2GRLA

Crystal structure of dct/icf10 complex
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
287
structure length
287
Chain Sequence
MFKIGSVLKQIRQELNYHQIDLYSGIMSKSVYIKVEADSRPISVEELSKFSERLGVNFFEILNRAGMNTKSVNETGKEKLLISKIFTNPDLFDKNFQRIEPKRLTSLQYFSIYLGYISIAHHYNIEVPTFNKTITSDLKHLYDKRTTFFGIDYEIVSNLLNVLPYEEVSSIIKPMYPIVDSFGKDYDLTIQTVLKNALTISIMNRNLKEAQYYINQFEHLKTIKNISINGYYDLEINYLKQIYQFLTDKNIDSYLNAVNIINIFKIIGKEDIHRSLVEELTKISAKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis for control of conjugation by bacterial pheromone and inhibitor peptides.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Transcription
molecule keywords PrgX
total genus 112
structure length 287
sequence length 287
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2grlA01
1.25.40.400 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2grlA02
3VK0A 1JFTA 1X2LA 1ZVVA 1LMB3 2JCGA 1DW9A 3IVPA 3LFPA 1LCCA 3U3WA 2FJRA 1O4XA 3F51A 3S8QA 2IVGA 3CROL 2XIUA 2MQKA 1ZZBA 3ZHIA 1DWKA 2PIJA 1PERL 4X4GA 3O9XA 2LYPA 2PUCA 1QPZA 1NERA 2LYLA 3CECA 2O38A 1CJGA 2H8RA 1ZZCA 2LYSA 1L1MA 1VPWA 4YG7B 1ZZ9A 4Z58A 4Z59A 4X4CA 2CSFA 3JXBC 2BNOA 3PXPA 1WETA 1BDHA 1S7EA 2KPJA 1JH9A 3F52A 3DNVB 1RIOA 1UXDA 1ZZ6A 3JXDL 2KEKA 2WUSR 3ZHMA 4MCTA 3G7DA 4OB4A 4YG4A 2CROA 2AXVA 2A6CA 2IVQA 3FMYA 4I6RA 1RPEL 4X4BA 3CLCA 5A7LA 1QP7A 4X4IA 1NEQA 2AXZA 2B5AA 4I6TA 1AU7A 1WIZA 2LYKA 4PU7A 1SQ8A 2R1JL 3B7HA 3HZIB 4X4FA 3SCHA 3OQMA 2PUAA 2R63A 4X4DA 4IVZA 4X4EA 2PUGA 2BNNA 3MLFA 4F8DA 1GT0C 1QQAA 3L1PA 2O49A 4J1WA 2LYJA 2ICTA 3G5GA 1R63A 2L49A 1ZZ8A 1BDIA 5K98B 2GRLA 2ICPA 3F6WA 3QWGA 2LYRA 3FYMA 1WH8A 1Y7YA 4PU4C 1POUA 2KEIA 3BDNA 2PUBA 3D1NI 2PPXA 1JFSA 1QP0A 3H5TA 3OQNA 4Z5HA 2AUWA 3KZ3A 4GQMA 4YG1A 1OSLA 4I6UA 4J1XA 4JCYA 2HSGA 2PUDA 3UFDA 3GN5B 4I8TA 1E3OC 1HF0A 1QP4A 1RZSA 3EUSA 3GBFA 2BJCA 2XCJA 2AWIA 2IUOA 3R1FA 4FBIA 2GZUA 3OQOA 2PUFA 3FYAA 1LLIA 2O4AA 3JXCL 2AXUA 1EFAA 4IWRA 1YSEA 2EF8A 4IA8A 2BNMA 1X57A 1OCTC 2PUEA 3SCFA 1WH6A 4PU3C 3QF3A 2MEZA 4YARA 4Z5DA 1RZRD 4X4HA 1ZAYA 3BD1A 2D5VA 2GRMA 2EWTA 2LCVA 3RZZA 4PU8A 4JCXA 2JVLA 3BS3A 1Y9QA 4FN3A 3SCGA 1B0NA 1XWRA 2L8NA 3KXAA 2IV1A 3KJXA 4O8BA 2OR1L 1PRVA 2KZ8A 1ADRA 1RZRA 2KEJA 2LYQA 3QYXA 1IC8A 1QQBA 1ZUGA 1UTXA 3OMTA 1PNRA 3ZKCA 1PRAA 1R69A 4YBAA 1LQCA 2PE5A 1LCDA 1CQTA 4GHJA 2IVBA 4Z5CA 1ZZ7A 1PRUA 2OFYA 1ZS4A 2WIUB 3GN5A 1UXCA 2HINA 2IU7A 2XI8A 2XSDC 3LISA 4MCXA 1JWLA 2EBYA 3QQ6A 1ZPQA 2AW6A 3TRBA 4NDWA 4JQDA 2XJ3A 4Y42A 3OP9A
chains in the Genus database with same CATH superfamily
3C5RA 3IVPA 5DBKA 4BERA 2QFCA 4ANVA 2ZGGA 3PE3A 4X4GA 2YBDA 4ATZD 3LCAA 2LYPA 2IEJA 1NERA 3DXMG 1CJGA 4Q2JA 4AY6A 1ZZCA 2P9UG 3MYVA 3TWQA 2WXJA 2J4BA 1S7EA 3V31A 3SQVA 2IY0C 3S7JA 1TN8A 3CHQA 2DZOA 3TWTA 4F6RD 5JA4D 2L1PA 5JHAA 3ZFWA 1V54E 1WIZA 2HYZA 4J6IA 5AN8A 1NA0A 3CVYA 3CK8A 3P1UA 3UIPC 1YMPA 4HLLA 4JW1A 1YYHA 1N54A 4ABNA 2KEIA 3ZXSA 1TN7A 4LEUA 3L9TA 2P9SG 4U95D 3FU6A 5LOZA 3G0TA 1BI8B 4J8FA 4RG9A 4K0RA 4QFVA 4BX8A 2XCJA 1HO8A 3G2UA 5ENPD 1O1RA 4MS6A 1D9SA 1JCRA 2BNMA 4G11A 4YDOA 3ULYA 1SA5A 3NOCD 4YDWA 5G04J 3IHYA 3KXAA 3KJXA 4DLQA 5A6CA 2VGXB 4KT6B 3FEYA 2JQEA 3MV3B 3AG2E 4KBQA 5BW8C 5EKQD 3LISA 4TRQA 4MRUA 3QWVA 4L7TA 4IYPA 3KSQA 1OCRE 4KVMA 5EIBE 2FJRA 4U0SA 2ODRD 3UM3A 2OCCE 4DX7D 1K1BA 2OOEA 2XEEA 4ACKA 1KT1A 3PH0C 2PXVA 1BDHA 5J08A 4EHMA 2ETBA 4JHKA 4PDXA 3ABKE 3PEVB 2ZXWE 2KBXA 2AXZA 4RLYA 2WXRA 3DBSA 2IOSA 4GA0A 3SCHA 2R59A 3L17A 5AQBA 5ENQD 2P9LG 3D9KA 5AENA 3RRNB 2BTDA 2BEDA 2ICPA 3JUIA 3CHMA 3L08A 3NZUA 4ATGA 2LYRA 3FYMA 5J90A 1POUA 1TEZA 4UI9J 2PPXA 4I6EA 1H19A 1IHBA 4YG1A 4O1PA 4I6UA 2CHWA 3GBFA 4QQIA 3GZ1A 4FBIA 4G24A 2M63A 1SVXA 1JCSA 3IHVA 4JB8P 3JXCL 3ZUVB 3Q7FA 1O5MA 4XX5A 1U3CA 2WXKA 1RZRD 5HI7A 3QJZA 1HG5A 1TNUA 2KATA 2WPVA 1RZRA 3B7RL 2XPYA 2QYJA 5T3RA 4I9CA 1U3DA 4EZJA 1PRUA 3ZYMA 4A55A 1JWLA 3SNXA 4BSXA 2LAIA 4APOA 4WWOA 3HXEA 3FUNA 1MHQA 1DW9A 4N2SA 4GCNA 1HXIA 3FTXA 2IO2C 3CROL 4GYYA 1MQSA 4FJZA 2P9KG 4EBAA 2PXDA 2EIKE 4P29A 2XCCA 3F6QA 3AG1E 1WM5A 3UM1A 1OCZE 1E96B 4U0UA 2FBNA 3G2TA 3HRAA 4L23A 5CBNA 4YVOA 2XRZA 4EQZA 3ZYQA 3A9XA 5A23A 1WY6A 4CGWA 2Y1LE 2AVPA 1DVPA 2YINA 1N94A 3QAQA 3SFXA 3CHPA 2L6BA 2BUGA 4IRUA 3MA5A 1B89A 1WG0A 4FU3A 5CRVA 1WH8A 5G05C 4GZCA 4BT8A 4G25A 3QARA 3PUJA 4GQMA 2P58C 3LY7A 3ZNGA 3UFDA 1H6PA 4DK5A 1U2ZA 4WUYA 1NA3A 4I2ZA 4DRXE 2EF8A 4I9EA 1OCTC 5DSXA 2VEOA 2X3MA 2QYUA 2XS1A 5A7DB 2R03A 1HG2A 2JVLA 1JPLA 3SCGA 2XXPA 2LYQA 4GTPA 2C2LA 4AP2A 3T8MA 1UOHA 1Z3YA 2X6KA 1EDUA 3OP9A 2CHZA 4PH4B 2GROB 2CG3A 4Q96A 4HI8A 1PC2A 3K9IA 4K5AB 2LNIA 2XGMA 3NAWA 5FQ6A 4GTOA 3ONLA 1L1MA 1OWLA 3CVLA 3PS6A 2H6HA 1LD8A 3G2WA 3W9GA 1JH9A 2CFUA 3D9OA 2R2LA 3DWLG 4I6RA 1RPEL 3JQ1A 3APFA 4X4IA 4DE9A 3FWVA 3IBEA 4ANXA 3R7RA 3ZN3A 3B7HA 3CK9A 4A3TA 5JUWA 2PUGA 5FIOA 3ZPJA 1QQAA 3L1PA 3FTYA 3VLEA 4AXHA 1ZZ8A 1BDIA 1TNBA 3QWGA 3Q5MA 4K03A 1Y7YA 1QQEA 3ABME 1AWCB 5FTPA 5B3SE 3OXFA 2FFHA 2AUWA 3ML9A 3UT7A 3ZRHA 4CT0A 2X6FA 4GMRA 3MCXA 4G26A 2UWJG 5ENTD 3DEOA 2MRIA 2LSUA 4JL0A 5LP0A 4ANUA 3C3RA 4OAUC 2LCVA 2IF4A 2BKKB 3QOUA 2J07A 1FT1A 2YQ8A 1Y9QA 3FY4A 5KNHD 3RU0A 5G2NA 3RRUA 3AAAC 1DNPA 3D9MA 3CQCB 5M72A 3CHRA 5CEAA 1LD7A 4ILHB 5CHEE 2JLBA 2OFYA 2AJAA 4NQ0A 2L9BA 4K5BA 4BETA 3T8KA 2VSNA 2RKKA 3RJVA 2ONDA 1NZNA 4KVOA 1W3BA 1FCHA 4I43A 4B94A 3PREA 3G2VA 1Y6IA 5DIZA 3TG5A 2XIUA 3OKZA 1E7VA 4GMLA 3Q49B 4JHRA 3NZLA 3LYAA 5LCWC 3S7DA 1VPWA 3NB2A 2BNOA 3LDZA 2I9CA 5ENSD 3GYZA 4F1SA 2F0YA 1ELRA 2EQXA 2YHCA 3FH8A 2DVWA 3R7QA 4UI9K 3EU9A 1ZB1A 4UQYA 2C0LA 3TEPA 1QZXA 3TL5A 4X4EA 3Q4AB 4UWHA 3ZEFA 2ICTA 3QKYA 3LJ3A 4G23A 2KM4A 3O4ZA 3CR3A 3ZXPA 2XPZA 5BXUA 3H5TA 2IJGX 1OSLA 3VTXA 3A9ZA 4LNUD 1X5BA 2WVIA 4DUIA 5EX3A 3DSXA 4AV7A 4GTQA 2KCLA 2ZISA 2DIWA 4PU3C 3QF3A 2Y4UA 1EF1C 1HFAA 4EBAG 4XZ4A 2PZIA 3AS8A 3BG1B 3Q9UC 4UI9C 4O8BA 4TUMA 4XIFA 1SQMA 1UTXA 2WQ7A 2L0IA 4HRMB 1LQCA 4U8YD 2GRNB 1ZZ7A 2I1JA 2GRPB 5CEDB 2XSDC 2RFMA 3TG4A 4MCXA 3BU8A 4ER0A 4Q69A 3TELA 2V3CC 4U63A 4GTRA 1LCCA 4J8DA 3DSVA 4EKIA 3AJIA 2WXGA 3SO8A 2BF0X 4OVVA 4KMOA 1NW3A 4W9RA 3HIZA 3HVEA 2PUCA 1OUVA 3TJPA 3ME5A 4J7WA 4PS7A 1UJKA 3DNVB 1XNFA 2KCVA 2V5FA 4G8LA 2A5UA 3LJNA 3CVWA 2IVQA 4E6HA 4FC8A 1MZCA 2WXPA 3CQGB 3UX4A 3V2XA 3QOXA 3SY2A 5AIJA 4OYSA 1DC2A 1O1TA 2BKGA 2J08A 4ZFHA 3V30A 4OBMA 1HF8A 2XXAA 3EHQA 1QP4A 3LXUX 1QB2A 2X38A 4UQXA 3WXXA 5KNGA 1BU9A 5ANRA 2VGYA 3C3QA 1MX2A 3AG3E 4BT9A 4L1BA 2D5VA 4N3CA 2PXEA 