1IC8A

Hepatocyte nuclear factor 1a bound to dna : mody3 gene product
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
190
structure length
170
Chain Sequence
KELENLSPEEAAHQKAVVETLLQEDPWRVAKMVKSYLQQHNIPQREVVDTTGLNQSHLSQHLNKGTPMKTQKRAALYTWYVRKQREVAQQFTHARNRFKWGPASQQILFQAYERQKNPSKEERETLVEECNRAECIQRGVSPSQAQGLGSNLVTEVRVYNWFANRRKEEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Diabetes mutations delineate an atypical POU domains in HNF1-Alpha
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
molecule keywords 5'-D(*CP*TP*TP*GP*GP*TP*TP*AP*AP*TP*AP*AP*TP*TP*CP*AP*CP*CP*
total genus 50
structure length 170
sequence length 190
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-03-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1ic8A02
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 1ic8A01
4M6VA 2OR1L 3I4NJ 1JJ6C 4AYBN 4X4HA 1JH9A 4M3GA 4BY1J 5EGOA 4A3MJ 2E2HJ 1ZZ6A 1MH3A 1RZSA 4D5CA 2MW8A 2LYPA 3GBGA 5F1JA 4IVZA 1WGXA 2HDDA 2XB5A 5IP9J 1BDIA 1VF9A 2QCOA 3VPRA 2R0QC 1ZPQA 4JX4A 2LY9A 2XIUA 1PNRA 1GV2A 2M0CA 4L5EA 4Y52J 1DW9A 1NEQA 2AW6A 4Z5CA 4PU7A 4MO7A 2EZLA 4IWRA 4J1WA 1X2MA 1Y9QA 3LISA 4YBAA 3BQZA 2R5YB 1RPWA 1RETA 4C3IJ 1K83J 1B0NA 2DMPA 1PRAA 1U9NA 2PIJA 3RKQA 1U78A 4JX5A 4IHYA 1QVUA 1JTYA 3A01A 2EQRA 4XRSA 2I10A 2AXUA 4PU8A 2JMWA 4FBIA 1ZQ3P 3OQNA 2ICTA 1LCCA 1LLIA 2IBDA 1NTCA 4UUSB 5K7HA 3HOVJ 3S16J 2LP0A 2LTPA 3GTLJ 2ICPA 2AHQA 3PO2J 4YG7B 4X4DA 5HODA 5J3LA 3ZQCA 4IEJA 5EZHA 2KDZA 1XC5A 1QPIA 2DA7A 4D7MA 2HXOA 4DZPA 2VKVA 1Y7YA 2L7FP 3TW6A 5BNGA 4RBOA 1LMB3 2JJ7A 2R5ZB 2IVBA 2IEKA 1ENHA 1R63A 1UXDA 2LYQA 1JFSA 3VK0A 2FJ1A 3BR6A 1L1MA 2FQ4A 3M3YJ 2EBYA 2DMQA 1ETXA 4FE4A 4B1RA 5J1YA 3SJMA 3EUSA 5EDNA 2H8RA 2WUSR 3S1RJ 1WIZA 4XRMA 1RPEL 4J19A 1VPWA 3SDGA 3G7DA 4EEFG 3LSGA 3ZQHA 1BW5A 3SFIA 4J1XA 1ETYA 3G1OA 1T33A 1E3OC 1ORKA 2CJJA 1TWAJ 1MBEA 2Y0SN 1T56A 3W6VA 1IJWC 4BBSJ 2DTZA 2JK3A 3O9XA 3HKZN 2ELKA 3OP9A 1RZRA 5GP9A 3FMYA 3ZQFA 2X9DA 3MVPA 4B3AA 2M9HA 1F43A 1LFUP 3WHBA 3K2AA 2DMUA 3Q0UA 1W0TA 1PRUA 2AO9A 2EZHA 4FTHA 3PM1A 4X1EA 3ZQLA 1JWLA 1JT6A 4GFBA 3RZDJ 1JUMA 2CQXA 2K9SA 3FISA 1JGGA 5IOZA 1B8IA 2IVQA 5EG0B 1AKHA 3PXPA 3U3WA 2LK2A 1W0UA 1OCTC 2VUMJ 1UTXA 3JRDA 1OCPA 1YRNA 5J1UA 5EF6A 1TWHJ 2LYLA 4Y7NJ 4X4BA 2HOAA 5M3FJ 1QRYA 3MN2A 2IVGA 3ZHMA 2O4AA 2HI3A 1PUFA 3OIOA 4MIMA 2CU7A 4XICA 4A3IJ 4IA8A 1OJLA 1IGNA 3GTGJ 2B63J 2YS9A 1JUPA 1ITYA 1X58A 3K7AJ 1B8IB 3FYAA 4V2GA 4LOCA 1ZGWA 1EF4A 4MFDA 1AHDP 2LCVA 3OSGA 2MEZA 4GQMA 3IV5A 3QYXA 1ETQA 3PO3J 3S1NJ 1MNMC 5FLMJ 1HLVA 2BJCA 2EBIA 1PUFB 2AUWA 3CCYA 3DNVB 4A3CJ 4M3FA 1BDHA 2GM4A 5C3EJ 4IHWA 5EYRA 3S17J 1ZZ7A 2O38A 4A69C 1AU7A 1MBHA 3H0GJ 3JRFA 3LSPA 1DU0A 3BTLA 3G1LA 1GT0C 5GPAA 4W97A 2EH3A 1QP0A 3IH3A 2Y9ZA 5F0CA 2WB1N 1VI0A 3QQAA 1G2HA 4A3DJ 4I76A 1F36A 2IAIA 1FIAA 1QQAA 1A6IA 2FJRA 1PRVA 3HOWJ 4QTRA 4RDUA 4A93J 3SCGA 3BR1A 2G0EA 3CQZJ 2LKXA 2JVLA 1B72A 4BBRJ 3ZQGA 4JX6A 4UUSA 1IRZA 3JRGA 4I6RA 5E3OA 1JT0A 2XPVA 3HM5A 4DZJA 4X4EA 1CQTA 3MLFA 2A6CA 1ETWA 3JXCL 3GN5B 4PU3C 2MG4A 3FKIJ 5E3MA 1JKQC 1OFCX 4B4CA 4A3GJ 3GTQJ 2O49A 4V2FA 3JR9A 3S8QA 1XS9A 3BR0A 1MBGA 1IV6A 1NK2P 2PMZN 2GZUA 4YG4A 3G5GA 2L49A 3C2BA 5JLWA 2AXVA 2KEKA 3BD1A 2Y9YA 1GUUA 3H5TA 5FKNA 1H8AC 1XG1A 4JQDA 3BTIA 4PU4C 4FISA 1MBJA 3BDNA 2GRLA 4X4GA 3CMYA 5DTDA 4X4CA 1ZR2A 3DCFA 4QSHA 4IHVA 4YG1A 2Y2ZA 1FEXA 2MQKA 1LFBA 2HOSA 2JA7J 1SFOJ 4X6AJ 2EZKA 1UG2A 1TWFJ 2LYKA 1X57A 3L1PA 5JLXA 2NVYJ 5IP7J 3HZIB 2NS7A 4BY7J 2E1OA 2ID6A 4G12A 2YUSA 5M3MJ 3DEWA 1NERA 2R63A 4OB4A 5C4JJ 3HDDA 2GBYA 5M5YJ 2FD5A 1H88C 3BR2A 3F52A 3E7LA 3SCHA 1JUSA 2HQ5A 4FCYA 1JKOC 5IOYA 3UFDA 2MSYA 2NVTJ 3CROL 3A02A 1WPKA 1ZVVA 2O9LA 2TCTA 2IU7A 2R92J 3A01B 2CSFA 3S2DJ 3WHCA 3OSFA 2XGCA 1BW6A 4XIDA 3BR3A 3M4OJ 1BA5A 1QPZA 3OQMA 1ETVA 1HDPA 5FKOA 4F8DA 4NDLA 3HOZJ 1POUA 2WIUB 4JCXA 4NDWA 1DU6A 2LVSA 2E2IJ 2DJNA 2K40A 1FTTA 2VPRA 2R1JL 2XJ3A 2K9QA 4MLOA 2M8GX 1IUFA 5K7ZA 3ZOBA 4ABZA 3HOYJ 3ZQIA 3UKGA 2LYSA 3HEFA 5F0HA 4X4FA 1WETA 4MCXA 3MKLA 3LFPA 5EZGA 3FYMA 2PUCA 3LSRA 3HGGA 4YARA 2DMNA 1I50J 1JTXA 2NVXJ 3GTOJ 3Q3SA 3BG9A 2KEJA 2KEIA 2X48A 2CUEA 2OPTA 3TW7A 3JRCA 1GV5A 1QVTA 4GHJA 1BL0A 1QP4A 4A3KJ 4BKXA 3FIWA 5F08A 2BNNA 2OF7A 3HBLA 3LSJA 1HOMA 3BTCA 1GVDA 3IH2A 4AUXA 3JRAA 2CRGA 1RESA 2DA4A 1LE8B 1PERL 2DA6A 5A7LA 2WAQN 3NAUA 4M3DA 1QQBA 2R5YA 1WH5A 3F51A 1JKRC 4Z58A 2L7MP 1CJGA 1B72B 1VNDA 3BG5A 1S7EA 1U9OA 2XGEA 1I6HJ 1JFTA 4W1UA 5IYBJ 4C2MJ 3R1FA 1RR7A 1TC3C 3S14J 