2GRLA

Crystal structure of dct/icf10 complex
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
287
structure length
287
Chain Sequence
MFKIGSVLKQIRQELNYHQIDLYSGIMSKSVYIKVEADSRPISVEELSKFSERLGVNFFEILNRAGMNTKSVNETGKEKLLISKIFTNPDLFDKNFQRIEPKRLTSLQYFSIYLGYISIAHHYNIEVPTFNKTITSDLKHLYDKRTTFFGIDYEIVSNLLNVLPYEEVSSIIKPMYPIVDSFGKDYDLTIQTVLKNALTISIMNRNLKEAQYYINQFEHLKTIKNISINGYYDLEINYLKQIYQFLTDKNIDSYLNAVNIINIFKIIGKEDIHRSLVEELTKISAKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis for control of conjugation by bacterial pheromone and inhibitor peptides.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Transcription
molecule keywords PrgX
total genus 112
structure length 287
sequence length 287
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2grlA01
1.25.40.400 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2grlA02
1AU7A 4OB4A 1NERA 2L49A 3QF3A 2XSDC 1B0NA 2ICTA 2BNNA 3HZIB 1ZS4A 1LMB3 1E3OC 1GT0C 1QQBA 2PUAA 4I6UA 4YG1A 2AXZA 1LCDA 2CROA 3LFPA 5A7LA 3UFDA 1WH8A 3VK0A 2GRMA 2IVQA 3JXCL 2PUGA 1WIZA 3FMYA 2WUSR 2BJCA 1RZRA 1PERL 1VPWA 3EUSA 3F52A 1LLIA 4GHJA 4FN3A 1UXCA 3TRBA 3OQOA 4I6TA 2L8NA 4Z59A 1LQCA 4X4DA 1RZRD 1SQ8A 1NEQA 1JFSA 3GN5B 1X57A 3SCHA 2KEKA 3KJXA 3O9XA 3JXBC 1RZSA 4Z5CA 2B5AA 2KEJA 1DW9A 2ICPA 1ZUGA 1ADRA 1YSEA 1WH6A 2JVLA 1LCCA 2KZ8A 4IA8A 1ZZCA 2CSFA 1QPZA 4YG4A 1BDIA 1PNRA 1O4XA 2A6CA 2XI8A 4F8DA 2O38A 3GN5A 4X4GA 3CROL 2MEZA 3L1PA 1UTXA 1QP0A 3CECA 1RPEL 2IUOA 3U3WA 1DWKA 2HSGA 3BDNA 2PUEA 3FYMA 2KEIA 2AUWA 1ZZ6A 2LYKA 2AWIA 4JQDA 1ZZ9A 3PXPA 1L1MA 3QQ6A 4X4FA 2LYSA 1QP7A 1R63A 1ZPQA 1R69A 1Y9QA 2R63A 2WIUB 3OMTA 2LCVA 3MLFA 4FBIA 2HINA 2LYRA 4Z58A 3R1FA 3SCGA 2PIJA 2XCJA 2XJ3A 3FYAA 4PU3C 4X4BA 3LISA 3OQNA 2H8RA 2AXVA 2XIUA 4Y42A 4YG7B 4JCYA 2BNOA 4PU7A 3IVPA 4Z5HA 4X4CA 1ZAYA 4I6RA 3ZHMA 2PUBA 2GRLA 2LYPA 2PUCA 2IU7A 1Y7YA 1UXDA 2KPJA 3CLCA 1PRUA 2O4AA 4J1WA 2EBYA 5K98B 4X4EA 2PE5A 4MCXA 1ZZ7A 1JH9A 3RZZA 4X4HA 3ZHIA 4IVZA 2PPXA 2O49A 3SCFA 3GBFA 3QYXA 3G5GA 4YARA 1QP4A 1X2LA 3ZKCA 1QQAA 2OR1L 1RIOA 1ZVVA 4Z5DA 2PUDA 1S7EA 1CJGA 1EFAA 2GZUA 4J1XA 4PU4C 1ZZBA 3QWGA 4PU8A 2R1JL 1JWLA 2IVBA 3B7HA 1JFTA 1POUA 2AW6A 3G7DA 3KXAA 2BNMA 2IVGA 4X4IA 4JCXA 4GQMA 1IC8A 3JXDL 1CQTA 2MQKA 1ZZ8A 3KZ3A 3OP9A 1HF0A 3H5TA 2LYJA 3BS3A 2PUFA 1XWRA 4NDWA 4IWRA 3OQMA 2JCGA 3S8QA 2OFYA 4MCTA 3DNVB 3D1NI 1OCTC 3BD1A 2EWTA 2IV1A 2LYQA 2D5VA 2EF8A 1OSLA 1WETA 1PRVA 2LYLA 3F51A 1BDHA 3F6WA 4YBAA 4O8BA 4I8TA 2FJRA 1PRAA 2AXUA
chains in the Genus database with same CATH superfamily
3RJVA 2J4BA 3UM1A 2ICTA 3NZSA 4I6UA 2H6FA 3ABKE 2AXZA 2WQHA 1OT8A 2PQRA 4GCOA 3EUSA 2ZIRA 3TRBA 3HRAA 2QYJA 3VLFA 4Z59A 4ATGA 3KSLA 5FWQA 2AVPA 1L5JA 4B93B 2IOLA 2AJAA 5B1BE 2CHXA 4OAVB 3AU4A 1SA5A 4EZJA 2J7UA 2EQXA 1BU9A 4N3AA 4I1OB 2F0YA 2AUWA 1OCZE 4G24A 1QNFA 3Q7AA 2R63A 2P9NG 2VQ2A 1WAO1 4ACKA 4BESA 2PXEA 3S7BA 4CYMD 1N4QA 5DTMA 5ARGA 3HHMA 3UI2A 4WNFA 3FU5A 3E30A 2H8RA 2GRPB 3GZCA 1SW6A 2ODRD 4B8CB 2BTDA 2KPJA 5CBOA 3G2TA 3FU6A 4JHJA 3L08A 4BT9A 4F6RD 5FQ4A 4ANUA 2YNQA 3FUNA 1ZVVA 4QFVA 3FFLA 4GA1A 1JCQA 1CQTA 1FCHA 1YA0A 4AY6A 3FU3A 5HI7A 4CDNA 1KT0A 1HF0A 3D9HA 4NDWA 4IYPA 2JCGA 1E7UA 3C3RA 1TJCA 2GRRB 1BPOA 4I6EA 3ZKJA 3SGHA 2F8YA 3T8MA 4DX7D 5EKQD 3CV0A 3Q49B 2J7WA 2FEZA 3GZSA 2WXLA 1HH8A 2UY1B 4UI9C 3L16A 3TAXA 2XZTG 4F7AA 4EZLA 2CROA 3ZRHA 1TNOA 3FMYA 3T5VA 4KXKB 4YVQC 1LD7A 5C2YA 3UT4A 2L8NA 1NA0A 3TWUA 3FUMA 2WXMA 2I2OA 4GYOA 1NI1A 3D9JA 4HLLA 1O4XA 2DZOA 4X4GA 3QAQA 2O38A 1QP0A 2VGYA 3E33A 2HSGA 3MKRA 1X81A 3DRAA 3CK8A 2X6FA 1FVHA 1ZZ9A 4AJWA 4C9BB 2WIUB 5FZRA 2LCVA 3CIAA 3D9MA 3GW4A 1UOHA 3CHMA 3CLJA 1FT2A 4X4BA 1E8XA 4TUMA 4Y42A 3GUUA 3AG1E 1N95A 2XXAA 1IQRA 3L17A 4MCXA 3ZHEB 4B94A 1NL4A 4XIFA 4P29A 4GCNA 3PS6A 2VEOA 1CJGA 4PU4C 4PU8A 1JFTA 4GQMA 2MQKA 5JA4D 3LY9A 3OXLA 3AS5A 2LYJA 4IWRA 4J8DA 3OXFA 1TNZA 1MQSA 3ASDA 2MOWA 3ZN3A 3MEKA 3FTXA 4WNEA 5FJYA 4I8TA 3T8KA 2WXIA 1A17A 4ER3A 4JHRA 4TXPA 5D2MC 4CEMA 2H6GA 4H7XA 1LLIA 3ML8A 4RLYA 1DCQA 3LKUA 1HXIA 4G1TA 4BETA 3Q9UC 4GTRA 5E75A 1SA4A 3FULA 3FUKA 4AVXA 3SR4A 1PNRA 2XGSA 4ANVA 3Q75A 3U3WA 3HXBA 4FLHA 3SFZA 4DX5D 5T3RA 5ENOD 1L1MA 3KAEA 3SF4A 1MYOA 1ZPQA 3RKVA 3MLFA 2XS8A 3FUJA 4GZCA 3MKQB 1QB2A 4KMOA 4J8FA 1Y6IA 3BU8A 4ACLA 4R7LA 3AAAC 1MX2A 3SD5A 5LX8A 3B7RL 3A9XA 4UI9K 5EYLA 2FFHA 3ZPXA 2EBYA 4X4EA 3DSTA 3ZHIA 1FVFA 3HVEB 4A3VA 2Q7FA 5FTPA 3FY4A 5D0OD 4HRLA 1Z6TA 3F6QA 2I1JA 5LCWJ 3VLEA 2CG3A 3EJNA 2KCKA 1UN9A 5DIZA 3JXDL 3ZVVA 3NBNB 2PXQA 3LJNA 3QWPA 2X6IA 3TELA 3AS8A 3DNVB 5JMND 3PRZA 4FULA 3D9NA 3O48A 3U9WA 4RSYA 3D3MA 4HQDA 1LTXA 4K5AB 3TWWA 2KZTB 3TXMA 1AU7A 5LFAA 1U3DA 2L9BA 1LMB3 3G2VA 3GYZA 4PH4B 2V8SE 2R59A 3SO8A 3VWSA 4D10C 1K1AA 3LVRE 4ER5A 1WH8A 4GZ6A 4I1MA 2M63A 4YDWA 1N0RA 4AV7A 3UPVA 2QY7A 1WDYA 4DE9A 4DPRA 1HG2A 4L2YA 5ENPD 3MX3A 4KVOA 4G2VA 2IFUA 3BDNA 3SFXA 2KEIA 1Q2ZA 1ZZ6A 2OEVA 3L13A 4TUUA 4Z68A 3LS8A 2J09A 2XEVA 3FTVA 4JD2G 4OVVA 3OQNA 3LDZA 3TWQA 3RK6A 3SY2A 2LNMA 3ZHMA 4JEHA 1HQ1A 2Y4UA 4X8QA 3DXKG 1OWOA 2GW1A 2P58C 3BG0B 3CKBA 1DCEA 3DM5A 1U2ZA 1X2LA 3FEXA 2V4HC 5G55A 2BEDA 5FINA 2P9KG 3SX0A 5JJ7A 3APCA 2WXJA 4GMJA 4NACA 2LSVA 3JQ1A 4BSZB 5CEAA 2FI7A 2YBDA 1DVPA 2X38A 2OFYA 2C0LA 3FH5A 1SZAA 2IV1A 4YDYA 2HCSA 5FQ7A 2I1KA 2FJRA 2BNOA 5ENQD 4AM9A 3UM2A 3ZYLA 3HZIB 2IF4A 3QOUA 4U8VD 5EX3A 3QJZA 4KBQA 4GHJA 1D9SA 3LYAA 1O1SA 1NEQA 3ONKA 1X57A 4GTMA 4GTQA 1JPLA 1N4RA 1KZOA 5BPPA 4J8SA 4UQYA 5DRYA 4A1SA 3SZ7A 5BXUA 2IQCA 1S63A 3FWVA 4UWFA 2XI8A 4KZ0A 3OKZA 3UKUG 3BEEA 4LNBA 3ULEG 3UM3A 4EECA 2AWIA 3Q4AB 3NOCD 2M4HA 1JWFA 2XXQA 4EPZA 4V3IA 4KZCA 3S2AA 3ESKA 3S7FA 3FH8A 3FTUA 4A55A 1H2VC 3PUKA 4WNGA 3ME5A 1N11A 1MX6A 2HFZA 4G8LA 2KCLA 2WMNA 4J1WA 4EBAA 5K98B 3U4TA 5DT2A 2PZIA 4Q94A 5FT9A 3CHSA 5CECB 4GMRA 4ANWA 3PZ3A 4WUYA 4BTAA 2R1JL 3ZU7B 1POUA 3MKQA 4UUCA 3G2WA 2VYIA 3CVYA 3PE5A 2L0TB 2IEJA 2FO7A 4WWNA 4UWKA 4ILIA 3D1NI 3PZ2A 3BD1A 3R7RA 1TN6A 1K1BA 3CHOA 2DBAA 1U2VG 4JPSA 2I9CA 1TEZA 4RG9A 4OB4A 4J0UA 1B0NA 2LUHA 2LLWA 1E3OC 2A5UA 2OCCE 4LERA 1H2UA 3JQ0A 1LCDA 1NFIE 2DCPA 4ATZD 4U8HA 3UT8A 2V5FA 1OWNA 3K9IA 4M3OA 4N2QA 3PZ4A 2PQNA 3LXUX 4TRQA 1RZSA 1TYQG 4DJAA 3UTMA 1LCCA 2KZ8A 3IEGA 1KLXA 3MEJA 4AEZC 2P9LG 4WNDA 5D0QD 5CHEE 3CROL 4QQIA 2MEZA 4GTOA 2HO1A 4NQ0A 1RPEL 3LVQE 2V3CC 2PXUA 5AJDA 4BSXA 2LYSA 3ZEFA 4BERA 3C98A 1W3BA 1FPPA 1BI7B 1XGWA 2PIJA 4TXRA 3FYAA 4LCTA 3ASOE 2EIME 5EYPF 4PU7A 2LXMA 3BQOA 1BI8B 