2GRLA

Crystal structure of dct/icf10 complex
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
287
structure length
287
Chain Sequence
b'MFKIGSVLKQIRQELNYHQIDLYSGIMSKSVYIKVEADSRPISVEELSKFSERLGVNFFEILNRAGMNTKSVNETGKEKLLISKIFTNPDLFDKNFQRIEPKRLTSLQYFSIYLGYISIAHHYNIEVPTFNKTITSDLKHLYDKRTTFFGIDYEIVSNLLNVLPYEEVSSIIKPMYPIVDSFGKDYDLTIQTVLKNALTISIMNRNLKEAQYYINQFEHLKTIKNISINGYYDLEINYLKQIYQFLTDKNIDSYLNAVNIINIFKIIGKEDIHRSLVEELTKISAKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PrgX
publication title Molecular basis for control of conjugation by bacterial pheromone and inhibitor peptides.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Transcription
total genus 112
structure length 287
sequence length 287
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2grlA01
1.25.40.400 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2grlA02
1RIOA 2GRMA 4PU8A 1QP0A 1OSLA 1Y7YA 2BNNA 3LFPA 1YSEA 3KZ3A 1RZRD 1LCCA 2PUGA 3G7DA 2AXZA 1JH9A 2A6CA 4Z59A 1CQTA 2IU7A 3BD1A 1R63A 1NEQA 4YARA 4YG4A 1ZZ8A 1O4XA 2PUFA 3CLCA 2IVGA 3F51A 4GHJA 2LYJA 3CROL 3O9XA 4X4GA 2XCJA 3QQ6A 4O8BA 4PU7A 2LCVA 4MCXA 2PUEA 2O38A 1QQAA 1WH8A 1ZUGA 3QYXA 4X4FA 2MQKA 1QPZA 2PPXA 3B7HA 3MLFA 4Z5HA 1IC8A 1LQCA 2L8NA 2ICPA 1ZPQA 3SCGA 3CECA 4PU3C 3FYAA 2LYSA 4YBAA 3F6WA 1L1MA 3KJXA 1E3OC 1WH6A 4X4BA 4IA8A 1Y9QA 2KEKA 1PRVA 3PXPA 1EFAA 3SCHA 3IVPA 3EUSA 4J1XA 3GN5A 1POUA 1WETA 3R1FA 4YG1A 3D1NI 2BJCA 2OR1L 3ZHIA 1ADRA 4Z58A 2HSGA 2AUWA 1OCTC 1VPWA 4JQDA 2KEIA 1XWRA 3FMYA 2PUAA 1LLIA 1AU7A 3OP9A 1LMB3 3FYMA 1ZZ9A 2JCGA 2LYLA 2WIUB 4Z5DA 3S8QA 3L1PA 1PRUA 2KEJA 2L49A 5A7LA 2IVQA 3DNVB 1ZS4A 2EBYA 1ZZBA 2KZ8A 1ZZ6A 3QF3A 1BDIA 1GT0C 2GZUA 3TRBA 2EF8A 1PNRA 3JXBC 1JFTA 1ZAYA 2IV1A 3HZIB 1PRAA 1BDHA 2GRLA 3JXCL 3OQOA 1NERA 2HINA 4NDWA 1ZZ7A 4I6TA 1WIZA 3QWGA 3RZZA 1UXCA 2PUCA 2PUDA 2D5VA 1R69A 1B0NA 1S7EA 2LYRA 2XIUA 4PU4C 2JVLA 4I8TA 2R63A 3OMTA 2ICTA 2OFYA 2WUSR 1JWLA 2AXVA 1CJGA 4JCYA 4FN3A 2B5AA 3BS3A 4MCTA 1DW9A 4F8DA 4X4EA 3UFDA 1HF0A 4X4DA 2H8RA 2O49A 2R1JL 2PUBA 2IVBA 2AWIA 4JCXA 4YG7B 3OQNA 1UTXA 2LYPA 2MEZA 2BNOA 2XJ3A 1LCDA 2CROA 3U3WA 3F52A 1UXDA 2BNMA 3LISA 3OQMA 3ZHMA 2XI8A 1QP7A 2FJRA 1QP4A 2LYKA 2KPJA 3GN5B 4I6UA 1SQ8A 3KXAA 4I6RA 4X4HA 2XSDC 3JXDL 2O4AA 2CSFA 1RPEL 3VK0A 1ZZCA 4IVZA 3ZKCA 1QQBA 4OB4A 1PERL 4IWRA 4J1WA 1JFSA 4Y42A 2LYQA 1DWKA 2IUOA 3BDNA 1ZVVA 4FBIA 3G5GA 3H5TA 1X57A 3SCFA 2PIJA 4X4CA 1X2LA 2AW6A 2AXUA 3GBFA 2PE5A 4GQMA 4X4IA 5K98B 2EWTA 4Z5CA 1RZRA 1RZSA
chains in the Genus database with same CATH superfamily
1RIOA 4KZCA 3MGBA 1L5JA 1MX4A 4JC8A 5BV0A 3R9MA 1H6PA 4Z59A 3QNKA 4V3IA 4ANXA 2WXRA 3VTYA 3CR3A 2LYJA 3D9OA 2HM8A 4O60A 1OWLA 2I1KA 3NF1A 1PY1A 5AARA 3Q7AA 3PNLB 5B1BE 3APFA 3FUKA 2BEDA 3HVEA 4BESA 2KZTA 5CCLA 4F1SA 4FULA 3SX0A 1POUA 3D9MA 3NAWA 1UN8A 3ZHIA 2QZAA 4JHRA 4K5BA 2KEIA 1TR4A 1RW2A 1LLIA 3CLJA 3CK8A 4HRLA 1DCQA 2A5UA 4AY6A 3Q15A 3D9LA 2P9SG 3DSVA 4NQ0A 3G2UA 3FUNA 2DIWA 3HZIB 1BDHA 3ASGA 5BXUA 5EIBE 4AV7A 3E4BA 3PZ2A 5ARGA 4RG6A 4WNDA 2KCVA 3FP3A 5E75A 2ODRD 1TNYA 4HXIA 2F8YA 2YQ8A 3CVVA 1HF0A 4U8HA 5DT2A 2AVPA 4ILIA 2PXEA 3LISA 3QB2A 2BKGA 3NZSA 1N52A 3FH7A 2WM9A 1UW4B 2LYKA 3F6QA 2E2EA 4CYMD 3O48A 3FWVA 1LD7A 3UXGA 3BG0B 3FUFA 3JQ0A 2LUHA 4GQMA 3FU5A 4X4IA 2EWTA 3GZSA 3NDBB 1QZ2A 3RSEG 4LERA 3ONKA 2Q7FA 2BNNA 4FU3A 3CROL 3JUEA 1ZBPA 1FVFA 3LKUA 1TN8A 3MYVA 5KJNA 1WH8A 2L6BA 2MQKA 1QB2A 1IC8A 2VGEA 2ICPA 4UI9J 3Q78A 1ZPQA 1DCEA 3UIOC 2QFCA 4N3CA 1HX8A 2R5SA 4IA8A 2P9NG 3PXPA 2WXIA 3IVPA 3R7QA 3GN5A 2RFAA 2R03A 3EHMA 5KJMA 2NC9A 2PUAA 1AU7A 4OBMA 1JPLA 4UWGA 4RQIA 4JL0A 4N5QA 1ZS4A 4AP2A 2VSXE 3HVEB 3HHMA 3PNTB 2KZTB 2DBAA 5EX0A 4XE0A 3QWGA 1K3ZD 3DEPA 2PXKA 4Q94A 3FTYA 4ME2A 1INZA 1DW9A 4X4EA 3UKUG 4JCXA 3OQNA 5DTRA 1NZNA 3PDNA 3ZHMA 2J4DA 3VWSA 4GPKA 1RPEL 4ER7A 3FUEA 3JXJA 5LX8A 4OB4A 3RU0A 2HO1A 2WQ7A 4GMRA 4Y42A 3FULA 4WNEA 2AXUA 5AQBA 4DRXE 1EYHA 1P5QA 4YDWA 3Q7FA 2VTBB 2GRMA 4PU8A 5B3SE 3KS2A 4G25A 3UI2A 2VEOA 2WXQA 2C0LA 4JA9A 5A23A 4ANUA 5JHBA 3Q9NC 2P9KG 4TXQA 2PNNA 2PXDA 3V31A 4DE9A 1LQCA 2VSOE 3UTMA 3FH8A 5FIOA 2MYOA 3I5PA 1WH6A 4HFGA 3I4RB 3ULYA 3R1FA 5FZSA 2IO2C 5JA4D 4O1OA 1XWRA 4JB8P 4ACKA 3FYMA 2FEZA 2JLBA 1OWOA 5ENOD 4GZ5A 5T4YA 3QF3A 5BV1A 5AAOA 3TRBA 2LLWA 4JHKA 4W9RA 4FADA 4L9PA 1EPUA 1UXCA 3R9AB 2PXVA 1UOHA 1NW3A 4I8TA 3V2OA 2UWJG 1S0PA 4M3OA 4DPRA 2O49A 1UJKA 2MHKA 1HFAA 3ZPJA 2ZU6B 5AN8A 2Y69E 2IEJA 3V2XA 5FQ4A 3W9FA 5A7DB 3BQOA 4GYWA 3EUVA 4TV3A 1E8XA 3KXAA 2LAHA 2X6KA 4EZLA 4EKIA 3B7SA 3UMVA 3HXFA 3ZYMA 1PERL 3J5PA 3E30A 4JPSA 5T8IA 3QK0A 2YHCA 1YMPA 1MQSA 3ML9A 5KCMA 4Z5CA 2V4HC 5J08A 3B7RL 2B6CA 3ZHEA 4J8YA 4WUYA 3KZ3A 3SO8A 3CVUA 4U7EB 2KC7A 3LYAA 4HI9A 1ZU2A 3CLCA 3EU9A 2IVGA 1ELKA 3O9XA 5G04J 2XCJA 4PU7A 1OT8A 2I2OA 4EKGA 4BWRA 4AEZC 3ML8A 1QPZA 5FZQA 3S7JA 4PU3C 1A5EA 4J8EA 3ULQA 4YVOA 4C9BB 3Q75A 4FA6A 3SFXA 3C3RA 3OAWA 4DK5A 4GTTA 3ZXSA 2P9LG 4AY5A 4LUNU 3UUXA 5BW8C 4I9CA 4CT4A 2CG3A 4CT0A 3UM3A 1E8YA 2L49A 1SVXA 2WMNA 2RKKA 4GTMA 5AQ7A 2EBYA 2OCCE 2XXPA 2IY0C 3CVWA 3Q4AB 1DULA 5CBOA 5BXOA 3PZ4A 2GRLA 3CHOA 2F37A 2PL2A 5FZRA 3HXDA 2J7UA 4OAUC 4ER5A 3C72A 2XCCA 3FY4A 4Q2JA 4YG7B 3FDHA 5BT1A 3BU8A 4HVBA 2CROA 4GMJA 1NA0A 1WDYA 2XSDC 2J08A 4UWHA 3BEEA 2H6HA 1QQBA 3V30A 3QARA 4Y6CA 3DSXA 2IJGX 2LSUA 4XKBA 3BDNA 2XS1A 2P9UG 3Q73A 2EINE 4I1OB 4DI3A 3QOUA 2J9QA 4I6JA 4ABNA 1JWFA 2YBDA 4EQFA 3TXMA 4X8QA 2HR2A 5AYWD 4FJZA 1TNZA 3ZYLA 2WXFA 1BD8A 4N3BA 3QWWA 3QJZA 3GZCA 1KZPA 4OVVA 3SQVA 2Y4UA 3FFLA 4WWOA 4EHMA 3DXKG 1Z6TA 3HXCA 2FFHA 2V5FA 1MZCA 2PM7A 3RKVA 4X4BA 5EYLA 2GW1A 1QQEA 5DTMA 3MEJA 2OVBA 3EUSA 4CCAA 3ASHA 5GAGi 2CHZA 2Y0BG 4GU5A 2V0PA 5ENQD 1FCHA 1E7UA 3BG1B 2VYIA 4UWFA 4I6EA 4PUCA 1HE8A 3E32A 3AU5A 2GZUA 4CDRA 5D2MC 3JXBC 2KCLA 3OQOA 1NERA 2HINA 3FU6A 4GTSA 4I6TA 1O5MA 1D9SA 1R69A 1ELRA 3AS5A 5ENRD 2GRQB 3BS3A 4O1PA 2WB2A 4A1GA 4XI9A 4GTVA 4AJWA 2LNIA 3LXUX 3QKYA 3ZNGA 2DCPA 5EN5D 4BX8A 3JXDL 3ZIMA 2CSFA 2NYJA 3ZKCA 3KL4A 3QFIA 4JXTA 3LQXA 2ETAA 5AQ9A 3CGHA 2PXFA 4J8DA 3MX3A 1OWMA 3IV0A 2LXMA 3ISMC 1O1SA 1QP0A 1OSLA 4FHJA 4ILHB 1LCCA 5C2YA 2Y1LE 4AXHA 1JH9A 3HXEA 2XS8A 2J7WA 3ASFA 1V55E 2VGXA 4HRMB 3CK7A 1HG5A 3AJIA 4LNUD 3QYXA 1Y6IA 4Z5HA 2KXPC 1MX2A 1E3OC 4WAFA 5ENSD 1HS6A 2WXLA 2FO1E 5H7PA 4E6HA 2OR1L 3EJNA 3TEPA 3DSUA 3SZ7A 3JCKC 2VSNA 3D9KA 3ZEFA 1YA0A 3UWPA 2X6FA 3HDXA 1N4PA 4K03A 1G3NB 4HRAA 2ZGDA 2DZNA 2XPYA 5ITZF 5BNWA 2DZOA 4JA7A 