3KEZA 4PU8A 5G05J 2OR1L 2IV1A 3PUKA 5B1AE 1UN9A 1YA0A 2LAHA 2IU1A 4UWFA 3UKRG 1QQBA 2J7WA 3FH7A 4YBAA 3Q79A 5BXOA 2VTBB 1K3ZD 1DCQA 1OCOE 2VSXE 4GZDA 4WWNA 1OY3D 1FPPA 4XEIG 3E4BA 2NSZA 1OXJA 5EN5D 4X8QA 4I6JA 3FU3A 4OAVB 5DRYA 5JJ7A 2EIME 1N4QA 3ULEG 3O9XA 4D10C 2LYSA 1X81A 3CVXA 3FU5A 4Z59A 1H6OA 4L2YA 1E7UA 5GAHi 2HO1A 3VWSA 1E8ZA 1O1SA 2J4DA 4XE0A 1N0RA 4BY6A 4EECA 2WXNA 4HOSA 2Y4TA 4TXRA 1GW6A 3FHEA 3GZSA 2YNQA 1Z6TA 2MOWA 2B0OE 2XENA 3TXNA 1N9AA 4M7CA 2R5SA 3FUIA 4ANWA 3KD7A 4G8KA 3MJWA 2H6IA 2DYSE 1OWOA 1Y8MA 1HF0A 3ZU7B 4APFA 4GMJA 2AWIA 1ELKA 1LLIA 4U96D 3E37A 3CVVA 2LXMA 2VJ8A 3CEQA 4YARA 4Z5DA 3ML8A 4A1GA 4X4HA 2PXPA 1ZU2A 1ZAYA 3NDBB 3SHFA 3ZKJA 3Q9NC 1HZ4A 3U66A 1QYMA 2ILRA 4HOTA 4NIKA 3FDHA 2XHEA 3FTWA 2PXKA 1K8KG 3IEGA 4O60A 2LSVA 1KPSB 4GTTA 5T4YA 2QC9A 1RW2A 4I1OB 4JHJA 1NP7A 5FZQA 2ETCA 2CG2A 1LMB3 3L6AA 3GZDA 3ZHEB 3FUEA 5EYLA 4RG6A 2L0TB 4CT4A 3IKOB 4MBGA 1MYOA 1H6KA 2VGEA 4U0ZA 2F8XK 1BD8A 3HXFA 3B7UX 2VSOE 5FJYA 4CDMA 1UXDA 5AJDA 3MKRA 1LF8A 3T9KA 2V0PA 4JA7A 2A6CA 3PZDA 1QP7A 3ASNE 4KZ0A 4GYOA 1AU7A 4EZLA 3FUHA 3LY9A 1MFQC 3TWUA 1NFIE 3SF4A 2R17C 3KL4A 5LCWJ 3UT4A 2J9QA 2I1KA 4F8DA 3MZLB 3T5VA 3E34A 3ASDA 3UXGA 3FTUA 3AG4E 2XPIA 2XGOA 5E75A 1ZBPA 3EIQC 4G1TA 3OQNA 5BT1A 4I6GA 3EUVA 3OXGA 3FH5A 1E3OC 3Q73A 5JHBA 2X6JA 3R1FA 3CIAA 5KCMA 4BTAA 5AJLA 3ENEA 3ULQA 1OWPA 3E32A 2FF4A 5CCLA 4BEPA 2NC9A 4NRHB 3V2OA 4JXTA 4FLHA 3RAUA 3UI2A 4NACA 4YG4A 3TFLA 2V8SE 3Q47B 3LY8A 1ZUGA 3DSWA 3FUFA 3ZHEA 3APCA 3HDXA 2IVBA 1SW6A 1N11A 1E8XA 3CVQA 1UXCA 3TWRA 2WXHA 4NDWA 3GZ2A 3NZSA 1TR4A 1FVFA 1A17A 4Z68A 4RSYA 3L16A 1HH8A 4KYOB 1TJFA 3UWPA 3R09A 1ZZBA 1PERL 5ARFA 4CEMA 4DI3A 5D2MC 3UKUG 3FFLA 3MGBA 5EILA 2XQ0A 4HQDA 2PXUA 4AJWA 4H7XA 1E8WA 3CLCA 5A7LA 1FVHA 4O1OA 5ARGA 3GZCA 3CVPA 2Y69E 3U4TA 5FQ8A 4X4FA 3DSTA 4N5QA 3RKVA 3PDNA 5D66A 3MLFA 1BLXB 3FUMA 5LX8A 2XRYA 3DPYA 1R63A 2IFUA 3I5PA 4KZCA 2QZAA 4PU4C 3U9WA 4ACLA 2PNNA 1QP0A 2A5EA 3SBSA 2Y0BG 4JCYA 2PUDA 2B6CA 1SZ9A 3KS2A 3MKQA 5BV1A 2JEKA 3OAWA 4LERA 1DCEA 4J8SA 5HQ8A 1WH6A 3KAEA 3SGHA 1SZAA 4A3VA 1XGWA 2WM9A 3QNKA 2R05A 3UIOC 1B0NA 3ISMC 4BX9A 3CSTA 3BG0B 4CYMD 2DWZA 4CCAA 1PRAA 3DM5A 3JQ0A 2F37A 3VLDA 5BNWA 2IU7A 2XI8A 4I1MA 2IONA 4U04A 4WNDA 3FUDA 2J7UA 4HBDA 3C72A 3URZA 1JFTA 2P2CP 4GZ5A 4CZ2D 5H7PA 3ZVVA 3S7BA 4HI9A 2X6IA 3FU0A 4L9PA 5FQ7A 3JCKC 3APDA 4HLEA 5FWQA 4FHJA 4FA6A 3ZHMA 3I3NA 4LNGA 4JA9A 1OT8A 2F8YA 4HFGA 1NEQA 4I2WA 3QC1A 3RIBA 3AU5A 3ASFA 4KXKB 3DSUA 3JXIA 1PAQA 3ESLA 1GT0C 3NXHA 3ASHA 3G5GA 1P5QA 2FO1E 4DPRA 4DI4A 4ME2A 5D0OD 3BDNA 1S63A 5ENRD 3ZYLA 4U07A 3PZ4A 1JFSA 3C98A 5FZRA 2HSGA 4I8TA 3DSSA 3EHNA 4B0ZA 3EUSA 3OWQA 1JUQA 4GA2A 3FYAA 4HRLA 5AAOA 3LPZA 4A63B 3SI5A 3GW4A 2GRRB 2GRMA 2EWTA 4M3OA 4YDEA 2X6HA 4JCXA 1IC8A 2XGSA 2WQ6A 3CKBA 3NQPA 1R69A 5D0QD 5DTQA 4AM9A 4LRZA 3QQ6A 3ASGA 3ESKA 3ONKA 4CRWA 5FZSA 3FP3A 3FUJA 2OEVA 2JCGA 3CSFA 5CCMA 1HQ1A 4N3BA 1N4RA 3F51A 2MHKA 2IVGA 4DX6D 4N2QA 1QNFA 3ABLE 4I17A 3UTMA 4DE8A 2A4ZA 3CGHA 3FTZA 1QPZA 3CECA 3BEEA 3B7BA 3G2SA 2CSFA 3NF1A 3PXPA 3CVNA 2ZU6B 3KEAA 3MV2B 4J0UA 4AIFA 3JXDL 3PRZA 3CK7A 4EKGA 4NURA 5CBOA 2J09A 4BWRA 3BUAA 2V4HC 2FULA 2FI7A 5GAGi 2PUAA 3RRMB 4X4DA 2MYOA 2GGFA 2VTBA 3UPVA 3VTYA 2LYJA 2WMNA 1PY1A 2VQ2A 4URKA 5CMYA 4HOQA 3FUKA 3MEJA 3BQOA 1HE8A 1S70B 2PUBA 4ER6A 4MKTA 2I2OA 2ZIRA 2CHXA 3DEPA 2PL2A 5AQAA 3GN5B 3QK0A 2UY1A 3RO2A 3FTSA 3CLJA 4IA8A 3UM0A 3SCFA 3BD1A 1UG3A 3A9YA 1S0PA 1XWRA 5AARA 3RSEG 2WXQA 3QYXA 4F1PA 2LO6A 4LSZE 3ZKCA 5HS0A 4CDNA 2DZNA 4GHJA 2LXLA 2E2EA 2XCBA 4Y6CA 2WXLA 1ZPQA 3TRBA 4O6FA 3B7TA 1WAO1 1H2TC 4ER5A 3OXLA 3HHMA 1ZVVA 2HR2A 2XXQA 4U7EB 3HXBA 1D8EA 2MQKA 1N4SA 2OV8A 4A1SA 1IKND 1N0QA 1E90A 4OVUA 4V3IA 1VDYA 1N95A 3SD5A 3D3MA 5DT2A 4JD2G 3JXBC 2WXIA 5IY5E 2KZTA 4C9BB 5KJNA 5DRTA 3IXEA 4ILGA 3EIJA 5C2YA 5EX0A 5AYWD 2R1JL 3SX0A 3HZIB 3L13A 1MX4A 4JEUA 2PQRA 3CHOA 4IVZA 4G2VA 4EK9A 1NI1A 3PVLA 4AEZC 3CHSA 4DX1A 1NL4A 4JEHA 2EINE 3F6WA 2HM8A 3RO3A 2H6GA 3LKUA 3SFYA 3Q15A 3D9LA 4BFRA 1A5EA 3EHRA 4J1XA 4DX2A 1RZSA 5EDSA 4JC8A 4JVSA 4B89A 3ZGQA 3P2BA 4C48B 4BESA 3MX3A 2UY1B 3T5XA 1TJCA 3DXKG 4H7YA 4J8EA 4U8HA 2XS8A 1KZPA 4FN3A 5DTMA 4UUCA 4LUNU 2VYIA 2KEJA 2MXDA 4DJAA 4ER3A 1CQTA 3L22A 3B7SA 4N39A 4XI9A 3EJNA 3D9HA 4TXPA 2VSYA 4BTBA 2XJ3A 4CDRA 4Y42A 4YVQC 2RFAA 3QDNA 3TWXA 3TXMA 3PE5A 4IN3B 2FEZA 1QZ2A 3WG7E 1KLXA 1KZOA 2EIJE 3LVRE 3ZHIA 1LTXA 3Q78A 2PIJA 4FADA 2H8RA 3GUUA 4YG7B 3JYSA 1ZZ9A 4B8AA 1WETA 3QOWA 3LEWA 2KPJA 3F52A 3UUXA 3ZYKA 4FJYA 3LVQE 2KEKA 2IQCA 4B8CB 3UINC 5BUZA 1IQUA 4F7AA 1YCSB 4J8YA 1G3NB 2LYKA 1SQ8A 2FO7A 2HCNA 2R63A 1HX8A 5KWDA 1INZA 4XKCA 2GRQB 2PM7A 3FULA 4PS8A 4LG6A 5K98B 4BSZB 1OWNA 3TWWA 1HU3A 3C3OA 3GZDC 1TYQG 2RD0A 2BJCA 4R7LA 3N71A 2PUFA 3PNTB 4C0MA 3TGOA 1KT0A 4AY5A 1H2UA 3VLFA 1ELWA 2R02A 3RZZA 1H0AA 3U64A 4EZIA 4B93B 2PQNA 2WMOA 1LCDA 2QY7A 5CECB 4WVLA 1FT2A 3HYMB 3NBNB 2WIUB 2HINA 3CV0A 1H2VC 4JQDA 1WDYA 3M9LA 5KJMA 3ZW3A 3PZ3A 1MJ0A 4GTSA 1OCCE 4TUUA 3TWVA 5ITZF 3LFPA 2P9NG 3O48A 4YDYA 1JCQA 1BPOA 3SFZA 4WAFA 1BI7B 4IULA 4UQZA 1DWKA 4ZHBA 3QWPA 2LLWA 2O38A 4Z58A 5E76A 4FP7A 2NXPA 4DX5D 5BV0A 1IHGA 1E8YA 4GZ3A 4HRAA 3KSLA 3SZ7A 3G7DA 2YHEA 4HS2A 3FMYA 3OTNA 4Q94A 4X4BA 3CVUA 4GTVA 4I6TA 2PXLA 4HNAD 5CRUA 2BNNA 5G55A 4FLBA 2OEWA 4HXIA 2L49A 5G04C 4MLPA 2LUHA 3PE4A 1V55E 4Z5HA 2WQHA 4GAAA 4GPMA 3ZPXA 1Z3XA 3Q75A 5JMND 3EHMA 3OQOA 2O4AA 3LQXA 2DCPA 4GU5A 1EFAA 3Q7AA 2NYJA 1X57A 2PUEA 4CGVA 2L6JA 2MEZA 3S7FA 1Q2ZA 3TAXA 2KXPC 3PNLB 4UWLA 3UQ3A 1UN8A 1ADRA 2KZ8A 1SA4A 3X2QE 4ILIA 2M4HA 5KBAA 3D9JA 2PXTA 3PZ1A 4L2LA 4WWPA 3NROA 2XZTG 3GN5A 5CMWA 1TNZA 4HB5A 3QFIA 4PS3A 1TNYA 2XZDG 3JXJA 3U3WA 4K5CA 5FT9A 3SR4A 3SBTB 3S8QA 3B13A 2ETAA 4GB9A 5ENOD 5FINA 5T8IA 3FEXA 4UWKA 3UMVA 3R9AB 5JJ6A 3ZIMA 1IXVA 2P9IG 3QWWA 1N4PA 4GCOA 2PXBA 2WXMA 4HOUA 1RIOA 4AVXA 1ZZ6A 2P9PG 1TNOA 4MCTA 1JWFA 4TXQA 5EIDA 2CROA 5FQ4A 2B5AA 1DULA 2Q7FA 4TV3A 3V79K 1OWMA 2PXQA 2DBAA 3OQMA 1S64A 4RVBA 4E85A 3I4RB 4F3VA 2H6FA 2ZGDA 3AS5A 4N3AA 4RQIA 2O49A 5B1BE 4J1WA 1U2VG 1QBQA 3AS4A 2OVFA 4HORA 2GRLA 3IV0A 4FHKA 5DTRA 4YNDA 3HG0D 2XEVA 3TWSA 3E30A 3DRAA 2RG8A 2WB2A 2XEHA 5BPPA 5HKPA 3ASOE 4JZYA 5AQ9A 2PM6A 3NOGD 4JPSA 2GZUA 3D9NA 2WXOA 2AXUA 4IWRA 3QB2A 1YSEA 4WNGA 4PUCA 3JUEA 1RZ4A 3MKQB 5EYPF 4LNBA 3BS3A 5JJTA 1IYGA 2L8NA 2EILE 1PRVA 5CERB 1EPUA 3J5PA 4GYWA 2HFZA 1N52A 4DLOA 3PZ2A 3EDTB 4GPKA 1ZS4A 1D8DA 3UM2A 2HCSA 2EBYA 3W9FA 4C0EA 3VK0A 1L5JA 3R9MA 4LCTA 4I1AA 1X2LA 4F53A 4AOFA 2KZTB 2C0MA 1JWGA 4Y6WA 3FTVA 3I4GA 1UW4B 1UJJA 4FULA 2LYLA 4UWGA 4X4CA 2E0IA 2IOLA 4HVBA 5HRYA 2GW1A 3D9IA 5KJKA 2I6HA 1TN6A 5KJLA 3L82A 2CFZA 4EQFA 2WUSR 5LFAA 4OB4A 2J8SD 3MEKA 2AXVA 2V5QC 2Y3AA 2DYRE 3UT8A 4ER7A 4PU7A 3L54A 3RK6A 2HE0A 2JABA 1Z5SC 2LLVA 5ENNA 2VGXA 4EPZA 2KCKA 2OVBA 1HS6A 1MX6A 3B95A 3D9PA 2PXFA 1IQRA 3D1NI 4EZKA 4GA1A 5ANLA 3KZ3A 2J49A 4HRNA 2IUOA 3J5QB 4N5CA 3DPDA 4GTMA 4GZ6A 1AP7A 4WNFA 3LS8A 2V4LA 4XI0A 3CKCA 3AU4A 3EU5A 1EYHA 2LNMA 3HXCA 3HVEB 4U8VD 3OMTA 1PNRA 4WNEA 2PE5A 3E33A 3PEUB 2WXFA 4Z5CA 5C1DA 4XKBA 1K1AA 2IO3C 3HXDA 3S2AA 2KC7A 2AW6A 5AQ7A 1O4XA