3Q7FA 3V31A 3TG5A 1QQAA 1HS6A 3MCXA 3HXEA 4HB5A 2KC7A 5G05C 3OWQA 3G7DA 4BFRA 4GPKA 4CRWA 4F1PA 4AIFA 2MRIA 2WQ7A 2HM8A 2J08A 3ZXPA 3ZFWA 3B95A 5AQ7A 5BV1A 2EWTA 4HLEA 1OSLA 2L0IA 3ZHEA 2R05A 4GZDA 4UI9J 4LNUD 2AXUA 5ITZF 3UXGA 3QF3A 1NZNA 4LUNU 4U96D 3UWPA 4J6IA 2R03A 2LXLA 4DX1A 4MS6A 1X5BA 3RU0A 2VJ8A 1K3ZD 3CK7A 2KATA 5A6CA 3ASFA 3LFPA 4BT8A 3KD7A 3ZW3A 1KT1A 3F52A 3ESLA 3B13A 3JXIA 4RQIA 3CVPA 2CSFA 4YG4A 4H7YA 4HOSA 4F3VA 3SBTB 3HDXA 3W9GA 1UTXA 3CEQA 5D66A 5DSXA 3FYMA 3SBSA 1QP7A 4O1OA 3URZA 1TNUA 2LYRA 3B7TA 4Z58A 3HYMB 2XCJA 3ASHA 3FHEA 2WXRA 2AXVA 5G2NA 5AYWD 2J49A 4CDMA 3CR3A 1N4SA 4Z5HA 4X4CA 4XE0A 2H6IA 3UKRG 3CLCA 3R7QA 3FDHA 3PZDA 3TXNA 1ZZ7A 1IXVA 2KXPC 2PNNA 2XZDG 3GBFA 2ETCA 1MZCA 3MV3B 4KT6B 5AENA 1Z3XA 3JUIA 4CT0A 2YINA 2RD0A 1U3CA 4HXIA 1ZZ8A 3FTSA 3D9PA 2PXBA 3Q79A 3MGBA 1OWPA 2OOEA 4AOFA 4MCTA 3TGOA 4ER0A 5EDSA 2GROB 4OAUC 1H2TC 3F6WA 3AS4A 3C3OA 5AQ9A 2RFMA 4BTBA 2LO6A 2Y0BG 4C0MA 2XSDC 1ZS4A 4HNAD 1QQBA 2PUAA 1MJ0A 3P1UA 2XEHA 4YG1A 4L7TA 4OBMA 2IY0C 3RIBA 4TXQA 4U7EB 4J7WA 3Q78A 1UXCA 2R17C 3OTNA 3QB2A 1AP7A 4N3CA 4K0RA 5DTQA 3HG0D 4IA8A 4TV3A 5AAOA 1TN8A 3EHRA 4ER6A 4U8YD 4IULA 1DWKA 4B89A 3A9YA 3C3QA 4G26A 4GPMA 2CHWA 5H7PA 1R69A 2PXKA 3PVLA 3NDBB 4DX6D 1QYMA 1IYGA 3CVUA 3SCGA 2P9UG 5AIJA 4URKA 4OYSA 5KCMA 4JCYA 1ZAYA 1N52A 3LJ3A 2Y1LE 2KCVA 1IQUA 3G2SA 4I1AA 4XKBA 3RZZA 3X2QE 3JXJA 5CRUA 1WG0A 1SZ9A 3UM0A 2FF4A 3IHYA 3CVWA 2PXLA 1S0PA 5CCLA 2C0MA 3TJPA 3QKYA 2WXGA 2WQ6A 2EILE 3HXDA 5FZSA 4ZFHA 3L9TA 4DI3A 1S64A 1WETA 3PREA 4ME2A 2JQEA 3JYSA 5ENSD 5J90A 5E76A 2OR1L 3DXMG 1NERA 1ELWA 2ZISA 1JCSA 3EU5A 1Z3YA 1OWLA 3LY7A 1XNFA 2EIKE 2GGFA 3UT7A 5KJNA 1JCRA 1NA3A 5A7LA 1KPSB 5DRTA 3E4BA 5JHBA 4Q69A 1OUVA 2FBNA 1MFQC 4FC8A 4LG6A 5BXOA 4DUIA 5DTRA 4EBAG 4BX9A 1DW9A 3CQCB 1ADRA 1ZZCA 1SVXA 2DWZA 3DWLG 3RRNB 3DSSA 3T9KA 4MLPA 5BW8C 5T8IA 5KBAA 2WXQA 2DVWA 2RKKA 2XQ0A 4G8KA 4CCAA 2F8XK 1N94A 2PXPA 3NQPA 2LAHA 1E7VA 4DK5A 3VLDA 3VTXA 4LEUA 2OV8A 1ELKA 3PNTB 4XI0A 3J5PA 4BWRA 4UQZA 5G04C 4A1GA 5AQAA 2PE5A 1JH9A 4U95D 4AP2A 3SCFA 3NF1A 3QYXA 3IBEA 3CHPA 3FUIA 4DLQA 2RG8A 3EIJA 3U64A 5LP0A 2VSXE 4HRMB 5FZQA 1UW4B 1OY3D 3UINC 4JCXA 2IVGA 3PH0C 4W9RA 2FO1E 4APOA 3H5TA 2KZTA 3L54A 3QK0A 5A23A 5KWDA 3S7JA 3E37A 2WMOA 4GAAA 3KSQA 2XEEA 2PM7A 2J4DA 2FULA 2GRQB 5BT1A 2KBXA 1E90A 4FJZA 1GT0C 3GZ1A 2WXNA 2R5SA 2QZAA 2X6HA 5KNGA 4HRNA 3VK0A 2PUGA 2P9SG 4A63B 2BF0X 2WB2A 1P5QA 4EKIA 1VDYA 3OQOA 2JEKA 3VTYA 3TEPA 4HORA 1RZRD 3DBSA 3OAWA 3EHQA 1A5EA 5CBNA 2B5AA 2B0OE 3CVVA 2ICPA 1ZUGA 1NP7A 2NC9A 2IOSA 3CKCA 2DIWA 4L9PA 2DZNA 2LLVA 3A9ZA 1BDIA 3O4ZA 1EYHA 4EKGA 4GZ5A 3GN5A 3HXCA 2KM4A 4JXTA 3ZXSA 2WM9A 2IUOA 2ZU6B 2PXFA 3EUVA 3CQGB 2ZGGA 4JW1A 4HS2A 3SI5A 1QQEA 1Y9QA 1N54A 5CEDB 3PE4A 4PU3C 3L82A 4CZ2D 4FHJA 1DULA 2HCNA 3M9LA 2UWJG 2O4AA 1QBQA 4J8YA 4IVZA 2J07A 4IRUA 4I6GA 3LPZA 1YMPA 5EIBE 3DEOA 5CMWA 4Q2JA 3BUAA 5LCWC 3BS3A 1WM5A 3V2XA 1YCSB 2LSUA 3ASGA 1E8ZA 4J8EA 3UX4A 4I6JA 3ML9A 2DYRE 4I17A 5EN5D 3SFYA 1PRAA 4N39A 2IJGX 5G05J 3ONLA 5B1AE 2OVFA 3FUDA 2GRMA 1G3NB 5FQ8A 2CFZA 1PERL 1HX8A 5T4YA 5B3SE 3TWTA 1SQMA 3ENEA 4CDRA 3UQ3A 3V2OA 1TN7A 3SQVA 3HIZA 4L2LA 3EDTB 4FADA 4EK9A 2ETBA 2A6CA 4F8DA 4GA0A 4JVSA 3AG4E 1H0AA 3CECA 4NURA 3GZDA 5JJTA 1FT1A 2RFAA 2PUEA 3SHFA 3ULQA 2CG2A 3QQ6A 3GZDC 3FU0A 3MV2B 2E0IA 3MYVA 4ANXA 3CSFA 5KNHD 2X3MA 4XEIG 2GRNB 2WXPA 3DSUA 2VSNA 2PUBA 2PUCA 2XPIA 3FUFA 3Q73A 3D9OA 4UQXA 3CK9A 3W9FA 1HFAA 2YHEA 1ELRA 2XHEA 3QWWA 4HOQA 2F37A 1RIOA 4ILHB 4PDXA 3QWVA 5CERB 2PUDA 2PL2A 1BLXB 3LEWA 2EIJE 5EX0A 3I4RB 5AJLA 4FP7A 5LOZA 4UWHA 4RVBA 4F1SA 4N5QA 1QZXA 3I4GA 1XWRA 4F53A 4JEUA 3Q47B 2H6HA 2D5VA 1JUQA 3D9LA 1EPUA 4JB8P 1HF8A 4HOTA 5FIOA 4WVLA 4C48B 4DX2A 2L49A 1PC2A 1RW2A 1OXJA 3TWRA 1ZB1A 2IU1A 2WUSR 1RZRA 4YVOA 5KJKA 2Y69E 2WXHA 3ZNGA 4LNGA 2YHCA 2WXFA 3GN5B 3ISMC 5BV0A 2JVLA 1BD8A 4JA7A 3L22A 4DLOA 3QC1A 2NSZA 5BUZA 2HYZA 3L1PA 3FTWA 4I2WA 1O1TA 3DSVA 4AXHA 4XX5A 5JHAA 3CVXA 2HR2A 4JQDA 4ZHBA 3FEYA 2YQ8A 3OMTA 3QDNA 1E8YA 4FJYA 4GZ3A 2MHKA 2XJ3A 2ONDA 3LISA 3UIOC 1JWGA 2VGXA 2ZXWE 3APFA 4I6RA 3PEUB 3ZIMA 3P2BA 1UXDA 2VTBA 3QNKA 3JUEA 2VGEA 2MYOA 4B0ZA 1D8EA 3RAUA 3ZKCA 1OCRE 1IKND 3CHQA 3EIQC 1S7EA 1H19A 4ABNA 1ZZBA 3QWGA 4X4IA 3SNXA 3QOWA 1H6PA 3D9IA 3Q15A 4EZKA 3KZ3A 4MKTA 3T5XA 3N71A 2E2EA 3R09A 4GYWA 4G25A 4HFGA 3RRUA 4B8AA 3IKOB 4G23A 4APFA 4L23A 3CVNA 4DRXE 3NZLA 3PDNA 3G2UA 2EINE 4JZYA 3ZYKA 3QOXA 3ZUVB 4U0UA 3UUXA 3CGHA 1O1RA 1WIZA 2ETAA 1GW6A 2XPZA 1VPWA 1MX4A 3AU5A 2V4LA 2QC9A 4JHKA 5ANRA 2KEKA 4L1BA 1D8DA 4JA9A 5GAGi 1QPZA 1N9AA 3DSWA 1HE8A 4LSZE 4O6FA 4U04A 1H6OA 5KJMA 2LYKA 3APDA 2CFUA 3J5QB 4N5CA 4BEPA 3ZYMA 3OXGA 1E96B 2Y3AA 4HRAA 2IONA 1OCCE 3TL5A 2I6HA 3FH7A 3TWXA 2XIUA 3WXXA 4C0EA 4PS8A 3ABME 3IVPA 2PXTA 1EDUA 3LQXA 5FQ6A 1KZPA 1LF8A 4YARA 2OEWA 4WAFA 2QFCA 1HG5A 3U66A 1PAQA 2HE0A 3NZUA 1EFAA 4J1XA 5ARFA 1EF1C 1V55E 1IHGA 2IVBA 3LY8A 3R9MA 3KS2A 3MJWA 3HVEA 3NB2A 4ER7A 2C2LA 3PEVB 4N2SA 3OP9A 3AJIA 2PUFA 5CCMA 5KJLA 3OQMA 2ZGDA 1TJFA 4GTPA 4K5CA 4LRZA 4Q96A 3PE3A 5HRYA 2UY1A 3JCKC 1UJJA 2CHZA 1QZ2A 1UJKA 3DEPA 1YYHA 4N3BA 2LNIA 1OWMA 5JJ6A 4PS7A 3ZPJA 2BNNA 4MRUA 4HOUA 2BKKB 4XZ4A 4ILGA 1OCOE 4JL0A 1V54E 4I2ZA 3TWSA 3FUHA 1E8WA 4Y6WA 1LQCA 4X4DA 1WH6A 3Q9NC 5EIDA 3BG1B 2VTBB 4Y6CA 4FU3A 4UWLA 5GAHi 4I43A 5AARA 3UMVA 3ZGQA 5JUWA 4U63A 4GTTA 5EILA 2L6BA 3PZ1A 1ZBPA 2P2CP 3PNLB 3QFIA 5AQBA 4FBIA 2HINA 1TNYA 2L6JA 3DPDA 2V0PA 3E34A 3QARA 2B6CA 4FHKA 4U0ZA 4G11A 5HKPA 3S7DA 1RZ4A 3LCAA 4YDOA 3I3NA 2GRLA 2IU7A 5BNWA 5CRVA 4YNDA 5AN8A 4PS3A 4X4HA 1HZ4A 4NRHB 1QP4A 4RG6A 2A4ZA 1WY6A 3PUJA 2AW6A 2BNMA 4U0SA 3EHMA 2JLBA 4JC8A 3EHNA 3KL4A 2LYQA 1UG3A 2Y4TA 3DSXA 1PRVA 3WG7E 4YBAA 3CVQA 2R2LA 3I5PA 3NXHA 2XGOA 5J08A 4WWPA 3CVLA 4EQZA 5ENNA 1N4PA 1NW3A 3R9AB 4EQFA 4HBDA 4CGVA 2JABA 2IVQA 2PXVA 4U07A 2BJCA 2PXDA 3FUEA 3AG3E 3E32A 3IHVA 2NYJA 3KJXA 3O9XA 3JXBC 2KEJA 4BX8A 1YSEA 1S70B 3CHRA 2PM6A 4MBGA 2NXPA 4GMLA 3G0TA 4DE8A 4IN3B 2R02A 4GU5A 3ASNE 3KEZA 4XI9A 1DNPA 1Z5SC 2A5EA 3PXPA 4X4FA 4GA2A 1R63A 3V30A 2X6KA 4CGWA 2XS1A 5HS0A 3FP3A 3MA5A 5ENRD 2IO2C 2XRYA 4YG7B 4I9CA 2LYPA 3C72A 4EZIA 1PRUA 2DYSE 2QYUA 4FLBA 2XCCA 1Y8MA 1TNBA 3ULYA 3GZ2A 2PPXA 2O49A 2OVBA 3B7BA 4YDEA 1HO8A 1DC2A 4DI4A 4Z5DA 2IO3C 3B7SA 5A7DB 2GZUA 2XXPA 3TFLA 5M72A 3C5RA 3B7HA 2BKGA 3KXAA 1IC8A 4XKCA 4E6HA 3FTZA 3S8QA 1B89A 4OVUA 4FA6A 1OCTC 3MZLB 3RO3A 2BUGA 2WVIA 4K03A 3CSTA 3F51A 1BDHA 1TR4A 2L1PA 4KYOB 4O8BA 2WPVA 3HXFA 4O60A 3UIPC 1ZU2A 4K5BA 4UWGA 2J8SD 2MXDA 4BY6A 2P9IG 5C1DA 4KVMA 1H6KA 3UFDA 2VSOE 3JXCL 3L6AA 5HQ8A 3EU9A 4FN3A 2XPYA 4I6TA 1N0QA 1JFSA 1SQ8A 3SCHA 2XCBA 4Z5CA 2VSYA 2XGMA 4HI8A 2J9QA 1O5MA 4AY5A 3KEAA 4A3TA 4WWOA 3RRMB 3AG2E 3ZYQA 5IY5E 4HVBA 5ANLA 2VGXB 1LD8A 1AWCB 5ENTD 3TWVA 4GTVA 4GTSA 2ILRA 3R1FA 3RO2A 3IV0A 1K8KG 1PY1A 3NROA 3NOGD 4GB9A 3RSEG 2XRZA 1IHBA 3FTYA 4E85A 4GYYA 3NAWA 1Y7YA 2P9PG 4EHMA 1MHQA 3D9KA 3G5GA 5G04J 3V79K 3DPYA 3ABLE 3Q5MA 2LAIA 1JWLA 1HU3A 4O1PA 4CT4A 3TG4A 3B7UX 4I9EA 1UN8A 1INZA 4M7CA 4NIKA 5DBKA 2WXKA 4HI9A 2XENA 2X6JA 2EF8A 3IXEA 2LYLA 4PUCA 2V5QC 5CMYA 2WXOA