1MBKA 1D5YA 4QIWN 1DWKA 1WH8A 1P7JA 3JRHA 1TWGJ 2XI8A 4I6TA 4M3BA 2AWIA 5F0FA 1XWRA 2GLOA 4JYKA 1K61A 4DYCA 3BQYA 1HDDC 4FE7A 1YRNB 2HINA 2BNOA 3CDLA 3D1NI 3GTKJ 1O4XA 5K98B 2PUAA 4Z5DA 3NARA 5FKMA 2R5ZA 2PE5A 3OMTA 1RKTA 5FLVA 2LLKA 4XK4A 1VFCA 3GTJJ 1MSEC 4C3JJ 2K9NA 5E3LA 4DYQA 4X4IA 5K7FA 3BR5A 3HOXJ 3ZKCA 1X2LA 4D5FA 3FK7A 3F6WA 2XPWA 1Y1VJ 1NK3P 1HCRA 1MH4A 5F27A 3CECA 3SCFA 1UXCA 3QF3A 2D5VA 2CROA 4FN3A 2PUEA 4MFEA 1ZS4A 1BJZA 2NOGA 1YSEA 2IV1A 2ZB9A 1MBFA 5FKLA 1FIPA 1UMQA 1RIOA 1ETKA 3B6AA 4D7NA 2EF8A 5EEAA 2COBA 1H89C 2XGDA 2HOTA 2XCJA 1WI3A 1ZR4A 5IPAA 3S1MJ 2R93J 2L7ZA 2L9RA 3QWGA 3O8HA 2PUDA 1RKWA 4I8TA 1ZZBA 2DA3A 1OSLA 4O8BA 1RZRD 2JA5J 2JWTA 1SQ8A 1IDZA 2HYJA 4I6ZA 1ZK8A 3GBFA 2NVQJ 2TRTA 1MSFC 1A5JA 2MGQA 3RZOJ 2Y30A 5M5XJ 1Y1WJ 1WCMJ 1IG7A 1TWCJ 1Z77A 3IH4A 2R7ZJ 5EGOB 2EZIA 2XB0X 3HB9A 2E2JJ 5E3NA 1R69A 2LYRA 1LCDA 3LOCA 2QF7A 2LYJA 3I4MJ 4Y42A 3JXDL 2FX0A 2WV1A 3S2HJ 3S15J 5FKKA 1ZAYA 1P7IA 2XRLA 1ZZ9A 2JA8J 2ECBA 1X2NA 1Q1VA 3Q0WA 3RZZA 3B6CA 5M5WJ 2O7OA 3BG3A 4M3EA 9ANTA 1R9TJ 3IVPA 2VI6A 2CQQA 4DYRA 2XSDC 4Z59A 4DW6A 2PUFA 2ID3A 3Q0VA 3TEDA 1QP7A 1JJ8C 4UUTA 1ZTRA 2LD5A 2DMTA 2XPUA 2ME0A 1EFAA 4Z5HA 2CUFA 1WH7A 1POGA 4A3JJ 1ADRA 4I6UA 1ZZCA 3RQIA 3BS3A 4XRSG 3ZHIA 2PUGA 2DA2A 2LFBA 3JRIA 2AXZA 3HOUJ 4BXXJ 2B5AA 2RAEA 1LE8A 2M2EA 2JCGA 3B7HA 1UHSA 3A03A 3OOUA 5EG0A 2DN0A 1AKHB 4IHXA 2EWTA 2Y31A 3H3VK 3BT9A 1ZKGA 3JREA 2OFYA 2M34A 3HGYA 4JCYA 3GTMJ 3G1MA 1SANA 2P81A 3TP0A 3TRBA 4HNVA 4JP0A 5F04A 2X6OA 1Z0XA 2NS8A 4A3EJ 2ECCA 4CYCB 3QPLA 1HF0A 2H1KA 2IUOA 3O8GA 2W48A 2HSGA 1IC8A 3JXBC 3CLCA 2L0KA 5C4XJ 3FK6A 2VKEA 2ME6A 1U8BA 2LR8A 2JN6A 4A3BJ 3JRBA 2BNMA 3F0CA 2KPJA 2DA5A 3KZ3A 5GPCA 5DS9A 1ETOA 2YU9J 1JKPC 3KJXA 3LNQA 3GTPJ 3QQ6A 1ZZ8A 3OQOA 2HXIA 4MCTA 4C3HJ 3QPSA 1LQCA 3GN5A 1FTZA 4CYCA 5IYCJ 1WH6A 2DA1A 3BTJA 4AC0A 3S1QJ 5FJ8J 2GRMA 2O8KA 2JA6J 2E19A 1ZUGA 1I3QJ 3KXAA 2L8NA 4A3LJ 1IDYA 2KZ8A 2PPXA 1FJLA 2KT0A 4S0HB 5IP6A 5IYDJ 2N8GA 5C44J 3TP3A 4A3FJ 2PUBA 1GDTA 1APLC 5J1RA
chains in the Genus database with same CATH superfamily
1T0FC 3E6DA 1JJ6C 3HKZA 4AYBN 2VIXA 2VASA 3HOSA 3WGGA 4Q2JA 3OYMA 3RYRA 2EB7A 2V1NA 4RMNA 2BXYA 3F8CA 1ZZ6A 2HKXA 1RZSA 4D5CA 3CMMA 2LYPA 5F1JA 1JGSA 1WGXA 4M72A 1OMIA 5IP9J 3PIPF 3ZMZA 1VF9A 3FMSA 3OIPA 2M4KA 2XIUA 4XLPF 1GV2A 4DE9A 3JW4A 1QHGA 5LHHA 3A2KA 4WWCA 4Z6YA 2RQPA 1F9NA 1OCOH 2ZFUA 1Y9QA 5D5WB 3BQZA 3V8KA 1BIAA 2QUFA 1K83J 3QYEA 2DMPA 2QA4I 1PRAA 3OY9A 2K4JA 3RKQA 2M45A 1H9TA 1HKSA 4LD5A 1QVUA 2AQEA 5KVRA 2VL8A 2I10A 5CYVA 1HQ1A 4OIPF 2VC1A 2CV1A 3MFKA 3RKXA 1ONVA 2JMWA 2ZNZA 4JK1X 1ZQ3P 1LCCA 1R1VA 2Y48A 5K7HA 2K02A 2ICPA 2LTPA 3ZQ7A 2F4IA 2PXDA 3CJQB 3OYFA 5J3LA 4E7SA 2DW4A 2BHYA 5EZHA 1QPIA 2DA7A 2P6TA 4D7MA 2HXOA 2VQCA 1Y7YA 2FU4A 4CICA 2L7FP 3IRQA 3JTHA 1ZG1A 5LRSA 3VEPA 4GRIA 3CC4I 3A9ZA 4CZCA 2IVBA 1KGSA 1L3LA 2IS1A 1ZLKA 1UXDA 2W1OA 3H5AA 3ZN0A 3BCBA 2FJ1A 1L1MA 2BY3A 4M9ZA 3GZDA 2EBYA 2DMQA 5HLTA 1ETXA 1PUEE 1HA8A 4KICA 4HLYA 1LFPA 4UB6C 4CSWA 2VN2A 3HYIA 2WUSR 2H8RA 5KAIC 1X3UA 5KHDA 4XRFA 4M71A 1IN4A 3IAM2 5E20A 3RKYA 3S3MA 4OMZA 5JR3A 1TWAJ 2Y0SN 3AG1H 3KLNA 3ERMA 2DTZA 4DJAA 1OYYA 5L3FA 3O9XA 2XDVA 5ICFA 3CESA 2NVUB 1WJBA 1K78B 2ELKA 3ZMUA 3OP9A 1RZRA 1Q1HA 3H1CA 3CCVI 1NH3A 3CF2A 3E6MA 4KIFA 1LFUP 3K2AA 4B3XA 4KN7X 2KISA 5JI6A 5GTHC 2CQXA 3FISA 4RLFA 1M1EB 1OCTC 5FLXZ 2ESHA 1SAXA 1I3AA 1UTXA 3JRDA 4ZYDA 1YRNA 5J1UA 2EIKH 4Q48A 2ZXWH 1LPQA 2WWYA 5DSXA 1QPMA 2EILH 1QRYA 2OCEA 3I71A 2DYSH 2FNPA 4L9VA 2O4AA 3KZYA 5BMZA 2HI3A 3UR3C 2P8TA 4XICA 3G0TA 2YPRA 2EFWA 4HRAA 2YS9A 1ITYA 4XMYA 3ZMDA 5BPIA 3DTKA 3M1CA 4WXDA 2LCVA 1I1SA 4KFCA 4WXHA 2KIFA 4GQMA 3NEUA 1MNMC 3MWMA 2DFIA 3Q9VA 2BJCA 2H1LA 1Z7LA 2GM4A 1ZYRF 1S7AA 5C3EJ 1XTAA 1G3SA 3ZN1A 3S17J 1Z7UA 2O38A 3IL2A 4A69C 1YW8A 3H0GJ 2QM3A 4I7HA 5ERIA 2PX9A 3EETA 3LSPA 1QO0D 2EH3A 3MKZA 4BYYA 3SEZA 2FOKA 1WKMA 3QQAA 1G2HA 5L3DA 4A3DJ 4XONA 2F4OB 1LEAA 2V1XA 3S8PA 3FBNB 4RGRA 3EUAA 1LQ1A 3BR1A 4DOZA 3Q9SA 3TGNA 3ZQGA 4UUSA 5LBQA 2R7QA 1JT0A 4Y13A 3HM5A 2VT3A 4LFUA 3MLFA 1QNTA 5FFZA 2WBMA 5JVGF 4RM2A 3GCMA 2HQNA 4YFKF 2Z9OA 3F8NA 1KQ9A 1XCVA 2PMZN 1T6SA 2ZCWA 4OIRF 2QZ8A 2XGXA 5E17F 2NS0A 3BD1A 2F5DA 3OL3A 3DM5A 4ZZDA 2GIZA 1IRFA 1F5TA 4FISA 1ZREA 2KRFA 4X4GA 5DTDA 2UZKA 1S72I 4X4CA 4QWQA 1KU2A 3DCFA 4IHVA 3K4KA 2WY7Q 5GAGJ 1MNEA 3ME5A 5L3BA 2V4JC 4HA8A 4X6AJ 3EPZA 2LY2A 3VWBA 2CV2A 3RQ4A 2AXTC 2HNHA 5JLXA 3K1PA 3FZVA 2D1VA 4BY7J 1W7PA 2YUSA 2EV6A 4LJZF 3DBLB 3H9JA 2R63A 