2AXVA 1H6OA 1MHQA 3R09A 3AS8A 3OTNA 3NXHA 2PUBA 3AG2E 3LEWA 3Q47B 4APOA 3CHSA 3TWVA 3TG5A 2XJ3A 1LCDA 2CG2A 3MKQA 2XGSA 2E0IA 4GAAA 4GTOA 3B95A 3MEKA 3T8KA 4F1PA 3ESLA 1H2TC 2LYQA 1DWKA 2IUOA 3TL5A 4DX6D 2XEEA 4X4CA 1SZAA 1N4SA 3G2SA 4B93B 3M9LA 2WXNA 1V54E 1RZSA 4A55A 3TWRA 3MKRA 3S2AA 3LFPA 4U8YD 3IXEA 1CQTA 3FUDA 3FHEA 4X4GA 4RLYA 3FU0A 4EK9A 1S63A 1E90A 2YINA 3B7HA 4TUMA 3TAXA 4UWKA 3ZPXA 2LYSA 4YBAA 3ASDA 1TJFA 4BSZB 5ENTD 4ER3A 4FC8A 5CEDB 5CCMA 2OV8A 3Q9UC 1IKND 4BERA 2VGXB 3FTVA 2WXKA 4I2WA 2XRYA 3VLFA 1FVHA 2NSZA 4J0UA 1TYQG 4BTBA 2V8SE 4DX1A 4XZ4A 4G8LA 3RRUA 4NIKA 3JXCL 3DEOA 3RZZA 4CRWA 1LTXA 2L6JA 4CEMA 2EIME 3CHQA 3ZYQA 4JCYA 3PEVB 4WWPA 1QZXA 1YCSB 1IXVA 3K9IA 4L2YA 2BNOA 2ILRA 3PH0C 3I4GA 4ANVA 4IVZA 4HOSA 3FUIA 3DPDA 3CSFA 1JFSA 3T5VA 2FBNA 2A4ZA 1N54A 3B7BA 2AW6A 2L1PA 4U0ZA 1H0AA 4DUIA 2H6IA 2PQNA 4GCNA 4U04A 5CMWA 2GRRB 3G0TA 3F51A 4GHJA 3EIJA 2QYJA 4BTAA 5FQ7A 4HRNA 4BFRA 1N9AA 3J5QB 4GA0A 3UT7A 3IBEA 2XPZA 3PRZA 4MRUA 3SF4A 2IOLA 2FF4A 2OEWA 4A63B 5A6CA 1LF8A 1X5BA 4A1SA 4EZKA 5D0OD 4U8VD 4JQDA 2LYLA 2JCGA 3PEUB 3L1PA 2WVIA 5AIJA 2IVQA 5KJLA 4EQZA 4P29A 3ASNE 3RRNB 3MV3B 2EF8A 4L2LA 3SD5A 1Q2ZA 5G2NA 3S7FA 3OXLA 2J4BA 3CHPA 2R2LA 3I3NA 2PUCA 4GYOA 2RFMA 1S7EA 4ZFHA 2CFZA 5DIZA 2BF0X 1JWLA 4GA2A 4YDEA 4FN3A 2GRPB 4KZ0A 1W3BA 4I1MA 5EX3A 5G05C 2MEZA 1RZ4A 1HXIA 4GA1A 4WVLA 4HLLA 5C1DA 3GN5B 4I6UA 2JEKA 4I2ZA 2JABA 1ZZCA 1TEZA 3JYSA 4I17A 4PS8A 4J1WA 1MFQC 3MV2B 4FBIA 3FTUA 4Y6WA 3NOCD 3QOXA 4DE8A 2PQRA 3EDTB 4GMLA 3MJWA 1LD8A 1U3DA 4X4FA 3U9WA 4B94A 3APDA 1RZRD 3A9XA 4AVXA 3CVXA 2Y3AA 4M7CA 3FH5A 4YVQC 1DNPA 2XCBA 2IU7A 5FQ6A 4JZYA 4YDYA 2H6GA 3JXIA 3QQ6A 4MCXA 4DLQA 4UI9K 2O38A 2WXGA 4A3TA 3GZDC 3FYAA 1ELWA 4U95D 1O1TA 3SNXA 4EZJA 2VQ2A 4AOFA 4Z68A 3SR4A 4BT9A 3GZ1A 3NQPA 3BUAA 1ADRA 2BJCA 1N11A 3KD7A 3RO2A 3S8QA 4G8KA 4KVMA 3DNVB 1UN9A 2DWZA 3RIBA 2ZISA 3DBSA 4BEPA 3Q49B 5B1AE 2EILE 4BETA 2KCKA 2EIJE 3SBTB 1QBQA 1Z3XA 3IHVA 3LJNA 4LG6A 4TRQA 2A5EA 2YNQA 1N94A 2WUSR 5CEAA 2V3CC 2H8RA 3CVPA 1UTXA 2ZGGA 3UT8A 4BT8A 4CDNA 5JUWA 4E85A 3SBSA 1MJ0A 4B89A 3QC1A 3L6AA 3CEQA 3A9ZA 2HE0A 5DRTA 3D9PA 3URZA 5D0QD 5IY5E 2FO7A 1X2LA 3HG0D 2XXAA 1ZB1A 1AP7A 1D8DA 3G2TA 4Q96A 2LO6A 1Y7YA 2X38A 5DTQA 4PS7A 1H2UA 3ZUVB 2P58C 1R63A 1ZZ8A 5ENNA 3D9NA 3L54A 3AS4A 2DVWA 1NA3A 1ZUGA 3GZDA 4FLHA 1K8KG 3MLFA 4LCTA 4IN3B 3KJXA 3ABKE 1QYMA 3P2BA 3SHFA 5LCWC 1BI7B 4Z58A 4AIFA 1OCTC 4UWLA 1U3CA 1ZZ9A 1SW6A 4JEUA 1HZ4A 2X6JA 3IHYA 1K1BA 2XEHA 3AU4A 1PRUA 1FT1A 2XENA 2KATA 3ZHEB 4CZ2D 1ZZBA 2DYRE 4HLEA 5JJTA 4GTPA 3TWXA 2M63A 1PNRA 5GAHi 2IV1A 4CDMA 1SA4A 4GZDA 1SQMA 3IKOB 3G2VA 1N95A 3ZU7B 3E37A 1D8EA 3AG1E 3QOWA 4XIFA 3EHRA 5JJ7A 4X4DA 5EKQD 3RK6A 1U2ZA 4HORA 3QDNA 1H19A 3CVLA 3APCA 4BX9A 3O4ZA 1SQ8A 4TXRA 5FWQA 4B8AA 3VTXA 1EDUA 5FINA 5CMYA 3FTZA 3SCFA 3DM5A 5BPPA 3MA5A 5FJYA 4EPZA 2V5QC 2ONDA 3CQCB 2HCSA 1RZRA 1U2VG 4FLBA 1KT1A 4XX5A 3DXMG 4U96D 3LY9A 2WXPA 5FT9A 3JQ1A 2PUGA 3SI5A 4J7WA 1EF1C 1OCRE 3NROA 2VGYA 3DRAA 4NRHB 3L82A 2PUEA 3R7RA 1QQAA 5LFAA 2PPXA 1JWGA 1TNUA 2CFUA 4UQZA 1UJJA 2P2CP 3CVYA 2KEKA 4F6RD 4GCOA 4ACLA 1VPWA 1TNBA 3U66A 1SA5A 4GTQA 2QYUA 2L0IA 2WXHA 3FU3A 1TJCA 2EIKE 4MKTA 2OVFA 2XHEA 2KEJA 5A7LA 3UIPC 4OAVB 3ZKJA 1HH8A 1GT0C 3TWQA 4KMOA 5CHEE 5E76A 5FQ8A 1ZAYA 2IF4A 5M72A 2LAIA 4GB9A 4ER0A 1DC2A 3AG3E 4I43A 4WNFA 4C48B 1CJGA 2R02A 3FTWA 3IEGA 3EHNA 4JW1A 3HYMB 2C2LA 3VLDA 3SGHA 2IVBA 2AWIA 1IQRA 3UT4A 4HOQA 2CHWA 4R7LA 2XQ0A 3F52A 3OQMA 4WNGA 2WMOA 3QWVA 4D10C 4ILGA 4HNAD 5HRYA 5LOZA 1IHBA 4YDOA 4UQXA 1ZVVA 1N0RA 3H5TA 3LCAA 2UY1A 2PIJA 1BLXB 3KAEA 3CV0A 1OXJA 3Q5MA 2XXQA 3RJVA 2LSVA 4PDXA 4CGWA 1FT2A 3AG4E 5AENA 3LDZA 2AXZA 4PH4B 1DVPA 1S70B 2WQ6A 2RD0A 3FUJA 4O8BA 2IO3C 4LNGA 5EIDA 3CQGB 1NP7A 4UI9C 3OXGA 3B13A 1WG0A 3ENEA 5EDSA 4LSZE 4QFVA 5ANLA 3KEAA 4QQIA 3ONLA 1EFAA 2J8SD 1WETA 3D1NI 2XGOA 3KEZA 4G24A 4GZ3A 3L17A 5FTPA 4G23A 4J6IA 5CRUA 4UUCA 3JUIA 1BU9A 3LY8A 1E8WA 2HFZA 1JFTA 1KZOA 3UQ3A 2VSYA 4ATGA 2VTBA 3MCXA 2MXDA 2PXQA 3DSTA 1WM5A 3A9YA 4I6GA 2M4HA 3SY2A 2ZXWE 2PXPA 3PUKA 5G55A 1OY3D 3L13A 2I9CA 1JCQA 1BI8B 3UM2A 5CRVA 2KPJA 2PXTA 2O4AA 2PZIA 5KNHD 3E33A 4B0ZA 4U0UA 4NACA 3PZ1A 4H7YA 3QAQA 4HS2A 1X81A 5LP0A 1X57A 2DYSE 2I1JA 2QC9A 2PE5A 2HYZA 4L1BA 3DWLG 1XGWA 1FPPA 4G11A 3LVRE 4F3VA 3TJPA 4XEIG 3ZYKA 2C0MA 4IYPA 3KSQA 2XEVA 2MRIA 1WY6A 3PE3A 2I6HA 3L9TA 2UY1B 2VJ8A 1NEQA 1O4XA 4G26A 3V79K 2BKKB 1N0QA 4KXKB 1NFIE 2GGFA 3HXBA 1HQ1A 3RAUA 1HU3A 5AJLA 3MKQB 1MYOA 2XZDG 4EECA 3CKCA 3F6WA 4KYOB 4O6FA 4HOTA 3KSLA 1Y9QA 3SCHA 3TWSA 3PREA 1LMB3 2WIUB 1E7VA 3CVQA 5D66A 3WG7E 4A3VA 1Z5SC 2FI7A 3NOGD 1BDIA 1HG2A 3ASOE 3ZW3A 4AM9A 1H2VC 4NDWA 1WIZA 2PUDA 1Y8MA 2WXOA 3PZDA 3TXNA 2JVLA 2WPVA 2ICTA 2OFYA 3PE4A 4LRZA 1K1AA 3ZGQA 2V4LA 3UFDA 4YNDA 3MZLB 3RRMB 2RG8A 5CBNA 5JJ6A 2LYPA 3FTSA 2J49A 3LJ3A 3TWTA 3U4TA 4GZCA 4F53A 1E96B 3G2WA 2XI8A 2FJRA 1QP4A 1KPSB 3W9GA 1YYHA 4LEUA 2PXUA 3VK0A 2P9IG 3OKZA 4EZIA 5CECB 2H6FA 3TELA 4ZHBA 2R05A 1TN6A 4HI8A 1WAO1 4KBQA 3CHRA 3AAAC 3FUMA 2PXLA 1QNFA 3C98A 4EBAG 2AJAA 4FHKA 3HRAA 2A6CA 4JEHA 3TFLA 3NZUA 4YARA 2X6IA 2PUFA 5G04C 2L0TB 3ULEG 3UM1A 2XRZA 3ESKA 1H6KA 4N39A 2P9PG 4G1TA 4C0EA 4U0SA 1IYGA 2B0OE 3SCGA 3S7DA 5KNGA 1L1MA 3GW4A 3CK9A 3ZFWA 4HOUA 3EIQC 2WQHA 2QY7A 1BPOA 2R59A 2J07A 3DPYA 5JMND 1IHGA 4JVSA 2HSGA 4APFA 2AUWA 3WXXA 4N2QA 4ER6A 4KVOA 3UPVA 4GPMA 2J09A 3N71A 1N4QA 3EHQA 1SZ9A 2KZ8A 3NB2A 3OXFA 1IQUA 1TN7A 3ME5A 3ABME 5ENPD 2ETCA 2NXPA 2JQEA 4N5CA 1ZZ7A 1JUQA 2F0YA 4J8FA 4MBGA 3DSSA 3LVQE 2XIUA 1KT0A 1NL4A 5KBAA 3NZLA 4F8DA 4DJAA 5ANRA 3CIAA 5HKPA 2R1JL 4ATZD 5G05J 4K5AB 3UX4A 4I1AA 3TG4A 4WWNA 5DBKA 4K0RA 3D3MA 1UXDA 2IOSA 2MOWA 3E34A 3L22A 4PS3A 4LNBA 3TWWA 5J90A 3SFYA 1NI1A 4K5CA 3GBFA 1OWPA 4GYYA 3CSTA 2OEVA 4HBDA 2LXLA 1A17A 3FUHA 2WXMA 4UQYA 4URKA 2HCNA 3C5RA 4HB5A 1VDYA 3T8MA 4N3AA 2GROB 3CKBA 3ZVVA 3BD1A 1HF8A 2R17C 2XPIA 4GTRA 3C3QA 2FULA 4L7TA 2IQCA 2LCVA 1JCRA 5CERB 3TGOA 2CHXA 4XKCA 1KLXA 5HI7A 4BY6A 3SFZA 1OCCE 2L8NA 3FEYA 4BSXA 5EILA 3D9JA 4C0MA 5KWDA 3LS8A 4J1XA 4Q69A 2BTDA 5DSXA 2PXBA 4DI4A 3FMYA 5BUZA 3OP9A 1O1RA 3S7BA 4EBAA 4J8SA 2EQXA 3GUUA 2KBXA 1ZZ6A 5AJDA 5DRYA 3LY7A 3GZ2A 2D5VA 4OVUA 1B0NA 2XGMA 3OMTA 4TUUA 2XZTG 5AQAA 3PZ3A 2X3MA 2B5AA 4MCTA 4U63A 1PAQA 4MLPA 3Q79A 1Z3YA 3C3OA 3PE5A 1XNFA 2ZIRA 3FTXA 4IULA 3P1UA 3PS6A 4F7AA 1OCOE 5KJKA 4X4HA 3VLEA 4I6RA 2IU1A 4HQDA 2OOEA 4RG9A 3ZXPA 2BUGA 5HQ8A 3G5GA 3PUJA 1OWNA 3OWQA 2ETBA 1B89A 3ZRHA 1JCSA 5K98B 2LNMA 3TWUA 1OUVA 3DSWA 4FJYA 4G2VA 4RVBA 2LLVA 1YSEA 2Y4TA 3T5XA 3G7DA 5T3RA 3L08A 4CGVA 4YG4A 5JHAA 2PM6A 4DX5D 4KT6B 4I9EA 3ZN3A 2IFUA 1HO8A 1TNOA 4JHJA 3CVNA 4L23A 3CHMA 4DX2A 1S64A 3CECA 3T9KA 4TXPA 4U07A 1PRVA 4RSYA 3D9HA 4ANWA 5LCWJ 4YG1A 3FEXA 3B7UX 4MS6A 1GW6A 3EU5A 4Z5DA 3LPZA 2GRNB 1N4RA 1AWCB 1PC2A 3UKRG 2YHEA 3UINC 2X6HA 3RO3A 1PRAA 1MX6A 5ARFA 3HIZA 2LYRA 4PU4C 2R63A 3U64A 3NBNB 1OCZE 3GYZA 2F8XK 4JD2G 4XI0A 3D9IA 3PVLA 4H7XA 4B8CB 3U3WA 2BNMA 1QP7A 4IRUA 4NURA 4FP7A 3X2QE 4DLOA 5EYPF 4N2SA 4GZ6A 4IWRA 3QWPA 1E8ZA 2IONA 3ABLE 2KM4A 3UM0A 3B7TA 3L16A 5HS0A 1UG3A 2L9BA 4OYSA 4DX7D 2WXJA