chains in the Genus database with same CATH topology
4AM9A 3RJVA 1NERA 1ELWA 2J4BA 1Z3YA 3ZYKA 2ICTA 3HZIB 3NZSA 3ZYLA 1OWLA 3LY7A 1XNFA 2GGFA 3UT7A 5KJNA 2IF4A 3QOUA 4I6UA 2FJRA 5EX3A 2AXZA 4U0UA 3QJZA 1NA3A 3UUXA 5A7LA 3CGHA 3E4BA 2WQHA 1WIZA 4Q69A 1OUVA 5JHBA 2PQRA 1GW6A 2XPZA 4KBQA 4GCOA 1VPWA 3EUSA 2FBNA 4FC8A 4GHJA 3TRBA 3VLFA 4ATGA 4Z59A 3AU5A 3LYAA 1NEQA 2V4LA 4JHKA 3ONKA 1X57A 2KEKA 5ANRA 5FWQA 1JPLA 4EBAG 4BX9A 1DW9A 2AVPA 1L5JA 1ADRA 3CQCB 4L1BA 2IOLA 4JA9A 4J8SA 5BPPA 1ZZCA 4UQYA 4A1SA 3SZ7A 2IQCA 1QPZA 3FWVA 2CHXA 3RRNB 4UWFA 3AU4A 3G2UA 2XI8A 4KZ0A 4MLPA 5BW8C 5T8IA 4EZJA 1HE8A 4O6FA 2EQXA 3BEEA 2WXQA 4N3AA 4I1OB 4U04A 2AUWA 4G24A 1QNFA 2XQ0A 2LYKA 2AWIA 3APDA 4EECA 2CFUA 5KJMA 3Q4AB 4N5CA 4CCAA 2R63A 2VQ2A 1WAO1 3OXGA 3ZYMA 1E96B 1JWFA 4ACKA 4EPZA 4V3IA 2Y3AA 4KZCA 3S7BA 5ARGA 3S2AA 2IONA 3ESKA 3HHMA 3TL5A 3NQPA 2LAHA 1E7VA 4WNFA 2I6HA 3FH7A 2H8RA 3FU5A 4DK5A 3S7FA 3VLDA 3VTXA 2XIUA 4LEUA 3FH8A 3FTUA 3WXXA 4A55A 4PS8A 2OV8A 1ELKA 1H2VC 3PNTB 3PUKA 4WNGA 3IVPA 4XI0A 4BWRA 4UQZA 4B8CB 2BTDA 2KPJA 3VTYA 2KCLA 5G04C 2WMNA 4A1GA 4J1WA 4EBAA 5K98B 1EDUA 2PE5A 1JH9A 3G2TA 3FU6A 4JHJA 3L08A 4BT9A 3U4TA 5FQ6A 5FQ4A 4AP2A 3T5VA 3SCFA 3NF1A 4ANUA 3QYXA 3IBEA 2PZIA 1LF8A 2YNQA 4Q94A 4YARA 3CHSA 5FT9A 3CHPA 3FUIA 2QFCA 1HG5A 4WAFA 4DLQA 3U66A 1PAQA 2RG8A 1ZVVA 3EIJA 3FUNA 3NZUA 4QFVA 3U64A 5LP0A 2VSXE 1EFAA 3FFLA 4J1XA 1UW4B 5ARFA 1EF1C 4WUYA 1IHGA 4GA1A 2R1JL 4ANWA 4BTAA 2IVBA 1POUA 3LY8A 4JCXA 2IVGA 3KS2A 3MJWA 3MKQA 3PH0C 3HVEA 1CQTA 1FCHA 1YA0A 2C2LA 3G2WA 3FU3A 3PEVB 2VYIA 1KT0A 5HI7A 4APOA 4CDNA 3OP9A 1HF0A 5C2YA 3H5TA 2L0TB 3CVYA 2PUFA 4NDWA 5CCMA 5KJLA 4IYPA 2FO7A 3OQMA 2JCGA 1E7UA 4WWNA 1TJFA 4UWKA 3UT4A 2KZTA 4ILIA 1TJCA 3D1NI 1BPOA 3L54A 3QK0A 4I6EA 5A23A 4LRZA 3BD1A 4Q96A 3PE3A 3S7JA 3SGHA 2UY1A 3R7RA 2WMOA 3JCKC 4GAAA 3T8MA 1UJJA 2CHZA 3CHOA 2DBAA 1QZ2A 5EKQD 3CV0A 1UJKA 3Q49B 4JPSA 2I9CA 2PM7A 1TEZA 4RG9A 2J4DA 4N3BA 2FEZA 2FULA 2LNIA 3GZSA 1OWMA 4OB4A 4J0UA 5JJ6A 5BT1A 1E90A 4PS7A 1B0NA 2WXLA 3ZPJA 2BNNA 1HH8A 4FJZA 4MRUA 1E3OC 1GT0C 3GZ1A 2UY1B 2WXNA 4UI9C 2R5SA 4HOUA 3L16A 3TAXA 2A5UA 2X6HA 4LERA 4EZLA 1H2UA 3JQ0A 4F7AA 1LCDA 4XZ4A 2CROA 4ILGA 4JL0A 4AY6A 3VK0A 2PUGA 3ZRHA 2BF0X 3FMYA 1P5QA 1VDYA 2DCPA 4I2ZA 4KXKB 4YVQC 4U8HA 3UT8A 3FUHA 4C0EA 1E8WA 2V5FA 3OQOA 2JEKA 1OWNA 3K9IA 4M3OA 4Y6WA 2L8NA 1NA0A 5D0QD 1LQCA 4X4DA 1RZRD 2PQNA 3DBSA 3OAWA 4HORA 3LXUX 4TRQA 1RZSA 2B5AA 3FUMA 4DJAA 3CVVA 2ICPA 1ZUGA 1NP7A 1WH6A 1LCCA 2NC9A 2WXMA 2KZ8A 2I2OA 2IOSA 2DIWA 3CKCA 4GYOA 3BG1B 3IEGA 1KLXA 3U9WA 2VTBB 4AEZC 1BDIA 3O4ZA 1EYHA 3D9JA 4FU3A 4WNDA 4UWLA 1O4XA 4GZ5A 4X4GA 4Y6CA 3QAQA 2O38A 3GN5A 3CROL 5CHEE 2MEZA 2KM4A 4JXTA 3ZXSA 2HO1A 1QP0A 5J08A 4I43A 4NQ0A 2WM9A 1RPEL 2IUOA 3LVQE 3UMVA 3ZGQA 2VGYA 4U63A 2HSGA 2ZU6B 3MKRA 5AJDA 1ZBPA 2WB2A 3CK8A 2X6FA 3CQGB 1FVHA 4BSXA 1ZZ9A 4AJWA 2LYSA 3PNLB 4JW1A 4HS2A 3SI5A 3ZEFA 1QQEA 3C98A 4C9BB 1Y9QA 1N54A 2WIUB 1W3BA 5FZRA 2LCVA 3CIAA 3D9MA 4FBIA 2HINA 3GW4A 3CHMA 1XGWA 2PIJA 3PE4A 2L6JA 3FYAA 3DPDA 4N2QA 4PU3C 2V0PA 3CLJA 4X4BA 3QARA 5LCWC 4LCTA 1E8XA 4FHKA 4U0ZA 4G11A 4Y42A 3S7DA 3LCAA 4PU7A 4FHJA 3I3NA 2GRLA 2IU7A 5BNWA 2UWJG 2O4AA 4YNDA 1IQRA 3L17A 4MCXA 3ZHEB 4PS3A 4X4HA 4IVZA 4B94A 3TG5A 1HZ4A 2J07A 4XIFA 4NRHB 4IRUA 1QP4A 1QQAA 1HS6A 3MCXA 4I6GA 4P29A 4GCNA 3LPZA 3PS6A 4RG6A 2A4ZA 1WY6A 2KC7A 1CJGA 5G05C 4PU4C 3PUJA 4PU8A 1JFTA 3G7DA 2AW6A 4BFRA 4GPKA 2BNMA 4CRWA 4GQMA 2MQKA 5CMWA 3LY9A 4U0SA 3OXLA 4AIFA 3AS5A 2LYJA 3EHMA 3BS3A 4IWRA 2MRIA 1WM5A 2JLBA 2HM8A 4J8DA 2J08A 2WQ7A 3OXFA 1MQSA 4JC8A 3ZFWA 2LSUA 3EHNA 3ASGA 3ASDA 1E8ZA 2MOWA 4J8EA 2EWTA 3UX4A 2LYQA 4I6JA 5BV1A 3ML9A 1UG3A 2Y4TA 4HLEA 3ZN3A 1OSLA 4I17A 2L0IA 1PRVA 3ZHEA 4YBAA 3CVQA 3MEKA 3I5PA 3FTXA 4GZDA 2XGOA 4UI9J 4WNEA 4I8TA 4WWPA 5FJYA 2WXIA 1PRAA 2AXUA 3CVLA 1A17A 4N39A 3QF3A 5ENNA 1NZNA 4LUNU 4J6IA 2IJGX 4JHRA 4MS6A 1X5BA 5G05J 3RU0A 3ONLA 2VJ8A 3R9AB 4EQFA 3CK7A 2KATA 5A6CA 2OVFA 3LFPA 3ASFA 3FUDA 4CEMA 2GRMA 2IVQA 3KD7A 3ZW3A 4BT8A 4CGVA 5FQ8A 4U07A 2CFZA 2BJCA 1PERL 1HX8A 1KT1A 4H7XA 5T4YA 3F52A 1LLIA 3FUEA 1SQMA 5J90A 3ESLA 3ENEA 4CDRA 3UQ3A 3ML8A 3LKUA 3IHVA 3KJXA 3O9XA 3JXBC 1HXIA 2KEJA 4G1TA 3B13A 3HIZA 4L2LA 4BX8A 1YSEA 5E75A 3CHRA 3EDTB 3CVPA 2PM6A 3FULA 3FUKA 2CSFA 4AVXA 2NXPA 4FADA 4YG4A 4GMLA 4H7YA 4HOSA 1PNRA 4F3VA 2A6CA 4F8DA 3SBTB 3HDXA 4GA0A 4IN3B 4JVSA 2XGSA 1H0AA 1UTXA 3CECA 4GU5A 4ANVA 4NURA 3CEQA 3U3WA 5JJTA 3KEZA 4XI9A 2PUEA 3FYMA 1DNPA 4FLHA 3SFZA 3SHFA 5T3RA 3ULQA 2CG2A 3SBSA 3PXPA 1L1MA 3QQ6A 4X4FA 1QP7A 3KAEA 4GA2A 1R63A 3FU0A 3SF4A 1ZPQA 3RKVA 3URZA 3MV2B 2E0IA 2X6KA 3MYVA 3MLFA 3FUJA 4GZCA 3MKQB 2LYRA 3B7TA 4Z58A 3HYMB 4ANXA 4CGWA 3CSFA 2XCJA 3ASHA 2X3MA 4KMOA 3FP3A 3MA5A 5FZQA 3FHEA 1Y6IA 4J8FA 4ACLA 2WXRA 2AXVA 5G2NA 5AYWD 2XRYA 2J49A 4R7LA 4YG7B 2WXPA 3CR3A 4CDMA 4Z5HA 4X4CA 2VSNA 3SD5A 2PUBA 2LYPA 2PUCA 3B7RL 4I9CA 4UI9K 4XE0A 5LX8A 3CLCA 2XPIA 1PRUA 3R7QA 3FDHA 3PZDA 4FLBA 2XCCA 2EBYA 1Y8MA 3TXNA 4X4EA 1ZZ7A 3FUFA 3ZHIA 3GZ2A 3D9OA 2PPXA 4UQXA 2O49A 2OVBA 3CK9A 1HO8A 1FVFA 3GBFA 1HFAA 3HVEB 4A3VA 2YHEA 1ELRA 2Q7FA 2XHEA 3QWWA 5FTPA 4DI4A 4HOQA 1RIOA 3MV3B 4ILHB 4PDXA 3QWVA 3FY4A 4Z5DA 2PUDA 3B7SA 4KT6B 5A7DB 2PL2A 5AENA 5D0OD 2GZUA 1Z3XA 1Z6TA 3JUIA 3LEWA 2I1JA 3I4RB 5AJLA 5EX0A 4CT0A 5LCWJ 5M72A 3B7HA 2YINA 3VLEA 2CG3A 2RD0A 2KCKA 3KXAA 1UN9A 3EJNA 1U3CA 4HXIA 5DIZA 1IC8A 4FP7A 5LOZA 3JXDL 4RVBA 4UWHA 1ZZ8A 3FTSA 4W9RA 3D9PA 3I4GA 4XKCA 3ZVVA 4F1SA 4E6HA 3QWPA 3MGBA 3FTZA 1XWRA 1OWPA 2X6IA 3S8QA 1B89A 4OVUA 2OOEA 3AS8A 4FA6A 4AOFA 4MCTA 3DNVB 4F53A 3TGOA 1OCTC 3MZLB 3PRZA 4JEUA 5EDSA 3RO3A 4FULA 3D9NA 3O48A 3Q47B 2BUGA 2D5VA 1JUQA 2WVIA 4K03A 1H2TC 3D9LA 3CSTA 3D3MA 1EPUA 3F51A 4RSYA 1BDHA 