chains in the Genus database with same CATH topology
3NZSA 1FVFA 1NZNA 1A17A 3QDNA 4KVOA 3TXMA 1W3BA 3IVPA 1FCHA 4RSYA 3L16A 1HH8A 4I43A 2FEZA 3PREA 3G2VA 4IN3B 4KYOB 1QZ2A 1TJFA 1Y6IA 2QFCA 4ANVA 5DIZA 3TG5A 2XIUA 1KLXA 1ZZBA 3LVRE 3ZHIA 1E7VA 3PE3A 1PERL 2PIJA 4X4GA 3Q49B 4GMLA 4JHRA 5ARFA 4CEMA 4FADA 3LCAA 4DI3A 2LYPA 1NERA 3LYAA 1CJGA 2H8RA 3S7DA 5LCWC 1ZZCA 4AY6A 1VPWA 4YG7B 3JYSA 1ZZ9A 3MYVA 3FFLA 2BNOA 2WXJA 3LDZA 3MGBA 4B8AA 1WETA 2J4BA 2XQ0A 3GZ2A 2I9CA 3LEWA 1S7EA 2KPJA 3GYZA 3F52A 3UUXA 3ZYKA 1ELRA 2EQXA 3LVQE 2YHCA 4FJYA 2KEKA 2IQCA 3S7JA 4B8CB 4F1SA 3CHQA 4AJWA 4H7XA 1E8WA 3FH8A 3CLCA 5A7LA 1IQUA 5BUZA 4F7AA 5JHAA 1FVHA 3R7QA 3ZFWA 5ARGA 3CVPA 1WIZA 2LYKA 2HYZA 4J6IA 4UI9K 3U4TA 5FQ8A 4UQYA 1SQ8A 2FO7A 2C0LA 4X4FA 3TL5A 2R63A 1NA0A 3CVYA 3RKVA 1HX8A 4X4EA 3CK8A 3Q4AB 3PDNA 4UWHA 1INZA 4XKCA 3MLFA 3P1UA 2PM7A 3ZEFA 3FULA 3FUMA 4PS8A 5LX8A 2ICTA 2XRYA 1R63A 3QKYA 4JW1A 2IFUA 1N54A 5K98B 3I5PA 3LJ3A 4KZCA 1OWNA 4G23A 2KM4A 3O4ZA 3CR3A 4ABNA 4PU4C 2XPZA 2KEIA 3ZXSA 3U9WA 4LEUA 4ACLA 1HU3A 1QP0A 3H5TA 3FU6A 3SBSA 5LOZA 2IJGX 1OSLA 2ONDA 2RD0A 4JCYA 4J8FA 2PUDA 4RG9A 4K0RA 1SZ9A 3KS2A 4QFVA 3VTXA 3MKQA 4BX8A 5BV1A 2JEKA 2BJCA 1X5BA 2XCJA 3OAWA 3N71A 2PUFA 1HO8A 3G2UA 4R7LA 3PNTB 4C0MA 3TGOA 1KT0A 2WVIA 5EX3A 4LERA 4AY5A 4MS6A 1H2UA 4G11A 2BNMA 4J8SA 4AV7A 2KCLA 5HQ8A 3VLFA 1WH6A 4PU3C 2DIWA 3QF3A 2Y4UA 3KAEA 3SGHA 1EF1C 1ELWA 1SZAA 1HFAA 4A3VA 3RZZA 5G04J 4EBAG 1XGWA 2WM9A 3QNKA 4XZ4A 2PZIA 3AS8A 3IHYA 1H0AA 3BG1B 4UI9C 5DBKA 3U64A 1B0NA 3KXAA 3KJXA 4O8BA 4BX9A 4XIFA 4DLQA 3CSTA 5A6CA 3BG0B 1SQMA 2VGXB 1UTXA 4KT6B 2WQ7A 4CCAA 2L0IA 3FEYA 2PQNA 1PRAA 1LQCA 2WMOA 1LCDA 3JQ0A 3MV3B 2QY7A 4KBQA 3VLDA 5BNWA 5BW8C 3HYMB 1ZZ7A 2I1JA 2WIUB 2HINA 2IU7A 2XI8A 3CV0A 2XSDC 4I1MA 2IONA 4U04A 3LISA 4MCXA 1H2VC 4WNDA 5EKQD 3TG4A 3FUDA 4JQDA 4TRQA 4MRUA 4Q69A 3QWVA 4L7TA 4U63A 1JFTA 3URZA 3ZW3A 4IYPA 5KJMA 4TUUA 3LFPA 1LCCA 4GZ5A 3O48A 4J8DA 3ZVVA 3S7BA 1BPOA 4KVMA 2FJRA 4U0SA 2X6IA 3SFZA 4WAFA 2WXGA 3FU0A 2BF0X 4OVVA 4IULA 4UQZA 1DWKA 4KMOA 5FQ7A 4W9RA 3HIZA 3APDA 3JCKC 3HVEA 2PUCA 1OUVA 3QWPA 2O38A 4HLEA 3TJPA 2OOEA 4Z58A 5E76A 4FP7A 2NXPA 4PS7A 5FWQA 1KT1A 3PH0C 4ACKA 5BV0A 1UJKA 4FHJA 1BDHA 5J08A 3DNVB 1IHGA 1E8YA 1XNFA 2KCVA 4GZ3A 2V5FA 4FA6A 3ZHMA 3SZ7A 3I3NA 2A5UA 3G7DA 2YHEA 4JHKA 3CVWA 2IVQA 4HS2A 3FMYA 4JA9A 3PEVB 4PDXA 4E6HA 3OTNA 4FC8A 4Q94A 4X4BA 3CVUA 4HFGA 2WXPA 1NEQA 2AXZA 4I2WA 3QC1A 3RIBA 4I6TA 3AU5A 3ASFA 2WXRA 4KXKB 3DBSA 2IOSA 3CQGB 1PAQA 3UX4A 4GA0A 3SCHA 2R59A 3L17A 2BNNA 3ESLA 5G55A 4D10C 5AIJA 1GT0C 4FLBA 3ASHA 3D9KA 5AENA 4HXIA 4OYSA 3G5GA 1P5QA 3RRNB 2L49A 2BTDA 4DPRA 2ICPA 3JUIA 3CHMA 3L08A 5G04C 3NZUA 4DI4A 4ME2A 2LYRA 5D0OD 4ATGA 3FYMA 5J90A 3BDNA 1POUA 4MLPA 4UI9J 1TEZA 2PPXA 4I6EA 3ZYLA 3PE4A 1H19A 4U07A 2J08A 1JFSA 3C98A 4Z5HA 2WQHA 4YG1A 5FZRA 4I6UA 4GAAA 2CHWA 2HSGA 4I8TA 1HF8A 3EHNA 1QP4A 4B0ZA 1Z3XA 3EUSA 3GBFA 1JUQA 3GZ1A 3EHMA 3LXUX 4GA2A 3OQOA 4FBIA 2O4AA 4G24A 2M63A 2DCPA 3FYAA 2X38A 3IHVA 4GU5A 3LPZA 3JXCL 1EFAA 4UQXA 3WXXA 5ANRA 3SI5A 2VGYA 1X57A 2PUEA 4XX5A 1U3CA 2WXKA 3GW4A 1RZRD 2MEZA 2L6JA 4CGVA 5HI7A 3QJZA 4L1BA 2D5VA 3S7FA 4BT9A 2GRMA 2EWTA 4M3OA 3TAXA 4N3CA 2X6HA 3KEZA 1HG5A 4PU8A 4JCXA 5G05J 2OR1L 3PNLB 2IV1A 3PUKA 4UWLA 3UQ3A 1UN8A 1ADRA 2KZ8A 2KATA 2WPVA 1UN9A 1YA0A 1RZRA 1IC8A 2LAHA 2IU1A 2XGSA 2XPYA 1QQBA 3B7RL 4ILIA 4I9CA 4UWFA 3CKBA 5T3RA 2WQ6A 3FH7A 3D9JA 1R69A 3NQPA 4YBAA 5D0QD 2VTBB 1U3DA 4L2LA 4WWPA 4AM9A 4EZJA 1PRUA 3GN5A 3ZYMA 4LRZA 4A55A 5CMWA 2VSXE 1JWLA 4GZDA 4WWNA 3SNXA 3QQ6A 4BSXA 2LAIA 3ASGA 3ESKA 3ONKA 4PS3A 4APOA 4CRWA 4WWOA 5FZSA 3FP3A 3FUJA 3E4BA 3FUNA 1MHQA 2JCGA 1DW9A 2NSZA 4GCNA 4N2SA 3U3WA 3CSFA 5CCMA 1HXIA 3FTXA 5FT9A 3SBTB 4N3BA 3F51A 3S8QA 2IVGA 3CROL 2MHKA 1MQSA 1QNFA 3B13A 4FJZA 4GB9A 4GYYA 4N2QA 4I6JA 3FU3A 4I17A 4EBAA 5T8IA 5JJ7A 3FEXA 4UWKA 3UMVA 2A4ZA 3O9XA 3CGHA 3FTZA 1QPZA 4P29A 5JJ6A 3R9AB 3CECA 3ZIMA 3BEEA 2LYSA 3CVXA 3FU5A 4Z59A 2XCCA 4L2YA 3G2SA 2CSFA 3NF1A 1E7UA 3PXPA 3CVNA 3QWWA 1WM5A 2ZU6B 3MV2B 2HO1A 4GCOA 4HOUA 2WXMA 4J0UA 1RIOA 4AIFA 4AVXA 1ZZ6A 3JXDL 1E96B 4U0UA 3PRZA 2FBNA 4MCTA 1E8ZA 1JWFA 3CK7A 3G2TA 2J09A 4NURA 2CROA 2J4DA 4BWRA 4L23A 4XE0A 4BY6A 4YVOA 5FQ4A 2XRZA 2B5AA 2Q7FA 4EECA 3ZYQA 4TV3A 1OWMA 2FULA 5A23A 2FI7A 1WY6A 4CGWA 2PUAA 2DBAA 2WXNA 3RRMB 3OQMA 4HOSA 4X4DA 2AVPA 4RVBA 2Y4TA 3I4RB 4E85A 1DVPA 2YINA 4F3VA 1GW6A 2GGFA 3FHEA 3QAQA 3AS5A 4N3AA 2VTBA 3GZSA 3UPVA 3CHPA 3VTYA 2O49A 1Z6TA 2YNQA 4J1WA 2MOWA 2LYJA 2WMNA 1PY1A 2VQ2A 2OVFA 3AS4A 3TXNA 2BUGA 4IRUA 3MA5A 4HORA 2GRLA 1B89A 3IV0A 4FU3A 4FHKA 4HOQA 3FUKA 5CMYA 4YNDA 4URKA 2XEVA 1WH8A 1HE8A 2PUBA 2RG8A 5G05C 2WB2A 2R5SA 3FUIA 4MKTA 2I2OA 3KD7A 4GZCA 4ANWA 4G25A 3QARA 4BT8A 2CHXA 5BPPA 3PUJA 4GQMA 2PL2A 2P58C 3LY7A 3MJWA 3UFDA 3GN5B 1OWOA 1Y8MA 1HF0A 4JZYA 4APFA 4GMJA 4DK5A 2PM6A 1ELKA 2AWIA 3QK0A 4JPSA 2GZUA 2UY1A 3RO2A 3D9NA 1LLIA 2WXOA 3FTSA 3CVVA 4WUYA 2AXUA 4IWRA 1NA3A 3QB2A 1YSEA 4WNGA 4I2ZA 3CLJA 2EF8A 4IA8A 4I9EA 4PUCA 1OCTC 2VJ8A 3SCFA 3CEQA 4YARA 4Z5DA 3ML8A 4A1GA 4X4HA 1ZU2A 3MKQB 1ZAYA 3BD1A 3SHFA 2X3MA 1UG3A 1HZ4A 5A7DB 3U66A 1S0PA 1HG2A 2JVLA 3BS3A 1JPLA 2ILRA 3SCGA 5JJTA 1XWRA 2L8NA 1IYGA 4CDRA 1PRVA 4HOTA 1EPUA 2WXQA 4GYWA 3FDHA 2LYQA 3QYXA 2XHEA 2LO6A 3FTWA 2C2LA 3ZKCA 1N52A 4AP2A 4DLOA 4CDNA 3IEGA 4GHJA 2LSVA 5T4YA 2E2EA 3EDTB 3T8MA 4GPKA 1ZS4A 2XCBA 4Y6CA 2WXLA 4I1OB 4JHJA 1NP7A 2EBYA 1ZPQA 5FZQA 3TRBA 1Z3YA 2X6KA 1EDUA 4O6FA 4C0EA 3B7TA 3OP9A 3VK0A 1L5JA 1WAO1 2CG2A 1H2TC 3OXLA 2CHZA 3HHMA 4LCTA 4I1AA 1X2LA 1ZVVA 1LMB3 3L6AA 4F53A 3ZHEB 4PH4B 2HR2A 3FUEA 2CG3A 4Q96A 4RG6A 2L0TB 4AOFA 2KZTB 4CT4A 1PC2A 3K9IA 3IKOB 2MQKA 2C0MA 2LNIA 2XGMA 2OV8A 4A1SA 1JWGA 5FQ6A 4Y6WA 3FTVA 