3OYAA 2OA4A 5HOOA 5M5YJ 2JQ7A 3CJRB 2FD5A 4BNCA 3F52A 3DLAA 3AKZA 3MMYB 1JUSA 3LSTA 1JKOC 2MSYA 5A2QK 2NVTJ 2V1UA 4MGRA 2M30A 5HS8A 2DK8A 4BHBA 2FSWA 2KMUA 4ZZLA 3QOEA 1R1TA 3QOXA 1D8KA 1BA5A 4PZJA 5EEHA 3KP3A 3OQMA 5FKOA 4BGDA 1W5SA 4NDLA 3R0JA 1POUA 4NDWA 1DU6A 3TQNA 3QP6A 2Z33A 1FLIA 2E2IJ 2DJNA 1YYVA 4LG0A 2R1JL 3HG9A 2XJ3A 2ZKZA 1A6QA 2K9QA 4MLOA 5K7ZA 3VSKA 3ZOBA 4ABZA 4X4FA 3HEFA 3LFPA 1FP2A 3FYMA 3HGGA 2HPIA 2ZO4A 3BJ6A 3K4CA 2DMNA 2KP6A 1I50J 2QQ9A 3WTTC 2VC0A 3KIOA 1OR7C 3N05A 3MZHA 1BR1A 5FRNA 2O8XA 2OPTA 4N9HA 1QVTA 5DD4A 3RPUA 3A0HC 3CC2I 1BL0A 1BOAA 3UNGC 2YSRA 5F08A 4IKFA 3FXLA 3HBLA 3LSJA 1HOMA 4ER0A 1XGMA 2VKHA 3IH2A 4ZH4F 1DPRA 1FMWA 3CUQB 1XSDA 2VJ4A 3RJPA 3OYHA 2JSCA 2WAEA 1Z6RA 4N9IA 4LK1F 1T08B 2DA6A 3F6VA 3CMAI 5A7LA 1FC3A 2VXDA 1WH5A 3KCCA 3F51A 2EFQA 3CJTB 2JVHA 2L7MP 2LSOA 1R36A 5LHGA 1K4SA 1U9OA 1I6HJ 1YJNI 5BS6A 1BI2A 3KP7A 4HF0A 1MBKA 3W6KB 3PQKA 4L18B 4EZIA 1P7JA 1SD4A 1SMYF 1YS7A 1EH6A 1JI8A 2XI8A 2XXPA 4I6TA 5LEJA 2VLAA 2AWIA 3IKVA 1FBSA 5F0FA 2HQAA 2J7UA 3DBRB 4JYKA 2NRAC 4XOPA 1YRNB 2BNOA 1J7KA 3GTKJ 1LVAA 3OYNA 3KLOA 3LFUA 2PUAA 2A3SA 2EPFA 3F6OA 2PE5A 1RKTA 3PFYA 3SXYA 2LLKA 2ISZA 1RZ4A 4MTDA 2QKMB 4C3JJ 2K9NA 1WRJA 4DYQA 3IWFA 2VBXA 1HSTA 3J81Z 2M4HA 4X4IA 3MEXA 2M3AA 3BR5A 3BG7A 4CCKA 3FM5A 4FT8A 5CJ9A 3DPLC 1SEUA 1OISA 2EK5A 3FK7A 3F6WA 2XPWA 1ODDA 4AYBA 1YJWI 5DTRA 5F27A 1N78A 3SCFA 2W84A 3WTVC 1P4XA 1XPXA 2Z99A 4XKBA 3CCMI 3H5RA 4FN3A 3F21A 1ZS4A 1BJZA 2NOGA 4Y4RA 3OYDA 3B6AA 2XAFA 2COBA 1H89C 3FXRA 1P4AA 1WI3A 2E36A 5B1BH 2L9RA 3DFGA 2CW8A 3ZPLA 2DA3A 1HXDA 2L54A 4O8BA 4OWRB 3WU1B 2L5QA 4ENJA 2KZGA 4RGUA 1SQ8A 3E1SA 5TGTA 3GBFA 1MSFC 2MGQA 3M9AA 3R09A 1Y6IA 3X2QH 2R7ZJ 4UVAA 2JUCA 3NQOA 4WX9A 2EZIA 2X51A 3HB9A 4CGZA 2IXSA 2HFHA 4Y42A 1S3JA 2M87A 4HBLA 2WV1A 2LH9A 3S15J 3WGIA 4AU7A 1X3ZB 1ZZ9A 3Q0WA 3BG3A 4ITVA 3ZMTA 2PFBA 5ICCA 4Z59A 1FOKA 3PNTA 4F93B 4PSWA 2E7WA 3TEDA 2MC3A 4LIVA 2KRHA 4YFNF 1ZTRA 2XPUA 1EFAA 3B02A 2CUFA 1WH7A 4U87A 1LNWA 3I54A 3GW2A 3WTYC 1EV7A 4EGZA 3I59B 2AXLA 3QWLA 3F22A 2IS4A 3L7WA 3JRIA 4GCVA 1VTNC 4IHSA 2AXZA 3K4NA 3KP4A 2B5AA 5E79C 2IA0A 5D4SA 5EG0A 2Y31A 4IVNA 2IGMA 4F3QA 3JREA 3GFJA 4MQ9F 3CCEI 2H8WA 4JCYA 3GTMJ 3LQXA 1HSJA 2P81A 4DGWB 1FNNA 3TRBA 2R7WA 2NS8A 4CYCB 2H1KA 3QPLA 2JUGA 2GXGA 2QLZA 2ELJA 1FMVA 2L0KA 4PUSA 3FK6A 4R8HA 2WTEA 1AOYA 2KKOA 2DJIA 2RVCA 2A61A 3ABUA 4A0YA 1D0YA 2CUZA 4HG2A 4BQNA 2ZNYA 2CYYA 2V9VA 4XQFA 1XCBA 3OQOA 3IUOA 2UV1A 3QPSA 4KJZA 1YHQI 1S29A 3GN5A 4CYCA 5IYCJ 2EIJH 3FXJA 4U0WA 1J59A 1XMKA 2PMHA 1OKRA 2E19A 2H27A 3VYRB 4E7JA 1VZ0A 1SVMA 1S8NA 2O5RA 2Q1ZB 2PJPA 5IP6A 4A12A 2N8GA 2FNAA 2L4MA 4RA2A 3TBIA 4HF2A 2IGNA 5CVVA 3TP3A 2MD0A 1UHWA 3TKYA 4J00A 2LBFB 2OR1L 2DAOA 1KYZA 1IW7F 3HXLA 4AD9A 3V42A 2MFZA 2MH9A 3A1YA 4NC8A 4A3MJ 2E2HJ 2A05A 4P5OA 3L2QA 4PJLA 4E6KG 4ZYEA 3OKZA 2QSFX 2VE9A 5DTMA 3CCUI 4LK0F 2QVOA 1ZPQA 3U9GA 3G4SI 1Z3XA 5DD8A 4WK8F 4L5EA 3CCQI 1ZRCA 1UAAA 3HTSB 3ISPA 4Y52J 5H2FC 1DW9A 4Z5CA 3G71I 3VWSA 1X2MA 1MIJA 2MH2A 1MNDA 1YOVB 1HKQA 4BJ6C 3BJAA 2Q2EA 5AONA 3I53A 1B0NA 4S05A 1IZ1A 4IOCF 4CDGA 2M0MA 4JX5A 4Y3OA 2VPLA 2YX7A 2LY1A 4S04A 2FEZA 1QGPA 3VOEA 4XRSA 1T38A 2E1CA 5GAHJ 2AXUA 4PU8A 1KQ8A 4FBIA 2BVMA 2ICTA 1LLIA 1NTCA 3R60A 1R00A 4X4DA 1Z1DA 3LL7A 1A31A 1NG6A 1FSHA 3CJNA 4HV6A 2PJRA 1ZN2A 4IEJA 2KDZA 1XC5A 1PVEA 3QYFA 4DZPA 1R22A 1XD7A 2BOLA 2M7AA 4RBOA 4TV7A 1LMB3 3QRFF 2JJ7A 3S3NA 2OTLI 1ENHA 2BHZA 5HLHA 1X1AA 1XGNA 2FE3A 2FQ4A 2XXQA 3M3YJ 2IGKA 3T8RA 3HZJA 2G7HA 4FE4A 4M74A 3J7AO 2WADA 2BE5F 3W2WA 2HGCA 2ELHA 3IRRA 1VPWA 5LLQA 2XC7A 4GGGA 5CVIA 5B1AH 3G7DA 3LSGA 3ZQHA 3U1KA 1V3FA 4UY8I 3FXQA 1FBUA 1E3PA 3W2AA 3G1OA 4HQEA 2XF6A 3IKTA 1T33A 3V7RA 1T56A 2CUJA 3R0AA 5DDGA 4BBSJ 3I58A 2L9VA 5J40A 1X1DA 4CYDA 1U2ZA 3RTRA 3K2ZA 3FMYA 2GXBA 2P7VB 2X9DA 4L9JA 2NAZA 1G3YA 2M9HA 3VFZA 4HNUA 2IA1A 1F43A 2K3PA 3LA2A 2FA5A 4A2UA 1OCRH 1BOBA 4KIBA 2DMUA 3P7NA 3Q0UA 3DU5A 5A2QZ 1W0TA 4Z2YA 2LG4A 3GF2A 4HLXA 2LC2A 4GFBA 2QQAA 1EKEA 3OV8A 3BROA 4IL6C 4DBQA 4FASD 1JGGA 3PJRA 2IVQA 3PXPA 2DBBA 1QP7A 1W0UA 2VUMJ 1YIJI 3MEJA 5DRTA 4EQQA 1FYMA 2IGOA 1TWHJ 3PQJA 1U5TC 1MMNA 1IO2A 1WSUA 1QB2A 2IVGA 3C7JA 3OIOA 2LNMA 1B59A 1R4NB 5DM7F 2Y75A 4IX7A 4F92B 4IA8A 1IGNA 2B63J 1W7PB 4ZTFA 2Z16A 4UUVA 5J8FA 4E7KA 3FYAA 2X1DA 1SVLA 4MFDA 1AHDP 2X6WA 3I55I 1ETQA 3L2UA 2CFOA 5FLMJ 3CMEI 5ICGA 1O7LA 1XN7A 3DKXA 5HVQC 2AUWA 4YELA 3WE3A 3I59A 3CCYA 1REPC 1B4AA 3BLYA 5D5XB 4CO8A 5FO5A 1R5ID 1ZRDA 1P2FA 2O61A 