chains in the Genus database with same CATH topology
1RIOA 3U9WA 2C0MA 1JWFA 4KZCA 3ZYKA 3MGBA 4IYPA 4EQFA 4B94A 3TXMA 2XEVA 2HR2A 3APDA 5AYWD 1RZRD 2MRIA 1WY6A 1L5JA 4AVXA 3CVXA 2Y3AA 4JC8A 3FH5A 3PE3A 5BV0A 2I6HA 4YVQC 1DNPA 4ABNA 4Z59A 2XCBA 4FJZA 3ZYLA 2IU7A 3QNKA 2WXFA 2UY1B 2VJ8A 1NEQA 1O4XA 4JZYA 4G26A 5FQ6A 4N3BA 4V3IA 4ANXA 3QWWA 2WXRA 3QJZA 3CR3A 3VTYA 2LYJA 3D9OA 2HM8A 3QQ6A 4KXKB 1OWLA 2GGFA 4OVVA 4MCXA 2I1KA 4UI9K 4DLQA 2O38A 2Y4UA 3FFLA 4WWOA 3NF1A 1HU3A 1Z6TA 1PY1A 2V5FA 2WXGA 4A3TA 5AJLA 3MKQB 4EECA 3CKCA 3PNLB 3FYAA 1ELWA 3F6WA 3APFA 4KYOB 4O6FA 3SNXA 4EZJA 3FUKA 4HOTA 2VQ2A 2PM7A 3HVEA 4AOFA 3RKVA 4X4BA 4BT9A 3GZ1A 1Y9QA 2GW1A 2KZTA 1QQEA 5CCLA 4F1SA 4FULA 3SCHA 3NQPA 2OVBA 3EUSA 4CCAA 1POUA 3D9MA 1ADRA 1UN8A 2BJCA 3ZHIA 4JHRA 3ASHA 2KEIA 2CHZA 3KD7A 3PREA 1LLIA 1LMB3 2V0PA 3CLJA 4GU5A 3RO2A 2WIUB 1E7UA 1FCHA 1E7VA 3CK8A 3CVQA 3S8QA 3BG1B 2A5UA 4KVMA 4AY6A 3Q15A 2VYIA 4UWFA 4A3VA 3DNVB 3D9LA 2FI7A 1UN9A 4I6EA 4PUCA 1HE8A 3AU5A 4NQ0A 1BDIA 3G2UA 3DBSA 3FUNA 3RIBA 2GZUA 4CDRA 3Q49B 1HG2A 3JXBC 2DIWA 2KCKA 3HZIB 1BDHA 3ASGA 3ZW3A 2KCLA 4AM9A 3SBTB 3OQOA 1NERA 2HINA 4NDWA 1H2VC 1Z3XA 4I6TA 1WIZA 2PUDA 1Y8MA 3FU6A 3IHVA 4RG6A 5ARGA 4TRQA 4WNDA 2KCVA 3FP3A 1R69A 1ELRA 2WXOA 3PZDA 5E75A 2JVLA 2YNQA 2WPVA 3TXNA 3AS5A 2ICTA 2OFYA 2WUSR 3PE4A 4LRZA 4HXIA 2YQ8A 3ZGQA 2V4LA 3CVVA 3BS3A 1HF0A 3UFDA 2H8RA 4YNDA 3MZLB 2WB2A 4U8HA 4A1GA 3RRMB 2AVPA 2RG8A 3CVPA 5JJ6A 4XI9A 1UTXA 2LYPA 4ILIA 2LNIA 3LXUX 3QKYA 3UT8A 4AJWA 3FTSA 2J49A 3LJ3A 4BT8A 4CDNA 3U4TA 4GZCA 4F53A 1E96B 3LISA 3G2WA 3E4BA 2XI8A 3QB2A 3NZSA 1N52A 3FH7A 2DCPA 2FJRA 1QP4A 2LYKA 1UW4B 2WM9A 2E2EA 3SBSA 4BX8A 3JXDL 3ZIMA 4LEUA 2CSFA 3VK0A 3O48A 4B89A 3ZKCA 3FWVA 3QC1A 4JXTA 3L6AA 3CEQA 4DI4A 3BG0B 3FUFA 3JQ0A 3D9PA 3URZA 5D0QD 1WAO1 2FO7A 3CGHA 3CHRA 4KBQA 1X2LA 4J8DA 4GQMA 3FU5A 3MX3A 4X4IA 1OWMA 3FUMA 3IV0A 2EWTA 3GZSA 1QNFA 3C98A 1QZ2A 4LERA 3G2TA 3ONKA 4Q96A 4EBAG 1QP0A 2LO6A 1OSLA 1Y7YA 2Q7FA 2X38A 4FHJA 2BNNA 4ILHB 1LCCA 5C2YA 4FHKA 4AXHA 1JH9A 2A6CA 1H2UA 4JEHA 4PS7A 2P58C 3NZUA 1R63A 4FU3A 4YARA 1ZZ8A 2PUFA 2X6IA 3D9NA 5ENNA 3ASFA 3L54A 3AS4A 5G04C 3CROL 2L0TB 1ZBPA 1FVFA 3LKUA 2VGXA 2XRZA 3CK7A 1HG5A 3MYVA 5KJNA 1NA3A 3ESKA 1H6KA 1WH8A 1ZUGA 3QYXA 1Y6IA 2MQKA 4FLHA 4N39A 3MLFA 4Z5HA 1IC8A 4G1TA 4LCTA 4C0EA 4U0SA 2ICPA 4UI9J 1IYGA 1ZPQA 3SCGA 4IN3B 3S7DA 1L1MA 2QFCA 4N3CA 3GW4A 3KJXA 1E3OC 3CK9A 4HOUA 1HX8A 2R5SA 4WAFA 3ZFWA 3EIQC 3P2BA 4IA8A 2WQHA 2QY7A 1BPOA 3PXPA 1HS6A 2WXIA 2WXLA 2R59A 3SHFA 5LCWC 2J07A 3IVPA 2OR1L 3R7QA 3GN5A 3EJNA 4E6HA 1IHGA 4Z58A 4JVSA 2HSGA 4AIFA 2AUWA 1OCTC 3EHMA 4APFA 5KJMA 3WXXA 4UWLA 2NC9A 4N2QA 2PUAA 1AU7A 1JPLA 1U3CA 4UWGA 1ZZ9A 4JEUA 1HZ4A 2X6JA 3IHYA 3AU4A 4KVOA 3SZ7A 1PRUA 3UPVA 3JCKC 2VSNA 3D9KA 2J09A 3N71A 4JL0A 1ZS4A 1SZ9A 2KATA 3ZEFA 1YA0A 3ZHEB 4AP2A 1ZZBA 2VSXE 3HVEB 2KZ8A 2X6FA 3HHMA 3HDXA 4HLEA 3PNTB 3OXFA 1IQUA 5JJTA 2KZTB 2DBAA 2M63A 1PNRA 2IV1A 5EX0A 4K03A 2NXPA 4CDMA 4N5CA 1ZZ7A 1JUQA 4J8FA 3QWGA 4GZDA 4XE0A 3LVQE 2XPYA 2XIUA 5BNWA 1SQMA 4Q94A 3FTYA 1KT0A 3IKOB 4JA7A 4ME2A 2AXVA 3G2VA 1INZA 1MHQA 4F8DA 4XIFA 1DW9A 4X4EA 4DJAA 4E85A 5ANRA 4X4DA 3AS8A 3CIAA 2R1JL 3OTNA 2PUBA 4JCXA 3LEWA 5EKQD 5G05J 3UX4A 3OQNA 4I1AA 3RK6A 3Q47B 3TG4A 3CHSA 1NZNA 4APOA 3PDNA 4WWNA 2XJ3A 1LCDA 4K0RA 5DBKA 3TG5A 4HORA 3QDNA 1H19A 2CG2A 3CVLA 3D3MA 1UXDA 3ZHMA 3MKQA 4U63A 2IOSA 2MOWA 3APCA 2XGSA 2E0IA 2J4DA 4BX9A 3O4ZA 1SQ8A 4GAAA 5FWQA 4GPKA 3L22A 1RPEL 4PS3A 3FUEA 5J90A 3MEKA 5LX8A 4OB4A 3RU0A 3ESLA 2HO1A 2WQ7A 4Y42A 1H2TC 2LYQA 3FULA 1DWKA 3VTXA 2IUOA 4WNEA 1EDUA 4B8AA 3TL5A 5CMYA 3FTZA 3SCFA 4X4CA 1SZAA 5BPPA 2AXUA 3GBFA 1OWPA 3MA5A 4GYYA 5FJYA 3CSTA 1EYHA 3G2SA 4EPZA 1P5QA 2ONDA 2WXNA 3CQCB 1A17A 1RZRA 1RZSA 4A55A 4FLBA 2VTBB 3FUHA 1KT1A 4XX5A 2GRMA 4PU8A 3MKRA 3LY9A 2WXMA 2WXPA 4UQYA 3S2AA 5FT9A 4URKA 3LFPA 3JQ1A 3KS2A 2PUGA 3SI5A 1VDYA 3T8MA 4N3AA 1EF1C 4G25A 3CKBA 3ZVVA 1CQTA 2WXQA 3BD1A 1HF8A 2R17C 2C0LA 2XPIA 4JA9A 5A23A 3FUDA 4ANUA 2VGYA 2FULA 5JHBA 3FHEA 4X4GA 4NRHB 4L7TA 5JJ7A 2IQCA 2LCVA 2PUEA 3FU0A 3R7RA 1QQAA 3TGOA 5LFAA 2CHXA 1E90A 2YINA 1KLXA 4XKCA 2PPXA 3B7HA 5HI7A 4BY6A 3SFZA 1JWGA 3TAXA 1LQCA 2L8NA 2CFUA 3U66A 2VSOE 4UWKA 3FH8A 3FEYA 4AV7A 2LYSA 4YBAA 4UQZA 3ASDA 4BSXA 1TJFA 3I5PA 3D9JA 4FC8A 1WH6A 1UJJA 4C0MA 3CVYA 4HFGA 5CCMA 3LS8A 2KEKA 2OV8A 3I4RB 4J1XA 4Q69A 3R1FA 5FZSA 4GCOA 2BTDA 2VGXB 3FTVA 4ACLA 1VPWA 2WXKA 1XWRA 3FMYA 2XRYA 4I2WA 3VLFA 4ACKA 3OP9A 3S7BA 3FYMA 2L0IA 2WXHA 3FU3A 5BUZA 1TJCA 4EBAA 2FEZA 1FVHA 2JLBA 2NSZA 4MKTA 4J8SA 2EQXA 2OVFA 2XHEA 2KEJA 4J0UA 5A7LA 1OWOA 4GZ5A 5T4YA 4BTBA 2V8SE 1HH8A 1ZZ6A 3QF3A 4XZ4A 5AJDA 1GT0C 5BV1A 3TRBA 4KMOA 5CHEE 5E76A 3RRUA 5FQ8A 1ZAYA 2IF4A 4JHKA 5M72A 4W9RA 3JXCL 2LAIA 3LY7A 4GB9A 4FADA 3RZZA 1UXCA 1EPUA 3R9AB 3GZ2A 4CRWA 2D5VA 4OVUA 1B0NA 4I8TA 2L6JA 4I43A 2XGMA 4CEMA 3OMTA 4WNFA 2UWJG 3CHQA 4TUUA 1S0PA 4M3OA 1CJGA 4JCYA 3PEVB 3ZYQA 2X3MA 4DPRA 3FTWA 3IEGA 2B5AA 4MCTA 2O49A 1UJKA 3EHNA 4JW1A 2MHKA 1HFAA 1PAQA 3HYMB 2C2LA 4MLPA 3VLDA 3SGHA 2IVBA 2AWIA 3ZPJA 1IQRA 2ZU6B 3K9IA 3UT4A 4L2YA 2BNOA 4HOQA 2CHWA 1Z3YA 4R7LA 2ILRA 5FQ4A 1XNFA 2XQ0A 3F52A 3OQMA 3PH0C 3FTXA 5A7DB 4GYWA 4WNGA 4IULA 3P1UA 3PS6A 4F7AA 3I4GA 4TV3A 1E8XA 4X4HA 2WMOA 3KXAA 2LAHA 4I6RA 3QWVA 3VLEA 5KJKA 2X6KA 4EZLA 4D10C 3B7SA 4ILGA 4IVZA 3UMVA 2IU1A 3ZYMA 4ANVA 4HOSA 2OOEA 3FUIA 5LOZA 4RG9A 3DPDA 1PERL 3CSFA 1JFSA 3T5VA 2FBNA 2BUGA 4UQXA 1ZVVA 2A4ZA 5HQ8A 3G5GA 3H5TA 1N54A 3LCAA 3PUJA 4JPSA 2UY1A 2PIJA 1OWNA 5T8IA 2AW6A 2YHCA 3QK0A 3KAEA 4U0ZA 1B89A 1MQSA 3ZRHA 5K98B 3CV0A 3ML9A 1OUVA 5KCMA 1H0AA 3Q5MA 4Z5CA 5J08A 4FJYA 4G2VA 2PQNA 3B7RL 3RJVA 2LSVA 3ZHEA 4RVBA 4PDXA 4GCNA 4U04A 4CGWA 4WUYA 1YSEA 3KZ3A 