3I4GA 1UW4B 1UJJA 1E90A 4FULA 1H6KA 4OVUA 4V3IA 1VDYA 2LYLA 3ONLA 4U0ZA 3SD5A 1L1MA 1OWLA 3CVLA 3D3MA 4UWGA 4X4CA 2E0IA 2IOLA 3JXBC 2WXIA 4HVBA 3PS6A 3G2WA 2GW1A 3B7UX 2VSOE 3D9IA 5KJKA 1JH9A 2CFUA 2I6HA 3D9OA 5FJYA 2KZTA 1UXDA 4CDMA 5AJDA 5KJLA 2CFZA 4EQFA 2WUSR 3MKRA 5LFAA 4C9BB 1LF8A 4OB4A 2V0PA 4JA7A 3MEKA 2AXVA 2A6CA 4I6RA 3PZDA 1RPEL 3JQ1A 5KJNA 2Y3AA 1QP7A 3APFA 4X4IA 4ILGA 3FWVA 4KZ0A 4GYOA 3UT8A 1AU7A 3EIJA 5C2YA 5EX0A 4PU7A 3IBEA 5AYWD 4ANXA 4EZLA 2R1JL 3FUHA 3L54A 3R7RA 3RK6A 3B7HA 3HZIB 3ZN3A 3LY9A 3L13A 3CK9A 4A3TA 3SF4A 2R17C 4JEUA 2PQRA 3CHOA 4IVZA 4G2VA 5LCWJ 2PUGA 3UT4A 2J9QA 4B94A 2I1KA 4F8DA 3MZLB 3PVLA 3ZPJA 3T5VA 1QQAA 3L1PA 3FTYA 5ENNA 4AEZC 3CHSA 2VGXA 3ASDA 4EPZA 2KCKA 2OVBA 3VLEA 4AXHA 1ZZ8A 1HS6A 1BDIA 4JEHA 3D9PA 3F6WA 3QWGA 3FTUA 2HM8A 2XPIA 3Q5MA 2XGOA 4K03A 3RO3A 1Y7YA 1IQRA 5E75A 3LKUA 3D1NI 1ZBPA 1QQEA 3EIQC 4EZKA 5FTPA 3Q15A 4G1TA 3OQNA 3D9LA 3OXFA 4GA1A 5ANLA 4BFRA 2AUWA 3KZ3A 3ML9A 4I6GA 3UT7A 3ZRHA 4J1XA 5BT1A 2J49A 3OXGA 4CT0A 3FH5A 1E3OC 2X6FA 1RZSA 5EDSA 5JHBA 4JC8A 2X6JA 2IUOA 3R1FA 3CIAA 3MCXA 4G26A 4JVSA 5KCMA 5AJLA 4B89A 4BTAA 3ENEA 4N5CA 3DPDA 3ULQA 1OWPA 2UWJG 3ZGQA 4GZ6A 2MRIA 3P2BA 2FF4A 5CCLA 2LSUA 2UY1B 3MX3A 3T5XA 4JL0A 4WNFA 5LP0A 3LS8A 4ANUA 1TJCA 2NC9A 4NRHB 4JXTA 4FLHA 2LCVA 2IF4A 4H7YA 3QOUA 2V4LA 4J8EA 4U8HA 2J07A 2VSYA 4NACA 4XI0A 4YG4A 1Y9QA 4FN3A 2V8SE 2YQ8A 3FY4A 3CKCA 3RU0A 3AU4A 5G2NA 3Q47B 3RRUA 4LUNU 2VYIA 3D9MA 1DNPA 1EYHA 3CQCB 2KEJA 5M72A 3CHRA 1ZUGA 3LY8A 3HVEB 3OMTA 1PNRA 3FUFA 4WNEA 2PE5A 4ILHB 3PEUB 4DJAA 3ZHEA 3APCA 3HDXA 1CQTA 2JLBA 3L22A 5CHEE 2IVBA 2WXFA 4Z5CA 3B7SA 5C1DA 4N39A 2OFYA 4NQ0A 3CVQA 1E8XA 2L9BA 1UXCA 4XKBA 4XI9A 2WXHA 3EJNA 3S2AA 2KC7A 2VSNA 3RJVA 2AW6A 4NDWA 4BTBA 2XJ3A 4Y42A 4YVQC 1O4XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VK0 A;  1JFT A;  1X2L A;  1ZVV A;  1LMB 3;  2JCG A;  1DW9 A;  3IVP A;  3LFP A;  1LCC A;  3U3W A;  2FJR A;  1O4X A;  3F51 A;  3S8Q A;  2IVG A;  3CRO L;  2XIU A;  2MQK A;  1ZZB A;  3ZHI A;  1DWK A;  2PIJ A;  1PER L;  4X4G A;  3O9X A;  2LYP A;  2PUC A;  1QPZ A;  1NER A;  2LYL A;  3CEC A;  2O38 A;  1CJG A;  2H8R A;  1ZZC A;  2LYS A;  1L1M A;  1VPW A;  4YG7 B;  1ZZ9 A;  4Z58 A;  4Z59 A;  4X4C A;  2CSF A;  3JXB C;  2BNO A;  3PXP A;  1WET A;  1BDH A;  1S7E A;  2KPJ A;  1JH9 A;  3F52 A;  3DNV B;  1RIO A;  1UXD A;  1ZZ6 A;  3JXD L;  2KEK A;  2WUS R;  3ZHM A;  4MCT A;  3G7D A;  4OB4 A;  4YG4 A;  2CRO A;  2AXV A;  2A6C A;  2IVQ A;  3FMY A;  4I6R A;  1RPE L;  4X4B A;  3CLC A;  5A7L A;  1QP7 A;  4X4I A;  1NEQ A;  2AXZ A;  2B5A A;  4I6T A;  1AU7 A;  1WIZ A;  2LYK A;  4PU7 A;  1SQ8 A;  2R1J L;  3B7H A;  3HZI B;  4X4F A;  3SCH A;  3OQM A;  2PUA A;  2R63 A;  4X4D A;  4IVZ A;  4X4E A;  2PUG A;  2BNN A;  3MLF A;  4F8D A;  1GT0 C;  1QQA A;  3L1P A;  2O49 A;  4J1W A;  2LYJ A;  2ICT A;  3G5G A;  1R63 A;  2L49 A;  1ZZ8 A;  1BDI A;  5K98 B;  2GRL A;  2ICP A;  3F6W A;  3QWG A;  2LYR A;  3FYM A;  1WH8 A;  1Y7Y A;  4PU4 C;  1POU A;  2KEI A;  3BDN A;  2PUB A;  3D1N I;  2PPX A;  1JFS A;  1QP0 A;  3H5T A;  3OQN A;  4Z5H A;  2AUW A;  3KZ3 A;  4GQM A;  4YG1 A;  1OSL A;  4I6U A;  4J1X A;  4JCY A;  2HSG A;  2PUD A;  3UFD A;  3GN5 B;  4I8T A;  1E3O C;  1HF0 A;  1QP4 A;  1RZS A;  3EUS A;  3GBF A;  2BJC A;  2XCJ A;  2AWI A;  2IUO A;  3R1F A;  4FBI A;  2GZU A;  3OQO A;  2PUF A;  3FYA A;  1LLI A;  2O4A A;  3JXC L;  2AXU A;  1EFA A;  4IWR A;  1YSE A;  2EF8 A;  4IA8 A;  2BNM A;  1X57 A;  1OCT C;  2PUE A;  3SCF A;  1WH6 A;  4PU3 C;  3QF3 A;  2MEZ A;  4YAR A;  4Z5D A;  1RZR D;  4X4H A;  1ZAY A;  3BD1 A;  2D5V A;  2GRM A;  2EWT A;  2LCV A;  3RZZ A;  4PU8 A;  4JCX A;  2JVL A;  3BS3 A;  1Y9Q A;  4FN3 A;  3SCG A;  1B0N A;  1XWR A;  2L8N A;  3KXA A;  2IV1 A;  3KJX A;  4O8B A;  2OR1 L;  1PRV A;  2KZ8 A;  1ADR A;  1RZR A;  2KEJ A;  2LYQ A;  3QYX A;  1IC8 A;  1QQB A;  1ZUG A;  1UTX A;  3OMT A;  1PNR A;  3ZKC A;  1PRA A;  1R69 A;  4YBA A;  1LQC A;  2PE5 A;  1LCD A;  1CQT A;  4GHJ A;  2IVB A;  4Z5C A;  1ZZ7 A;  1PRU A;  2OFY A;  1ZS4 A;  2WIU B;  3GN5 A;  1UXC A;  2HIN A;  2IU7 A;  2XI8 A;  2XSD C;  3LIS A;  4MCX A;  1JWL A;  2EBY A;  3QQ6 A;  1ZPQ A;  2AW6 A;  3TRB A;  4NDW A;  4JQD A;  2XJ3 A;  4Y42 A;  3OP9 A; 
#chains in the Genus database with same CATH topology
 3C5R A;  3IVP A;  5DBK A;  4BER A;  2QFC A;  4ANV A;  2ZGG A;  3PE3 A;  4X4G A;  2YBD A;  4ATZ D;  3LCA A;  2LYP A;  2IEJ A;  1NER A;  3DXM G;  1CJG A;  4Q2J A;  4AY6 A;  1ZZC A;  2P9U G;  3MYV A;  3TWQ A;  2WXJ A;  2J4B A;  1S7E A;  3V31 A;  3SQV A;  2IY0 C;  3S7J A;  1TN8 A;  3CHQ A;  2DZO A;  3TWT A;  4F6R D;  5JA4 D;  2L1P A;  5JHA A;  3ZFW A;  1V54 E;  1WIZ A;  2HYZ A;  4J6I A;  5AN8 A;  1NA0 A;  3CVY A;  3CK8 A;  3P1U A;  3UIP C;  1YMP A;  4HLL A;  4JW1 A;  1YYH A;  1N54 A;  4ABN A;  2KEI A;  3ZXS A;  1TN7 A;  4LEU A;  3L9T A;  2P9S G;  4U95 D;  3FU6 A;  5LOZ A;  3G0T A;  1BI8 B;  4J8F A;  4RG9 A;  4K0R A;  4QFV A;  4BX8 A;  2XCJ A;  1HO8 A;  3G2U A;  5ENP D;  1O1R A;  4MS6 A;  1D9S A;  1JCR A;  2BNM A;  4G11 A;  4YDO A;  3ULY A;  1SA5 A;  3NOC D;  4YDW A;  5G04 J;  3IHY A;  3KXA A;  3KJX A;  4DLQ A;  5A6C A;  2VGX B;  4KT6 B;  3FEY A;  2JQE A;  3MV3 B;  3AG2 E;  4KBQ A;  5BW8 C;  5EKQ D;  3LIS A;  4TRQ A;  4MRU A;  3QWV A;  4L7T A;  4IYP A;  3KSQ A;  1OCR E;  4KVM A;  5EIB E;  2FJR A;  4U0S A;  2ODR D;  3UM3 A;  2OCC E;  4DX7 D;  1K1B A;  2OOE A;  2XEE A;  4ACK A;  1KT1 A;  3PH0 C;  2PXV A;  1BDH A;  5J08 A;  4EHM A;  2ETB A;  4JHK A;  4PDX A;  3ABK E;  3PEV B;  2ZXW E;  2KBX A;  2AXZ A;  4RLY A;  2WXR A;  3DBS A;  2IOS A;  4GA0 A;  3SCH A;  2R59 A;  3L17 A;  5AQB A;  5ENQ D;  2P9L G;  3D9K A;  5AEN A;  3RRN B;  2BTD A;  2BED A;  2ICP A;  3JUI A;  3CHM A;  3L08 A;  3NZU A;  4ATG A;  2LYR A;  3FYM A;  5J90 A;  1POU A;  1TEZ A;  4UI9 J;  2PPX A;  4I6E A;  1H19 A;  1IHB A;  4YG1 A;  4O1P A;  4I6U A;  2CHW A;  3GBF A;  4QQI A;  3GZ1 A;  4FBI A;  4G24 A;  2M63 A;  1SVX A;  1JCS A;  3IHV A;  4JB8 P;  3JXC L;  3ZUV B;  3Q7F A;  1O5M A;  4XX5 A;  1U3C A;  2WXK A;  1RZR D;  5HI7 A;  3QJZ A;  1HG5 A;  1TNU A;  2KAT A;  2WPV A;  1RZR A;  3B7R L;  2XPY A;  2QYJ A;  5T3R A;  4I9C A;  1U3D A;  4EZJ A;  1PRU A;  3ZYM A;  4A55 A;  1JWL A;  3SNX A;  4BSX A;  2LAI A;  4APO A;  4WWO A;  3HXE A;  3FUN A;  1MHQ A;  1DW9 A;  4N2S A;  4GCN A;  1HXI A;  3FTX A;  2IO2 