3F6WA 3AS4A 2WPVA 4O8BA 4KYOB 1HF8A 4HOTA 1ZU2A 4UWGA 4BTBA 2KZTB 3TXMA 2LO6A 1AU7A 4BY6A 4C0MA 2L49A 2XSDC 5LFAA 1U3DA 1ZS4A 1PC2A 1LMB3 2L9BA 5C1DA 1QQBA 3G2VA 2PUAA 3GYZA 2V8SE 3P1UA 2R59A 4PH4B 4YG1A 4L7TA 4KVMA 4D10C 3LVRE 1H6KA 3UFDA 2VSOE 1WH8A 3JXCL 3RIBA 3L6AA 4GZ6A 5HQ8A 4I1MA 2IU1A 2WUSR 1RZRA 2M63A 4YVOA 5KJKA 2WXHA 4FN3A 1UXCA 2XPYA 4I6TA 2YHCA 2WXFA 1JFSA 1SQ8A 2R17C 5E76A 3GN5B 3SCHA 2XCBA 3OTNA 3QB2A 4Z5CA 4AV7A 3UPVA 2VSYA 4N3CA 2QY7A 2XGMA 5BV0A 4K0RA 2JVLA 4JA7A 4DLOA 3L22A 4IA8A 2J9QA 3QC1A 4TV3A 2NSZA 5BUZA 4AY5A 2HYZA 4A3TA 4WWOA 4DPRA 1HG2A 4L2YA 3TJPA 3L1PA 3MX3A 3FTWA 4KVOA 3RRMB 4G2VA 4IULA 2IFUA 4I2WA 3ZYQA 4AXHA 1DWKA 3BDNA 4XX5A 4HVBA 4B89A 2KEIA 5ANLA 4G26A 5JHAA 1ZZ6A 3CVXA 2HR2A 2CHWA 4JQDA 3FEYA 2VGXB 3L13A 1R69A 2YQ8A 3OMTA 3PVLA 4TUUA 1IYGA 2ILRA 3LS8A 2J09A 3QDNA 4N2SA 3CVUA 1E8YA 4FJYA 3R1FA 3SCGA 4GZ3A 2XEVA 3FTVA 2MHKA 2XJ3A 1PY1A 3IV0A 3RO2A 5AIJA 2ONDA 4URKA 4GB9A 2XRZA 4OVVA 3LISA 3OQNA 3LDZA 1JWGA 3RK6A 3FTYA 4OYSA 5KCMA 4E85A 4JCYA 4GYYA 2VGXA 1N52A 1ZAYA 3ZHMA 4JEHA 3APFA 4I6RA 2Y4UA 3LJ3A 3PEUB 3ZIMA 1Y7YA 3P2BA 1UXDA 1IQUA 2KCVA 3G2SA 4I1AA 2VTBA 3QNKA 4XKBA 1MHQA 1OWOA 3RZZA 2GW1A 2P58C 3BG0B 3CKBA 4B0ZA 3D9KA 3G5GA 5G04J 1X2LA 3FEXA 1SZ9A 3ZKCA 5G55A 3CHQA 2FF4A 3EIQC 1S7EA 3Q5MA 1H19A 3IHYA 4ABNA 1ZZBA 3QWGA 2LAIA 3CVWA 1JWLA 1S0PA 1HU3A 4X4IA 4CT4A 5JJ7A 3SNXA 3TG4A 3APCA 5CCLA 2WXJA 2C0MA 3B7UX 3D9IA 3Q15A 3QKYA 4GMJA 3KZ3A 4NACA 2LSVA 3JQ1A 4EZKA 2WXGA 4I9EA 1UN8A 2FI7A 1INZA 2WQ6A 4MKTA 3T5XA 1DVPA 2X38A 3N71A 2OFYA 5FZSA 2E2EA 2C0LA 3FH5A 4GYWA 4G25A 1SZAA 5DBKA 4HFGA 2WXKA 3RRUA 4B8AA 3IKOB 4G23A 2IV1A 2X6JA 4APFA 4L23A 2EF8A 4DI3A 3CVNA 1WETA 3PREA 2LYLA 4ME2A 4PUCA 5CMYA 3JYSA 3PDNA 5FQ7A 2WXOA 2I1KA 2BNOA 2OR1L 4JZYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AU7 A;  4OB4 A;  1NER A;  2L49 A;  3QF3 A;  2XSD C;  1B0N A;  2ICT A;  2BNN A;  3HZI B;  1ZS4 A;  1LMB 3;  1E3O C;  1GT0 C;  1QQB A;  2PUA A;  4I6U A;  4YG1 A;  2AXZ A;  1LCD A;  2CRO A;  3LFP A;  5A7L A;  3UFD A;  1WH8 A;  3VK0 A;  2GRM A;  2IVQ A;  3JXC L;  2PUG A;  1WIZ A;  3FMY A;  2WUS R;  2BJC A;  1RZR A;  1PER L;  1VPW A;  3EUS A;  3F52 A;  1LLI A;  4GHJ A;  4FN3 A;  1UXC A;  3TRB A;  3OQO A;  4I6T A;  2L8N A;  4Z59 A;  1LQC A;  4X4D A;  1RZR D;  1SQ8 A;  1NEQ A;  1JFS A;  3GN5 B;  1X57 A;  3SCH A;  2KEK A;  3KJX A;  3O9X A;  3JXB C;  1RZS A;  4Z5C A;  2B5A A;  2KEJ A;  1DW9 A;  2ICP A;  1ZUG A;  1ADR A;  1YSE A;  1WH6 A;  2JVL A;  1LCC A;  2KZ8 A;  4IA8 A;  1ZZC A;  2CSF A;  1QPZ A;  4YG4 A;  1BDI A;  1PNR A;  1O4X A;  2A6C A;  2XI8 A;  4F8D A;  2O38 A;  3GN5 A;  4X4G A;  3CRO L;  2MEZ A;  3L1P A;  1UTX A;  1QP0 A;  3CEC A;  1RPE L;  2IUO A;  3U3W A;  1DWK A;  2HSG A;  3BDN A;  2PUE A;  3FYM A;  2KEI A;  2AUW A;  1ZZ6 A;  2LYK A;  2AWI A;  4JQD A;  1ZZ9 A;  3PXP A;  1L1M A;  3QQ6 A;  4X4F A;  2LYS A;  1QP7 A;  1R63 A;  1ZPQ A;  1R69 A;  1Y9Q A;  2R63 A;  2WIU B;  3OMT A;  2LCV A;  3MLF A;  4FBI A;  2HIN A;  2LYR A;  4Z58 A;  3R1F A;  3SCG A;  2PIJ A;  2XCJ A;  2XJ3 A;  3FYA A;  4PU3 C;  4X4B A;  3LIS A;  3OQN A;  2H8R A;  2AXV A;  2XIU A;  4Y42 A;  4YG7 B;  4JCY A;  2BNO A;  4PU7 A;  3IVP A;  4Z5H A;  4X4C A;  1ZAY A;  4I6R A;  3ZHM A;  2PUB A;  2GRL A;  2LYP A;  2PUC A;  2IU7 A;  1Y7Y A;  1UXD A;  2KPJ A;  3CLC A;  1PRU A;  2O4A A;  4J1W A;  2EBY A;  5K98 B;  4X4E A;  2PE5 A;  4MCX A;  1ZZ7 A;  1JH9 A;  3RZZ A;  4X4H A;  3ZHI A;  4IVZ A;  2PPX A;  2O49 A;  3SCF A;  3GBF A;  3QYX A;  3G5G A;  4YAR A;  1QP4 A;  1X2L A;  3ZKC A;  1QQA A;  2OR1 L;  1RIO A;  1ZVV A;  4Z5D A;  2PUD A;  1S7E A;  1CJG A;  1EFA A;  2GZU A;  4J1X A;  4PU4 C;  1ZZB A;  3QWG A;  4PU8 A;  2R1J L;  1JWL A;  2IVB A;  3B7H A;  1JFT A;  1POU A;  2AW6 A;  3G7D A;  3KXA A;  2BNM A;  2IVG A;  4X4I A;  4JCX A;  4GQM A;  1IC8 A;  3JXD L;  1CQT A;  2MQK A;  1ZZ8 A;  3KZ3 A;  3OP9 A;  1HF0 A;  3H5T A;  2LYJ A;  3BS3 A;  2PUF A;  1XWR A;  4NDW A;  4IWR A;  3OQM A;  2JCG A;  3S8Q A;  2OFY A;  4MCT A;  3DNV B;  3D1N I;  1OCT C;  3BD1 A;  2EWT A;  2IV1 A;  2LYQ A;  2D5V A;  2EF8 A;  1OSL A;  1WET A;  1PRV A;  2LYL A;  3F51 A;  1BDH A;  3F6W A;  4YBA A;  4O8B A;  4I8T A;  2FJR A;  1PRA A;  2AXU A; 
#chains in the Genus database with same CATH topology
 3RJV A;  2J4B A;  3UM1 A;  2ICT A;  3NZS A;  4I6U A;  2H6F A;  3ABK E;  2AXZ A;  2WQH A;  1OT8 A;  2PQR A;  4GCO A;  3EUS A;  2ZIR A;  3TRB A;  3HRA A;  2QYJ A;  3VLF A;  4Z59 A;  4ATG A;  3KSL A;  5FWQ A;  2AVP A;  1L5J A;  4B93 B;  2IOL A;  2AJA A;  5B1B E;  2CHX A;  4OAV B;  3AU4 A;  1SA5 A;  4EZJ A;  2J7U A;  2EQX A;  1BU9 A;  4N3A A;  4I1O B;  2F0Y A;  2AUW A;  1OCZ E;  4G24 A;  1QNF A;  3Q7A A;  2R63 A;  2P9N G;  2VQ2 A;  1WAO 1;  4ACK A;  4BES A;  2PXE A;  3S7B A;  4CYM D;  1N4Q A;  5DTM A;  5ARG A;  3HHM A;  3UI2 A;  4WNF A;  3FU5 A;  3E30 A;  2H8R A;  2GRP B;  3GZC A;  1SW6 A;  2ODR D;  4B8C B;  2BTD A;  2KPJ A;  5CBO A;  3G2T A;  3FU6 A;  4JHJ A;  3L08 A;  4BT9 A;  4F6R D;  5FQ4 A;  4ANU A;  2YNQ A;  3FUN A;  1ZVV A;  4QFV A;  3FFL A;  4GA1 A;  1JCQ A;  1CQT A;  1FCH A;  1YA0 A;  4AY6 A;  3FU3 A;  5HI7 A;  4CDN A;  1KT0 A;  1HF0 A;  3D9H A;  4NDW A;  4IYP A;  2JCG A;  1E7U A;  3C3R A;  1TJC A;  2GRR B;  1BPO A;  4I6E A;  3ZKJ A;  3SGH A;  2F8Y A;  3T8M A;  4DX7 D;  5EKQ D;  3CV0 A;  3Q49 B;  2J7W A;  2FEZ A;  3GZS A;  2WXL A;  1HH8 A;  2UY1 B;  4UI9 C;  3L16 A;  3TAX A;  2XZT G;  4F7A A;  4EZL A;  2CRO A;  3ZRH A;  1TNO A;  3FMY A;  3T5V A;  4KXK B;  4YVQ C;  1LD7 A;  5C2Y A;  3UT4 A;  2L8N A;  1NA0 A;  3TWU A;  3FUM A;  2WXM A;  2I2O A;  4GYO A;  1NI1 A;  3D9J A;  4HLL A;  1O4X A;  2DZO A;  4X4G A;  3QAQ A;  2O38 A;  1QP0 A;  2VGY A;  3E33 A;  2HSG A;  3MKR A;  1X81 A;  3DRA A;  3CK8 A;  2X6F A;  1FVH A;  1ZZ9 A;  4AJW A;  4C9B B;  2WIU B;  5FZR A;  2LCV A;  3CIA A;  3D9M A;  3GW4 A;  1UOH A;  3CHM A;  3CLJ A;  1FT2 A;  4X4B A;  1E8X A;  4TUM A;  4Y42 A;  3GUU A;  3AG1 E;  1N95 A;  2XXA A;  1IQR A;  3L17 A;  4MCX A;  3ZHE B;  4B94 A;  1NL4 A;  4XIF A;  4P29 A;  4GCN A;  3PS6 A;  2VEO A;  1CJG A;  4PU4 C;  4PU8 A;  1JFT A;  4GQM A;  2MQK A;  5JA4 D;  3LY9 A;  3OXL A;  3AS5 A;  2LYJ A;  4IWR A;  4J8D A;  3OXF A;  1TNZ A;  1MQS A;  3ASD A;  2MOW A;  3ZN3 A;  3MEK A;  3FTX A;  4WNE A;  5FJY A;  4I8T A;  3T8K A;  2WXI A;  1A17 A;  4ER3 A;  4JHR