BD1 A;  3AS5 A;  1HE8 A;  3CVL A;  2O38 A;  4O8B A;  4YVQ C;  4ATG A;  4LER A;  3FTS A;  1UG3 A;  2BUG A;  1N54 A;  3R1F A;  5DBK A;  1P5Q A;  3PNL B;  3MEK A;  4GAA A;  1H0A A;  2VSO E;  5AYW D;  4L2L A;  3SBS A;  3JQ1 A;  4LEU A;  1L5J A;  3AS4 A;  1NP7 A;  3SFZ A;  3CVU A;  4U0U A;  3UT4 A;  2FEZ A;  3B7S A;  3FMY A;  2YHC A;  4PH4 B;  5G05 J;  4FU3 A;  4ILG A;  4HLE A;  3FU0 A;  3HYM B;  4JC8 A;  4BX8 A;  2WXR A;  2UY1 A;  4CDN A;  5HQ8 A;  2R5S A;  4ANV A;  3MKQ B;  5KJK A;  4X4B A;  3EIJ A;  4GCO A;  3U64 A;  3MA5 A;  2JVL A;  1PNR A;  3CQC B;  3D9K A;  3HVE A;  4JEU A;  4MCT A;  3I5P A;  4L1B A;  3SNX A;  1KT1 A;  2WM9 A;  2HIN A;  3CKC A;  3UMV A;  4AIF A;  4FA6 A;  1OWL A;  4GZ6 A;  2O49 A;  4GA1 A;  4JHR A;  4K03 A;  2D5V A;  3K9I A;  2X6K A;  4NUR A;  4IN3 B;  3BG1 B;  3HVE B;  2PUD A;  4XI9 A;  3ZN3 A;  4BY6 A;  3B7T A;  1PY1 A;  3GZ1 A;  4JCY A;  5BNW A;  3RRM B;  1IYG A;  4GPK A;  4X4F A;  4IWR A;  3KS2 A;  4H7Y A;  4TV3 A;  3ZYM A;  4DJA A;  1U3D A;  1E96 B;  2CHZ A;  3G2T A;  1HG2 A;  3TXN A;  1JFT A;  3CVY A;  2R59 A;  1WET A;  2Y4U A;  4J8E A;  2V5F A;  2YIN A;  3LPZ A;  4D10 C;  4BT8 A;  1PRA A;  2ICP A;  1CJG A;  1ZUG A;  4UWF A;  3JQ0 A;  3ZHI A;  2PZI A;  3R9A B;  2WXQ A;  3PVL A;  4HFG A;  2GGF A;  1Y9Q A;  3LIS A;  4DK5 A;  4ANW A;  2WXP A;  3FUF A;  4Y6C A;  5D0O D;  3CHO A;  3PXP A;  2WMN A;  4OB4 A;  4FBI A;  2VQ2 A;  5CHE E;  2R1J L;  2OVF A;  3FU3 A;  3PDN A;  2LAI A;  2XRZ A;  2WXG A;  3B13 A;  4Z58 A;  3JCK C;  4HOU A;  3ZKC A;  3ULQ A;  4BX9 A;  2R17 C;  4I2W A;  2IUO A;  3LY7 A;  2I1K A;  3ZYQ A;  4G24 A;  2NSZ A;  5C2Y A;  2LAH A;  2LYR A;  4YG1 A;  3ZYK A;  2YNQ A;  4U8H A;  1E7V A;  4E85 A;  3T5X A;  3OQO A;  3PS6 A;  2WXJ A;  1LMB 3;  2MQK A;  2AXV A;  2LNI A;  4KZ0 A;  3URZ A;  4FAD A;  4X4G A;  2KEJ A;  3RK6 A;  4BSX A;  1EF1 C;  3ZVV A;  4Z5C A;  3GZS A;  1HZ4 A;  3Q49 B;  2UWJ G;  3NZU A;  1CQT A;  4X4I A;  1QQE A;  4WNF A;  5JHB A;  2MOW A;  3L22 A;  4GYO A;  4LRZ A;  4N3B A;  2IU7 A;  3QNK A;  2J4B A;  1YSE A;  2FJR A;  1WM5 A;  4L23 A;  1UN9 A;  4WND A;  4HVB A;  3ZYL A;  4I8T A;  5FZR A;  3SI5 A;  3O9X A;  4F1S A;  3NF1 A;  4B94 A;  1OWO A;  2I2O A;  1QZ2 A;  4WAF A;  4JZY A;  4GA0 A;  2CFZ A;  4I6E A;  4OYS A;  4F53 A;  4FLH A;  4MKT A;  1ELR A;  3CIA A;  4ACK A;  3I4R B;  3PE4 A;  4XZ4 A;  1RZS A;  3OXG A;  3FWV A;  5ANL A;  2PQR A;  4G23 A;  1UTX A;  