C;  3CRO L;  4GYY A;  1MQS A;  4FJZ A;  2P9K G;  4EBA A;  2PXD A;  2EIK E;  4P29 A;  2XCC A;  3F6Q A;  3AG1 E;  1WM5 A;  3UM1 A;  1OCZ E;  1E96 B;  4U0U A;  2FBN A;  3G2T A;  3HRA A;  4L23 A;  5CBN A;  4YVO A;  2XRZ A;  4EQZ A;  3ZYQ A;  3A9X A;  5A23 A;  1WY6 A;  4CGW A;  2Y1L E;  2AVP A;  1DVP A;  2YIN A;  1N94 A;  3QAQ A;  3SFX A;  3CHP A;  2L6B A;  2BUG A;  4IRU A;  3MA5 A;  1B89 A;  1WG0 A;  4FU3 A;  5CRV A;  1WH8 A;  5G05 C;  4GZC A;  4BT8 A;  4G25 A;  3QAR A;  3PUJ A;  4GQM A;  2P58 C;  3LY7 A;  3ZNG A;  3UFD A;  1H6P A;  4DK5 A;  1U2Z A;  4WUY A;  1NA3 A;  4I2Z A;  4DRX E;  2EF8 A;  4I9E A;  1OCT C;  5DSX A;  2VEO A;  2X3M A;  2QYU A;  2XS1 A;  5A7D B;  2R03 A;  1HG2 A;  2JVL A;  1JPL A;  3SCG A;  2XXP A;  2LYQ A;  4GTP A;  2C2L A;  4AP2 A;  3T8M A;  1UOH A;  1Z3Y A;  2X6K A;  1EDU A;  3OP9 A;  2CHZ A;  4PH4 B;  2GRO B;  2CG3 A;  4Q96 A;  4HI8 A;  1PC2 A;  3K9I A;  4K5A B;  2LNI A;  2XGM A;  3NAW A;  5FQ6 A;  4GTO A;  3ONL A;  1L1M A;  1OWL A;  3CVL A;  3PS6 A;  2H6H A;  1LD8 A;  3G2W A;  3W9G A;  1JH9 A;  2CFU A;  3D9O A;  2R2L A;  3DWL G;  4I6R A;  1RPE L;  3JQ1 A;  3APF A;  4X4I A;  4DE9 A;  3FWV A;  3IBE A;  4ANX A;  3R7R A;  3ZN3 A;  3B7H A;  3CK9 A;  4A3T A;  5JUW A;  2PUG A;  5FIO A;  3ZPJ A;  1QQA A;  3L1P A;  3FTY A;  3VLE A;  4AXH A;  1ZZ8 A;  1BDI A;  1TNB A;  3QWG A;  3Q5M A;  4K03 A;  1Y7Y A;  1QQE A;  3ABM E;  1AWC B;  5FTP A;  5B3S E;  3OXF A;  2FFH A;  2AUW A;  3ML9 A;  3UT7 A;  3ZRH A;  4CT0 A;  2X6F A;  4GMR A;  3MCX A;  4G26 A;  2UWJ G;  5ENT D;  3DEO A;  2MRI A;  2LSU A;  4JL0 A;  5LP0 A;  4ANU A;  3C3R A;  4OAU C;  2LCV A;  2IF4 A;  2BKK B;  3QOU A;  2J07 A;  1FT1 A;  2YQ8 A;  1Y9Q A;  3FY4 A;  5KNH D;  3RU0 A;  5G2N A;  3RRU A;  3AAA C;  1DNP A;  3D9M A;  3CQC B;  5M72 A;  3CHR A;  5CEA A;  1LD7 A;  4ILH B;  5CHE E;  2JLB A;  2OFY A;  2AJA A;  4NQ0 A;  2L9B A;  4K5B A;  4BET A;  3T8K A;  2VSN A;  2RKK A;  3RJV A;  2OND A;  1NZN A;  4KVO A;  1W3B A;  1FCH A;  4I43 A;  4B94 A;  3PRE A;  3G2V A;  1Y6I A;  5DIZ A;  3TG5 A;  2XIU A;  3OKZ A;  1E7V A;  4GML A;  3Q49 B;  4JHR A;  3NZL A;  3LYA A;  5LCW C;  3S7D A;  1VPW A;  3NB2 A;  2BNO A;  3LDZ A;  2I9C A;  5ENS D;  3GYZ A;  4F1S A;  2F0Y A;  1ELR A;  2EQX A;  2YHC A;  3FH8 A;  2DVW A;  3R7Q A;  4UI9 K;  3EU9 A;  1ZB1 A;  4UQY A;  2C0L A;  3TEP A;  1QZX A;  3TL5 A;  4X4E A;  3Q4A B;  4UWH A;  3ZEF A;  2ICT A;  3QKY A;  3LJ3 A;  4G23 A;  2KM4 A;  3O4Z A;  3CR3 A;  3ZXP A;  2XPZ A;  5BXU A;  3H5T A;  2IJG X;  1OSL A;  3VTX A;  3A9Z A;  4LNU D;  1X5B A;  2WVI A;  4DUI A;  5EX3 A;  3DSX A;  4AV7 A;  4GTQ A;  2KCL A;  2ZIS A;  2DIW A;  4PU3 C;  3QF3 A;  2Y4U A;  1EF1 C;  1HFA A;  4EBA G;  4XZ4 A;  2PZI A;  3AS8 A;  3BG1 B;  3Q9U C;  4UI9 C;  4O8B A;  4TUM A;  4XIF A;  1SQM A;  1UTX A;  2WQ7 A;  2L0I A;  4HRM B;  1LQC A;  4U8Y D;  2GRN B;  1ZZ7 A;  2I1J A;  2GRP B;  5CED B;  2XSD C;  2RFM A;  3TG4 A;  4MCX A;  3BU8 A;  4ER0 A;  4Q69 A;  3TEL A;  2V3C C;  4U63 A;  4GTR A;  1LCC A;  4J8D A;  3DSV A;  4EKI A;  3AJI A;  2WXG A;  3SO8 A;  2BF0 X;  4OVV A;  4KMO A;  1NW3 A;  4W9R A;  3HIZ A;  3HVE A;  2PUC A;  1OUV A;  3TJP A;  3ME5 A;  4J7W A;  4PS7 A;  1UJK A;  3DNV B;  1XNF A;  2KCV A;  2V5F A;  4G8L A;  2A5U A;  3LJN A;  3CVW A;  2IVQ A;  4E6H A;  4FC8 A;  1MZC A;  2WXP A;  3CQG B;  3UX4 A;  3V2X A;  3QOX A;  3SY2 A;  5AIJ A;  4OYS A;  1DC2 A;  1O1T A;  2BKG A;  2J08 A;  4ZFH A;  3V30 A;  4OBM A;  1HF8 A;  2XXA A;  3EHQ A;  1QP4 A;  3LXU X;  1QB2 A;  2X38 A;  4UQX A;  3WXX A;  5KNG A;  1BU9 A;  5ANR A;  2VGY A;  3C3Q A;  1MX2 A;  3AG3 E;  4BT9 A;  4L1B A;  2D5V A;  4N3C A;  2PXE A;  3KEZ A;  4PU8 A;  5G05 J;  2OR1 L;  2IV1 A;  3PUK A;  5B1A E;  1UN9 A;  1YA0 A;  2LAH A;  2IU1 A;  4UWF A;  3UKR G;  1QQB A;  2J7W A;  3FH7 A;  4YBA A;  3Q79 A;  5BXO A;  2VTB B;  1K3Z D;  1DCQ A;  1OCO E;  2VSX E;  4GZD A;  4WWN A;  1OY3 D;  1FPP A;  4XEI G;  3E4B A;  2NSZ A;  1OXJ A;  5EN5 D;  4X8Q A;  4I6J A;  3FU3 A;  4OAV B;  5DRY A;  5JJ7 A;  2EIM E;  1N4Q A;  3ULE G;  3O9X A;  4D10 C;  2LYS A;  1X81 A;  3CVX A;  3FU5 A;  4Z59 A;  1H6O A;  4L2Y A;  1E7U A;  5GAH i;  2HO1 A;  3VWS A;  1E8Z A;  1O1S A;  2J4D A;  4XE0 A;  1N0R A;  4BY6 A;  4EEC A;  2WXN A;  4HOS A;  2Y4T A;  4TXR A;  1GW6 A;  3FHE A;  3GZS A;  2YNQ A;  1Z6T A;  2MOW A;  2B0O E;  2XEN A;  3TXN A;  1N9A A;  4M7C A;  2R5S A;  3FUI A;  4ANW A;  3KD7 A;  4G8K A;  3MJW A;  2H6I A;  2DYS E;  1OWO A;  1Y8M A;  1HF0 A;  3ZU7 B;  4APF A;  4GMJ A;  2AWI A;  1ELK A;  1LLI A;  4U96 D;  3E37 A;  3CVV A;  2LXM A;  2VJ8 A;  3CEQ A;  4YAR A;  4Z5D A;  3ML8 A;  4A1G A;  4X4H A;  2PXP A;  1ZU2 A;  1ZAY A;  3NDB B;  3SHF A;  3ZKJ A;  3Q9N C;  1HZ4 A;  3U66 A;  1QYM A;  2ILR A;  4HOT A;  4NIK A;  3FDH A;  2XHE A;  3FTW A;  2PXK A;  1K8K G;  3IEG A;  4O60 A;  2LSV A;  1KPS B;  4GTT A;  5T4Y A;  2QC9 A;  1RW2 A;  4I1O B;  4JHJ A;  1NP7 A;  5FZQ A;  2ETC A;  2CG2 A;  1LMB 3;  3L6A A;  3GZD A;  3ZHE B;  3FUE A;  5EYL A;  4RG6 A;  2L0T B;  4CT4 A;  3IKO B;  4MBG A;  1MYO A;  1H6K A;  2VGE A;  4U0Z A;  2F8X K;  1BD8 A;  3HXF A;  3B7U X;  2VSO E;  5FJY A;  4CDM A;  1UXD A;  5AJD A;  3MKR A;  1LF8 A;  3T9K A;  2V0P A;  4JA7 A;  2A6C A;  3PZD A;  1QP7 A;  3ASN E;  4KZ0 A;  4GYO A;  1AU7 A;  4EZL A;  3FUH A;  3LY9 A;  1MFQ C;  3TWU A;  1NFI E;  3SF4 A;  2R17 C;  3KL4 A;  5LCW J;  3UT4 A;  2J9Q A;  2I1K A;  4F8D A;  3MZL B;  3T5V A;  3E34 A;  3ASD A;  3UXG A;  3FTU A;  3AG4 E;  2XPI A;  2XGO A;  5E75 A;  1ZBP A;  3EIQ C;  4G1T A;  3OQN A;  5BT1 A;  4I6G A;  3EUV A;  3OXG A;  3FH5 A;  1E3O C;  3Q73 A;  5JHB A;  2X6J A;  3R1F A;  3CIA A;  5KCM A;  4BTA A;  5AJL A;  3ENE A;  3ULQ A;  1OWP A;  3E32 A;  2FF4 A;  5CCL A;  4BEP A;  2NC9 A;  4NRH B;  3V2O A;  4JXT A;  4FLH A;  3RAU A;  3UI2 A;  4NAC A;  4YG4 A;  3TFL A;  2V8S E;  3Q47 B;  3LY8 A;  1ZUG A;  3DSW A;  3FUF A;  3ZHE A;  3APC A;  3HDX A;  2IVB A;  1SW6 A;  1N11 A;  1E8X A;  3CVQ A;  1UXC A;  3TWR A;  2WXH A;  4NDW A;  3GZ2 A;  3NZS A;  1TR4 A;  1FVF A;  1A17 A;  4Z68 A;  4RSY A;  3L16 A;  1HH8 A;  4KYO B;  1TJF A;  3UWP A;  3R09 A;  1ZZB A;  1PER L;  5ARF A;  4CEM A;  4DI3 A;  5D2M C;  3UKU G;  3FFL A;  3MGB A;  5EIL A;  2XQ0 A;  4HQD A;  2PXU A;  4AJW A;  4H7X A;  1E8W A;  3CLC A;  5A7L A;  1FVH A;  4O1O A;  5ARG A;  3GZC A;  3CVP A;  2Y69 E;  