A;  4TXP A;  5D2M C;  4CEM A;  2H6G A;  4H7X A;  1LLI A;  3ML8 A;  4RLY A;  1DCQ A;  3LKU A;  1HXI A;  4G1T A;  4BET A;  3Q9U C;  4GTR A;  5E75 A;  1SA4 A;  3FUL A;  3FUK A;  4AVX A;  3SR4 A;  1PNR A;  2XGS A;  4ANV A;  3Q75 A;  3U3W A;  3HXB A;  4FLH A;  3SFZ A;  4DX5 D;  5T3R A;  5ENO D;  1L1M A;  3KAE A;  3SF4 A;  1MYO A;  1ZPQ A;  3RKV A;  3MLF A;  2XS8 A;  3FUJ A;  4GZC A;  3MKQ B;  1QB2 A;  4KMO A;  4J8F A;  1Y6I A;  3BU8 A;  4ACL A;  4R7L A;  3AAA C;  1MX2 A;  3SD5 A;  5LX8 A;  3B7R L;  3A9X A;  4UI9 K;  5EYL A;  2FFH A;  3ZPX A;  2EBY A;  4X4E A;  3DST A;  3ZHI A;  1FVF A;  3HVE B;  4A3V A;  2Q7F A;  5FTP A;  3FY4 A;  5D0O D;  4HRL A;  1Z6T A;  3F6Q A;  2I1J A;  5LCW J;  3VLE A;  2CG3 A;  3EJN A;  2KCK A;  1UN9 A;  5DIZ A;  3JXD L;  3ZVV A;  3NBN B;  2PXQ A;  3LJN A;  3QWP A;  2X6I A;  3TEL A;  3AS8 A;  3DNV B;  5JMN D;  3PRZ A;  4FUL A;  3D9N A;  3O48 A;  3U9W A;  4RSY A;  3D3M A;  4HQD A;  1LTX A;  4K5A B;  3TWW A;  2KZT B;  3TXM A;  1AU7 A;  5LFA A;  1U3D A;  2L9B A;  1LMB 3;  3G2V A;  3GYZ A;  4PH4 B;  2V8S E;  2R59 A;  3SO8 A;  3VWS A;  4D10 C;  1K1A A;  3LVR E;  4ER5 A;  1WH8 A;  4GZ6 A;  4I1M A;  2M63 A;  4YDW A;  1N0R A;  4AV7 A;  3UPV A;  2QY7 A;  1WDY A;  4DE9 A;  4DPR A;  1HG2 A;  4L2Y A;  5ENP D;  3MX3 A;  4KVO A;  4G2V A;  2IFU A;  3BDN A;  3SFX A;  2KEI A;  1Q2Z A;  1ZZ6 A;  2OEV A;  3L13 A;  4TUU A;  4Z68 A;  3LS8 A;  2J09 A;  2XEV A;  3FTV A;  4JD2 G;  4OVV A;  3OQN A;  3LDZ A;  3TWQ A;  3RK6 A;  3SY2 A;  2LNM A;  3ZHM A;  4JEH A;  1HQ1 A;  2Y4U A;  4X8Q A;  3DXK G;  1OWO A;  2GW1 A;  2P58 C;  3BG0 B;  3CKB A;  1DCE A;  3DM5 A;  1U2Z A;  1X2L A;  3FEX A;  2V4H C;  5G55 A;  2BED A;  5FIN A;  2P9K G;  3SX0 A;  5JJ7 A;  3APC A;  2WXJ A;  4GMJ A;  4NAC A;  2LSV A;  3JQ1 A;  4BSZ B;  5CEA A;  2FI7 A;  2YBD A;  1DVP A;  2X38 A;  2OFY A;  2C0L A;  3FH5 A;  1SZA A;  2IV1 A;  4YDY A;  2HCS A;  5FQ7 A;  2I1K A;  2FJR A;  2BNO A;  5ENQ D;  4AM9 A;  3UM2 A;  3ZYL A;  3HZI B;  2IF4 A;  3QOU A;  4U8V D;  5EX3 A;  3QJZ A;  4KBQ A;  4GHJ A;  1D9S A;  3LYA A;  1O1S A;  1NEQ A;  3ONK A;  1X57 A;  4GTM A;  4GTQ A;  1JPL A;  1N4R A;  1KZO A;  5BPP A;  4J8S A;  4UQY A;  5DRY A;  4A1S A;  3SZ7 A;  5BXU A;  2IQC A;  1S63 A;  3FWV A;  4UWF A;  2XI8 A;  4KZ0 A;  3OKZ A;  3UKU G;  3BEE A;  4LNB A;  3ULE G;  3UM3 A;  4EEC A;  2AWI A;  3Q4A B;  3NOC D;  2M4H A;  1JWF A;  2XXQ A;  4EPZ A;  4V3I A;  4KZC A;  3S2A A;  3ESK A;  3S7F A;  3FH8 A;  3FTU A;  4A55 A;  1H2V C;  3PUK A;  4WNG A;  3ME5 A;  1N11 A;  1MX6 A;  2HFZ A;  4G8L A;  2KCL A;  2WMN A;  4J1W A;  4EBA A;  5K98 B;  3U4T A;  5DT2 A;  2PZI A;  4Q94 A;  5FT9 A;  3CHS A;  5CEC B;  4GMR A;  4ANW A;  3PZ3 A;  4WUY A;  4BTA A;  2R1J L;  3ZU7 B;  1POU A;  3MKQ A;  4UUC A;  3G2W A;  2VYI A;  3CVY A;  3PE5 A;  2L0T B;  2IEJ A;  2FO7 A;  4WWN A;  4UWK A;  4ILI A;  3D1N I;  3PZ2 A;  3BD1 A;  3R7R A;  1TN6 A;  1K1B A;  3CHO A;  2DBA A;  1U2V G;  4JPS A;  2I9C A;  1TEZ A;  4RG9 A;  4OB4 A;  4J0U A;  1B0N A;  2LUH A;  2LLW A;  1E3O C;  2A5U A;  2OCC E;  4LER A;  1H2U A;  3JQ0 A;  1LCD A;  1NFI E;  2DCP A;  4ATZ D;  4U8H A;  3UT8 A;  2V5F A;  1OWN A;  3K9I A;  4M3O A;  4N2Q A;  3PZ4 A;  2PQN A;  3LXU X;  4TRQ A;  1RZS A;  1TYQ G;  4DJA A;  3UTM A;  1LCC A;  2KZ8 A;  3IEG A;  1KLX A;  3MEJ A;  4AEZ C;  2P9L G;  4WND A;  5D0Q D;  5CHE E;  3CRO L;  4QQI A;  2MEZ A;  4GTO A;  2HO1 A;  4NQ0 A;  1RPE L;  3LVQ E;  2V3C C;  2PXU A;  5AJD A;  4BSX A;  2LYS A;  3ZEF A;  4BER A;  3C98 A;  1W3B A;  1FPP A;  1BI7 B;  1XGW A;  2PIJ A;  4TXR A;  3FYA A;  4LCT A;  3ASO E;  2EIM E;  5EYP F;  4PU7 A;  2LXM A;  3BQO A;  1BI8 B;  3Q7F A;  3V31 A;  3TG5 A;  1QQA A;  1HS6 A;  3MCX A;  3HXE A;  4HB5 A;  2KC7 A;  5G05 C;  3OWQ A;  3G7D A;  4BFR A;  4GPK A;  4CRW A;  4F1P A;  4AIF A;  2MRI A;  2WQ7 A;  2HM8 A;  2J08 A;  3ZXP A;  3ZFW A;  3B95 A;  5AQ7 A;  5BV1 A;  2EWT A;  4HLE A;  1OSL A;  2L0I A;  3ZHE A;  2R05 A;  4GZD A;  4UI9 J;  4LNU D;  2AXU A;  5ITZ F;  3UXG A;  3QF3 A;  1NZN A;  4LUN U;  4U96 D;  3UWP A;  4J6I A;  2R03 A;  2LXL A;  4DX1 A;  4MS6 A;  1X5B A;  3RU0 A;  2VJ8 A;  1K3Z D;  3CK7 A;  2KAT A;  5A6C A;  3ASF A;  3LFP A;  4BT8 A;  3KD7 A;  3ZW3 A;  1KT1 A;  3F52 A;  3ESL A;  3B13 A;  3JXI A;  4RQI A;  3CVP A;  2CSF A;  4YG4 A;  4H7Y A;  4HOS A;  4F3V A;  3SBT B;  3HDX A;  3W9G A;  1UTX A;  3CEQ A;  5D66 A;  5DSX A;  3FYM A;  3SBS A;  1QP7 A;  4O1O A;  3URZ A;  1TNU A;  2LYR A;  3B7T A;  4Z58 A;  3HYM B;  2XCJ A;  3ASH A;  3FHE A;  2WXR A;  2AXV A;  5G2N A;  5AYW D;  2J49 A;  4CDM A;  3CR3 A;  1N4S A;  4Z5H A;  4X4C A;  4XE0 A;  2H6I A;  3UKR G;  3CLC A;  3R7Q A;  3FDH A;  3PZD A;  3TXN A;  1ZZ7 A;  1IXV A;  2KXP C;  2PNN A;  2XZD G;  3GBF A;  2ETC A;  1MZC A;  3MV3 B;  4KT6 B;  5AEN A;  1Z3X A;  3JUI A;  4CT0 A;  2YIN A;  2RD0 A;  1U3C A;  4HXI A;  1ZZ8 A;  3FTS A;  3D9P A;  2PXB A;  3Q79 A;  3MGB A;  1OWP A;  2OOE A;  4AOF A;  4MCT A;  3TGO A;  4ER0 A;  5EDS A;  2GRO B;  4OAU C;  1H2T C;  3F6W A;  3AS4 A;  3C3O A;  5AQ9 A;  2RFM A;  4BTB A;  2LO6 A;  2Y0B G;  4C0M A;  2XSD C;  1ZS4 A;  4HNA D;  1QQB A;  2PUA A;  1MJ0 A;  3P1U A;  2XEH A;  4YG1 A;  4L7T A;  4OBM A;  2IY0 C;  3RIB A;  4TXQ A;  4U7E B;  4J7W A;  3Q78 A;  1UXC A;  2R17 C;  3OTN A;  3QB2 A;  1AP7 A;  4N3C A;  4K0R A;  5DTQ A;  3HG0 D;  4IA8 A;  4TV3 A;  5AAO A;  1TN8 A;  3EHR A;  4ER6 A;  4U8Y D;  4IUL A;  1DWK A;  4B89 A;  3A9Y A;  3C3Q A;  4G26 A;  4GPM A;  2CHW A;  5H7P A;  1R69 A;  2PXK A;  3PVL A;  3NDB B;  4DX6 D;  1QYM A;  1IYG A;  3CVU A;  3SCG A;  2P9U G;  5AIJ A;  4URK A;  4OYS A;  5KCM A;  4JCY A;  1ZAY A;  1N52 A;  3LJ3 A;  2Y1L E;  2KCV A;  1IQU A;  3G2S A;  4I1A A;  4XKB A;  3RZZ A;  3X2Q E;  3JXJ A;  5CRU A;  1WG0 A;  1SZ9 A;  3UM0 A;  2FF4 A;  3IHY A;  3CVW A;  2PXL A;  1S0P A;  5CCL A;  2C0M A;  3TJP A;  3QKY A;  2WXG A;  2WQ6 A;  2EIL E;  3HXD A;  5FZS A;  4ZFH A;  3L9T A;  4DI3 A;  1S64 A;  1WET A;  3PRE A;  4ME2 A;  2JQE A;  3JYS A;  5ENS D;  5J90 A;  5E76 A;  2OR1 L;  3DXM G;  1NER A;  1ELW A;  2ZIS A;  1JCS A;  3EU5 A;  1Z3Y A;  1OWL A;  3LY7 A;  1XNF A;  2EIK E;  2GGF A;  3UT7 A;  5KJN A;  1JCR A;  1NA3 A;  5A7L A;  1KPS B;  5DRT A;  3E4B A;  5JHB A;  4Q69 A;  1OUV A;  2FBN A;  1MFQ C;  4FC8 A;  4LG6 A;  5BXO A;  4DUI A;  5DTR A;  4EBA G;  4BX9 A;  1DW9 A;  3CQC B;  