1JXSA 5GAHi 4XORA 4NHJA 5D8LB 1ZH5A 3PE5A 2R7DA 4RB1A 1UB9A 4N4NB 3G1LA 1V5EA 5LFAA 1S9HA 1Y0NA 2EWNA 5CVJA 2Y9ZA 3KYLA 5F0CA 5DCMA 1VI0A 2X1EA 3GWZA 5IY5H 1F36A 2IAIA 1QQAA 5DTQA 1D1AA 2LKXA 2JVLA 1B72A 2RGVA 2JRMA 1DULA 2OUMA 3JRGA 5J4VA 1V54H 1P4WA 1K78A 1WWXA 2E71A 1BBYA 1VQLI 4DZJA 1ERDA 2J7WA 3ZPXA 4X4EA 1CQTA 2QGUA 2A6CA 2L4AA 1MMAA 2HYFA 3GN5B 1K6YA 2DQRA 3AFHA 4FX4A 5E3MA 1OFCX 4EJWA 4KT6A 4V2FA 3HRTA 3JR9A 3PNYA 1XS9A 1TNTA 1XDUA 3CZ6A 4XM3A 3QP5A 2GZUA 3J7ZI 2ADUA 3QU6A 3G5GA 2L9SA 2AXVA 2XAHA 4BHCA 4FQGA 2E60A 3LSMA 4ENMA 3O3KA 3O6BB 4AVZA 1MFQC 3BTIA 1MBJA 3BDNA 2GRLA 2L02A 3BZKA 3S32A 4EVIA 3DBHB 3REOA 1FEXA 2MQKA 4DE8A 2JA7J 4MEYF 3RPQA 2LYKA 3PSFA 4F55A 1X57A 3L1PA 4U0YA 2WY8Q 2XROA 5K5OA 5CLSA 2HDCA 1HC8A 4OB4A 2VJIA 5KK1A 5HDKA 2D1HA 3HPGA 5C4JJ 2HKOA 3NRVA 3CUOA 4NUBA 4JBAA 2FXAA 5GAGi 2DT7B 4FCYA 1WJCA 4O5VA 2QYOA 1TT5B 3EYIA 3LA7A 2R92J 2CSFA 3FX3A 3S2DJ 1RUOA 3OSFA 4EM0B 3VB2A 2A6TA 4PK4A 2C6YA 2GOMA 1ETVA 1QPZA 1HDPA 3OIQA 5F64A 1RIOH 2KL4A 1XSVA 4YIIA 2LVSA 2ZC2A 3P5JA 3SDBA 4D0PA 4EM1A 2HPMA 2K40A 1FTTA 1R49A 2KIQA 3FXKA 1QZXA 1QZYA 4QPQA 2RNGA 4BAYA 4YG2F 4D1QA 1FP1D 4MCXA 3HRSA 2BY1A 2DDBA 2IJLA 2A5YB 1FZPB 1LDKB 2CFXA 4YARA 2UUZA 2NVXJ 3CLOA 3M9LA 2DODA 4MQVA 4WF2A 1J2XA 4PJMA 3RYPA 2KEIA 3V7CA 3E5UA 3JRCA 3TW7A 2B7EA 2FOWA 1WI9A 1Z9CA 4IQJA 1YITI 4M6XA 1KONA 1CF7A 4NC7A 5LGTA 2OF7A 4AUXA 3U2RA 3JRAA 3NZLA 1RESA 2STTA 1LDJA 2ZSIB 4FHTA 1LE8B 4KISA 2EJRA 2WAQN 1SFUA 2DDAA 4M3DA 2BYVE 2HU9A 4G8XA 4BS9A 3OMYA 2XKOA 3ZR8X 2A6EF 4UNOA 3KEOA 2OV7A 1WJAA 3SR4A 1CJGA 2VQGA 1R7JA 3BG5A 4KITB 2PMUA 1O3QA 3AG3H 5IYBJ 2VQLA 3R1FA 1YX5A 4IF4A 1RR7A 1YIOA 3SYTA 3W3CA 3F9KA 4QIWN 3A4CA 2F2EA 3JRHA 4M3BA 2O3FA 5EJCA 3GZCA 2XF5A 4DYCA 3ABKH 3BQYA 1RRJA 1Y56A 3C2GA 4FE7A 1HDDC 3S3OA 2CGPA 3CDLA 4IOAF 1HQCA 1O4XA 3UWPA 4ER6A 5K98B 2R7XA 2JT1A 3NWSA 2BW3B 5LHIA 3OMTA 3TELA 5LRRA 4OMYA 1GVJA 2ZBKA 3CDIA 3DEUA 5E3LA 5F1RA 1SAUA 2R7SA 2K9MA 2ZFWA 3K70C 3GVAA 4BE2A 4BXUA 1DP7P 3HOXJ 2VQHA 1L0OC 1GDTA 1IN5A 1EH8A 4E4HA 3M07A 1Y1VJ 1NK3P 1HCRA 2RC4A 2KDOA 3TDZC 4G7ZF 3QF3A 2YX4A 2D5VA 1WFXA 2LF8A 2CROA 2PUEA 3SHFA 2PXQA 1D1BA 4B09A 1FIPA 1UMQA 2L3DA 3QOPA 1ETKA 5CVUA 5EEAA 3QAHA 2Z1DA 1ZR4A 3S1MJ 2PUDA 2L7ZA 4RB3C 2LKPA 4G6DA 4BQQA 1RZRD 2WB1A 2JWTA 2G9WA 4I6ZA 5DT2A 1W36D 1ZK8A 2TRTA 4LLLA 3RZOJ 2CG4A 1SD7A 2Y30A 4G7HF 2VBZA 1WCMJ 2NXNB 2F5CA 3KEYA 1Z77A 3IH4A 2XB0X 4ETSA 5TJJA 5E3NA 2R7RA 2QF7A 1EA3A 4HSTA 5IT3A 3I4MJ 5E8GA 1U5TB 2DXIA 2BBYA 3S2HJ 5FKKA 1ZAYA 1P7IA 2XRLA 2K4BA 1D8JA 2H94A 2HR3A 1JHFA 2COMA 3D0SA 1I5ZA 2MBFA 1K4TA 1B9NA 2HCSA 2QSHX 3OYJA 1R9TJ 9ANTA 3HSFA 4DYRA 3HC7A 2HEOA 3Q0VA 4LB6B 4KT5C 4UXNA 2IS2A 2CMPA 2DMTA 4E7ZA 2LLVA 1SFEA 1PP7U 2IRFG 2HCNA 1ADRA 4GYGA 2OD5A 4I6UA 4XLCA 1LVKA 3RQIA 3TO7A 5J6XA 3F8FA 2DPDA 2K7LA 4L0YB 3LA3A 3FWEA 1SD6A 2JCGA 3F23A 4BU2A 1V5FA 4F8DA 2MA3A 2M8EA 2EWTA 3H3VK 4EK9A 1ZKGA 1MJBA 1XGOA 4KUMA 2OFYA 1G8XA 2P0WA 3G73A 2M34A 3GO5A 3HGYA 2OZUA 2DO7A 4BL0B 3M7GA 2XAJA 4C30A 1HF0A 2IUOA 3O8GA 2W48A 2GQQA 1IC8A 2HSGA 4I01A 3CLCA 2BZTA 4PSXA 5D5VB 1MMSA 2ME6A 4R79A 2LR8A 1IRGA 3FM3A 2HTJA 4A3BJ 2XHKA 3F0CA 3LWFA 3WTXC 3KZ3A 2LNBA 4ER7A 2DQLA 5GPCA 2O0YA 2YU9J 4IJAA 4HDUA 3C18A 3GTPJ 2F5VA 2A07F 4IRIA 3PUBA 4MCTA 4C3HJ 1LQCA 3KETA 1WH6A 1HKTA 4AC0A 3S1QJ 2KZVA 2FF4A 2F6CA 1C0WA 2A6HF 4ZJZA 4IO9F 4CCOA 3S93A 1T2KA 1IDYA 2O03A 2PPXA 2P6SA 5FRMA 5IYDJ 4MHGA 1SD5A 3K0LA 3RCOA 1Y8RB 1APLC 1FOWA 4M6VA 3I4NJ 1U5TA 5KAFC 5DM6F 4Q4ZF 3ULQB 3EUHC 1JH9A 4M3GA 3DEEA 3PIOF 5EGOA 2XSJC 4KMFA 1ZELA 5JHFA 1BI1A 2ZMEB 2MW8A 2LKSA 2EIMH 3GBGA 3I0TA 1U3EM 2Z2SB 1E2XA 1U0JA 4MNUA 4I99C 4IPAA 4OAYA 2R0QC 2ETHA 2M4GA 3SZPA 4KDPA 2AW6A 1IXCA 1R6RA 4OBMA 3L00A 3ZRGA 4I98B 4PU7A 4MO7A 2HFZA 4IWRA 2XUBA 1EJ9A 2RQQA 3LISA 4YBAA 4BEHB 1T95A 1YW7A 1RPWA 2X0LA 4C3IJ 2ZJQF 4XN3A 2MLGA 2PIJA 1V55H 4PGGA 1JTYA 4BE0A 3A01A 2EQRA 2PMZA 3OR2C 3BCAA 4RM3A 1ZLJA 1MMGA 1ZGAA 2PI0A 2IBDA 4UUSB 4A6DA 4BEHA 3ERED 3HOVJ 1MKMA 2LP0A 4KN4X 5KCMA 4ER3A 5HODA 1OYWA 4HOBA 2E35A 3QFIA 1LUJB 2V9PA 1R71A 3ABLH 2VKVA 2CO5A 2BW3A 4NBQA 1V5GA 2G7UA 2NYXA 2CQKA 3CLQA 2IEKA 3RKWA 1R63A 4AIJA 2LYQA 4ZTJA 1JFSA 4FX0A 4CH7A 5E8IA 1TW2A 1MDMA 4P9UA 2IPQX 3T1BA 5LEKA 4CCLA 4B1RA 5J1YA 2KFDA 1TP4A 2RNJA 4RLQA 4PJ0C 3F72A 2DYRH 2R4GA 1WIZA 3OS1A 3IWZA 3MZYA 1RPEL 2L2OA 3OR1C 2E1MC 3SDGA 5HNFA 3DTIA 4EEFG 1BW5A 1P9QC 4PJJA 4LLGF 1VQ6I 1ULYA 1ETYA 2BXZA 1X1CA 1DP3A 3R6SA 4N0BA 1ORKA 2CJJA 2PXBA 1MBEA 