3U4T A;  5FQ8 A;  4X4F A;  3DST A;  4N5Q A;  3RKV A;  3PDN A;  5D66 A;  3MLF A;  1BLX B;  3FUM A;  5LX8 A;  2XRY A;  3DPY A;  1R63 A;  2IFU A;  3I5P A;  4KZC A;  2QZA A;  4PU4 C;  3U9W A;  4ACL A;  2PNN A;  1QP0 A;  2A5E A;  3SBS A;  2Y0B G;  4JCY A;  2PUD A;  2B6C A;  1SZ9 A;  3KS2 A;  3MKQ A;  5BV1 A;  2JEK A;  3OAW A;  4LER A;  1DCE A;  4J8S A;  5HQ8 A;  1WH6 A;  3KAE A;  3SGH A;  1SZA A;  4A3V A;  1XGW A;  2WM9 A;  3QNK A;  2R05 A;  3UIO C;  1B0N A;  3ISM C;  4BX9 A;  3CST A;  3BG0 B;  4CYM D;  2DWZ A;  4CCA A;  1PRA A;  3DM5 A;  3JQ0 A;  2F37 A;  3VLD A;  5BNW A;  2IU7 A;  2XI8 A;  4I1M A;  2ION A;  4U04 A;  4WND A;  3FUD A;  2J7U A;  4HBD A;  3C72 A;  3URZ A;  1JFT A;  2P2C P;  4GZ5 A;  4CZ2 D;  5H7P A;  3ZVV A;  3S7B A;  4HI9 A;  2X6I A;  3FU0 A;  4L9P A;  5FQ7 A;  3JCK C;  3APD A;  4HLE A;  5FWQ A;  4FHJ A;  4FA6 A;  3ZHM A;  3I3N A;  4LNG A;  4JA9 A;  1OT8 A;  2F8Y A;  4HFG A;  1NEQ A;  4I2W A;  3QC1 A;  3RIB A;  3AU5 A;  3ASF A;  4KXK B;  3DSU A;  3JXI A;  1PAQ A;  3ESL A;  1GT0 C;  3NXH A;  3ASH A;  3G5G A;  1P5Q A;  2FO1 E;  4DPR A;  4DI4 A;  4ME2 A;  5D0O D;  3BDN A;  1S63 A;  5ENR D;  3ZYL A;  4U07 A;  3PZ4 A;  1JFS A;  3C98 A;  5FZR A;  2HSG A;  4I8T A;  3DSS A;  3EHN A;  4B0Z A;  3EUS A;  3OWQ A;  1JUQ A;  4GA2 A;  3FYA A;  4HRL A;  5AAO A;  3LPZ A;  4A63 B;  3SI5 A;  3GW4 A;  2GRR B;  2GRM A;  2EWT A;  4M3O A;  4YDE A;  2X6H A;  4JCX A;  1IC8 A;  2XGS A;  2WQ6 A;  3CKB A;  3NQP A;  1R69 A;  5D0Q D;  5DTQ A;  4AM9 A;  4LRZ A;  3QQ6 A;  3ASG A;  3ESK A;  3ONK A;  4CRW A;  5FZS A;  3FP3 A;  3FUJ A;  2OEV A;  2JCG A;  3CSF A;  5CCM A;  1HQ1 A;  4N3B A;  1N4R A;  3F51 A;  2MHK A;  2IVG A;  4DX6 D;  4N2Q A;  1QNF A;  3ABL E;  4I17 A;  3UTM A;  4DE8 A;  2A4Z A;  3CGH A;  3FTZ A;  1QPZ A;  3CEC A;  3BEE A;  3B7B A;  3G2S A;  2CSF A;  3NF1 A;  3PXP A;  3CVN A;  2ZU6 B;  3KEA A;  3MV2 B;  4J0U A;  4AIF A;  3JXD L;  3PRZ A;  3CK7 A;  4EKG A;  4NUR A;  5CBO A;  2J09 A;  4BWR A;  3BUA A;  2V4H C;  2FUL A;  2FI7 A;  5GAG i;  2PUA A;  3RRM B;  4X4D A;  2MYO A;  2GGF A;  2VTB A;  3UPV A;  3VTY A;  2LYJ A;  2WMN A;  1PY1 A;  2VQ2 A;  4URK A;  5CMY A;  4HOQ A;  3FUK A;  3MEJ A;  3BQO A;  1HE8 A;  1S70 B;  2PUB A;  4ER6 A;  4MKT A;  2I2O A;  2ZIR A;  2CHX A;  3DEP A;  2PL2 A;  5AQA A;  3GN5 B;  3QK0 A;  2UY1 A;  3RO2 A;  3FTS A;  3CLJ A;  4IA8 A;  3UM0 A;  3SCF A;  3BD1 A;  1UG3 A;  3A9Y A;  1S0P A;  1XWR A;  5AAR A;  3RSE G;  2WXQ A;  3QYX A;  4F1P A;  2LO6 A;  4LSZ E;  3ZKC A;  5HS0 A;  4CDN A;  2DZN A;  4GHJ A;  2LXL A;  2E2E A;  2XCB A;  4Y6C A;  2WXL A;  1ZPQ A;  3TRB A;  4O6F A;  3B7T A;  1WAO 1;  1H2T C;  4ER5 A;  3OXL A;  3HHM A;  1ZVV A;  2HR2 A;  2XXQ A;  4U7E B;  3HXB A;  1D8E A;  2MQK A;  1N4S A;  2OV8 A;  4A1S A;  1IKN D;  1N0Q A;  1E90 A;  4OVU A;  4V3I A;  1VDY A;  1N95 A;  3SD5 A;  3D3M A;  5DT2 A;  4JD2 G;  3JXB C;  2WXI A;  5IY5 E;  2KZT A;  4C9B B;  5KJN A;  5DRT A;  3IXE A;  4ILG A;  3EIJ A;  5C2Y A;  5EX0 A;  5AYW D;  2R1J L;  3SX0 A;  3HZI B;  3L13 A;  1MX4 A;  4JEU A;  2PQR A;  3CHO A;  4IVZ A;  4G2V A;  4EK9 A;  1NI1 A;  3PVL A;  4AEZ C;  3CHS A;  4DX1 A;  1NL4 A;  4JEH A;  2EIN E;  3F6W A;  2HM8 A;  3RO3 A;  2H6G A;  3LKU A;  3SFY A;  3Q15 A;  3D9L A;  4BFR A;  1A5E A;  3EHR A;  4J1X A;  4DX2 A;  1RZS A;  5EDS A;  4JC8 A;  4JVS A;  4B89 A;  3ZGQ A;  3P2B A;  4C48 B;  4BES A;  3MX3 A;  2UY1 B;  3T5X A;  1TJC A;  3DXK G;  4H7Y A;  4J8E A;  4U8H A;  2XS8 A;  1KZP A;  4FN3 A;  5DTM A;  4UUC A;  4LUN U;  2VYI A;  2KEJ A;  2MXD A;  4DJA A;  4ER3 A;  1CQT A;  3L22 A;  3B7S A;  4N39 A;  4XI9 A;  3EJN A;  3D9H A;  4TXP A;  2VSY A;  4BTB A;  2XJ3 A;  4CDR A;  4Y42 A;  4YVQ C;  2RFA A;  3QDN A;  3TWX A;  3TXM A;  3PE5 A;  4IN3 B;  2FEZ A;  1QZ2 A;  3WG7 E;  1KLX A;  1KZO A;  2EIJ E;  3LVR E;  3ZHI A;  1LTX A;  3Q78 A;  2PIJ A;  4FAD A;  2H8R A;  3GUU A;  4YG7 B;  3JYS A;  1ZZ9 A;  4B8A A;  1WET A;  3QOW A;  3LEW A;  2KPJ A;  3F52 A;  3UUX A;  3ZYK A;  4FJY A;  3LVQ E;  2KEK A;  2IQC A;  4B8C B;  3UIN C;  5BUZ A;  1IQU A;  4F7A A;  1YCS B;  4J8Y A;  1G3N B;  2LYK A;  1SQ8 A;  2FO7 A;  2HCN A;  2R63 A;  1HX8 A;  5KWD A;  1INZ A;  4XKC A;  2GRQ B;  2PM7 A;  3FUL A;  4PS8 A;  4LG6 A;  5K98 B;  4BSZ B;  1OWN A;  3TWW A;  1HU3 A;  3C3O A;  3GZD C;  1TYQ G;  2RD0 A;  2BJC A;  4R7L A;  3N71 A;  2PUF A;  3PNT B;  4C0M A;  3TGO A;  1KT0 A;  4AY5 A;  1H2U A;  3VLF A;  1ELW A;  2R02 A;  3RZZ A;  1H0A A;  3U64 A;  4EZI A;  4B93 B;  2PQN A;  2WMO A;  1LCD A;  2QY7 A;  5CEC B;  4WVL A;  1FT2 A;  3HYM B;  3NBN B;  2WIU B;  2HIN A;  3CV0 A;  1H2V C;  4JQD A;  1WDY A;  3M9L A;  5KJM A;  3ZW3 A;  3PZ3 A;  1MJ0 A;  4GTS A;  1OCC E;  4TUU A;  3TWV A;  5ITZ F;  3LFP A;  2P9N G;  3O48 A;  4YDY A;  1JCQ A;  1BPO A;  3SFZ A;  4WAF A;  1BI7 B;  4IUL A;  4UQZ A;  1DWK A;  4ZHB A;  3QWP A;  2LLW A;  2O38 A;  4Z58 A;  5E76 A;  4FP7 A;  2NXP A;  4DX5 D;  5BV0 A;  1IHG A;  1E8Y A;  4GZ3 A;  4HRA A;  3KSL A;  3SZ7 A;  3G7D A;  2YHE A;  4HS2 A;  3FMY A;  3OTN A;  4Q94 A;  4X4B A;  3CVU A;  4GTV A;  4I6T A;  2PXL A;  4HNA D;  5CRU A;  2BNN A;  5G55 A;  4FLB A;  2OEW A;  4HXI A;  2L49 A;  5G04 C;  4MLP A;  2LUH A;  3PE4 A;  1V55 E;  4Z5H A;  2WQH A;  4GAA A;  4GPM A;  3ZPX A;  1Z3X A;  3Q75 A;  5JMN D;  3EHM A;  3OQO A;  2O4A A;  3LQX A;  2DCP A;  4GU5 A;  1EFA A;  3Q7A A;  2NYJ A;  1X57 A;  2PUE A;  4CGV A;  2L6J A;  2MEZ A;  3S7F A;  1Q2Z A;  3TAX A;  2KXP C;  3PNL B;  4UWL A;  3UQ3 A;  1UN8 A;  1ADR A;  2KZ8 A;  1SA4 A;  3X2Q E;  4ILI A;  2M4H A;  5KBA A;  3D9J A;  2PXT A;  3PZ1 A;  4L2L A;  4WWP A;  3NRO A;  2XZT G;  3GN5 A;  5CMW A;  1TNZ A;  4HB5 A;  3QFI A;  4PS3 A;  1TNY A;  2XZD G;  3JXJ A;  3U3W A;  4K5C A;  5FT9 A;  3SR4 A;  3SBT B;  3S8Q A;  3B13 A;  2ETA A;  4GB9 A;  5ENO D;  5FIN A;  5T8I A;  3FEX A;  4UWK A;  3UMV A;  3R9A B;  5JJ6 A;  3ZIM A;  1IXV A;  2P9I G;  3QWW A;  1N4P A;  4GCO A;  2PXB A;  2WXM A;  4HOU A;  1RIO A;  4AVX A;  1ZZ6 A;  2P9P G;  1TNO A;  4MCT A;  1JWF A;  4TXQ A;  5EID A;  2CRO A;  5FQ4 A;  2B5A A;  1DUL A;  2Q7F A;  4TV3 A;  3V79 K;  1OWM A;  2PXQ A;  2DBA A;  3OQM A;  1S64 A;  4RVB A;  4E85 A;  3I4R B;  4F3V A;  2H6F A;  2ZGD A;  3AS5 A;  4N3A A;  4RQI A;  2O49 A;  5B1B E;  4J1W A;  1U2V G;  1QBQ A;  3AS4 A;  2OVF A;  4HOR A;  2GRL A;  3IV0 A;  4FHK A;  5DTR A;  