2Y4TA 5CMWA 3T5XA 3G7DA 5AENA 3CVUA 5T3RA 3LDZA 2AXZA 4PH4B 2KC7A 1DVPA 3L08A 1ZU2A 3CLCA 2RD0A 4YG4A 3LYAA 4CGVA 5JHAA 2WQ6A 2IVGA 1ELKA 3F51A 2PM6A 4GHJA 3FUJA 3O9XA 5G04J 2XCJA 4PU7A 4O8BA 3EIJA 4KT6B 2I2OA 4I9EA 3ZN3A 4BTAA 4BWRA 2IFUA 4AEZC 1HO8A 3ML8A 4JHJA 1QPZA 5FQ7A 3CVNA 5FZQA 4L23A 3CQGB 3CHMA 1NP7A 4BFRA 4GA0A 4UI9C 3UT7A 3IBEA 2XPZA 3OXGA 3PRZA 3S7JA 4MRUA 3CECA 4PU3C 3B13A 2IOLA 3SF4A 2FF4A 3ENEA 4J8EA 3ULQA 5A6CA 4YVOA 5EDSA 4C9BB 4QFVA 4U07A 5ANLA 4FA6A 1LF8A 3ONLA 3OAWA 4DK5A 1PRVA 1EFAA 4RSYA 4ANWA 5LCWJ 1X5BA 4A1SA 4EZKA 5D0OD 1WETA 3ZXSA 4YG1A 3D1NI 3FEXA 4AY5A 3B7UX 4MS6A 4LUNU 3UUXA 4JQDA 2XGOA 5BW8C 3KEZA 1GW6A 4I9CA 2LYLA 2JCGA 4Z5DA 2CG3A 4G24A 4CT4A 3LPZA 3PEUB 4GZ3A 3L1PA 2WVIA 3L17A 4CT0A 1E8YA 5FTPA 2L49A 4G23A 4J6IA 5AIJA 2IVQA 2WMNA 5KJLA 2EBYA 3CVWA 1PC2A 3JUIA 4P29A 3RRNB 3LY8A 1E8WA 3Q4AB 4WWPA 2YHEA 3MV3B 2EF8A 1JFTA 4L2LA 5G2NA 3SD5A 2VSYA 2X6HA 3S7FA 3RO3A 3UQ3A 1PRAA 4ATGA 2GRLA 2VTBA 3MCXA 3CHOA 2J4BA 2PL2A 3OXLA 3CHPA 3I3NA 5FZRA 2PUCA 4GYOA 5ARFA 1S7EA 3HIZA 2LYRA 4PU4C 2CFZA 5DIZA 2R63A 3U64A 2BF0X 1WM5A 1JWLA 4GA2A 4FN3A 4I6GA 4KZ0A 3GYZA 1W3BA 4I1MA 2XCCA 5EX3A 3FY4A 5G05C 4YG7B 4XI0A 3FDHA 3D9IA 3PVLA 2MEZA 3PUKA 4H7XA 5G55A 1HXIA 3L13A 5BT1A 4GA1A 2I9CA 4B8CB 2CROA 4GMJA 4HVBA 3U3WA 2BNMA 1NA0A 1QP7A 5C1DA 4IRUA 4NURA 2KPJA 3GN5B 4I6UA 2XSDC 2O4AA 2J08A 4FP7A 4UWHA 2JEKA 3BEEA 2PZIA 4I2ZA 4DLOA 1ZZCA 1TEZA 4N2SA 1QQBA 4GZ6A 3JYSA 3QARA 4B0ZA 4U0UA 4NACA 4I17A 4PS8A 4IWRA 4Y6CA 4J1WA 3QWPA 2IJGX 2LSUA 4H7YA 1E8ZA 4XKBA 3BDNA 2IONA 3MV2B 4FBIA 3FTUA 3QAQA 4HS2A 5LP0A 4Y6WA 2KM4A 1X57A 2I1JA 2PQRA 2PE5A 2HYZA 3EDTB 4L1BA 3B7TA 3L16A 4I1OB 4GMLA 4DI3A 1XGWA 1UG3A 3QOUA 2L9BA 3MJWA 4G11A 1U3DA 4OYSA 2J9QA 3LVRE 4F3VA 4I6JA 4X4FA 2WXJA 3TJPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RIO A;  2GRM A;  4PU8 A;  1QP0 A;  1OSL A;  1Y7Y A;  2BNN A;  3LFP A;  1YSE A;  3KZ3 A;  1RZR D;  1LCC A;  2PUG A;  3G7D A;  2AXZ A;  1JH9 A;  2A6C A;  4Z59 A;  1CQT A;  2IU7 A;  3BD1 A;  1R63 A;  1NEQ A;  4YAR A;  4YG4 A;  1ZZ8 A;  1O4X A;  2PUF A;  3CLC A;  2IVG A;  3F51 A;  4GHJ A;  2LYJ A;  3CRO L;  3O9X A;  4X4G A;  2XCJ A;  3QQ6 A;  4O8B A;  4PU7 A;  2LCV A;  4MCX A;  2PUE A;  2O38 A;  1QQA A;  1WH8 A;  1ZUG A;  3QYX A;  4X4F A;  2MQK A;  1QPZ A;  2PPX A;  3B7H A;  3MLF A;  4Z5H A;  1IC8 A;  1LQC A;  2L8N A;  2ICP A;  1ZPQ A;  3SCG A;  3CEC A;  4PU3 C;  3FYA A;  2LYS A;  4YBA A;  3F6W A;  1L1M A;  3KJX A;  1E3O C;  1WH6 A;  4X4B A;  4IA8 A;  1Y9Q A;  2KEK A;  1PRV A;  3PXP A;  1EFA A;  3SCH A;  3IVP A;  3EUS A;  4J1X A;  3GN5 A;  1POU A;  1WET A;  3R1F A;  4YG1 A;  3D1N I;  2BJC A;  2OR1 L;  3ZHI A;  1ADR A;  4Z58 A;  2HSG A;  2AUW A;  1OCT C;  1VPW A;  4JQD A;  2KEI A;  1XWR A;  3FMY A;  2PUA A;  1LLI A;  1AU7 A;  3OP9 A;  1LMB 3;  3FYM A;  1ZZ9 A;  2JCG A;  2LYL A;  2WIU B;  4Z5D A;  3S8Q A;  3L1P A;  1PRU A;  2KEJ A;  2L49 A;  5A7L A;  2IVQ A;  3DNV B;  1ZS4 A;  2EBY A;  1ZZB A;  2KZ8 A;  1ZZ6 A;  3QF3 A;  1BDI A;  1GT0 C;  2GZU A;  3TRB A;  2EF8 A;  1PNR A;  3JXB C;  1JFT A;  1ZAY A;  2IV1 A;  3HZI B;  1PRA A;  1BDH A;  2GRL A;  3JXC L;  3OQO A;  1NER A;  2HIN A;  4NDW A;  1ZZ7 A;  4I6T A;  1WIZ A;  3QWG A;  3RZZ A;  1UXC A;  2PUC A;  2PUD A;  2D5V A;  1R69 A;  1B0N A;  1S7E A;  2LYR A;  2XIU A;  4PU4 C;  2JVL A;  4I8T A;  2R63 A;  3OMT A;  2ICT A;  2OFY A;  2WUS R;  1JWL A;  2AXV A;  1CJG A;  4JCY A;  4FN3 A;  2B5A A;  3BS3 A;  4MCT A;  1DW9 A;  4F8D A;  4X4E A;  3UFD A;  1HF0 A;  4X4D A;  2H8R A;  2O49 A;  2R1J L;  2PUB A;  2IVB A;  2AWI A;  4JCX A;  4YG7 B;  3OQN A;  1UTX A;  2LYP A;  2MEZ A;  2BNO A;  2XJ3 A;  1LCD A;  2CRO A;  3U3W A;  3F52 A;  1UXD A;  2BNM A;  3LIS A;  3OQM A;  3ZHM A;  2XI8 A;  1QP7 A;  2FJR A;  1QP4 A;  2LYK A;  2KPJ A;  3GN5 B;  4I6U A;  1SQ8 A;  3KXA A;  4I6R A;  4X4H A;  2XSD C;  3JXD L;  2O4A A;  2CSF A;  1RPE L;  3VK0 A;  1ZZC A;  4IVZ A;  3ZKC A;  1QQB A;  4OB4 A;  1PER L;  4IWR A;  4J1W A;  1JFS A;  4Y42 A;  2LYQ A;  1DWK A;  2IUO A;  3BDN A;  1ZVV A;  4FBI A;  3G5G A;  3H5T A;  1X57 A;  3SCF A;  2PIJ A;  4X4C A;  1X2L A;  2AW6 A;  2AXU A;  3GBF A;  2PE5 A;  4GQM A;  4X4I A;  5K98 B;  2EWT A;  4Z5C A;  1RZR A;  1RZS A; 
#chains in the Genus database with same CATH topology
 1RIO A;  4KZC A;  3MGB A;  1L5J A;  1MX4 A;  4JC8 A;  5BV0 A;  3R9M A;  1H6P A;  4Z59 A;  3QNK A;  4V3I A;  4ANX A;  2WXR A;  3VTY A;  3CR3 A;  2LYJ A;  3D9O A;  2HM8 A;  4O60 A;  1OWL A;  2I1K A;  3NF1 A;  1PY1 A;  5AAR A;  3Q7A A;  3PNL B;  5B1B E;  3APF A;  3FUK A;  2BED A;  3HVE A;  4BES A;  2KZT A;  5CCL A;  4F1S A;  4FUL A;  3SX0 A;  1POU A;  3D9M A;  3NAW A;  1UN8 A;  3ZHI A;  2QZA A;  4JHR A;  4K5B A;  2KEI A;  1TR4 A;  1RW2 A;  1LLI A;  3CLJ A;  3CK8 A;  4HRL A;  1DCQ A;  2A5U A;  4AY6 A;  3Q15 A;  3D9L A;  2P9S G;  3DSV A;  4NQ0 A;  3G2U A;  3FUN A;  2DIW A;  3HZI B;  1BDH A;  3ASG A;  5BXU A;  5EIB E;  4AV7 A;  3E4B A;  3PZ2 A;  5ARG A;  4RG6 A;  4WND A;  2KCV A;  3FP3 A;  5E75 A;  2ODR D;  1TNY A;  4HXI A;  2F8Y A;  2YQ8 A;  3CVV A;  1HF0 A;  4U8H A;  5DT2 A;  2AVP A;  4ILI A;  2PXE A;  3LIS A;  3QB2 A;  2BKG A;  3NZS A;  1N52 A;  3FH7 A;  2WM9 A;  1UW4 B;  2LYK A;  3F6Q A;  2E2E A;  4CYM D;  3O48 A;  3FWV A;  1LD7 A;  3UXG A;  3BG0 B;  3FUF A;  3JQ0 A;  2LUH A;  4GQM A;  3FU5 A;  4X4I A;  2EWT A;  3GZS A;  3NDB B;  1QZ2 A;  3RSE G;  4LER A;  3ONK A;  2Q7F A;  2BNN A;  4FU3 A;  3CRO L;  3JUE A;  1ZBP A;  1FVF A;  3LKU A;  1TN8 A;  3MYV A;  5KJN A;  1WH8 A;  2L6B A;  2MQK A;  1QB2 A;  1IC8 A;  2VGE A;  2ICP A;  4UI9 J;  3Q78 A;  1ZPQ A;  1DCE A;  3UIO C;  2QFC A;  4N3C A;  1HX8 A;  2R5S A;  4IA8 A;  2P9N G;  3PXP A;  2WXI A;  3IVP A;  3R7Q A;  3GN5 A;  2RFA A;  2R03 A;  3EHM A;  5KJM A;  2NC9 A;  2PUA A;  1AU7 A;  4OBM A;  1JPL A;  4UWG A;  4RQI A;  4JL0 A;  4N5Q A;  1ZS4 A;  4AP2 A;  2VSX E;  3HVE B;  3HHM A;  3PNT B;  2KZT B;  2DBA A;  5EX0 A;  4XE0 A;  3QWG A;  1K3Z D;  3DEP A;  2PXK A;  4Q94 A;  3FTY A;  4ME2 A;  1INZ A;  1DW9 A;  4X4E A;  3UKU G;  4JCX A;  3OQN A;  5DTR A;  1NZN A;  3PDN A;  3ZHM A;  2J4D A;  3VWS A;  4GPK A;  1RPE L;  4ER7 A;  3FUE A;  3JXJ A;  5LX8 A;  4OB4 A;  3RU0 A;  2HO1 A;  2WQ7 A;  4GMR A;  4Y42 A;  3FUL A;  4WNE A;  2AXU A;  5AQB A;  4DRX E;  1EYH A;  1P5Q A;  4YDW A;  3Q7F A;  2VTB B;  2GRM A;  4PU8 