2BVLA 4XOTA 1X3WB 2JK3A 2OC6A 4RB0A 4ANJA 5GTIC 5KNLA 2W7NA 5ILVA 2FFHA 5E1WA 1MJAA 1WJ5A 5GP9A 4N4OB 3WU0A 3MVPA 4B3AA 5L3GA 5IT9K 2UXXA 5DCFA 1YTYA 4XLNF 3MD2A 2IT0A 3E6BA 2AO9A 2XVCA 4MTEA 2VE8A 4DIQA 2P5LC 1RNLA 4X1EA 2CW7A 2E34A 4G6TB 3FXUA 3RZDJ 1JUMA 1KU3A 2K9SA 3CP8A 4U88A 1B8IA 3U3WA 1AKHA 2LK2A 5DV5A 1R5HA 3P9CA 4E7IA 4ESJA 3K69A 3GZDC 3EUHA 4Y7NJ 3JSPA 3CCRI 4X4BA 2HOEA 3N97A 3I56I 3GXOA 1V4RA 4O3MA 1ZG3A 1KU7A 3MN2A 3ZHMA 3PUFA 1PUFA 3KYDB 5DUKA 4AWXB 3RI4A 1TW3A 4UV8A 1OCCH 2CU7A 4NC6A 1PDNC 3VODA 3ZXSA 3I9V2 5E18F 4LGWA 1KA8A 4LOCA 4V2GA 1ZGWA 4KYWA 1EF4A 1FOYA 4OOIA 4EM2A 3HUGA 3OSGA 2RV8A 3HTUA 3QOWA 1N75A 3DV8A 3S1NJ 2PXTA 1O3SA 1K7AA 3CTAA 1UJ8A 2R3SA 1Z6TA 4A3CJ 2V26A 1BDHA 4XKVA 3LAPA 3W6JB 4IHWA 4CCJA 2LOOA 1ZZ7A 2YU3A 4BH9A 4HAMA 1AU7A 4OIQF 4G9YA 1EH7A 2VBWA 1VQNI 1DU0A 3ZQQA 2V3CC 1GT0C 5GPAA 3H35A 2QKLB 2JRTA 1FIAA 2H6BA 1A6IA 4PDKA 5F6FA 4L0ZB 1TL8A 2FJRA 4QTRA 3FDYA 4RDUA 4A93J 1H9GA 2G0EA 3V8JA 1IAWA 5DRYA 3GMEA 4BBRJ 1IRZA 4JX6A 3LAJA 2K5CA 5E3OA 1ON2A 3KP2A 3COAC 4XKWA 5TISC 1TQMA 2MG4A 2RREA 4ZYAA 1JKQC 4B4CA 3S8QA 1WJFA 4EQZA 3BR0A 4X0GA 1MBGA 1IV6A 1DGRM 4BE1A 4YG4A 1OLTA 3C2BA 4GYIA 2FUG2 3DPTA 3ONQA 1H8AC 1X4PA 1ZAOA 2MD5A 4JQDA 2LF7A 2PLYA 3CMYA 3NDBB 5GAEJ 1ZR2A 3CCSI 1F4KA 4GO1A 4YG1A 2Y2ZA 4I0AA 1YI2I 3V8LA 3K10A 1SFOJ 5EEGA 1UG2A 2EV5A 3OYBA 1RC9A 4AIDA 3BPVA 5IP7J 3HZIB 2NS7A 2KRCA 4NQWB 2E1OA 3ZMSA 4ZDOA 3RDIA 5M3MJ 4UHTA 3HDDA 2CW0F 2GBYA 1H88C 2XF7A 3RIRA 2HVQA 1TLHB 1X1BA 3E7LA 3SCHA 2XV4S 4OAZA 1UG0A 2HQ5A 4IHTA 5IOYA 3UFDA 3A02A 1WPKA 2VT2A 2O9LA 2TCTA 2ZMEC 4J01A 2IW5A 2E1NA 4L9TA 4A6EA 3A01B 3R4KA 2W85A 1BW6A 2PJRB 3KX2A 1IXSB 2ZJRF 3DPUA 1TT0A 2JSPA 3GLLA 4C2UA 2VB6A 3HL2A 1KZHA 4JOMA 3OL4A 5K5QA 4HX8A 1WJEA 2W4SA 2MYSA 2L7KA 3K4LA 3FXOA 4WCGA 3FXMA 4F52A 1UZCA 1FWZA 3UKGA 2EV0A 2DPUA 2V9KA 3KYCB 2WAQA 1A36A 5EZGA 3BZCA 2JTVA 1U6GA 1J09A 5CPRB 2M5WA 4I09A 3LSRA 2UXNA 1JTXA 2OTJI 2EINH 3Q3SA 1MGTA 2OQGA 3ABTA 3BG9A 2X48A 4ESFA 3R61A 2WAFA 4M9XA 4HW0A 4GHJA 2QSGX 1RR8C 5HS7A 3M8EA 5D6EA 1QP4A 2KLOA 2QENA 4BKXA 1JHHA 3FIWA 2BNNA 2W24A 3ABMH 5BQTA 4CXFA 2CRGA 1OCZH 1KU9A 2K86A 4I02A 2EFNA 2LLWA 5DUIA 3F3XA 1PERL 4Y15A 3NAUA 1QQBA 4O6JA 3TOAA 3ESWB 3H3UA 2R5YA 2CWEA 4Z58A 5HNHA 2VXZA 3DWLE 3E5XA 2VONA 3SQNA 3ECOA 1FYKA 1YX3A 1S7EA 1SMTA 3K1MA 4BHPA 1JFTA 2DI3A 3SEQA 2E1MB 3KL4A 2BY0A 3C1DA 2X6YA 1TC3C 1ON1A 4NQWA 1WH8A 4PFOA 4DBRA 3FMRA 4LG3A 4PJNA 2V6EA 2GLOA 4II3A 1XWRA 1K61A 3P9KA 3DLLF 1TZLA 3OWTA 4JQFA 1NW3A 5CQEA 3HJEA 2OCCH 3BP8A 3D1NI 3ROUA 2L01A 3M8FA 2WA0A 3OS2A 3ASOH 2F48A 3NARA 2R5ZA 3JTGA 4L9NA 3AAFA 3J7AY 4XKCA 3E3VA 2HVRA 3K6GA 1S6LA 3GTJJ 3EDPA 4ENNA 3U21A 1MDMB 4G94A 4Y17A 3ECHA 3ELKA 1O3RA 2BGCA 1BI3A 2JVGA 4RGSA 2P5KA 4ON0A 3NXHA 4YFXF 2Z5UA 3BOQA 4F91B 2DCEA 3VDXA 2EFPA 3BWGA 2ZB9A 1MBFA 3HHHA 3BC8A 1RIOA 3H0DA 2EA2A 4LB5A 5LGUA 1ZRFA 2XGDA 2HOTA 2A69F 2XCJA 5IPAA 2R93J 1LB2A 4II2A 4I8TA 3FKJA 2QEXI 2GOXB 1OSLA 2JA5J 2HDWA 4UB8C 3DTEA 5L3CA 2IP2A 1IDZA 1Z67A 4UVBA 1NHAA 1J5YA 2NVQJ 4ASNA 3J7YJ 4EKIA 1F1ZA 2RDPA 2R7VA 1W5TA 1IG7A 4DQ2A 1TWCJ 2ZSHB 1IUYA 3LFKA 4IRHA 2HWVA 5HS9A 3QODA 1R69A 1LCDA 2LYRA 2LYCA 3LOCA 1IV8A 2Q0OA 1VQ9I 3EUKL 1X2NA 1O7FA 2XAGA 1FYLA 3I5UA 4CA0A 3AL0B 2O7OA 2GA1A 1G3WA 2DFHA 2R7UA 2XAQA 3IVPA 2VI6A 2CQQA 4EJOA 1YW9A 1BN5A 1O57A 2XSDC 2ID3A 1YFHA 3EYYA 2ZXHA 4UUTA 1LDDA 4KMUX 3W2VA 2LD5A 2ME0A 2HZTA 4E7LA 4RAYA 4HNTA 5FD5A 1POGA 2LRDA 1ZZCA 4M9SA 2VKDA 4IXAA 1CF7B 2KPMA 2IS6A 2PEXA 4XRSG 3BS3A 2PUGA 2DA2A 1D3YA 2CQNA 4BDZA 4BXXJ 1MD0A 2ZXIA 2QWWA 2L1PA 1UHSA 3A03A 1Z91A 2M1BA 2RKHA 2Y69H 1UCRA 1UFMA 2M7BA 4HNVA 5FLXK 4JP0A 5E1XA 4A3EJ 1Z0XA 2ECCA 1IN8A 3G3ZA 2X1CA 3JXBC 3HHGA 2PQ8A 2LREA 2VKEA 4EJUA 4KIGA 2JN6A 3KPHA 3JRBA 2A68F 2DU9A 2KPJA 3IP4B 5DS9A 1ETOA 3WTWC 1JKPC 2L9NA 5AIPA 3LNQA 3KJXA 2V6CA 5H6QA 4ESBA 3QQ6A 1YS6A 5HDGA 3S2WA 3DF8A 2P5VA 1LEBA 1TQIA 1FTZA 1QQIA 3D5RC 2VOPA 2GRMA 5FJ8J 1ZARA 2O8KA 3PFIA 3ZCOA 1GXPA 1BI0A 4C9YA 2L8NA 4A3LJ 3ZP5A 1XDSA 5JVTA 2X4HA 4BUPA 4XLFA 2KT0A 4XN0A 4S0HB 1FJLA 4L5IA 5C44J 4B44A 3L2CA 4A3FJ 5J1RA 5IT9Z 4CZZA 1MMDA 1S5LC 1FSEA 4X4HA 4CHUA 1YG2A 2D2WA 1OQYA 5H6RA 3ML6A 2PXFA 4BY1J 5FD6A 1YJ9I 1MH3A 1TBXA 2O6GE 3C3WA 3DQVC 3CUQA 1D0XA 4HDVA 4XSXF 3OOPA 5ICEA 4IVZA 2HDDA 2XB5A 4HF1A 1BDIA 4UVCA 2QCOA 3VPRA 1QA6A 2VJJA 4JX4A 2LY9A 1PNRA 2M0CA 3JAMZ 1NEQA 5JHUA 5FGMA 2EZLA 4J1WA 2H6CA 4UV9A 1JE8A 5DEQA 5LGNA 2R5YB 1RETA 2BY2A 3BG6A 1QHHD 3ZMVA 1W36C 1UHMA 1VQPI 