1ADR A;  1ZZC A;  1SVX A;  2DWZ A;  3DWL G;  3RRN B;  3DSS A;  3T9K A;  4MLP A;  5BW8 C;  5T8I A;  5KBA A;  2WXQ A;  2DVW A;  2RKK A;  2XQ0 A;  4G8K A;  4CCA A;  2F8X K;  1N94 A;  2PXP A;  3NQP A;  2LAH A;  1E7V A;  4DK5 A;  3VLD A;  3VTX A;  4LEU A;  2OV8 A;  1ELK A;  3PNT B;  4XI0 A;  3J5P A;  4BWR A;  4UQZ A;  5G04 C;  4A1G A;  5AQA A;  2PE5 A;  1JH9 A;  4U95 D;  4AP2 A;  3SCF A;  3NF1 A;  3QYX A;  3IBE A;  3CHP A;  3FUI A;  4DLQ A;  2RG8 A;  3EIJ A;  3U64 A;  5LP0 A;  2VSX E;  4HRM B;  5FZQ A;  1UW4 B;  1OY3 D;  3UIN C;  4JCX A;  2IVG A;  3PH0 C;  4W9R A;  2FO1 E;  4APO A;  3H5T A;  2KZT A;  3L54 A;  3QK0 A;  5A23 A;  5KWD A;  3S7J A;  3E37 A;  2WMO A;  4GAA A;  3KSQ A;  2XEE A;  2PM7 A;  2J4D A;  2FUL A;  2GRQ B;  5BT1 A;  2KBX A;  1E90 A;  4FJZ A;  1GT0 C;  3GZ1 A;  2WXN A;  2R5S A;  2QZA A;  2X6H A;  5KNG A;  4HRN A;  3VK0 A;  2PUG A;  2P9S G;  4A63 B;  2BF0 X;  2WB2 A;  1P5Q A;  4EKI A;  1VDY A;  3OQO A;  2JEK A;  3VTY A;  3TEP A;  4HOR A;  1RZR D;  3DBS A;  3OAW A;  3EHQ A;  1A5E A;  5CBN A;  2B5A A;  2B0O E;  3CVV A;  2ICP A;  1ZUG A;  1NP7 A;  2NC9 A;  2IOS A;  3CKC A;  2DIW A;  4L9P A;  2DZN A;  2LLV A;  3A9Z A;  1BDI A;  3O4Z A;  1EYH A;  4EKG A;  4GZ5 A;  3GN5 A;  3HXC A;  2KM4 A;  4JXT A;  3ZXS A;  2WM9 A;  2IUO A;  2ZU6 B;  2PXF A;  3EUV A;  3CQG B;  2ZGG A;  4JW1 A;  4HS2 A;  3SI5 A;  1QQE A;  1Y9Q A;  1N54 A;  5CED B;  3PE4 A;  4PU3 C;  3L82 A;  4CZ2 D;  4FHJ A;  1DUL A;  2HCN A;  3M9L A;  2UWJ G;  2O4A A;  1QBQ A;  4J8Y A;  4IVZ A;  2J07 A;  4IRU A;  4I6G A;  3LPZ A;  1YMP A;  5EIB E;  3DEO A;  5CMW A;  4Q2J A;  3BUA A;  5LCW C;  3BS3 A;  1WM5 A;  3V2X A;  1YCS B;  2LSU A;  3ASG A;  1E8Z A;  4J8E A;  3UX4 A;  4I6J A;  3ML9 A;  2DYR E;  4I17 A;  5EN5 D;  3SFY A;  1PRA A;  4N39 A;  2IJG X;  5G05 J;  3ONL A;  5B1A E;  2OVF A;  3FUD A;  2GRM A;  1G3N B;  5FQ8 A;  2CFZ A;  1PER L;  1HX8 A;  5T4Y A;  5B3S E;  3TWT A;  1SQM A;  3ENE A;  4CDR A;  3UQ3 A;  3V2O A;  1TN7 A;  3SQV A;  3HIZ A;  4L2L A;  3EDT B;  4FAD A;  4EK9 A;  2ETB A;  2A6C A;  4F8D A;  4GA0 A;  4JVS A;  3AG4 E;  1H0A A;  3CEC A;  4NUR A;  3GZD A;  5JJT A;  1FT1 A;  2RFA A;  2PUE A;  3SHF A;  3ULQ A;  2CG2 A;  3QQ6 A;  3GZD C;  3FU0 A;  3MV2 B;  2E0I A;  3MYV A;  4ANX A;  3CSF A;  5KNH D;  2X3M A;  4XEI G;  2GRN B;  2WXP A;  3DSU A;  2VSN A;  2PUB A;  2PUC A;  2XPI A;  3FUF A;  3Q73 A;  3D9O A;  4UQX A;  3CK9 A;  3W9F A;  1HFA A;  2YHE A;  1ELR A;  2XHE A;  3QWW A;  4HOQ A;  2F37 A;  1RIO A;  4ILH B;  4PDX A;  3QWV A;  5CER B;  2PUD A;  2PL2 A;  1BLX B;  3LEW A;  2EIJ E;  5EX0 A;  3I4R B;  5AJL A;  4FP7 A;  5LOZ A;  4UWH A;  4RVB A;  4F1S A;  4N5Q A;  1QZX A;  3I4G A;  1XWR A;  4F53 A;  4JEU A;  3Q47 B;  2H6H A;  2D5V A;  1JUQ A;  3D9L A;  1EPU A;  4JB8 P;  1HF8 A;  4HOT A;  5FIO A;  4WVL A;  4C48 B;  4DX2 A;  2L49 A;  1PC2 A;  1RW2 A;  1OXJ A;  3TWR A;  1ZB1 A;  2IU1 A;  2WUS R;  1RZR A;  4YVO A;  5KJK A;  2Y69 E;  2WXH A;  3ZNG A;  4LNG A;  2YHC A;  2WXF A;  3GN5 B;  3ISM C;  5BV0 A;  2JVL A;  1BD8 A;  4JA7 A;  3L22 A;  4DLO A;  3QC1 A;  2NSZ A;  5BUZ A;  2HYZ A;  3L1P A;  3FTW A;  4I2W A;  1O1T A;  3DSV A;  4AXH A;  4XX5 A;  5JHA A;  3CVX A;  2HR2 A;  4JQD A;  4ZHB A;  3FEY A;  2YQ8 A;  3OMT A;  3QDN A;  1E8Y A;  4FJY A;  4GZ3 A;  2MHK A;  2XJ3 A;  2OND A;  3LIS A;  3UIO C;  1JWG A;  2VGX A;  2ZXW E;  3APF A;  4I6R A;  3PEU B;  3ZIM A;  3P2B A;  1UXD A;  2VTB A;  3QNK A;  3JUE A;  2VGE A;  2MYO A;  4B0Z A;  1D8E A;  3RAU A;  3ZKC A;  1OCR E;  1IKN D;  3CHQ A;  3EIQ C;  1S7E A;  1H19 A;  4ABN A;  1ZZB A;  3QWG A;  4X4I A;  3SNX A;  3QOW A;  1H6P A;  3D9I A;  3Q15 A;  4EZK A;  3KZ3 A;  4MKT A;  3T5X A;  3N71 A;  2E2E A;  3R09 A;  4GYW A;  4G25 A;  4HFG A;  3RRU A;  4B8A A;  3IKO B;  4G23 A;  4APF A;  4L23 A;  3CVN A;  4DRX E;  3NZL A;  3PDN A;  3G2U A;  2EIN E;  4JZY A;  3ZYK A;  3QOX A;  3ZUV B;  4U0U A;  3UUX A;  3CGH A;  1O1R A;  1WIZ A;  2ETA A;  1GW6 A;  2XPZ A;  1VPW A;  1MX4 A;  3AU5 A;  2V4L A;  2QC9 A;  4JHK A;  5ANR A;  2KEK A;  4L1B A;  1D8D A;  4JA9 A;  5GAG i;  1QPZ A;  1N9A A;  3DSW A;  1HE8 A;  4LSZ E;  4O6F A;  4U04 A;  1H6O A;  5KJM A;  2LYK A;  3APD A;  2CFU A;  3J5Q B;  4N5C A;  4BEP A;  3ZYM A;  3OXG A;  1E96 B;  2Y3A A;  4HRA A;  2ION A;  1OCC E;  3TL5 A;  2I6H A;  3FH7 A;  3TWX A;  2XIU A;  3WXX A;  4C0E A;  4PS8 A;  3ABM E;  3IVP A;  2PXT A;  1EDU A;  3LQX A;  5FQ6 A;  1KZP A;  1LF8 A;  4YAR A;  2OEW A;  4WAF A;  2QFC A;  1HG5 A;  3U66 A;  1PAQ A;  2HE0 A;  3NZU A;  1EFA A;  4J1X A;  5ARF A;  1EF1 C;  1V55 E;  1IHG A;  2IVB A;  3LY8 A;  3R9M A;  3KS2 A;  3MJW A;  3HVE A;  3NB2 A;  4ER7 A;  2C2L A;  3PEV B;  4N2S A;  3OP9 A;  3AJI A;  2PUF A;  5CCM A;  5KJL A;  3OQM A;  2ZGD A;  1TJF A;  4GTP A;  4K5C A;  4LRZ A;  4Q96 A;  3PE3 A;  5HRY A;  2UY1 A;  3JCK C;  1UJJ A;  2CHZ A;  1QZ2 A;  1UJK A;  3DEP A;  1YYH A;  4N3B A;  2LNI A;  1OWM A;  5JJ6 A;  4PS7 A;  3ZPJ A;  2BNN A;  4MRU A;  4HOU A;  2BKK B;  4XZ4 A;  4ILG A;  1OCO E;  4JL0 A;  1V54 E;  4I2Z A;  3TWS A;  3FUH A;  1E8W A;  4Y6W A;  1LQC A;  4X4D A;  1WH6 A;  3Q9N C;  5EID A;  3BG1 B;  2VTB B;  4Y6C A;  4FU3 A;  4UWL A;  5GAH i;  4I43 A;  5AAR A;  3UMV A;  3ZGQ A;  5JUW A;  4U63 A;  4GTT A;  5EIL A;  2L6B A;  3PZ1 A;  1ZBP A;  2P2C P;  3PNL B;  3QFI A;  5AQB A;  4FBI A;  2HIN A;  1TNY A;  2L6J A;  3DPD A;  2V0P A;  3E34 A;  3QAR A;  2B6C A;  4FHK A;  4U0Z A;  4G11 A;  5HKP A;  3S7D A;  1RZ4 A;  3LCA A;  4YDO A;  3I3N A;  2GRL A;  2IU7 A;  5BNW A;  5CRV A;  4YND A;  5AN8 A;  4PS3 A;  4X4H A;  1HZ4 A;  4NRH B;  1QP4 A;  4RG6 A;  2A4Z A;  1WY6 A;  3PUJ A;  2AW6 A;  2BNM A;  4U0S A;  3EHM A;  2JLB A;  4JC8 A;  3EHN A;  3KL4 A;  2LYQ A;  1UG3 A;  2Y4T A;  3DSX A;  1PRV A;  3WG7 E;  4YBA A;  3CVQ A;  2R2L A;  3I5P A;  3NXH A;  2XGO A;  5J08 A;  4WWP A;  3CVL A;  4EQZ A;  5ENN A;  1N4P A;  1NW3 A;  3R9A B;  4EQF A;  4HBD A;  4CGV A;  2JAB A;  2IVQ A;  2PXV A;  4U07 A;  2BJC A;  2PXD A;  3FUE A;  3AG3 E;  3E32 A;  3IHV A;  2NYJ A;  3KJX A;  3O9X A;  3JXB C;  2KEJ A;  4BX8 A;  1YSE A;  1S70 B;  3CHR A;  2PM6 A;  4MBG A;  2NXP A;  4GML A;  3G0T A;  4DE8 A;  4IN3 B;  2R02 A;  4GU5 A;  3ASN E;  3KEZ A;  4XI9 A;  1DNP A;  1Z5S C;  2A5E A;  3PXP A;  4X4F A;  4GA2 A;  1R63 A;  3V30 A;  2X6K A;  4CGW A;  2XS1 A;  5HS0 A;  3FP3 A;  3MA5 A;  