A;  5B3S E;  3KS2 A;  4G25 A;  3UI2 A;  2VEO A;  2WXQ A;  2C0L A;  4JA9 A;  5A23 A;  4ANU A;  5JHB A;  3Q9N C;  2P9K G;  4TXQ A;  2PNN A;  2PXD A;  3V31 A;  4DE9 A;  1LQC A;  2VSO E;  3UTM A;  3FH8 A;  5FIO A;  2MYO A;  3I5P A;  1WH6 A;  4HFG A;  3I4R B;  3ULY A;  3R1F A;  5FZS A;  2IO2 C;  5JA4 D;  4O1O A;  1XWR A;  4JB8 P;  4ACK A;  3FYM A;  2FEZ A;  2JLB A;  1OWO A;  5ENO D;  4GZ5 A;  5T4Y A;  3QF3 A;  5BV1 A;  5AAO A;  3TRB A;  2LLW A;  4JHK A;  4W9R A;  4FAD A;  4L9P A;  1EPU A;  1UXC A;  3R9A B;  2PXV A;  1UOH A;  1NW3 A;  4I8T A;  3V2O A;  2UWJ G;  1S0P A;  4M3O A;  4DPR A;  2O49 A;  1UJK A;  2MHK A;  1HFA A;  3ZPJ A;  2ZU6 B;  5AN8 A;  2Y69 E;  2IEJ A;  3V2X A;  5FQ4 A;  3W9F A;  5A7D B;  3BQO A;  4GYW A;  3EUV A;  4TV3 A;  1E8X A;  3KXA A;  2LAH A;  2X6K A;  4EZL A;  4EKI A;  3B7S A;  3UMV A;  3HXF A;  3ZYM A;  1PER L;  3J5P A;  3E30 A;  4JPS A;  5T8I A;  3QK0 A;  2YHC A;  1YMP A;  1MQS A;  3ML9 A;  5KCM A;  4Z5C A;  2V4H C;  5J08 A;  3B7R L;  2B6C A;  3ZHE A;  4J8Y A;  4WUY A;  3KZ3 A;  3SO8 A;  3CVU A;  4U7E B;  2KC7 A;  3LYA A;  4HI9 A;  1ZU2 A;  3CLC A;  3EU9 A;  2IVG A;  1ELK A;  3O9X A;  5G04 J;  2XCJ A;  4PU7 A;  1OT8 A;  2I2O A;  4EKG A;  4BWR A;  4AEZ C;  3ML8 A;  1QPZ A;  5FZQ A;  3S7J A;  4PU3 C;  1A5E A;  4J8E A;  3ULQ A;  4YVO A;  4C9B B;  3Q75 A;  4FA6 A;  3SFX A;  3C3R A;  3OAW A;  4DK5 A;  4GTT A;  3ZXS A;  2P9L G;  4AY5 A;  4LUN U;  3UUX A;  5BW8 C;  4I9C A;  4CT4 A;  2CG3 A;  4CT0 A;  3UM3 A;  1E8Y A;  2L49 A;  1SVX A;  2WMN A;  2RKK A;  4GTM A;  5AQ7 A;  2EBY A;  2OCC E;  2XXP A;  2IY0 C;  3CVW A;  3Q4A B;  1DUL A;  5CBO A;  5BXO A;  3PZ4 A;  2GRL A;  3CHO A;  2F37 A;  2PL2 A;  5FZR A;  3HXD A;  2J7U A;  4OAU C;  4ER5 A;  3C72 A;  2XCC A;  3FY4 A;  4Q2J A;  4YG7 B;  3FDH A;  5BT1 A;  3BU8 A;  4HVB A;  2CRO A;  4GMJ A;  1NA0 A;  1WDY A;  2XSD C;  2J08 A;  4UWH A;  3BEE A;  2H6H A;  1QQB A;  3V30 A;  3QAR A;  4Y6C A;  3DSX A;  2IJG X;  2LSU A;  4XKB A;  3BDN A;  2XS1 A;  2P9U G;  3Q73 A;  2EIN E;  4I1O B;  4DI3 A;  3QOU A;  2J9Q A;  4I6J A;  4ABN A;  1JWF A;  2YBD A;  4EQF A;  3TXM A;  4X8Q A;  2HR2 A;  5AYW D;  4FJZ A;  1TNZ A;  3ZYL A;  2WXF A;  1BD8 A;  4N3B A;  3QWW A;  3QJZ A;  3GZC A;  1KZP A;  4OVV A;  3SQV A;  2Y4U A;  3FFL A;  4WWO A;  4EHM A;  3DXK G;  1Z6T A;  3HXC A;  2FFH A;  2V5F A;  1MZC A;  2PM7 A;  3RKV A;  4X4B A;  5EYL A;  2GW1 A;  1QQE A;  5DTM A;  3MEJ A;  2OVB A;  3EUS A;  4CCA A;  3ASH A;  5GAG i;  2CHZ A;  2Y0B G;  4GU5 A;  2V0P A;  5ENQ D;  1FCH A;  1E7U A;  3BG1 B;  2VYI A;  4UWF A;  4I6E A;  4PUC A;  1HE8 A;  3E32 A;  3AU5 A;  2GZU A;  4CDR A;  5D2M C;  3JXB C;  2KCL A;  3OQO A;  1NER A;  2HIN A;  3FU6 A;  4GTS A;  4I6T A;  1O5M A;  1D9S A;  1R69 A;  1ELR A;  3AS5 A;  5ENR D;  2GRQ B;  3BS3 A;  4O1P A;  2WB2 A;  4A1G A;  4XI9 A;  4GTV A;  4AJW A;  2LNI A;  3LXU X;  3QKY A;  3ZNG A;  2DCP A;  5EN5 D;  4BX8 A;  3JXD L;  3ZIM A;  2CSF A;  2NYJ A;  3ZKC A;  3KL4 A;  3QFI A;  4JXT A;  3LQX A;  2ETA A;  5AQ9 A;  3CGH A;  2PXF A;  4J8D A;  3MX3 A;  1OWM A;  3IV0 A;  2LXM A;  3ISM C;  1O1S A;  1QP0 A;  1OSL A;  4FHJ A;  4ILH B;  1LCC A;  5C2Y A;  2Y1L E;  4AXH A;  1JH9 A;  3HXE A;  2XS8 A;  2J7W A;  3ASF A;  1V55 E;  2VGX A;  4HRM B;  3CK7 A;  1HG5 A;  3AJI A;  4LNU D;  3QYX A;  1Y6I A;  4Z5H A;  2KXP C;  1MX2 A;  1E3O C;  4WAF A;  5ENS D;  1HS6 A;  2WXL A;  2FO1 E;  5H7P A;  4E6H A;  2OR1 L;  3EJN A;  3TEP A;  3DSU A;  3SZ7 A;  3JCK C;  2VSN A;  3D9K A;  3ZEF A;  1YA0 A;  3UWP A;  2X6F A;  3HDX A;  1N4P A;  4K03 A;  1G3N B;  4HRA A;  2ZGD A;  2DZN A;  2XPY A;  5ITZ F;  5BNW A;  2DZO A;  4JA7 A;  2AXV A;  1H6O A;  1MHQ A;  3R09 A;  3AS8 A;  3OTN A;  3NXH A;  2PUB A;  3AG2 E;  3LEW A;  3Q47 B;  4APO A;  3CHS A;  3TWV A;  3TG5 A;  2XJ3 A;  1LCD A;  2CG2 A;  3MKQ A;  2XGS A;  2E0I A;  4GAA A;  4GTO A;  3B95 A;  3MEK A;  3T8K A;  4F1P A;  3ESL A;  1H2T C;  2LYQ A;  1DWK A;  2IUO A;  3TL5 A;  4DX6 D;  2XEE A;  4X4C A;  1SZA A;  1N4S A;  3G2S A;  4B93 B;  3M9L A;  2WXN A;  1V54 E;  1RZS A;  4A55 A;  3TWR A;  3MKR A;  3S2A A;  3LFP A;  4U8Y D;  3IXE A;  1CQT A;  3FUD A;  3FHE A;  4X4G A;  4RLY A;  3FU0 A;  4EK9 A;  1S63 A;  1E90 A;  2YIN A;  3B7H A;  4TUM A;  3TAX A;  4UWK A;  3ZPX A;  2LYS A;  4YBA A;  3ASD A;  1TJF A;  4BSZ B;  5ENT D;  4ER3 A;  4FC8 A;  5CED B;  5CCM A;  2OV8 A;  3Q9U C;  1IKN D;  4BER A;  2VGX B;  3FTV A;  2WXK A;  4I2W A;  2XRY A;  3VLF A;  1FVH A;  2NSZ A;  4J0U A;  1TYQ G;  4BTB A;  2V8S E;  4DX1 A;  4XZ4 A;  4G8L A;  3RRU A;  4NIK A;  3JXC L;  3DEO A;  3RZZ A;  4CRW A;  1LTX A;  2L6J A;  4CEM A;  2EIM E;  3CHQ A;  3ZYQ A;  4JCY A;  3PEV B;  4WWP A;  1QZX A;  1YCS B;  1IXV A;  3K9I A;  4L2Y A;  2BNO A;  2ILR A;  3PH0 C;  3I4G A;  4ANV A;  4IVZ A;  4HOS A;  3FUI A;  3DPD A;  3CSF A;  1JFS A;  3T5V A;  2FBN A;  2A4Z A;  1N54 A;  3B7B A;  2AW6 A;  2L1P A;  4U0Z A;  1H0A A;  4DUI A;  2H6I A;  2PQN A;  4GCN A;  4U04 A;  5CMW A;  2GRR B;  3G0T A;  3F51 A;  4GHJ A;  3EIJ A;  2QYJ A;  4BTA A;  5FQ7 A;  4HRN A;  4BFR A;  1N9A A;  3J5Q B;  4GA0 A;  3UT7 A;  3IBE A;  2XPZ A;  3PRZ A;  4MRU A;  3SF4 A;  2IOL A;  2FF4 A;  2OEW A;  4A63 B;  5A6C A;  1LF8 A;  1X5B A;  4A1S A;  4EZK A;  5D0O D;  4U8V D;  4JQD A;  2LYL A;  2JCG A;  3PEU B;  3L1P A;  2WVI A;  5AIJ A;  2IVQ A;  5KJL A;  4EQZ A;  4P29 A;  3ASN E;  3RRN B;  3MV3 B;  2EF8 A;  4L2L A;  3SD5 A;  1Q2Z A;  5G2N A;  3S7F A;  3OXL A;  2J4B A;  3CHP A;  2R2L A;  3I3N A;  2PUC A;  4GYO A;  2RFM A;  1S7E A;  4ZFH A;  2CFZ A;  5DIZ A;  2BF0 X;  1JWL A;  4GA2 A;  4YDE A;  4FN3 A;  2GRP B;  4KZ0 A;  1W3B A;  4I1M A;  5EX3 A;  5G05 C;  2MEZ A;  1RZ4 A;  1HXI A;  4GA1 A;  4WVL A;  4HLL A;  5C1D A;  3GN5 B;  4I6U A;  2JEK A;  4I2Z A;  2JAB A;  1ZZC A;  1TEZ A;  3JYS A;  4I17 A;  4PS8 A;  4J1W A;  1MFQ C;  3MV2 B;  4FBI A;  3FTU A;  4Y6W A;  3NOC D;  3QOX A;  4DE8 A;  2PQR A;  3EDT B;  4GML A;  3MJW A;  1LD8 A;  1U3D A;  4X4F A;  3U9W A;  4B94 A;  3APD A;  1RZR D;  3A9X A;  4AVX A;  3CVX A;  2Y3A A;  4M7C A;  3FH5 A;  4YVQ C;  1DNP A;  2XCB A;  2IU7 A;  5FQ6 A;  4JZY A;  4YDY A;  2H6G A;  3JXI A;  3QQ6 A;  4MCX A;  4DLQ A;  4UI9 K;  2O38 A;  2WXG A;  4A3T A;  3GZD C;  3FYA A;  1ELW A;  4U95 D;  1O1T A;  3SNX A;  4EZJ A;  2VQ2 A;  4AOF A;  4Z68 A;  3SR4 A;  4BT9 A;  3GZ1 A;  3NQP A;  3BUA A;  