1T39A 3FMQA 1U9NA 1U78A 2FBKA 2ZJ2A 4IHYA 3CCJI 4U7BA 4PFPA 3VYSB 1FX7A 1XX5A 2W57A 3DP7A 1CGPA 1GXQA 1W7PD 1VQ8I 3TL4X 2QQ8A 3OQNA 1R1UA 2Y0SA 3S16J 4YG7B 3GTLJ 3RSNA 2AHQA 5J47A 3PO2J 2MXDA 4ZDLA 4P9FA 2IA2A 2I8DA 3ZQCA 3GEZA 2P4WA 3GZ6A 4EV0A 1ACIA 3BY6A 3TW6A 2F4MB 4IRGA 3CO6C 2B9SA 5BNGA 1G59A 2R5ZB 3GYHX 1W4MA 2H09A 1WQ2A 3FHZA 1J9IA 4M6YA 5J8CA 3VK0A 1FT9A 3BR6A 1SFXA 1P92A 1DPUA 5D6FA 2CS3A 1HW1A 1AWCA 2FMLA 4OINF 3SJMA 4CCNA 3EUSA 5L3EA 1I1GA 3K9TA 5EDNA 5J4YA 3S1RJ 1OPCA 4XRMA 4WVLA 1TQPA 2A5WA 4J19A 2AQFA 1FBQA 2OBPA 5B5EC 3WG7H 1G3TA 4RAGA 4HX7A 3SFIA 2WC2A 4J1XA 3GUUA 4HX4A 2DLLA 2GWRA 1DGWY 3SZGA 1PJRA 1YLFA 1E3OC 3W6VA 1D1CA 1IJWC 3HKZN 2DOAA 5H20A 2E5ZA 1MJ9A 2CQ7A 4YEJA 2QBYA 2LMDA 2V79A 3OYGA 3GX4X 1IF1A 3ZQFA 1B9MA 3F8BA 3WHBA 3GUDA 2VOOA 2PG4A 2YR2A 1PRUA 3H9GA 2K9LA 4M73A 2EZHA 2PXVA 1STZA 4FTHA 3PM1A 5BPDA 3ZQLA 2DTRA 2E7XA 1JT6A 3L09A 2J5OA 4I2OA 1JWLA 1WJDA 3E97A 5IOZA 4XLAA 5EG0B 3TOBA 2K3FA 2KIMA 1OCPA 1DQUA 2ZXJA 5EF6A 2LYLA 4QLCU 3H92A 3RPUD 2HOAA 4HPQA 5M3FJ 4H4KC 5FROA 4BJTA 3DKYA 3I4PA 3J80Z 4MIMA 2HYGD 3LQQA 3Q5FA 4A3IJ 2KJBA 4ENKA 3L2VA 2FQ3A 1OJLA 1A04A 3GTGJ 1JUPA 4HRIA 4LG0B 2JA2A 1X58A 3CUQC 3K7AJ 1B8IB 2DOEA 3V7SA 4F7ZA 1K6OA 2KQRA 3BZ6A 2MEZA 3BDDA 3IV5A 3QYXA 2R7FA 3K70D 4H0EA 3PO3J 2DK5A 3A9XA 1IRXA 2ICWG 1HLVA 4Y33A 3K1NA 4P55A 4AVPA 2XXAA 2EBIA 1PUFB 1R23A 1K79A 3DNVB 1T8IA 2PXLA 2V1DA 3GLXA 1D0ZA 4M3FA 1VQKI 2KIUA 1E17A 3EQLF 4LMYA 5EYRA 5HLGA 2R7TA 3JCUC 4EGYA 4QPOA 4LITA 4Q5SF 3CF5F 1MBHA 2GA2A 3JRFA 3MZ8A 3BTLA 1XMAA 4W97A 1QP0A 3IH3A 1B1BA 3FBIB 1W1WE 1WVRA 2WB1N 4RB2C 1Y39A 3CC7I 1E3HA 4I76A 2Q8KA 1X19A 1IN6A 2E5NA 3HOWJ 1PRVA 5DYMA 3SCGA 1QZZA 3GZNB 2HS5A 3GFIA 3H5NA 5D4RA 4E7HA 3CQZJ 1UELB 2XRNA 1E0EA 2EA4A 1VQMI 2JZYA 2XIGA 3MKWB 4I6RA 3KP6A 3AG2H 2AS5F 2EFOA 3A0BC 4KNYA 2XPVA 3DU6A 3C2HA 1ETWA 6PAXA 4FETA 3JXCL 3HIFA 4K2EA 2VBYA 3IC7A 3QU3A 5ILSA 3ZGKA 4PU3C 3FKIJ 3K4MA 1AA7A 4A3GJ 3GTQJ 2GXAA 2O49A 1GLNA 1OYIA 3WTUC 2ODRD 1NK2P 2MABA 2L49A 5JLWA 2KEKA 1YO5C 5B66C 4XL9A 3IAS2 4ZDPA 2Y9YA 1GUUA 3H5TA 5FKNA 2X85A 4IZZA 3I64A 2OAZA 2HTSA 4XNFA 1XG1A 1NG7A 3QPHA 3TO6A 1X4OA 4PU4C 1MW7A 2WV0A 1O3TA 4KA4A 3SFZA 1BC7C 3HSEA 4ZYHA 3T0YA 4QSHA 1J0RA 2K85A 1XSXA 3BPXA 2ESNA 1LFBA 2BV6A 2FMYA 5FB2A 2HOSA 2EZKA 3M1EA 1TWFJ 3U1DA 2OZ6A 3QPTA 1YE9A 3HUGB 1P6RA 2NVYJ 5ED4A 2JPCA 4CUGA 3LSHA 2ID6A 1S7OA 3KE2A 4G12A 4XLEA 4Q47A 3DEWA 1NERA 3TMOA 4L5JA 1G6NA 3TDUC 3BR2A 3LMMA 2I5UA 2PXUA 3KFWX 1R4MB 5FFXA 3CROL 3PL8A 1ZVVA 2IU7A 3B73A 1I39A 3V4GA 3WHCA 3FHNA 2XGCA 4XIDA 1XMXA 3BR3A 2DT6A 3M4OJ 3M8JA 1FY7A 1XGSA 2NOJB 2V7FA 4XBFA 3HRMA 4A5MA 4YIFA 3I3LA 3L2WA 1VQ4I 3HOZJ 2WIUB 4JCXA 2NNYA 4GDFA 5HDNA 2DFFA 4GXOA 3PSIA 2VPRA 1BJAA 3LSKA 1VQOI 4V19K 2OQRA 2M8GX 1IUFA 3KP5A 4EMSA 4G6QA 3HOYJ 3ZQIA 2LYSA 5F0HA 2VEOA 1XB4A 1WETA 1R5GA 3H9QA 3MKLA 4IQ4A 2PUCA 2JPBA 3K4BA 3WG9A 3BJOA 3HOTA 4HSRA 1D5VA 2CV0A 3GTOJ 2MLKA 3OYCA 2W82A 3NROA 4HZFA 2KEJA 3GFLA 3MQ0A 3GZ5A 4PCQA 5D8KB 3WTSC 3JSOA 2CUEA 3L2RA 4RGXA 1KYWA 1GV5A 1U8RA 1R58A 3VYUB 1IN7A 3DKWA 4E70A 2Z3YA 4ZC3A 4A3KJ 3AG4H 1Z3YA 3KZIC 2STWA 1ZHFA 3BTCA 1GVDA 2DA4A 2ACJA 2ZMEA 4B48A 2W25A 3G6EI 3CD6I 3D5SC 5DCMB 1QU3A 2MC4A 3PNVA 1TNSA 3SZTA 1T98A 1WZ2A 3J80K 4P96A 3ASNH 1JKRC 2YBDA 4A0XA 2HQRA 1BM9A 3QYBA 2ZJPF 1B72B 2CSOA 5CKTA 3HPHA 1VNDA 3CCLI 3TFLA 2XGEA 4W1UA 2JQEA 4C2MJ 1HW5A 2PXPA 3WU2C 1KQ0A 3S14J 1D5YA 1DWKA 2Q2EB 2PXKA 1N77A 1TWGJ 1YQAA 3TEPA 4PGHA 3K4JA 4HYEA 2HINA 4I0BA 1SFKA 2XASA 3VYTB 1BC8C 4NNJA 4CCMA 4Z5DA 4BXFA 3WODF 1QBJA 5AIQA 2R7OA 3T5XA 5FKMA 4OU0A 5FLVA 1ZG5A 4AM3A 4XK4A 1ZGJA 2Y0MA 1VFCA 1MSEC 3SX0A 2XKPA 3OYKA 1HW2A 3OWQA 4LLNA 4P1WA 3E6CC 3KEQA 3OYLA 4LIUA 5K7FA 4U7DA 1B6AA 2B0LA 3ZKCA 3HRUA 1X2LA 3E5QA 4D5FA 2OJED 5HLIA 1MH4A 4XLHA 1Z21A 2P7CB 2J5PA 5K1YA 3CECA 1UXCA 3HSRA 4MFEA 5ILUA 2VODA 3CDHA 1YSEA 2IV1A 4RAFA 5FKLA 3TO9A 2RN7A 4B43A 3JAMK 4D7NA 2ISYA 2EF8A 4G7OF 1USTA 1DUXC 4EKGA 1U2WA 1Y0UA 3QWGA 2FBIA 3O8HA 2QBYB 4B47A 3OYIA 5TRDA 1RKWA 3AL0C 1ZZBA 4A0ZA 4ER5A 4ZYGA 1PP8F 4C2TA 1Y8QB 2HYJA 2IVMA 3FF5A 4BQOA 3DXJF 1SVOA 1A5JA 2DOFA 1X1PA 2HVSA 5M5XJ 1Y1WJ 1QZEA 4RS8A 1N25A 5EGOB 5BOXA 1SC7A 1FOXA 3CP2A 2E2JJ 4EJTA 5CVRA 2LYJA 2VJ5A 3JXDL 2FX0A 3IHUA 3O2PE 2BEOA 2KJCA 4U0VA 4WXCA 2JA8J 1IXRC 2ECBA 2OU2A 1Q1VA 1G4DA 1GHCA 2F5FA 2HZDA 3B6CA 5M5WJ 3RZZA 4NB5A 4M3EA 4AIKA 3GFMA 3VSLA 4DW6A 2PUFA 1BIBA 3G2BA 2W00A 1JJ8C 3CO7C 2TDXA 1LKXA 2NNNA 2QQBA 4Z5HA 4XSZF 4B8XA 4A3JJ 