5ENR D;  2IO2 C;  2XRY A;  4YG7 B;  4I9C A;  2LYP A;  3C72 A;  4EZI A;  1PRU A;  2DYS E;  2QYU A;  4FLB A;  2XCC A;  1Y8M A;  1TNB A;  3ULY A;  3GZ2 A;  2PPX A;  2O49 A;  2OVB A;  3B7B A;  4YDE A;  1HO8 A;  1DC2 A;  4DI4 A;  4Z5D A;  2IO3 C;  3B7S A;  5A7D B;  2GZU A;  2XXP A;  3TFL A;  5M72 A;  3C5R A;  3B7H A;  2BKG A;  3KXA A;  1IC8 A;  4XKC A;  4E6H A;  3FTZ A;  3S8Q A;  1B89 A;  4OVU A;  4FA6 A;  1OCT C;  3MZL B;  3RO3 A;  2BUG A;  2WVI A;  4K03 A;  3CST A;  3F51 A;  1BDH A;  1TR4 A;  2L1P A;  4KYO B;  4O8B A;  2WPV A;  3HXF A;  4O60 A;  3UIP C;  1ZU2 A;  4K5B A;  4UWG A;  2J8S D;  2MXD A;  4BY6 A;  2P9I G;  5C1D A;  4KVM A;  1H6K A;  3UFD A;  2VSO E;  3JXC L;  3L6A A;  5HQ8 A;  3EU9 A;  4FN3 A;  2XPY A;  4I6T A;  1N0Q A;  1JFS A;  1SQ8 A;  3SCH A;  2XCB A;  4Z5C A;  2VSY A;  2XGM A;  4HI8 A;  2J9Q A;  1O5M A;  4AY5 A;  3KEA A;  4A3T A;  4WWO A;  3RRM B;  3AG2 E;  3ZYQ A;  5IY5 E;  4HVB A;  5ANL A;  2VGX B;  1LD8 A;  1AWC B;  5ENT D;  3TWV A;  4GTV A;  4GTS A;  2ILR A;  3R1F A;  3RO2 A;  3IV0 A;  1K8K G;  1PY1 A;  3NRO A;  3NOG D;  4GB9 A;  3RSE G;  2XRZ A;  1IHB A;  3FTY A;  4E85 A;  4GYY A;  3NAW A;  1Y7Y A;  2P9P G;  4EHM A;  1MHQ A;  3D9K A;  3G5G A;  5G04 J;  3V79 K;  3DPY A;  3ABL E;  3Q5M A;  2LAI A;  1JWL A;  1HU3 A;  4O1P A;  4CT4 A;  3TG4 A;  3B7U X;  4I9E A;  1UN8 A;  1INZ A;  4M7C A;  4NIK A;  5DBK A;  2WXK A;  4HI9 A;  2XEN A;  2X6J A;  2EF8 A;  3IXE A;  2LYL A;  4PUC A;  2V5Q C;  5CMY A;  2WXO A; 
#chains in the Genus database with same CATH homology
 4AM9 A;  3RJV A;  1NER A;  1ELW A;  2J4B A;  1Z3Y A;  3ZYK A;  2ICT A;  3HZI B;  3NZS A;  3ZYL A;  1OWL A;  3LY7 A;  1XNF A;  2GGF A;  3UT7 A;  5KJN A;  2IF4 A;  3QOU A;  4I6U A;  2FJR A;  5EX3 A;  2AXZ A;  4U0U A;  3QJZ A;  1NA3 A;  3UUX A;  5A7L A;  3CGH A;  3E4B A;  2WQH A;  1WIZ A;  4Q69 A;  1OUV A;  5JHB A;  2PQR A;  1GW6 A;  2XPZ A;  4KBQ A;  4GCO A;  1VPW A;  3EUS A;  2FBN A;  4FC8 A;  4GHJ A;  3TRB A;  3VLF A;  4ATG A;  4Z59 A;  3AU5 A;  3LYA A;  1NEQ A;  2V4L A;  4JHK A;  3ONK A;  1X57 A;  2KEK A;  5ANR A;  5FWQ A;  1JPL A;  4EBA G;  4BX9 A;  1DW9 A;  2AVP A;  1L5J A;  1ADR A;  3CQC B;  4L1B A;  2IOL A;  4JA9 A;  4J8S A;  5BPP A;  1ZZC A;  4UQY A;  4A1S A;  3SZ7 A;  2IQC A;  1QPZ A;  3FWV A;  2CHX A;  3RRN B;  4UWF A;  3AU4 A;  3G2U A;  2XI8 A;  4KZ0 A;  4MLP A;  5BW8 C;  5T8I A;  4EZJ A;  1HE8 A;  4O6F A;  2EQX A;  3BEE A;  2WXQ A;  4N3A A;  4I1O B;  4U04 A;  2AUW A;  4G24 A;  1QNF A;  2XQ0 A;  2LYK A;  2AWI A;  3APD A;  4EEC A;  2CFU A;  5KJM A;  3Q4A B;  4N5C A;  4CCA A;  2R63 A;  2VQ2 A;  1WAO 1;  3OXG A;  3ZYM A;  1E96 B;  1JWF A;  4ACK A;  4EPZ A;  4V3I A;  2Y3A A;  4KZC A;  3S7B A;  5ARG A;  3S2A A;  2ION A;  3ESK A;  3HHM A;  3TL5 A;  3NQP A;  2LAH A;  1E7V A;  4WNF A;  2I6H A;  3FH7 A;  2H8R A;  3FU5 A;  4DK5 A;  3S7F A;  3VLD A;  3VTX A;  2XIU A;  4LEU A;  3FH8 A;  3FTU A;  3WXX A;  4A55 A;  4PS8 A;  2OV8 A;  1ELK A;  1H2V C;  3PNT B;  3PUK A;  4WNG A;  3IVP A;  4XI0 A;  4BWR A;  4UQZ A;  4B8C B;  2BTD A;  2KPJ A;  3VTY A;  2KCL A;  5G04 C;  2WMN A;  4A1G A;  4J1W A;  4EBA A;  5K98 B;  1EDU A;  2PE5 A;  1JH9 A;  3G2T A;  3FU6 A;  4JHJ A;  3L08 A;  4BT9 A;  3U4T A;  5FQ6 A;  5FQ4 A;  4AP2 A;  3T5V A;  3SCF A;  3NF1 A;  4ANU A;  3QYX A;  3IBE A;  2PZI A;  1LF8 A;  2YNQ A;  4Q94 A;  4YAR A;  3CHS A;  5FT9 A;  3CHP A;  3FUI A;  2QFC A;  1HG5 A;  4WAF A;  4DLQ A;  3U66 A;  1PAQ A;  2RG8 A;  1ZVV A;  3EIJ A;  3FUN A;  3NZU A;  4QFV A;  3U64 A;  5LP0 A;  2VSX E;  1EFA A;  3FFL A;  4J1X A;  1UW4 B;  5ARF A;  1EF1 C;  4WUY A;  1IHG A;  4GA1 A;  2R1J L;  4ANW A;  4BTA A;  2IVB A;  1POU A;  3LY8 A;  4JCX A;  2IVG A;  3KS2 A;  3MJW A;  3MKQ A;  3PH0 C;  3HVE A;  1CQT A;  1FCH A;  1YA0 A;  2C2L A;  3G2W A;  3FU3 A;  3PEV B;  2VYI A;  1KT0 A;  5HI7 A;  4APO A;  4CDN A;  3OP9 A;  1HF0 A;  5C2Y A;  3H5T A;  2L0T B;  3CVY A;  2PUF A;  4NDW A;  5CCM A;  5KJL A;  4IYP A;  2FO7 A;  3OQM A;  2JCG A;  1E7U A;  4WWN A;  1TJF A;  4UWK A;  3UT4 A;  2KZT A;  4ILI A;  1TJC A;  3D1N I;  1BPO A;  3L54 A;  3QK0 A;  4I6E A;  5A23 A;  4LRZ A;  3BD1 A;  4Q96 A;  3PE3 A;  3S7J A;  3SGH A;  2UY1 A;  3R7R A;  2WMO A;  3JCK C;  4GAA A;  3T8M A;  1UJJ A;  2CHZ A;  3CHO A;  2DBA A;  1QZ2 A;  5EKQ D;  3CV0 A;  1UJK A;  3Q49 B;  4JPS A;  2I9C A;  2PM7 A;  1TEZ A;  4RG9 A;  2J4D A;  4N3B A;  2FEZ A;  2FUL A;  2LNI A;  3GZS A;  1OWM A;  4OB4 A;  4J0U A;  5JJ6 A;  5BT1 A;  1E90 A;  4PS7 A;  1B0N A;  2WXL A;  3ZPJ A;  2BNN A;  1HH8 A;  4FJZ A;  4MRU A;  1E3O C;  1GT0 C;  3GZ1 A;  2UY1 B;  2WXN A;  4UI9 C;  2R5S A;  4HOU A;  3L16 A;  3TAX A;  2A5U A;  2X6H A;  4LER A;  4EZL A;  1H2U A;  3JQ0 A;  4F7A A;  1LCD A;  4XZ4 A;  2CRO A;  4ILG A;  4JL0 A;  4AY6 A;  3VK0 A;  2PUG A;  3ZRH A;  2BF0 X;  3FMY A;  1P5Q A;  1VDY A;  2DCP A;  4I2Z A;  4KXK B;  4YVQ C;  4U8H A;  3UT8 A;  3FUH A;  4C0E A;  1E8W A;  2V5F A;  3OQO A;  2JEK A;  1OWN A;  3K9I A;  4M3O A;  4Y6W A;  2L8N A;  1NA0 A;  5D0Q D;  1LQC A;  4X4D A;  1RZR D;  2PQN A;  3DBS A;  3OAW A;  4HOR A;  3LXU X;  4TRQ A;  1RZS A;  2B5A A;  3FUM A;  4DJA A;  3CVV A;  2ICP A;  1ZUG A;  1NP7 A;  1WH6 A;  1LCC A;  2NC9 A;  2WXM A;  2KZ8 A;  2I2O A;  2IOS A;  2DIW A;  3CKC A;  4GYO A;  3BG1 B;  3IEG A;  1KLX A;  3U9W A;  2VTB B;  4AEZ C;  1BDI A;  3O4Z A;  1EYH A;  3D9J A;  4FU3 A;  4WND A;  4UWL A;  1O4X A;  4GZ5 A;  4X4G A;  4Y6C A;  3QAQ A;  2O38 A;  3GN5 A;  3CRO L;  5CHE E;  2MEZ A;  2KM4 A;  4JXT A;  3ZXS A;  2HO1 A;  1QP0 A;  5J08 A;  4I43 A;  4NQ0 A;  2WM9 A;  1RPE L;  2IUO A;  3LVQ E;  3UMV A;  3ZGQ A;  2VGY A;  4U63 A;  2HSG A;  2ZU6 B;  3MKR A;  5AJD A;  1ZBP A;  2WB2 A;  3CK8 A;  2X6F A;  3CQG B;  1FVH A;  4BSX A;  1ZZ9 A;  4AJW A;  2LYS A;  3PNL B;  4JW1 A;  4HS2 A;  3SI5 A;  3ZEF A;  1QQE A;  3C98 A;  4C9B B;  1Y9Q A;  1N54 A;  2WIU B;  1W3B A;  5FZR A;  2LCV A;  3CIA A;  3D9M A;  4FBI A;  2HIN A;  3GW4 A;  3CHM A;  1XGW A;  2PIJ A;  3PE4 A;  2L6J A;  3FYA A;  3DPD A;  4N2Q A;  4PU3 C;  2V0P A;  3CLJ A;  4X4B A;  3QAR A;  5LCW C;  4LCT A;  1E8X A;  4FHK A;  4U0Z A;  4G11 A;  4Y42 A;  3S7D A;  3LCA A;  4PU7 A;  4FHJ A;  3I3N A;  2GRL A;  2IU7 A;  5BNW A;  2UWJ G;  2O4A A;  4YND A;  1IQR A;  3L17 A;  4MCX A;  3ZHE B;  4PS3 A;  4X4H A;  4IVZ A;  4B94 A;  3TG5 A;  1HZ4 A;  2J07 A;  4XIF A;  4NRH