4APF A;  3KZ3 A;  5J08 A;  2XRY A;  4I6U A;  4GYW A;  2XGS A;  5K98 B;  3QAR A;  2PUB A;  1HH8 A;  1HS6 A;  2CFU A;  3LVQ E;  3PRZ A;  4FC8 A;  5HI7 A;  4BWR A;  5BT1 A;  3VLE A;  5J90 A;  2XQ0 A;  2E2E A;  4BFR A;  2YQ8 A;  4BT9 A;  4H7X A;  3CVN A;  1QPZ A;  1IQR A;  1OUV A;  3CK9 A;  3Q4A B;  3QOU A;  5FZS A;  4EQF A;  1JUQ A;  5FT9 A;  1E8Y A;  3FTX A;  2J9Q A;  2PUE A;  2Q7F A;  2M63 A;  2V8S E;  3ASH A;  4F3V A;  3DPD A;  3FTZ A;  4I43 A;  1QP4 A;  3OXL A;  2VSN A;  3ZFW A;  1ZAY A;  2BF0 X;  4O6F A;  4JQD A;  1POU A;  2J4D A;  3S7F A;  4JVS A;  4N2Q A;  1INZ A;  4HOR A;  4N3C A;  4CGV A;  3R7R A;  3NZS A;  4CT4 A;  1ZBP A;  3ONK A;  3PEV B;  3MGB A;  2PUC A;  2VYI A;  4KZC A;  3MV2 B;  5FQ4 A;  3MKR A;  3H5T A;  1WY6 A;  2EWT A;  3G2V A;  1QP0 A;  4GMJ A;  4U63 A;  2AXU A;  4E6H A;  1A17 A;  5KCM A;  3CSF A;  3JXD L;  3PH0 C;  4MRU A;  2BNN A;  4HXI A;  2XJ3 A;  2H8R A;  2LSV A;  3C98 A;  3MZL B;  4ILH B;  2AVP A;  3TL5 A;  4IRU A;  3VTY A;  2MRI A;  4UI9 C;  4HOQ A;  4I6J A;  4DLQ A;  3U66 A;  2WIU B;  3U4T A;  4YND A;  4TUU A;  4I9E A;  2PUG A;  1UN8 A;  2FBN A;  3CVW A;  2IFU A;  3D9O A;  4G25 A;  1WIZ A;  3QWP A;  3CK8 A;  2LYS A;  2A6C A;  4YG4 A;  1E8W A;  3BEE A;  5T8I A;  3TGO A;  3RRN B;  3DNV B;  1EPU A;  3OMT A;  4FJZ A;  5G04 J;  1ZZ7 A;  3P2B A;  3RIB A;  5AIJ A;  3L6A A;  3EHN A;  1RPE L;  5EKQ D;  1SZ9 A;  3S7J A;  1N52 A;  3CRO L;  4JEH A;  3RO2 A;  4AEZ C;  5FTP A;  4N5C A;  3WXX A;  3FHE A;  1DVP A;  1SZA A;  4EPZ A;  2IOL A;  2HYZ A;  3Q47 B;  4X4D A;  1JWL A;  3IVP A;  1OWP A;  3SF4 A;  4G2V A;  3ZRH A;  2HR2 A;  4EBA G;  4J1X A;  4WWP A;  1DWK A;  5KJN A;  4AVX A;  1ZZ6 A;  1QQA A;  1WH8 A;  4RG9 A;  3FTW A;  4FLB A;  4XKC A;  3QQ6 A;  3PZD A;  2JCG A;  3F52 A;  2FI7 A;  3IHY A;  3LEW A;  3G2S A;  3S8Q A;  3VLF A;  1R69 A;  4AJW A;  4G26 A;  2IVB A;  1HX8 A;  3PRE A;  4JHK A;  4XKB A;  2AXZ A;  4X4H A;  4F8D A;  3KEZ A;  3O4Z A;  4WNG A;  3ZHM A;  3FY4 A;  3RKV A;  4EZJ A;  2FF4 A;  3B7R L;  3FEY A;  2JLB A;  2ZU6 B;  3GN5 B;  2KEI A;  4XI0 A;  4C9B B;  3SCF A;  1H2U A;  2GRM A;  4N3A A;  5LX8 A;  1TJC A;  1LCC A;  2GW1 A;  3S2A A;  5CMY A;  3G5G A;  4UWL A;  3U3W A;  3TAX A;  4I1A A;  2JEK A;  2AW6 A;  1NZN A;  2KPJ A;  3FH5 A;  3ZHE A;  1O4X A;  4Z5H A;  4NDW A;  2OOE A;  3B7H A;  5BUZ A;  3FUH A;  3CHQ A;  5LCW J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...