1ADR A;  2BJC A;  1N11 A;  3KD7 A;  3RO2 A;  3S8Q A;  4G8K A;  4KVM A;  3DNV B;  1UN9 A;  2DWZ A;  3RIB A;  2ZIS A;  3DBS A;  4BEP A;  3Q49 B;  5B1A E;  2EIL E;  4BET A;  2KCK A;  2EIJ E;  3SBT B;  1QBQ A;  1Z3X A;  3IHV A;  3LJN A;  4LG6 A;  4TRQ A;  2A5E A;  2YNQ A;  1N94 A;  2WUS R;  5CEA A;  2V3C C;  2H8R A;  3CVP A;  1UTX A;  2ZGG A;  3UT8 A;  4BT8 A;  4CDN A;  5JUW A;  4E85 A;  3SBS A;  1MJ0 A;  4B89 A;  3QC1 A;  3L6A A;  3CEQ A;  3A9Z A;  2HE0 A;  5DRT A;  3D9P A;  3URZ A;  5D0Q D;  5IY5 E;  2FO7 A;  1X2L A;  3HG0 D;  2XXA A;  1ZB1 A;  1AP7 A;  1D8D A;  3G2T A;  4Q96 A;  2LO6 A;  1Y7Y A;  2X38 A;  5DTQ A;  4PS7 A;  1H2U A;  3ZUV B;  2P58 C;  1R63 A;  1ZZ8 A;  5ENN A;  3D9N A;  3L54 A;  3AS4 A;  2DVW A;  1NA3 A;  1ZUG A;  3GZD A;  4FLH A;  1K8K G;  3MLF A;  4LCT A;  4IN3 B;  3KJX A;  3ABK E;  1QYM A;  3P2B A;  3SHF A;  5LCW C;  1BI7 B;  4Z58 A;  4AIF A;  1OCT C;  4UWL A;  1U3C A;  1ZZ9 A;  1SW6 A;  4JEU A;  1HZ4 A;  2X6J A;  3IHY A;  1K1B A;  2XEH A;  3AU4 A;  1PRU A;  1FT1 A;  2XEN A;  2KAT A;  3ZHE B;  4CZ2 D;  1ZZB A;  2DYR E;  4HLE A;  5JJT A;  4GTP A;  3TWX A;  2M63 A;  1PNR A;  5GAH i;  2IV1 A;  4CDM A;  1SA4 A;  4GZD A;  1SQM A;  3IKO B;  3G2V A;  1N95 A;  3ZU7 B;  3E37 A;  1D8E A;  3AG1 E;  3QOW A;  4XIF A;  3EHR A;  5JJ7 A;  4X4D A;  5EKQ D;  3RK6 A;  1U2Z A;  4HOR A;  3QDN A;  1H19 A;  3CVL A;  3APC A;  4BX9 A;  3O4Z A;  1SQ8 A;  4TXR A;  5FWQ A;  4B8A A;  3VTX A;  1EDU A;  5FIN A;  5CMY A;  3FTZ A;  3SCF A;  3DM5 A;  5BPP A;  3MA5 A;  5FJY A;  4EPZ A;  2V5Q C;  2OND A;  3CQC B;  2HCS A;  1RZR A;  1U2V G;  4FLB A;  1KT1 A;  4XX5 A;  3DXM G;  4U96 D;  3LY9 A;  2WXP A;  5FT9 A;  3JQ1 A;  2PUG A;  3SI5 A;  4J7W A;  1EF1 C;  1OCR E;  3NRO A;  2VGY A;  3DRA A;  4NRH B;  3L82 A;  2PUE A;  3R7R A;  1QQA A;  5LFA A;  2PPX A;  1JWG A;  1TNU A;  2CFU A;  4UQZ A;  1UJJ A;  2P2C P;  3CVY A;  2KEK A;  4F6R D;  4GCO A;  4ACL A;  1VPW A;  1TNB A;  3U66 A;  1SA5 A;  4GTQ A;  2QYU A;  2L0I A;  2WXH A;  3FU3 A;  1TJC A;  2EIK E;  4MKT A;  2OVF A;  2XHE A;  2KEJ A;  5A7L A;  3UIP C;  4OAV B;  3ZKJ A;  1HH8 A;  1GT0 C;  3TWQ A;  4KMO A;  5CHE E;  5E76 A;  5FQ8 A;  1ZAY A;  2IF4 A;  5M72 A;  2LAI A;  4GB9 A;  4ER0 A;  1DC2 A;  3AG3 E;  4I43 A;  4WNF A;  4C48 B;  1CJG A;  2R02 A;  3FTW A;  3IEG A;  3EHN A;  4JW1 A;  3HYM B;  2C2L A;  3VLD A;  3SGH A;  2IVB A;  2AWI A;  1IQR A;  3UT4 A;  4HOQ A;  2CHW A;  4R7L A;  2XQ0 A;  3F52 A;  3OQM A;  4WNG A;  2WMO A;  3QWV A;  4D10 C;  4ILG A;  4HNA D;  5HRY A;  5LOZ A;  1IHB A;  4YDO A;  4UQX A;  1ZVV A;  1N0R A;  3H5T A;  3LCA A;  2UY1 A;  2PIJ A;  1BLX B;  3KAE A;  3CV0 A;  1OXJ A;  3Q5M A;  2XXQ A;  3RJV A;  2LSV A;  4PDX A;  4CGW A;  1FT2 A;  3AG4 E;  5AEN A;  3LDZ A;  2AXZ A;  4PH4 B;  1DVP A;  1S70 B;  2WQ6 A;  2RD0 A;  3FUJ A;  4O8B A;  2IO3 C;  4LNG A;  5EID A;  3CQG B;  1NP7 A;  4UI9 C;  3OXG A;  3B13 A;  1WG0 A;  3ENE A;  5EDS A;  4LSZ E;  4QFV A;  5ANL A;  3KEA A;  4QQI A;  3ONL A;  1EFA A;  2J8S D;  1WET A;  3D1N I;  2XGO A;  3KEZ A;  4G24 A;  4GZ3 A;  3L17 A;  5FTP A;  4G23 A;  4J6I A;  5CRU A;  4UUC A;  3JUI A;  1BU9 A;  3LY8 A;  1E8W A;  2HFZ A;  1JFT A;  1KZO A;  3UQ3 A;  2VSY A;  4ATG A;  2VTB A;  3MCX A;  2MXD A;  2PXQ A;  3DST A;  1WM5 A;  3A9Y A;  4I6G A;  2M4H A;  3SY2 A;  2ZXW E;  2PXP A;  3PUK A;  5G55 A;  1OY3 D;  3L13 A;  2I9C A;  1JCQ A;  1BI8 B;  3UM2 A;  5CRV A;  2KPJ A;  2PXT A;  2O4A A;  2PZI A;  5KNH D;  3E33 A;  4B0Z A;  4U0U A;  4NAC A;  3PZ1 A;  4H7Y A;  3QAQ A;  4HS2 A;  1X81 A;  5LP0 A;  1X57 A;  2DYS E;  2I1J A;  2QC9 A;  2PE5 A;  2HYZ A;  4L1B A;  3DWL G;  1XGW A;  1FPP A;  4G11 A;  3LVR E;  4F3V A;  3TJP A;  4XEI G;  3ZYK A;  2C0M A;  4IYP A;  3KSQ A;  2XEV A;  2MRI A;  1WY6 A;  3PE3 A;  2I6H A;  3L9T A;  2UY1 B;  2VJ8 A;  1NEQ A;  1O4X A;  4G26 A;  3V79 K;  2BKK B;  1N0Q A;  4KXK B;  1NFI E;  2GGF A;  3HXB A;  1HQ1 A;  3RAU A;  1HU3 A;  5AJL A;  3MKQ B;  1MYO A;  2XZD G;  4EEC A;  3CKC A;  3F6W A;  4KYO B;  4O6F A;  4HOT A;  3KSL A;  1Y9Q A;  3SCH A;  3TWS A;  3PRE A;  1LMB 3;  2WIU B;  1E7V A;  3CVQ A;  5D66 A;  3WG7 E;  4A3V A;  1Z5S C;  2FI7 A;  3NOG D;  1BDI A;  1HG2 A;  3ASO E;  3ZW3 A;  4AM9 A;  1H2V C;  4NDW A;  1WIZ A;  2PUD A;  1Y8M A;  2WXO A;  3PZD A;  3TXN A;  2JVL A;  2WPV A;  2ICT A;  2OFY A;  3PE4 A;  4LRZ A;  1K1A A;  3ZGQ A;  2V4L A;  3UFD A;  4YND A;  3MZL B;  3RRM B;  2RG8 A;  5CBN A;  5JJ6 A;  2LYP A;  3FTS A;  2J49 A;  3LJ3 A;  3TWT A;  3U4T A;  4GZC A;  4F53 A;  1E96 B;  3G2W A;  2XI8 A;  2FJR A;  1QP4 A;  1KPS B;  3W9G A;  1YYH A;  4LEU A;  2PXU A;  3VK0 A;  2P9I G;  3OKZ A;  4EZI A;  5CEC B;  2H6F A;  3TEL A;  4ZHB A;  2R05 A;  1TN6 A;  4HI8 A;  1WAO 1;  4KBQ A;  3CHR A;  3AAA C;  3FUM A;  2PXL A;  1QNF A;  3C98 A;  4EBA G;  2AJA A;  4FHK A;  3HRA A;  2A6C A;  4JEH A;  3TFL A;  3NZU A;  4YAR A;  2X6I A;  2PUF A;  5G04 C;  2L0T B;  3ULE G;  3UM1 A;  2XRZ A;  3ESK A;  1H6K A;  4N39 A;  2P9P G;  4G1T A;  4C0E A;  4U0S A;  1IYG A;  2B0O E;  3SCG A;  3S7D A;  5KNG A;  1L1M A;  3GW4 A;  3CK9 A;  3ZFW A;  4HOU A;  3EIQ C;  2WQH A;  2QY7 A;  1BPO A;  2R59 A;  2J07 A;  3DPY A;  5JMN D;  1IHG A;  4JVS A;  2HSG A;  4APF A;  2AUW A;  3WXX A;  4N2Q A;  4ER6 A;  4KVO A;  3UPV A;  4GPM A;  2J09 A;  3N71 A;  1N4Q A;  3EHQ A;  1SZ9 A;  2KZ8 A;  3NB2 A;  3OXF A;  1IQU A;  1TN7 A;  3ME5 A;  3ABM E;  5ENP D;  2ETC A;  2NXP A;  2JQE A;  4N5C A;  1ZZ7 A;  1JUQ A;  2F0Y A;  4J8F A;  4MBG A;  3DSS A;  3LVQ E;  2XIU A;  1KT0 A;  1NL4 A;  5KBA A;  3NZL A;  4F8D A;  4DJA A;  5ANR A;  3CIA A;  5HKP A;  2R1J L;  4ATZ D;  5G05 J;  4K5A B;  3UX4 A;  4I1A A;  3TG4 A;  4WWN A;  5DBK A;  4K0R A;  3D3M A;  1UXD A;  2IOS A;  2MOW A;  3E34 A;  3L22 A;  4PS3 A;  4LNB A;  3TWW A;  5J90 A;  3SFY A;  1NI1 A;  4K5C A;  3GBF A;  1OWP A;  4GYY A;  3CST A;  2OEV A;  4HBD A;  2LXL A;  1A17 A;  3FUH A;  2WXM A;  4UQY A;  4URK A;  2HCN A;  3C5R A;  4HB5 A;  1VDY A;  3T8M A;  4N3A A;  2GRO B;  3CKB A;  3ZVV A;  3BD1 A;  1HF8 A;  2R17 C;  2XPI A;  4GTR A;  3C3Q A;  2FUL A;  4L7T A;  2IQC A;  2LCV A;  1JCR A;  5CER B;  3TGO A;  2CHX A;  4XKC A;  1KLX A;  5HI7 A;  4BY6 A;  3SFZ A;  1OCC E;  2L8N A;  3FEY A;  4BSX A;  5EIL A;  3D9J A;  4C0M A;  5KWD A;  3LS8 A;  4J1X A;  4Q69 A;  2BTD A;  5DSX A;  2PXB A;  4DI4 A;  3FMY A;  5BUZ A;  3OP9 