4YND A;  3HG0 D;  2XEV A;  3TWS A;  3E30 A;  3DRA A;  2RG8 A;  2WB2 A;  2XEH A;  5BPP A;  5HKP A;  3ASO E;  4JZY A;  5AQ9 A;  2PM6 A;  3NOG D;  4JPS A;  2GZU A;  3D9N A;  2WXO A;  2AXU A;  4IWR A;  3QB2 A;  1YSE A;  4WNG A;  4PUC A;  3JUE A;  1RZ4 A;  3MKQ B;  5EYP F;  4LNB A;  3BS3 A;  5JJT A;  1IYG A;  2L8N A;  2EIL E;  1PRV A;  5CER B;  1EPU A;  3J5P A;  4GYW A;  2HFZ A;  1N52 A;  4DLO A;  3PZ2 A;  3EDT B;  4GPK A;  1ZS4 A;  1D8D A;  3UM2 A;  2HCS A;  2EBY A;  3W9F A;  4C0E A;  3VK0 A;  1L5J A;  3R9M A;  4LCT A;  4I1A A;  1X2L A;  4F53 A;  4AOF A;  2KZT B;  2C0M A;  1JWG A;  4Y6W A;  3FTV A;  3I4G A;  1UW4 B;  1UJJ A;  4FUL A;  2LYL A;  4UWG A;  4X4C A;  2E0I A;  2IOL A;  4HVB A;  5HRY A;  2GW1 A;  3D9I A;  5KJK A;  2I6H A;  1TN6 A;  5KJL A;  3L82 A;  2CFZ A;  4EQF A;  2WUS R;  5LFA A;  4OB4 A;  2J8S D;  3MEK A;  2AXV A;  2V5Q C;  2Y3A A;  2DYR E;  3UT8 A;  4ER7 A;  4PU7 A;  3L54 A;  3RK6 A;  2HE0 A;  2JAB A;  1Z5S C;  2LLV A;  5ENN A;  2VGX A;  4EPZ A;  2KCK A;  2OVB A;  1HS6 A;  1MX6 A;  3B95 A;  3D9P A;  2PXF A;  1IQR A;  3D1N I;  4EZK A;  4GA1 A;  5ANL A;  3KZ3 A;  2J49 A;  4HRN A;  2IUO A;  3J5Q B;  4N5C A;  3DPD A;  4GTM A;  4GZ6 A;  1AP7 A;  4WNF A;  3LS8 A;  2V4L A;  4XI0 A;  3CKC A;  3AU4 A;  3EU5 A;  1EYH A;  2LNM A;  3HXC A;  3HVE B;  4U8V D;  3OMT A;  1PNR A;  4WNE A;  2PE5 A;  3E33 A;  3PEU B;  2WXF A;  4Z5C A;  5C1D A;  4XKB A;  1K1A A;  2IO3 C;  3HXD A;  3S2A A;  2KC7 A;  2AW6 A;  5AQ7 A;  1O4X A; 
#chains in the Genus database with same CATH homology
 3NZS A;  1FVF A;  1NZN A;  1A17 A;  3QDN A;  4KVO A;  3TXM A;  1W3B A;  3IVP A;  1FCH A;  4RSY A;  3L16 A;  1HH8 A;  4I43 A;  2FEZ A;  3PRE A;  3G2V A;  4IN3 B;  4KYO B;  1QZ2 A;  1TJF A;  1Y6I A;  2QFC A;  4ANV A;  5DIZ A;  3TG5 A;  2XIU A;  1KLX A;  1ZZB A;  3LVR E;  3ZHI A;  1E7V A;  3PE3 A;  1PER L;  2PIJ A;  4X4G A;  3Q49 B;  4GML A;  4JHR A;  5ARF A;  4CEM A;  4FAD A;  3LCA A;  4DI3 A;  2LYP A;  1NER A;  3LYA A;  1CJG A;  2H8R A;  3S7D A;  5LCW C;  1ZZC A;  4AY6 A;  1VPW A;  4YG7 B;  3JYS A;  1ZZ9 A;  3MYV A;  3FFL A;  2BNO A;  2WXJ A;  3LDZ A;  3MGB A;  4B8A A;  1WET A;  2J4B A;  2XQ0 A;  3GZ2 A;  2I9C A;  3LEW A;  1S7E A;  2KPJ A;  3GYZ A;  3F52 A;  3UUX A;  3ZYK A;  1ELR A;  2EQX A;  3LVQ E;  2YHC A;  4FJY A;  2KEK A;  2IQC A;  3S7J A;  4B8C B;  4F1S A;  3CHQ A;  4AJW A;  4H7X A;  1E8W A;  3FH8 A;  3CLC A;  5A7L A;  1IQU A;  5BUZ A;  4F7A A;  5JHA A;  1FVH A;  3R7Q A;  3ZFW A;  5ARG A;  3CVP A;  1WIZ A;  2LYK A;  2HYZ A;  4J6I A;  4UI9 K;  3U4T A;  5FQ8 A;  4UQY A;  1SQ8 A;  2FO7 A;  2C0L A;  4X4F A;  3TL5 A;  2R63 A;  1NA0 A;  3CVY A;  3RKV A;  1HX8 A;  4X4E A;  3CK8 A;  3Q4A B;  3PDN A;  4UWH A;  1INZ A;  4XKC A;  3MLF A;  3P1U A;  2PM7 A;  3ZEF A;  3FUL A;  3FUM A;  4PS8 A;  5LX8 A;  2ICT A;  2XRY A;  1R63 A;  3QKY A;  4JW1 A;  2IFU A;  1N54 A;  5K98 B;  3I5P A;  3LJ3 A;  4KZC A;  1OWN A;  4G23 A;  2KM4 A;  3O4Z A;  3CR3 A;  4ABN A;  4PU4 C;  2XPZ A;  2KEI A;  3ZXS A;  3U9W A;  4LEU A;  4ACL A;  1HU3 A;  1QP0 A;  3H5T A;  3FU6 A;  3SBS A;  5LOZ A;  2IJG X;  1OSL A;  2OND A;  2RD0 A;  4JCY A;  4J8F A;  2PUD A;  4RG9 A;  4K0R A;  1SZ9 A;  3KS2 A;  4QFV A;  3VTX A;  3MKQ A;  4BX8 A;  5BV1 A;  2JEK A;  2BJC A;  1X5B A;  2XCJ A;  3OAW A;  3N71 A;  2PUF A;  1HO8 A;  3G2U A;  4R7L A;  3PNT B;  4C0M A;  3TGO A;  1KT0 A;  2WVI A;  5EX3 A;  4LER A;  4AY5 A;  4MS6 A;  1H2U A;  4G11 A;  2BNM A;  4J8S A;  4AV7 A;  2KCL A;  5HQ8 A;  3VLF A;  1WH6 A;  4PU3 C;  2DIW A;  3QF3 A;  2Y4U A;  3KAE A;  3SGH A;  1EF1 C;  1ELW A;  1SZA A;  1HFA A;  4A3V A;  3RZZ A;  5G04 J;  4EBA G;  1XGW A;  2WM9 A;  3QNK A;  4XZ4 A;  2PZI A;  3AS8 A;  3IHY A;  1H0A A;  3BG1 B;  4UI9 C;  5DBK A;  3U64 A;  1B0N A;  3KXA A;  3KJX A;  4O8B A;  4BX9 A;  4XIF A;  4DLQ A;  3CST A;  5A6C A;  3BG0 B;  1SQM A;  2VGX B;  1UTX A;  4KT6 B;  2WQ7 A;  4CCA A;  2L0I A;  3FEY A;  2PQN A;  1PRA A;  1LQC A;  2WMO A;  1LCD A;  3JQ0 A;  3MV3 B;  2QY7 A;  4KBQ A;  3VLD A;  5BNW A;  5BW8 C;  3HYM B;  1ZZ7 A;  2I1J A;  2WIU B;  2HIN A;  2IU7 A;  2XI8 A;  3CV0 A;  2XSD C;  4I1M A;  2ION A;  4U04 A;  3LIS A;  4MCX A;  1H2V C;  4WND A;  5EKQ D;  3TG4 A;  3FUD A;  4JQD A;  4TRQ A;  4MRU A;  4Q69 A;  3QWV A;  4L7T A;  4U63 A;  1JFT A;  3URZ A;  3ZW3 A;  4IYP A;  5KJM A;  4TUU A;  3LFP A;  1LCC A;  4GZ5 A;  3O48 A;  4J8D A;  3ZVV A;  3S7B A;  1BPO A;  4KVM A;  2FJR A;  4U0S A;  2X6I A;  3SFZ A;  4WAF A;  2WXG A;  3FU0 A;  2BF0 X;  4OVV A;  4IUL A;  4UQZ A;  1DWK A;  4KMO A;  5FQ7 A;  4W9R A;  3HIZ A;  3APD A;  3JCK C;  3HVE A;  2PUC A;  1OUV A;  3QWP A;  2O38 A;  4HLE A;  3TJP A;  2OOE A;  4Z58 A;  5E76 A;  4FP7 A;  2NXP A;  4PS7 A;  5FWQ A;  1KT1 A;  3PH0 C;  4ACK A;  5BV0 A;  1UJK A;  4FHJ A;  1BDH A;  5J08 A;  3DNV B;  1IHG A;  1E8Y A;  1XNF A;  2KCV A;  4GZ3 A;  2V5F A;  4FA6 A;  3ZHM A;  3SZ7 A;  3I3N A;  2A5U A;  3G7D A;  2YHE A;  4JHK A;  3CVW A;  2IVQ A;  4HS2 A;  3FMY A;  4JA9 A;  3PEV B;  4PDX A;  4E6H A;  3OTN A;  4FC8 A;  4Q94 A;  4X4B A;  3CVU A;  4HFG A;  2WXP A;  1NEQ A;  2AXZ A;  4I2W A;  3QC1 A;  3RIB A;  4I6T A;  3AU5 A;  3ASF A;  2WXR A;  4KXK B;  3DBS A;  2IOS A;  3CQG B;  1PAQ A;  3UX4 A;  4GA0 A;  3SCH A;  2R59 A;  3L17 A;  2BNN A;  3ESL A;  5G55 A;  4D10 C;  5AIJ A;  1GT0 C;  4FLB A;  3ASH A;  3D9K A;  5AEN A;  4HXI A;  4OYS A;  3G5G A;  1P5Q A;  3RRN B;  2L49 A;  2BTD A;  4DPR A;  2ICP A;  3JUI A;  3CHM A;  3L08 A;  5G04 C;  3NZU A;  4DI4 A;  4ME2 A;  2LYR A;  5D0O D;  4ATG A;  3FYM A;  5J90 A;  3BDN A;  1POU A;  4MLP A;  4UI9 J;  1TEZ A;  2PPX A;  4I6E A;  3ZYL A;  3PE4 A;  1H19 A;  4U07 A;  2J08 A;  1JFS A;  3C98 A;  4Z5H A;  2WQH A;  4YG1 A;  5FZR A;  4I6U A;  4GAA A;  2CHW A;  2HSG A;  4I8T A;  1HF8 A;  3EHN A;  1QP4 A;  4B0Z A;  1Z3X A;  3EUS A;  3GBF A;  1JUQ A;  3GZ1 A;  3EHM A;  3LXU X;  4GA2 A;  3OQO A;  4FBI A;  2O4A A;  4G24 A;  2M63 A;  2DCP A;  3FYA A;  2X38 A;  3IHV A;  4GU5 A;  3LPZ A;  3JXC L;  1EFA A;  4UQX A;  3WXX A;  5ANR A;  3SI5 A;  2VGY A;  1X57 A;  2PUE A;  4XX5 A;  1U3C A;  2WXK A;  3GW4 A;  1RZR D;  2MEZ A;  2L6J A;  4CGV A;  5HI7 A;  3QJZ A;  4L1B A;  2D5V A;  3S7F A;  4BT9 A;  2GRM A;  2EWT A;  4M3O A;  3TAX A;  4N3C A;  2X6H A;  3KEZ A;  1HG5 A;  4PU8 A;  4JCX A;  5G05 J;  2OR1 L;  3PNL B;  2IV1 A;  3PUK A;  4UWL A;  3UQ3 