B;  4IRU A;  1QP4 A;  1QQA A;  1HS6 A;  3MCX A;  4I6G A;  4P29 A;  4GCN A;  3LPZ A;  3PS6 A;  4RG6 A;  2A4Z A;  1WY6 A;  2KC7 A;  1CJG A;  5G05 C;  4PU4 C;  3PUJ A;  4PU8 A;  1JFT A;  3G7D A;  2AW6 A;  4BFR A;  4GPK A;  2BNM A;  4CRW A;  4GQM A;  2MQK A;  5CMW A;  3LY9 A;  4U0S A;  3OXL A;  4AIF A;  3AS5 A;  2LYJ A;  3EHM A;  3BS3 A;  4IWR A;  2MRI A;  1WM5 A;  2JLB A;  2HM8 A;  4J8D A;  2J08 A;  2WQ7 A;  3OXF A;  1MQS A;  4JC8 A;  3ZFW A;  2LSU A;  3EHN A;  3ASG A;  3ASD A;  1E8Z A;  2MOW A;  4J8E A;  2EWT A;  3UX4 A;  2LYQ A;  4I6J A;  5BV1 A;  3ML9 A;  1UG3 A;  2Y4T A;  4HLE A;  3ZN3 A;  1OSL A;  4I17 A;  2L0I A;  1PRV A;  3ZHE A;  4YBA A;  3CVQ A;  3MEK A;  3I5P A;  3FTX A;  4GZD A;  2XGO A;  4UI9 J;  4WNE A;  4I8T A;  4WWP A;  5FJY A;  2WXI A;  1PRA A;  2AXU A;  3CVL A;  1A17 A;  4N39 A;  3QF3 A;  5ENN A;  1NZN A;  4LUN U;  4J6I A;  2IJG X;  4JHR A;  4MS6 A;  1X5B A;  5G05 J;  3RU0 A;  3ONL A;  2VJ8 A;  3R9A B;  4EQF A;  3CK7 A;  2KAT A;  5A6C A;  2OVF A;  3LFP A;  3ASF A;  3FUD A;  4CEM A;  2GRM A;  2IVQ A;  3KD7 A;  3ZW3 A;  4BT8 A;  4CGV A;  5FQ8 A;  4U07 A;  2CFZ A;  2BJC A;  1PER L;  1HX8 A;  1KT1 A;  4H7X A;  5T4Y A;  3F52 A;  1LLI A;  3FUE A;  1SQM A;  5J90 A;  3ESL A;  3ENE A;  4CDR A;  3UQ3 A;  3ML8 A;  3LKU A;  3IHV A;  3KJX A;  3O9X A;  3JXB C;  1HXI A;  2KEJ A;  4G1T A;  3B13 A;  3HIZ A;  4L2L A;  4BX8 A;  1YSE A;  5E75 A;  3CHR A;  3EDT B;  3CVP A;  2PM6 A;  3FUL A;  3FUK A;  2CSF A;  4AVX A;  2NXP A;  4FAD A;  4YG4 A;  4GML A;  4H7Y A;  4HOS A;  1PNR A;  4F3V A;  2A6C A;  4F8D A;  3SBT B;  3HDX A;  4GA0 A;  4IN3 B;  4JVS A;  2XGS A;  1H0A A;  1UTX A;  3CEC A;  4GU5 A;  4ANV A;  4NUR A;  3CEQ A;  3U3W A;  5JJT A;  3KEZ A;  4XI9 A;  2PUE A;  3FYM A;  1DNP A;  4FLH A;  3SFZ A;  3SHF A;  5T3R A;  3ULQ A;  2CG2 A;  3SBS A;  3PXP A;  1L1M A;  3QQ6 A;  4X4F A;  1QP7 A;  3KAE A;  4GA2 A;  1R63 A;  3FU0 A;  3SF4 A;  1ZPQ A;  3RKV A;  3URZ A;  3MV2 B;  2E0I A;  2X6K A;  3MYV A;  3MLF A;  3FUJ A;  4GZC A;  3MKQ B;  2LYR A;  3B7T A;  4Z58 A;  3HYM B;  4ANX A;  4CGW A;  3CSF A;  2XCJ A;  3ASH A;  2X3M A;  4KMO A;  3FP3 A;  3MA5 A;  5FZQ A;  3FHE A;  1Y6I A;  4J8F A;  4ACL A;  2WXR A;  2AXV A;  5G2N A;  5AYW D;  2XRY A;  2J49 A;  4R7L A;  4YG7 B;  2WXP A;  3CR3 A;  4CDM A;  4Z5H A;  4X4C A;  2VSN A;  3SD5 A;  2PUB A;  2LYP A;  2PUC A;  3B7R L;  4I9C A;  4UI9 K;  4XE0 A;  5LX8 A;  3CLC A;  2XPI A;  1PRU A;  3R7Q A;  3FDH A;  3PZD A;  4FLB A;  2XCC A;  2EBY A;  1Y8M A;  3TXN A;  4X4E A;  1ZZ7 A;  3FUF A;  3ZHI A;  3GZ2 A;  3D9O A;  2PPX A;  4UQX A;  2O49 A;  2OVB A;  3CK9 A;  1HO8 A;  1FVF A;  3GBF A;  1HFA A;  3HVE B;  4A3V A;  2YHE A;  1ELR A;  2Q7F A;  2XHE A;  3QWW A;  5FTP A;  4DI4 A;  4HOQ A;  1RIO A;  3MV3 B;  4ILH B;  4PDX A;  3QWV A;  3FY4 A;  4Z5D A;  2PUD A;  3B7S A;  4KT6 B;  5A7D B;  2PL2 A;  5AEN A;  5D0O D;  2GZU A;  1Z3X A;  1Z6T A;  3JUI A;  3LEW A;  2I1J A;  3I4R B;  5AJL A;  5EX0 A;  4CT0 A;  5LCW J;  5M72 A;  3B7H A;  2YIN A;  3VLE A;  2CG3 A;  2RD0 A;  2KCK A;  3KXA A;  1UN9 A;  3EJN A;  1U3C A;  4HXI A;  5DIZ A;  1IC8 A;  4FP7 A;  5LOZ A;  3JXD L;  4RVB A;  4UWH A;  1ZZ8 A;  3FTS A;  4W9R A;  3D9P A;  3I4G A;  4XKC A;  3ZVV A;  4F1S A;  4E6H A;  3QWP A;  3MGB A;  3FTZ A;  1XWR A;  1OWP A;  2X6I A;  3S8Q A;  1B89 A;  4OVU A;  2OOE A;  3AS8 A;  4FA6 A;  4AOF A;  4MCT A;  3DNV B;  4F53 A;  3TGO A;  1OCT C;  3MZL B;  3PRZ A;  4JEU A;  5EDS A;  3RO3 A;  4FUL A;  3D9N A;  3O48 A;  3Q47 B;  2BUG A;  2D5V A;  1JUQ A;  2WVI A;  4K03 A;  1H2T C;  3D9L A;  3CST A;  3D3M A;  1EPU A;  3F51 A;  4RSY A;  1BDH A;  3F6W A;  3AS4 A;  2WPV A;  4O8B A;  4KYO B;  1HF8 A;  4HOT A;  1ZU2 A;  4UWG A;  4BTB A;  2KZT B;  3TXM A;  2LO6 A;  1AU7 A;  4BY6 A;  4C0M A;  2L49 A;  2XSD C;  5LFA A;  1U3D A;  1ZS4 A;  1PC2 A;  1LMB 3;  2L9B A;  5C1D A;  1QQB A;  3G2V A;  2PUA A;  3GYZ A;  2V8S E;  3P1U A;  2R59 A;  4PH4 B;  4YG1 A;  4L7T A;  4KVM A;  4D10 C;  3LVR E;  1H6K A;  3UFD A;  2VSO E;  1WH8 A;  3JXC L;  3RIB A;  3L6A A;  4GZ6 A;  5HQ8 A;  4I1M A;  2IU1 A;  2WUS R;  1RZR A;  2M63 A;  4YVO A;  5KJK A;  2WXH A;  4FN3 A;  1UXC A;  2XPY A;  4I6T A;  2YHC A;  2WXF A;  1JFS A;  1SQ8 A;  2R17 C;  5E76 A;  3GN5 B;  3SCH A;  2XCB A;  3OTN A;  3QB2 A;  4Z5C A;  4AV7 A;  3UPV A;  2VSY A;  4N3C A;  2QY7 A;  2XGM A;  5BV0 A;  4K0R A;  2JVL A;  4JA7 A;  4DLO A;  3L22 A;  4IA8 A;  2J9Q A;  3QC1 A;  4TV3 A;  2NSZ A;  5BUZ A;  4AY5 A;  2HYZ A;  4A3T A;  4WWO A;  4DPR A;  1HG2 A;  4L2Y A;  3TJP A;  3L1P A;  3MX3 A;  3FTW A;  4KVO A;  3RRM B;  4G2V A;  4IUL A;  2IFU A;  4I2W A;  3ZYQ A;  4AXH A;  1DWK A;  3BDN A;  4XX5 A;  4HVB A;  4B89 A;  2KEI A;  5ANL A;  4G26 A;  5JHA A;  1ZZ6 A;  3CVX A;  2HR2 A;  2CHW A;  4JQD A;  3FEY A;  2VGX B;  3L13 A;  1R69 A;  2YQ8 A;  3OMT A;  3PVL A;  4TUU A;  1IYG A;  2ILR A;  3LS8 A;  2J09 A;  3QDN A;  4N2S A;  3CVU A;  1E8Y A;  4FJY A;  3R1F A;  3SCG A;  4GZ3 A;  2XEV A;  3FTV A;  2MHK A;  2XJ3 A;  1PY1 A;  3IV0 A;  3RO2 A;  5AIJ A;  2OND A;  4URK A;  4GB9 A;  2XRZ A;  4OVV A;  3LIS A;  3OQN A;  3LDZ A;  1JWG A;  3RK6 A;  3FTY A;  4OYS A;  5KCM A;  4E85 A;  4JCY A;  4GYY A;  2VGX A;  1N52 A;  1ZAY A;  3ZHM A;  4JEH A;  3APF A;  4I6R A;  2Y4U A;  3LJ3 A;  3PEU B;  3ZIM A;  1Y7Y A;  3P2B A;  1UXD A;  1IQU A;  2KCV A;  3G2S A;  4I1A A;  2VTB A;  3QNK A;  4XKB A;  1MHQ A;  1OWO A;  3RZZ A;  2GW1 A;  2P58 C;  3BG0 B;  3CKB A;  4B0Z A;  3D9K A;  3G5G A;  5G04 J;  1X2L A;  3FEX A;  1SZ9 A;  3ZKC A;  5G55 A;  3CHQ A;  2FF4 A;  3EIQ C;  1S7E A;  3Q5M A;  1H19 A;  3IHY A;  4ABN A;  1ZZB A;  3QWG A;  2LAI A;  3CVW A;  1JWL A;  1S0P A;  1HU3 A;  4X4I A;  4CT4 A;  5JJ7 A;  3SNX A;  3TG4 A;  3APC A;  5CCL A;  2WXJ A;  2C0M A;  3B7U X;  3D9I A;  3Q15 A;  3QKY A;  4GMJ A;  3KZ3 A;  4NAC A;  2LSV A;  3JQ1 A;  4EZK A;  2WXG A;  4I9E A;  1UN8 A;  2FI7 A;  1INZ A;  2WQ6 A;  4MKT A;  3T5X A;  1DVP A;  2X38 A;  3N71 A;  2OFY A;  5FZS A;  2E2E A;  2C0L A;  3FH5 A;  4GYW A;  4G25 A;  1SZA A;  5DBK A;  4HFG A;  2WXK A;  3RRU A;  4B8A A;  3IKO B;  4G23 A;  2IV1 A;  2X6J A;  4APF A;  4L23 A;  2EF8 A;  4DI3 A;  3CVN A;  1WET A;  3PRE A;  2LYL A;  4ME2 A;  4PUC A;  5CMY A;  3JYS A;  3PDN A;  5FQ7 A;  2WXO A;  2I1K A;  2BNO A;  2OR1 L;  4JZY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...