1LJ9A 3MCZA 1PYVA 1BR2A 2F5EA 4D9JA 4BJ5C 3LQRA 5CQGA 4DNCA 3H36A 2DT5A 5K5RA 3OYEA 3ZHIA 4HQMA 2LFBA 1H0MA 3HOUJ 5JFRA 4HEA2 2RAEA 1LE8A 2M2EA 3B7HA 1I6XA 3OOUA 4IHXA 1AKHB 2DN0A 4A5NA 5LD2C 4R1HA 3BT9A 3H3ZA 2FRHA 2FBHA 1W5CC 1A35A 3G1MA 3WGHA 1SANA 2KHMA 2X6XA 3TP0A 5F04A 2X6OA 3F8MA 5JUWA 2DFEA 2PN6A 2PBIA 4BDYA 1RI7A 1MZBA 4YRVA 3J81K 4AIHA 1RUNA 5C4XJ 1U8BA 1VQ7I 5B3SH 4HV5A 1USSA 4EJVA 5D5UB 2BNMA 3NWTA 1OR7A 4YIRX 2DA5A 3KZZA 4BACA 3WE2A 4BQAA 3LSIA 3WTZA 4OIOF 4EATA 1ZZ8A 2LBFA 3P9IA 2HXIA 1TTYA 4RAZA 2CH0A 3D5LA 3T8TA 1FPQA 1VQ5I 2GIVA 2DA1A 3BTJA 3E0JB 3N4MA 1Z05A 3MKYB 4XR6A 2JA6J 2LDUA 3MAJA 3A9YA 1HBXG 1J75A 2UWMA 1DDNA 1ZUGA 1I3QJ 3KXAA 3OS0A 3L9FA 2XAUA 2KZ8A 2PXEA 4MEXF 1I27A 5E1ZB 1T0FA 2GZWA 1BR4A 2GAUA 5GADJ 2D45A 1WHUA 2PUBA 2K27A
chains in the Genus database with same CATH topology
4M6VA 2OR1L 3I4NJ 1JJ6C 4AYBN 4X4HA 1JH9A 4M3GA 4BY1J 5EGOA 4A3MJ 2E2HJ 1ZZ6A 1MH3A 1RZSA 4D5CA 2MW8A 2LYPA 3GBGA 5F1JA 4IVZA 1WGXA 2HDDA 2XB5A 5IP9J 1BDIA 1VF9A 2QCOA 3VPRA 2R0QC 1ZPQA 4JX4A 2LY9A 2XIUA 1PNRA 1GV2A 2M0CA 4L5EA 4Y52J 1DW9A 1NEQA 2AW6A 4Z5CA 4PU7A 4MO7A 2EZLA 4IWRA 4J1WA 1X2MA 1Y9QA 3LISA 4YBAA 3BQZA 2R5YB 1RPWA 1RETA 4C3IJ 1K83J 1B0NA 2DMPA 1PRAA 1U9NA 2PIJA 3RKQA 1U78A 4JX5A 4IHYA 1QVUA 1JTYA 3A01A 2EQRA 4XRSA 2I10A 2AXUA 4PU8A 2JMWA 4FBIA 1ZQ3P 3OQNA 2ICTA 1LCCA 1LLIA 2IBDA 1NTCA 4UUSB 5K7HA 3HOVJ 3S16J 2LP0A 2LTPA 3GTLJ 2ICPA 2AHQA 3PO2J 4YG7B 4X4DA 5HODA 5J3LA 3ZQCA 4IEJA 5EZHA 2KDZA 1XC5A 1QPIA 2DA7A 4D7MA 2HXOA 4DZPA 2VKVA 1Y7YA 2L7FP 3TW6A 5BNGA 4RBOA 1LMB3 2JJ7A 2R5ZB 2IVBA 2IEKA 1ENHA 1R63A 1UXDA 2LYQA 1JFSA 3VK0A 2FJ1A 3BR6A 1L1MA 2FQ4A 3M3YJ 2EBYA 2DMQA 1ETXA 4FE4A 4B1RA 5J1YA 3SJMA 3EUSA 5EDNA 2H8RA 2WUSR 3S1RJ 1WIZA 4XRMA 1RPEL 4J19A 1VPWA 3SDGA 3G7DA 4EEFG 3LSGA 3ZQHA 1BW5A 3SFIA 4J1XA 1ETYA 3G1OA 1T33A 1E3OC 1ORKA 2CJJA 1TWAJ 1MBEA 2Y0SN 1T56A 3W6VA 1IJWC 4BBSJ 2DTZA 2JK3A 3O9XA 3HKZN 2ELKA 3OP9A 1RZRA 5GP9A 3FMYA 3ZQFA 2X9DA 3MVPA 4B3AA 2M9HA 1F43A 1LFUP 3WHBA 3K2AA 2DMUA 3Q0UA 1W0TA 1PRUA 2AO9A 2EZHA 4FTHA 3PM1A 4X1EA 3ZQLA 1JWLA 1JT6A 4GFBA 3RZDJ 1JUMA 2CQXA 2K9SA 3FISA 1JGGA 5IOZA 1B8IA 2IVQA 5EG0B 1AKHA 3PXPA 3U3WA 2LK2A 1W0UA 1OCTC 2VUMJ 1UTXA 3JRDA 1OCPA 1YRNA 5J1UA 5EF6A 1TWHJ 2LYLA 4Y7NJ 4X4BA 2HOAA 5M3FJ 1QRYA 3MN2A 2IVGA 3ZHMA 2O4AA 2HI3A 1PUFA 3OIOA 4MIMA 2CU7A 4XICA 4A3IJ 4IA8A 1OJLA 1IGNA 3GTGJ 2B63J 2YS9A 1JUPA 1ITYA 1X58A 3K7AJ 1B8IB 3FYAA 4V2GA 4LOCA 1ZGWA 1EF4A 4MFDA 1AHDP 2LCVA 3OSGA 2MEZA 4GQMA 3IV5A 3QYXA 1ETQA 3PO3J 3S1NJ 1MNMC 5FLMJ 1HLVA 2BJCA 2EBIA 1PUFB 2AUWA 3CCYA 3DNVB 4A3CJ 4M3FA 1BDHA 2GM4A 5C3EJ 4IHWA 5EYRA 3S17J 1ZZ7A 2O38A 4A69C 1AU7A 1MBHA 3H0GJ 3JRFA 3LSPA 1DU0A 3BTLA 3G1LA 1GT0C 5GPAA 4W97A 2EH3A 1QP0A 3IH3A 2Y9ZA 5F0CA 2WB1N 1VI0A 3QQAA 1G2HA 4A3DJ 4I76A 1F36A 2IAIA 1FIAA 1QQAA 1A6IA 2FJRA 1PRVA 3HOWJ 4QTRA 4RDUA 4A93J 3SCGA 3BR1A 2G0EA 3CQZJ 2LKXA 2JVLA 1B72A 4BBRJ 3ZQGA 4JX6A 4UUSA 1IRZA 3JRGA 4I6RA 5E3OA 1JT0A 2XPVA 3HM5A 4DZJA 4X4EA 1CQTA 3MLFA 2A6CA 1ETWA 3JXCL 3GN5B 4PU3C 2MG4A 3FKIJ 5E3MA 1JKQC 1OFCX 4B4CA 4A3GJ 3GTQJ 2O49A 4V2FA 3JR9A 3S8QA 1XS9A 3BR0A 1MBGA 1IV6A 1NK2P 2PMZN 2GZUA 4YG4A 3G5GA 2L49A 3C2BA 5JLWA 2AXVA 2KEKA 3BD1A 2Y9YA 1GUUA 3H5TA 5FKNA 1H8AC 1XG1A 4JQDA 3BTIA 4PU4C 4FISA 1MBJA 3BDNA 2GRLA 4X4GA 3CMYA 5DTDA 4X4CA 1ZR2A 3DCFA 4QSHA 4IHVA 4YG1A 2Y2ZA 1FEXA 2MQKA 1LFBA 2HOSA 2JA7J 1SFOJ 4X6AJ 2EZKA 1UG2A 1TWFJ 2LYKA 1X57A 3L1PA 5JLXA 2NVYJ 5IP7J 3HZIB 2NS7A 4BY7J 2E1OA 2ID6A 4G12A 2YUSA 5M3MJ 3DEWA 1NERA 2R63A 4OB4A 5C4JJ 3HDDA 2GBYA 5M5YJ 2FD5A 1H88C 3BR2A 3F52A 3E7LA 3SCHA 1JUSA 2HQ5A 4FCYA 1JKOC 5IOYA 3UFDA 2MSYA 2NVTJ 3CROL 3A02A 1WPKA 1ZVVA 2O9LA 2TCTA 2IU7A 2R92J 3A01B 2CSFA 3S2DJ 3WHCA 3OSFA 2XGCA 1BW6A 4XIDA 3BR3A 3M4OJ 1BA5A 1QPZA 3OQMA 1ETVA 1HDPA 5FKOA 4F8DA 4NDLA 3HOZJ 1POUA 2WIUB 4JCXA 4NDWA 1DU6A 2LVSA 2E2IJ 2DJNA 2K40A 1FTTA 2VPRA 2R1JL 2XJ3A 2K9QA 4MLOA 2M8GX 1IUFA 5K7ZA 3ZOBA 4ABZA 3HOYJ 3ZQIA 3UKGA 2LYSA 3HEFA 5F0HA 4X4FA 1WETA 4MCXA 3MKLA 3LFPA 5EZGA 3FYMA 2PUCA 3LSRA 3HGGA 4YARA 2DMNA 1I50J 1JTXA 2NVXJ 3GTOJ 3Q3SA 3BG9A 2KEJA 2KEIA 2X48A 2CUEA 2OPTA 3TW7A 3JRCA 1GV5A 1QVTA 4GHJA 1BL0A 1QP4A 4A3KJ 4BKXA 3FIWA 5F08A 2BNNA 2OF7A 3HBLA 3LSJA 1HOMA 3BTCA 1GVDA 3IH2A 4AUXA 3JRAA 2CRGA 1RESA 2DA4A 1LE8B 1PERL 2DA6A 5A7LA 2WAQN 3NAUA 4M3DA 1QQBA 2R5YA 1WH5A 3F51A 1JKRC 4Z58A 2L7MP 1CJGA 1B72B 1VNDA 3BG5A 1S7EA 1U9OA 2XGEA 1I6HJ 1JFTA 4W1UA 5IYBJ 4C2MJ 3R1FA 1RR7A 1TC3C 3S14J 1MBKA 1D5YA 