A;  1UN8 A;  1ADR A;  2KZ8 A;  2KAT A;  2WPV A;  1UN9 A;  1YA0 A;  1RZR A;  1IC8 A;  2LAH A;  2IU1 A;  2XGS A;  2XPY A;  1QQB A;  3B7R L;  4ILI A;  4I9C A;  4UWF A;  3CKB A;  5T3R A;  2WQ6 A;  3FH7 A;  3D9J A;  1R69 A;  3NQP A;  4YBA A;  5D0Q D;  2VTB B;  1U3D A;  4L2L A;  4WWP A;  4AM9 A;  4EZJ A;  1PRU A;  3GN5 A;  3ZYM A;  4LRZ A;  4A55 A;  5CMW A;  2VSX E;  1JWL A;  4GZD A;  4WWN A;  3SNX A;  3QQ6 A;  4BSX A;  2LAI A;  3ASG A;  3ESK A;  3ONK A;  4PS3 A;  4APO A;  4CRW A;  4WWO A;  5FZS A;  3FP3 A;  3FUJ A;  3E4B A;  3FUN A;  1MHQ A;  2JCG A;  1DW9 A;  2NSZ A;  4GCN A;  4N2S A;  3U3W A;  3CSF A;  5CCM A;  1HXI A;  3FTX A;  5FT9 A;  3SBT B;  4N3B A;  3F51 A;  3S8Q A;  2IVG A;  3CRO L;  2MHK A;  1MQS A;  1QNF A;  3B13 A;  4FJZ A;  4GB9 A;  4GYY A;  4N2Q A;  4I6J A;  3FU3 A;  4I17 A;  4EBA A;  5T8I A;  5JJ7 A;  3FEX A;  4UWK A;  3UMV A;  2A4Z A;  3O9X A;  3CGH A;  3FTZ A;  1QPZ A;  4P29 A;  5JJ6 A;  3R9A B;  3CEC A;  3ZIM A;  3BEE A;  2LYS A;  3CVX A;  3FU5 A;  4Z59 A;  2XCC A;  4L2Y A;  3G2S A;  2CSF A;  3NF1 A;  1E7U A;  3PXP A;  3CVN A;  3QWW A;  1WM5 A;  2ZU6 B;  3MV2 B;  2HO1 A;  4GCO A;  4HOU A;  2WXM A;  4J0U A;  1RIO A;  4AIF A;  4AVX A;  1ZZ6 A;  3JXD L;  1E96 B;  4U0U A;  3PRZ A;  2FBN A;  4MCT A;  1E8Z A;  1JWF A;  3CK7 A;  3G2T A;  2J09 A;  4NUR A;  2CRO A;  2J4D A;  4BWR A;  4L23 A;  4XE0 A;  4BY6 A;  4YVO A;  5FQ4 A;  2XRZ A;  2B5A A;  2Q7F A;  4EEC A;  3ZYQ A;  4TV3 A;  1OWM A;  2FUL A;  5A23 A;  2FI7 A;  1WY6 A;  4CGW A;  2PUA A;  2DBA A;  2WXN A;  3RRM B;  3OQM A;  4HOS A;  4X4D A;  2AVP A;  4RVB A;  2Y4T A;  3I4R B;  4E85 A;  1DVP A;  2YIN A;  4F3V A;  1GW6 A;  2GGF A;  3FHE A;  3QAQ A;  3AS5 A;  4N3A A;  2VTB A;  3GZS A;  3UPV A;  3CHP A;  3VTY A;  2O49 A;  1Z6T A;  2YNQ A;  4J1W A;  2MOW A;  2LYJ A;  2WMN A;  1PY1 A;  2VQ2 A;  2OVF A;  3AS4 A;  3TXN A;  2BUG A;  4IRU A;  3MA5 A;  4HOR A;  2GRL A;  1B89 A;  3IV0 A;  4FU3 A;  4FHK A;  4HOQ A;  3FUK A;  5CMY A;  4YND A;  4URK A;  2XEV A;  1WH8 A;  1HE8 A;  2PUB A;  2RG8 A;  5G05 C;  2WB2 A;  2R5S A;  3FUI A;  4MKT A;  2I2O A;  3KD7 A;  4GZC A;  4ANW A;  4G25 A;  3QAR A;  4BT8 A;  2CHX A;  5BPP A;  3PUJ A;  4GQM A;  2PL2 A;  2P58 C;  3LY7 A;  3MJW A;  3UFD A;  3GN5 B;  1OWO A;  1Y8M A;  1HF0 A;  4JZY A;  4APF A;  4GMJ A;  4DK5 A;  2PM6 A;  1ELK A;  2AWI A;  3QK0 A;  4JPS A;  2GZU A;  2UY1 A;  3RO2 A;  3D9N A;  1LLI A;  2WXO A;  3FTS A;  3CVV A;  4WUY A;  2AXU A;  4IWR A;  1NA3 A;  3QB2 A;  1YSE A;  4WNG A;  4I2Z A;  3CLJ A;  2EF8 A;  4IA8 A;  4I9E A;  4PUC A;  1OCT C;  2VJ8 A;  3SCF A;  3CEQ A;  4YAR A;  4Z5D A;  3ML8 A;  4A1G A;  4X4H A;  1ZU2 A;  3MKQ B;  1ZAY A;  3BD1 A;  3SHF A;  2X3M A;  1UG3 A;  1HZ4 A;  5A7D B;  3U66 A;  1S0P A;  1HG2 A;  2JVL A;  3BS3 A;  1JPL A;  2ILR A;  3SCG A;  5JJT A;  1XWR A;  2L8N A;  1IYG A;  4CDR A;  1PRV A;  4HOT A;  1EPU A;  2WXQ A;  4GYW A;  3FDH A;  2LYQ A;  3QYX A;  2XHE A;  2LO6 A;  3FTW A;  2C2L A;  3ZKC A;  1N52 A;  4AP2 A;  4DLO A;  4CDN A;  3IEG A;  4GHJ A;  2LSV A;  5T4Y A;  2E2E A;  3EDT B;  3T8M A;  4GPK A;  1ZS4 A;  2XCB A;  4Y6C A;  2WXL A;  4I1O B;  4JHJ A;  1NP7 A;  2EBY A;  1ZPQ A;  5FZQ A;  3TRB A;  1Z3Y A;  2X6K A;  1EDU A;  4O6F A;  4C0E A;  3B7T A;  3OP9 A;  3VK0 A;  1L5J A;  1WAO 1;  2CG2 A;  1H2T C;  3OXL A;  2CHZ A;  3HHM A;  4LCT A;  4I1A A;  1X2L A;  1ZVV A;  1LMB 3;  3L6A A;  4F53 A;  3ZHE B;  4PH4 B;  2HR2 A;  3FUE A;  2CG3 A;  4Q96 A;  4RG6 A;  2L0T B;  4AOF A;  2KZT B;  4CT4 A;  1PC2 A;  3K9I A;  3IKO B;  2MQK A;  2C0M A;  2LNI A;  2XGM A;  2OV8 A;  4A1S A;  1JWG A;  5FQ6 A;  4Y6W A;  3FTV A;  3I4G A;  1UW4 B;  1UJJ A;  1E90 A;  4FUL A;  1H6K A;  4OVU A;  4V3I A;  1VDY A;  2LYL A;  3ONL A;  4U0Z A;  3SD5 A;  1L1M A;  1OWL A;  3CVL A;  3D3M A;  4UWG A;  4X4C A;  2E0I A;  2IOL A;  3JXB C;  2WXI A;  4HVB A;  3PS6 A;  3G2W A;  2GW1 A;  3B7U X;  2VSO E;  3D9I A;  5KJK A;  1JH9 A;  2CFU A;  2I6H A;  3D9O A;  5FJY A;  2KZT A;  1UXD A;  4CDM A;  5AJD A;  5KJL A;  2CFZ A;  4EQF A;  2WUS R;  3MKR A;  5LFA A;  4C9B B;  1LF8 A;  4OB4 A;  2V0P A;  4JA7 A;  3MEK A;  2AXV A;  2A6C A;  4I6R A;  3PZD A;  1RPE L;  3JQ1 A;  5KJN A;  2Y3A A;  1QP7 A;  3APF A;  4X4I A;  4ILG A;  3FWV A;  4KZ0 A;  4GYO A;  3UT8 A;  1AU7 A;  3EIJ A;  5C2Y A;  5EX0 A;  4PU7 A;  3IBE A;  5AYW D;  4ANX A;  4EZL A;  2R1J L;  3FUH A;  3L54 A;  3R7R A;  3RK6 A;  3B7H A;  3HZI B;  3ZN3 A;  3LY9 A;  3L13 A;  3CK9 A;  4A3T A;  3SF4 A;  2R17 C;  4JEU A;  2PQR A;  3CHO A;  4IVZ A;  4G2V A;  5LCW J;  2PUG A;  3UT4 A;  2J9Q A;  4B94 A;  2I1K A;  4F8D A;  3MZL B;  3PVL A;  3ZPJ A;  3T5V A;  1QQA A;  3L1P A;  3FTY A;  5ENN A;  4AEZ C;  3CHS A;  2VGX A;  3ASD A;  4EPZ A;  2KCK A;  2OVB A;  3VLE A;  4AXH A;  1ZZ8 A;  1HS6 A;  1BDI A;  4JEH A;  3D9P A;  3F6W A;  3QWG A;  3FTU A;  2HM8 A;  2XPI A;  3Q5M A;  2XGO A;  4K03 A;  3RO3 A;  1Y7Y A;  1IQR A;  5E75 A;  3LKU A;  3D1N I;  1ZBP A;  1QQE A;  3EIQ C;  4EZK A;  5FTP A;  3Q15 A;  4G1T A;  3OQN A;  3D9L A;  3OXF A;  4GA1 A;  5ANL A;  4BFR A;  2AUW A;  3KZ3 A;  3ML9 A;  4I6G A;  3UT7 A;  3ZRH A;  4J1X A;  5BT1 A;  2J49 A;  3OXG A;  4CT0 A;  3FH5 A;  1E3O C;  2X6F A;  1RZS A;  5EDS A;  5JHB A;  4JC8 A;  2X6J A;  2IUO A;  3R1F A;  3CIA A;  3MCX A;  4G26 A;  4JVS A;  5KCM A;  5AJL A;  4B89 A;  4BTA A;  3ENE A;  4N5C A;  3DPD A;  3ULQ A;  1OWP A;  2UWJ G;  3ZGQ A;  4GZ6 A;  2MRI A;  3P2B A;  2FF4 A;  5CCL A;  2LSU A;  2UY1 B;  3MX3 A;  3T5X A;  4JL0 A;  4WNF A;  5LP0 A;  3LS8 A;  4ANU A;  1TJC A;  2NC9 A;  4NRH B;  4JXT A;  4FLH A;  2LCV A;  2IF4 A;  4H7Y A;  3QOU A;  2V4L A;  4J8E A;  4U8H A;  2J07 A;  2VSY A;  4NAC A;  4XI0 A;  4YG4 A;  1Y9Q A;  4FN3 A;  2V8S E;  2YQ8 A;  3FY4 A;  3CKC A;  3RU0 A;  3AU4 A;  5G2N A;  3Q47 B;  3RRU A;  4LUN U;  2VYI A;  3D9M A;  1DNP A;  1EYH A;  3CQC B;  2KEJ A;  5M72 A;  3CHR A;  1ZUG A;  3LY8 A;  3HVE B;  3OMT A;  1PNR A;  3FUF A;  4WNE A;  2PE5 A;  4ILH B;  3PEU B;  4DJA A;  3ZHE A;  3APC A;  3HDX A;  1CQT A;  2JLB A;  3L22 A;  5CHE E;  2IVB A;  2WXF A;  4Z5C A;  3B7S A;  5C1D A;  4N39 A;  2OFY A;  4NQ0 A;  3CVQ A;  1E8X A;  2L9B A;  1UXC A;  4XKB A;  4XI9 A;  2WXH A;  3EJN A;  3S2A A;  2KC7 A;  2VSN A;  3RJV A;  2AW6 A;  4NDW A;  4BTB A;  2XJ3 A;  4Y42 A;  4YVQ C;  1O4X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...