A;  1O1R A;  3S7B A;  4EBA A;  4J8S A;  2EQX A;  3GUU A;  2KBX A;  1ZZ6 A;  5AJD A;  5DRY A;  3LY7 A;  3GZ2 A;  2D5V A;  4OVU A;  1B0N A;  2XGM A;  3OMT A;  4TUU A;  2XZT G;  5AQA A;  3PZ3 A;  2X3M A;  2B5A A;  4MCT A;  4U63 A;  1PAQ A;  4MLP A;  3Q79 A;  1Z3Y A;  3C3O A;  3PE5 A;  1XNF A;  2ZIR A;  3FTX A;  4IUL A;  3P1U A;  3PS6 A;  4F7A A;  1OCO E;  5KJK A;  4X4H A;  3VLE A;  4I6R A;  2IU1 A;  4HQD A;  2OOE A;  4RG9 A;  3ZXP A;  2BUG A;  5HQ8 A;  3G5G A;  3PUJ A;  1OWN A;  3OWQ A;  2ETB A;  1B89 A;  3ZRH A;  1JCS A;  5K98 B;  2LNM A;  3TWU A;  1OUV A;  3DSW A;  4FJY A;  4G2V A;  4RVB A;  2LLV A;  1YSE A;  2Y4T A;  3T5X A;  3G7D A;  5T3R A;  3L08 A;  4CGV A;  4YG4 A;  5JHA A;  2PM6 A;  4DX5 D;  4KT6 B;  4I9E A;  3ZN3 A;  2IFU A;  1HO8 A;  1TNO A;  4JHJ A;  3CVN A;  4L23 A;  3CHM A;  4DX2 A;  1S64 A;  3CEC A;  3T9K A;  4TXP A;  4U07 A;  1PRV A;  4RSY A;  3D9H A;  4ANW A;  5LCW J;  4YG1 A;  3FEX A;  3B7U X;  4MS6 A;  1GW6 A;  3EU5 A;  4Z5D A;  3LPZ A;  2GRN B;  1N4R A;  1AWC B;  1PC2 A;  3UKR G;  2YHE A;  3UIN C;  2X6H A;  3RO3 A;  1PRA A;  1MX6 A;  5ARF A;  3HIZ A;  2LYR A;  4PU4 C;  2R63 A;  3U64 A;  3NBN B;  1OCZ E;  3GYZ A;  2F8X K;  4JD2 G;  4XI0 A;  3D9I A;  3PVL A;  4H7X A;  4B8C B;  3U3W A;  2BNM A;  1QP7 A;  4IRU A;  4NUR A;  4FP7 A;  3X2Q E;  4DLO A;  5EYP F;  4N2S A;  4GZ6 A;  4IWR A;  3QWP A;  1E8Z A;  2ION A;  3ABL E;  2KM4 A;  3UM0 A;  3B7T A;  3L16 A;  5HS0 A;  1UG3 A;  2L9B A;  4OYS A;  4DX7 D;  2WXJ A; 
#chains in the Genus database with same CATH homology
 1RIO A;  3U9W A;  2C0M A;  1JWF A;  4KZC A;  3ZYK A;  3MGB A;  4IYP A;  4EQF A;  4B94 A;  3TXM A;  2XEV A;  2HR2 A;  3APD A;  5AYW D;  1RZR D;  2MRI A;  1WY6 A;  1L5J A;  4AVX A;  3CVX A;  2Y3A A;  4JC8 A;  3FH5 A;  3PE3 A;  5BV0 A;  2I6H A;  4YVQ C;  1DNP A;  4ABN A;  4Z59 A;  2XCB A;  4FJZ A;  3ZYL A;  2IU7 A;  3QNK A;  2WXF A;  2UY1 B;  2VJ8 A;  1NEQ A;  1O4X A;  4JZY A;  4G26 A;  5FQ6 A;  4N3B A;  4V3I A;  4ANX A;  3QWW A;  2WXR A;  3QJZ A;  3CR3 A;  3VTY A;  2LYJ A;  3D9O A;  2HM8 A;  3QQ6 A;  4KXK B;  1OWL A;  2GGF A;  4OVV A;  4MCX A;  2I1K A;  4UI9 K;  4DLQ A;  2O38 A;  2Y4U A;  3FFL A;  4WWO A;  3NF1 A;  1HU3 A;  1Z6T A;  1PY1 A;  2V5F A;  2WXG A;  4A3T A;  5AJL A;  3MKQ B;  4EEC A;  3CKC A;  3PNL B;  3FYA A;  1ELW A;  3F6W A;  3APF A;  4KYO B;  4O6F A;  3SNX A;  4EZJ A;  3FUK A;  4HOT A;  2VQ2 A;  2PM7 A;  3HVE A;  4AOF A;  3RKV A;  4X4B A;  4BT9 A;  3GZ1 A;  1Y9Q A;  2GW1 A;  2KZT A;  1QQE A;  5CCL A;  4F1S A;  4FUL A;  3SCH A;  3NQP A;  2OVB A;  3EUS A;  4CCA A;  1POU A;  3D9M A;  1ADR A;  1UN8 A;  2BJC A;  3ZHI A;  4JHR A;  3ASH A;  2KEI A;  2CHZ A;  3KD7 A;  3PRE A;  1LLI A;  1LMB 3;  2V0P A;  3CLJ A;  4GU5 A;  3RO2 A;  2WIU B;  1E7U A;  1FCH A;  1E7V A;  3CK8 A;  3CVQ A;  3S8Q A;  3BG1 B;  2A5U A;  4KVM A;  4AY6 A;  3Q15 A;  2VYI A;  4UWF A;  4A3V A;  3DNV B;  3D9L A;  2FI7 A;  1UN9 A;  4I6E A;  4PUC A;  1HE8 A;  3AU5 A;  4NQ0 A;  1BDI A;  3G2U A;  3DBS A;  3FUN A;  3RIB A;  2GZU A;  4CDR A;  3Q49 B;  1HG2 A;  3JXB C;  2DIW A;  2KCK A;  3HZI B;  1BDH A;  3ASG A;  3ZW3 A;  2KCL A;  4AM9 A;  3SBT B;  3OQO A;  1NER A;  2HIN A;  4NDW A;  1H2V C;  1Z3X A;  4I6T A;  1WIZ A;  2PUD A;  1Y8M A;  3FU6 A;  3IHV A;  4RG6 A;  5ARG A;  4TRQ A;  4WND A;  2KCV A;  3FP3 A;  1R69 A;  1ELR A;  2WXO A;  3PZD A;  5E75 A;  2JVL A;  2YNQ A;  2WPV A;  3TXN A;  3AS5 A;  2ICT A;  2OFY A;  2WUS R;  3PE4 A;  4LRZ A;  4HXI A;  2YQ8 A;  3ZGQ A;  2V4L A;  3CVV A;  3BS3 A;  1HF0 A;  3UFD A;  2H8R A;  4YND A;  3MZL B;  2WB2 A;  4U8H A;  4A1G A;  3RRM B;  2AVP A;  2RG8 A;  3CVP A;  5JJ6 A;  4XI9 A;  1UTX A;  2LYP A;  4ILI A;  2LNI A;  3LXU X;  3QKY A;  3UT8 A;  4AJW A;  3FTS A;  2J49 A;  3LJ3 A;  4BT8 A;  4CDN A;  3U4T A;  4GZC A;  4F53 A;  1E96 B;  3LIS A;  3G2W A;  3E4B A;  2XI8 A;  3QB2 A;  3NZS A;  1N52 A;  3FH7 A;  2DCP A;  2FJR A;  1QP4 A;  2LYK A;  1UW4 B;  2WM9 A;  2E2E A;  3SBS A;  4BX8 A;  3JXD L;  3ZIM A;  4LEU A;  2CSF A;  3VK0 A;  3O48 A;  4B89 A;  3ZKC A;  3FWV A;  3QC1 A;  4JXT A;  3L6A A;  3CEQ A;  4DI4 A;  3BG0 B;  3FUF A;  3JQ0 A;  3D9P A;  3URZ A;  5D0Q D;  1WAO 1;  2FO7 A;  3CGH A;  3CHR A;  4KBQ A;  1X2L A;  4J8D A;  4GQM A;  3FU5 A;  3MX3 A;  4X4I A;  1OWM A;  3FUM A;  3IV0 A;  2EWT A;  3GZS A;  1QNF A;  3C98 A;  1QZ2 A;  4LER A;  3G2T A;  3ONK A;  4Q96 A;  4EBA G;  1QP0 A;  2LO6 A;  1OSL A;  1Y7Y A;  2Q7F A;  2X38 A;  4FHJ A;  2BNN A;  4ILH B;  1LCC A;  5C2Y A;  4FHK A;  4AXH A;  1JH9 A;  2A6C A;  1H2U A;  4JEH A;  4PS7 A;  2P58 C;  3NZU A;  1R63 A;  4FU3 A;  4YAR A;  1ZZ8 A;  2PUF A;  2X6I A;  3D9N A;  5ENN A;  3ASF A;  3L54 A;  3AS4 A;  5G04 C;  3CRO L;  2L0T B;  1ZBP A;  1FVF A;  3LKU A;  2VGX A;  2XRZ A;  3CK7 A;  1HG5 A;  3MYV A;  5KJN A;  1NA3 A;  3ESK A;  1H6K A;  1WH8 A;  1ZUG A;  3QYX A;  1Y6I A;  2MQK A;  4FLH A;  4N39 A;  3MLF A;  4Z5H A;  1IC8 A;  4G1T A;  4LCT A;  4C0E A;  4U0S A;  2ICP A;  4UI9 J;  1IYG A;  1ZPQ A;  3SCG A;  4IN3 B;  3S7D A;  1L1M A;  2QFC A;  4N3C A;  3GW4 A;  3KJX A;  1E3O C;  3CK9 A;  4HOU A;  1HX8 A;  2R5S A;  4WAF A;  3ZFW A;  3EIQ C;  3P2B A;  4IA8 A;  2WQH A;  2QY7 A;  1BPO A;  3PXP A;  1HS6 A;  2WXI A;  2WXL A;  2R59 A;  3SHF A;  5LCW C;  2J07 A;  3IVP A;  2OR1 L;  3R7Q A;  3GN5 A;  3EJN A;  4E6H A;  1IHG A;  4Z58 A;  4JVS A;  2HSG A;  4AIF A;  2AUW A;  1OCT C;  3EHM A;  4APF A;  5KJM A;  3WXX A;  4UWL A;  2NC9 A;  4N2Q A;  2PUA A;  1AU7 A;  1JPL A;  1U3C A;  4UWG A;  1ZZ9 A;  4JEU A;  1HZ4 A;  2X6J A;  3IHY A;  3AU4 A;  4KVO A;  3SZ7 A;  1PRU A;  3UPV A;  3JCK C;  2VSN A;  3D9K A;  2J09 A;  3N71 A;  4JL0 A;  1ZS4 A;  1SZ9 A;  2KAT A;  3ZEF A;  1YA0 A;  3ZHE B;  4AP2 A;  1ZZB A;  2VSX E;  3HVE B;  2KZ8 A;  2X6F A;  3HHM A;  3HDX A;  4HLE A;  3PNT B;  3OXF A;  1IQU A;  5JJT A;  2KZT B;  2DBA A;  2M63 A;  1PNR A;  2IV1 A;  5EX0 A;  4K03 A;  2NXP A;  4CDM A;  4N5C A;  1ZZ7 A;  1JUQ A;  4J8F A;  3QWG A;  4GZD A;  4XE0 A;  3LVQ E;  2XPY A;  2XIU A;  5BNW A;  1SQM A;  4Q94 A;  3FTY A;  1KT0 A;  3IKO B;  4JA7 A;  4ME2 A;  2AXV A;  3G2V A;  1INZ A;  1MHQ A;  4F8D A;  4XIF A;  1DW9 A;  4X4E A;  4DJA A;  4E85 A;  5ANR A;  4X4D A;  3AS8 A;  3CIA A;  2R1J L;  3OTN A;  2PUB A;  4JCX A;  3LEW A;  5EKQ D;  5G05 J;  3UX4 A;  3OQN A;  4I1A A;  3RK6 A;  3Q47 B;  3TG4 A;  3CHS A;  1NZN A;  4APO A;  3PDN A;  4WWN A;  2XJ3 A;  1LCD A;  4K0R A;  5DBK A;  3TG5 A;  4HOR A;  3QDN A;  1H19 A;  2CG2 A;  3CVL A;  3D3M A;  1UXD A;  3ZHM A;  3MKQ A;  4U63 A;  2IOS A;  2MOW A;  3APC A;  2XGS A;  2E0I A;  2J4D A;  4BX9 A;  3O4Z A;  1SQ8 A;  4GAA A;  5FWQ A;  4GPK A;  3L22 A;  1RPE L;  4PS3 A;  3FUE A;  5J90 A;  3MEK A;  5LX8 A;  4OB4 A;  3RU0 A;  3ESL A;  2HO1 A;  2WQ7 A;  4Y42 A;  1H2T C;  2LYQ A;  3FUL A;  1DWK A;  3VTX A;  2IUO A;  4WNE A;  1EDU A;  4B8A A;  3TL5 A;  5CMY A;  3FTZ A;  3SCF A;  4X4C A;  1SZA A;  5BPP A;  2AXU A;  3GBF A;  1OWP A;  3MA5 A;  4GYY A;  5FJY A;  3CST A;  1EYH A;  3G2S A;  4EPZ A;  1P5Q A;  2OND A;  2WXN A;  3CQC B;  1A17 A;  1RZR A;  1RZS A;  4A55 A;  4FLB A;  2VTB B;  3FUH A;  1KT1 A;  4XX5 A;  2GRM A;  4PU8 A;  3MKR A;  3LY9 A;  2WXM A;  2WXP A;  4UQY A;  3S2A A;  5FT9 A;  4URK A;  3LFP A;  3JQ1 A;  3KS2 A;  2PUG A;  3SI5 A;  1VDY A;  3T8M A;  4N3A A;  1EF1 C;  4G25 A;  3CKB A;  3ZVV A;  1CQT A;  2WXQ A;  3BD1 A;  1HF8 A;  2R17 C;  2C0L A;  2XPI A;  4JA9 A;  5A23 A;  3FUD A;  4ANU A;  2VGY A;  2FUL A;  5JHB A;  3FHE A;  4X4G A;  4NRH B;  4L7T A;  5JJ7 A;  2IQC A;  2LCV A;  2PUE A;  3FU0 A;  3R7R A;  1QQA A;  3TGO A;  5LFA A;  2CHX A;  1E90 A;  2YIN A;  1KLX A;  4XKC A;  2PPX A;  3B7H A;  5HI7 A;  4BY6 A;  3SFZ A;  1JWG A;  3TAX A;  1LQC A;  2L8N A;  2CFU A;  3U66 A;  2VSO E;  4UWK A;  3FH8 A;  3FEY A;  4AV7 A;  2LYS A;  4YBA A;  4UQZ A;  3ASD A;  4BSX A;  1TJF A;  3I5P A;  3D9J A;  4FC8 A;  1WH6 A;  1UJJ A;  4C0M A;  3CVY A;  4HFG A;  5CCM A;  3LS8 A;  2KEK A;  2OV8 A;  3I4R B;  4J1X A;  4Q69 A;  3R1F A;  5FZS A;  4GCO A;  2BTD A;  2VGX B;  3FTV A;  4ACL A;  1VPW A;  2WXK A;  1XWR A;  3FMY A;  2XRY A;  4I2W A;  3VLF A;  4ACK A;  3OP9 A;  3S7B A;  3FYM A;  2L0I A;  2WXH A;  3FU3 A;  5BUZ A;  1TJC A;  4EBA A;  2FEZ A;  1FVH A;  2JLB A;  2NSZ A;  4MKT A;  4J8S A;  2EQX A;  2OVF A;  2XHE A;  2KEJ A;  4J0U A;  5A7L A;  1OWO A;  4GZ5 A;  5T4Y A;  4BTB A;  2V8S E;  1HH8 A;  1ZZ6 A;  3QF3 A;  4XZ4 A;  5AJD A;  1GT0 C;  5BV1 A;  3TRB A;  4KMO A;  5CHE E;  5E76 A;  3RRU A;  5FQ8 A;  1ZAY A;  2IF4 A;  4JHK A;  5M72 A;  4W9R A;  3JXC L;  2LAI A;  3LY7 A;  4GB9 A;  4FAD A;  3RZZ A;  1UXC A;  1EPU A;  3R9A B;  3GZ2 A;  4CRW A;  2D5V A;  4OVU A;  1B0N A;  4I8T A;  2L6J A;  4I43 A;  2XGM A;  4CEM A;  3OMT A;  4WNF A;  2UWJ G;  3CHQ A;  4TUU A;  1S0P A;  4M3O A;  1CJG A;  4JCY A;  3PEV B;  3ZYQ A;  2X3M A;  4DPR A;  3FTW A;  3IEG A;  2B5A A;  4MCT A;  2O49 A;  1UJK A;  3EHN A;  4JW1 A;  2MHK A;  1HFA A;  1PAQ A;  3HYM B;  2C2L A;  4MLP A;  3VLD A;  3SGH A;  2IVB A;  2AWI A;  3ZPJ A;  1IQR A;  2ZU6 B;  3K9I A;  3UT4 A;  4L2Y A;  2BNO A;  4HOQ A;  2CHW A;  1Z3Y A;  4R7L A;  2ILR A;  5FQ4 A;  1XNF A;  2XQ0 A;  3F52 A;  3OQM A;  3PH0 C;  3FTX A;  5A7D B;  4GYW A;  4WNG A;  4IUL A;  3P1U A;  3PS6 A;  4F7A A;  3I4G A;  4TV3 A;  1E8X A;  4X4H A;  2WMO A;  3KXA A;  2LAH A;  4I6R A;  3QWV A;  3VLE A;  5KJK A;  2X6K A;  4EZL A;  4D10 C;  3B7S A;  4ILG A;  4IVZ A;  3UMV A;  2IU1 A;  3ZYM A;  4ANV A;  4HOS A;  2OOE A;  3FUI A;  5LOZ A;  4RG9 A;  3DPD A;  1PER L;  3CSF A;  1JFS A;  3T5V A;  2FBN A;  2BUG A;  4UQX A;  1ZVV A;  2A4Z A;  5HQ8 A;  3G5G A;  3H5T A;  1N54 A;  3LCA A;  3PUJ A;  4JPS A;  2UY1 A;  2PIJ A;  1OWN A;  5T8I A;  2AW6 A;  2YHC A;  3QK0 A;  3KAE A;  4U0Z A;  1B89 A;  1MQS A;  3ZRH A;  5K98 B;  3CV0 A;  3ML9 A;  1OUV A;  5KCM A;  1H0A A;  3Q5M A;  4Z5C A;  5J08 A;  4FJY A;  4G2V A;  2PQN A;  3B7R L;  3RJV A;  2LSV A;  3ZHE A;  4RVB A;  4PDX A;  4GCN A;  4U04 A;  4CGW A;  4WUY A;  1YSE A;  3KZ3 A;  2Y4T A;  5CMW A;  3T5X A;  3G7D A;  5AEN A;  3CVU A;  5T3R A;  3LDZ A;  2AXZ A;  4PH4 B;  2KC7 A;  1DVP A;  3L08 A;  1ZU2 A;  3CLC A;  2RD0 A;  4YG4 A;  3LYA A;  4CGV A;  5JHA A;  2WQ6 A;  2IVG A;  1ELK A;  3F51 A;  2PM6 A;  4GHJ A;  3FUJ A;  3O9X A;  5G04 J;  2XCJ A;  4PU7 A;  4O8B A;  3EIJ A;  4KT6 B;  2I2O A;  4I9E A;  3ZN3 A;  4BTA A;  4BWR A;  2IFU A;  4AEZ C;  1HO8 A;  3ML8 A;  4JHJ A;  1QPZ A;  5FQ7 A;  3CVN A;  5FZQ A;  4L23 A;  3CQG B;  3CHM A;  1NP7 A;  4BFR A;  4GA0 A;  4UI9 C;  3UT7 A;  3IBE A;  2XPZ A;  3OXG A;  3PRZ A;  3S7J A;  4MRU A;  3CEC A;  4PU3 C;  3B13 A;  2IOL A;  3SF4 A;  2FF4 A;  3ENE A;  4J8E A;  3ULQ A;  5A6C A;  4YVO A;  5EDS A;  4C9B B;  4QFV A;  4U07 A;  5ANL A;  4FA6 A;  1LF8 A;  3ONL A;  3OAW A;  4DK5 A;  1PRV A;  1EFA A;  4RSY A;  4ANW A;  5LCW J;  1X5B A;  4A1S A;  4EZK A;  5D0O D;  1WET A;  3ZXS A;  4YG1 A;  3D1N I;  3FEX A;  4AY5 A;  3B7U X;  4MS6 A;  4LUN U;  3UUX A;  4JQD A;  2XGO A;  5BW8 C;  3KEZ A;  1GW6 A;  4I9C A;  2LYL A;  2JCG A;  4Z5D A;  2CG3 A;  4G24 A;  4CT4 A;  3LPZ A;  3PEU B;  4GZ3 A;  3L1P A;  2WVI A;  3L17 A;  4CT0 A;  1E8Y A;  5FTP A;  2L49 A;  4G23 A;  4J6I A;  5AIJ A;  2IVQ A;  2WMN A;  5KJL A;  2EBY A;  3CVW A;  1PC2 A;  3JUI A;  4P29 A;  3RRN B;  3LY8 A;  1E8W A;  3Q4A B;  4WWP A;  2YHE A;  3MV3 B;  2EF8 A;  1JFT A;  4L2L A;  5G2N A;  3SD5 A;  2VSY A;  2X6H A;  3S7F A;  3RO3 A;  3UQ3 A;  1PRA A;  4ATG A;  2GRL A;  2VTB A;  3MCX A;  3CHO A;  2J4B A;  2PL2 A;  3OXL A;  3CHP A;  3I3N A;  5FZR A;  2PUC A;  4GYO A;  5ARF A;  1S7E A;  3HIZ A;  2LYR A;  4PU4 C;  2CFZ A;  5DIZ A;  2R63 A;  3U64 A;  2BF0 X;  1WM5 A;  1JWL A;  4GA2 A;  4FN3 A;  4I6G A;  4KZ0 A;  3GYZ A;  1W3B A;  4I1M A;  2XCC A;  5EX3 A;  3FY4 A;  5G05 C;  4YG7 B;  4XI0 A;  3FDH A;  3D9I A;  3PVL A;  2MEZ A;  3PUK A;  4H7X A;  5G55 A;  1HXI A;  3L13 A;  5BT1 A;  4GA1 A;  2I9C A;  4B8C B;  2CRO A;  4GMJ A;  4HVB A;  3U3W A;  2BNM A;  1NA0 A;  1QP7 A;  5C1D A;  4IRU A;  4NUR A;  2KPJ A;  3GN5 B;  4I6U A;  2XSD C;  2O4A A;  2J08 A;  4FP7 A;  4UWH A;  2JEK A;  3BEE A;  2PZI A;  4I2Z A;  4DLO A;  1ZZC A;  1TEZ A;  4N2S A;  1QQB A;  4GZ6 A;  3JYS A;  3QAR A;  4B0Z A;  4U0U A;  4NAC A;  4I17 A;  4PS8 A;  4IWR A;  4Y6C A;  4J1W A;  3QWP A;  2IJG X;  2LSU A;  4H7Y A;  1E8Z A;  4XKB A;  3BDN A;  2ION A;  3MV2 B;  4FBI A;  3FTU A;  3QAQ A;  4HS2 A;  5LP0 A;  4Y6W A;  2KM4 A;  1X57 A;  2I1J A;  2PQR A;  2PE5 A;  2HYZ A;  3EDT B;  4L1B A;  3B7T A;  3L16 A;  4I1O B;  4GML A;  4DI3 A;  1XGW A;  1UG3 A;  3QOU A;  2L9B A;  3MJW A;  4G11 A;  1U3D A;  4OYS A;  2J9Q A;  3LVR E;  4F3V A;  4I6J A;  4X4F A;  2WXJ A;  3TJP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...