4QIWN 1DWKA 1WH8A 1P7JA 3JRHA 1TWGJ 2XI8A 4I6TA 4M3BA 2AWIA 5F0FA 1XWRA 2GLOA 4JYKA 1K61A 4DYCA 3BQYA 1HDDC 4FE7A 1YRNB 2HINA 2BNOA 3CDLA 3D1NI 3GTKJ 1O4XA 5K98B 2PUAA 4Z5DA 3NARA 5FKMA 2R5ZA 2PE5A 3OMTA 1RKTA 5FLVA 2LLKA 4XK4A 1VFCA 3GTJJ 1MSEC 4C3JJ 2K9NA 5E3LA 4DYQA 4X4IA 5K7FA 3BR5A 3HOXJ 3ZKCA 1X2LA 4D5FA 3FK7A 3F6WA 2XPWA 1Y1VJ 1NK3P 1HCRA 1MH4A 5F27A 3CECA 3SCFA 1UXCA 3QF3A 2D5VA 2CROA 4FN3A 2PUEA 4MFEA 1ZS4A 1BJZA 2NOGA 1YSEA 2IV1A 2ZB9A 1MBFA 5FKLA 1FIPA 1UMQA 1RIOA 1ETKA 3B6AA 4D7NA 2EF8A 5EEAA 2COBA 1H89C 2XGDA 2HOTA 2XCJA 1WI3A 1ZR4A 5IPAA 3S1MJ 2R93J 2L7ZA 2L9RA 3QWGA 3O8HA 2PUDA 1RKWA 4I8TA 1ZZBA 2DA3A 1OSLA 4O8BA 1RZRD 2JA5J 2JWTA 1SQ8A 1IDZA 2HYJA 4I6ZA 1ZK8A 3GBFA 2NVQJ 2TRTA 1MSFC 1A5JA 2MGQA 3RZOJ 2Y30A 5M5XJ 1Y1WJ 1WCMJ 1IG7A 1TWCJ 1Z77A 3IH4A 2R7ZJ 5EGOB 2EZIA 2XB0X 3HB9A 2E2JJ 5E3NA 1R69A 2LYRA 1LCDA 3LOCA 2QF7A 2LYJA 3I4MJ 4Y42A 3JXDL 2FX0A 2WV1A 3S2HJ 3S15J 5FKKA 1ZAYA 1P7IA 2XRLA 1ZZ9A 2JA8J 2ECBA 1X2NA 1Q1VA 3Q0WA 3RZZA 3B6CA 5M5WJ 2O7OA 3BG3A 4M3EA 9ANTA 1R9TJ 3IVPA 2VI6A 2CQQA 4DYRA 2XSDC 4Z59A 4DW6A 2PUFA 2ID3A 3Q0VA 3TEDA 1QP7A 1JJ8C 4UUTA 1ZTRA 2LD5A 2DMTA 2XPUA 2ME0A 1EFAA 4Z5HA 2CUFA 1WH7A 1POGA 4A3JJ 1ADRA 4I6UA 1ZZCA 3RQIA 3BS3A 4XRSG 3ZHIA 2PUGA 2DA2A 2LFBA 3JRIA 2AXZA 3HOUJ 4BXXJ 2B5AA 2RAEA 1LE8A 2M2EA 2JCGA 3B7HA 1UHSA 3A03A 3OOUA 5EG0A 2DN0A 1AKHB 4IHXA 2EWTA 2Y31A 3H3VK 3BT9A 1ZKGA 3JREA 2OFYA 2M34A 3HGYA 4JCYA 3GTMJ 3G1MA 1SANA 2P81A 3TP0A 3TRBA 4HNVA 4JP0A 5F04A 2X6OA 1Z0XA 2NS8A 4A3EJ 2ECCA 4CYCB 3QPLA 1HF0A 2H1KA 2IUOA 3O8GA 2W48A 2HSGA 1IC8A 3JXBC 3CLCA 2L0KA 5C4XJ 3FK6A 2VKEA 2ME6A 1U8BA 2LR8A 2JN6A 4A3BJ 3JRBA 2BNMA 3F0CA 2KPJA 2DA5A 3KZ3A 5GPCA 5DS9A 1ETOA 2YU9J 1JKPC 3KJXA 3LNQA 3GTPJ 3QQ6A 1ZZ8A 3OQOA 2HXIA 4MCTA 4C3HJ 3QPSA 1LQCA 3GN5A 1FTZA 4CYCA 5IYCJ 1WH6A 2DA1A 3BTJA 4AC0A 3S1QJ 5FJ8J 2GRMA 2O8KA 2JA6J 2E19A 1ZUGA 1I3QJ 3KXAA 2L8NA 4A3LJ 1IDYA 2KZ8A 2PPXA 1FJLA 2KT0A 4S0HB 5IP6A 5IYDJ 2N8GA 5C44J 3TP3A 4A3FJ 2PUBA 1GDTA 1APLC 5J1RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M6V A;  2OR1 L;  3I4N J;  1JJ6 C;  4AYB N;  4X4H A;  1JH9 A;  4M3G A;  4BY1 J;  5EGO A;  4A3M J;  2E2H J;  1ZZ6 A;  1MH3 A;  1RZS A;  4D5C A;  2MW8 A;  2LYP A;  3GBG A;  5F1J A;  4IVZ A;  1WGX A;  2HDD A;  2XB5 A;  5IP9 J;  1BDI A;  1VF9 A;  2QCO A;  3VPR A;  2R0Q C;  1ZPQ A;  4JX4 A;  2LY9 A;  2XIU A;  1PNR A;  1GV2 A;  2M0C A;  4L5E A;  4Y52 J;  1DW9 A;  1NEQ A;  2AW6 A;  4Z5C A;  4PU7 A;  4MO7 A;  2EZL A;  4IWR A;  4J1W A;  1X2M A;  1Y9Q A;  3LIS A;  4YBA A;  3BQZ A;  2R5Y B;  1RPW A;  1RET A;  4C3I J;  1K83 J;  1B0N A;  2DMP A;  1PRA A;  1U9N A;  2PIJ A;  3RKQ A;  1U78 A;  4JX5 A;  4IHY A;  1QVU A;  1JTY A;  3A01 A;  2EQR A;  4XRS A;  2I10 A;  2AXU A;  4PU8 A;  2JMW A;  4FBI A;  1ZQ3 P;  3OQN A;  2ICT A;  1LCC A;  1LLI A;  2IBD A;  1NTC A;  4UUS B;  5K7H A;  3HOV J;  3S16 J;  2LP0 A;  2LTP A;  3GTL J;  2ICP A;  2AHQ A;  3PO2 J;  4YG7 B;  4X4D A;  5HOD A;  5J3L A;  3ZQC A;  4IEJ A;  5EZH A;  2KDZ A;  1XC5 A;  1QPI A;  2DA7 A;  4D7M A;  2HXO A;  4DZP A;  2VKV A;  1Y7Y A;  2L7F P;  3TW6 A;  5BNG A;  4RBO A;  1LMB 3;  2JJ7 A;  2R5Z B;  2IVB A;  2IEK A;  1ENH A;  1R63 A;  1UXD A;  2LYQ A;  1JFS A;  3VK0 A;  2FJ1 A;  3BR6 A;  1L1M A;  2FQ4 A;  3M3Y J;  2EBY A;  2DMQ A;  1ETX A;  4FE4 A;  4B1R A;  5J1Y A;  3SJM A;  3EUS A;  5EDN A;  2H8R A;  2WUS R;  3S1R J;  1WIZ A;  4XRM A;  1RPE L;  4J19 A;  1VPW A;  3SDG A;  3G7D A;  4EEF G;  3LSG A;  3ZQH A;  1BW5 A;  3SFI A;  4J1X A;  1ETY A;  3G1O A;  1T33 A;  1E3O C;  1ORK A;  2CJJ A;  1TWA J;  1MBE A;  2Y0S N;  1T56 A;  3W6V A;  1IJW C;  4BBS J;  2DTZ A;  2JK3 A;  3O9X A;  3HKZ N;  2ELK A;  3OP9 A;  1RZR A;  5GP9 A;  3FMY A;  3ZQF A;  2X9D A;  3MVP A;  4B3A A;  2M9H A;  1F43 A;  1LFU P;  3WHB A;  3K2A A;  2DMU A;  3Q0U A;  1W0T A;  1PRU A;  2AO9 A;  2EZH A;  4FTH A;  3PM1 A;  4X1E A;  3ZQL A;  1JWL A;  1JT6 A;  4GFB A;  3RZD J;  1JUM A;  2CQX A;  2K9S A;  3FIS A;  1JGG A;  5IOZ A;  1B8I A;  2IVQ A;  5EG0 B;  1AKH A;  3PXP A;  3U3W A;  2LK2 A;  1W0U A;  1OCT C;  2VUM J;  1UTX A;  3JRD A;  1OCP A;  1YRN A;  5J1U A;  5EF6 A;  1TWH J;  2LYL A;  4Y7N J;  4X4B A;  2HOA A;  5M3F J;  1QRY A;  3MN2 A;  2IVG A;  3ZHM A;  2O4A A;  2HI3 A;  1PUF A;  3OIO A;  4MIM A;  2CU7 A;  4XIC A;  4A3I J;  4IA8 A;  1OJL A;  1IGN A;  3GTG J;  2B63 J;  2YS9 A;  1JUP A;  1ITY A;  1X58 A;  3K7A J;  1B8I B;  3FYA A;  4V2G A;  4LOC A;  1ZGW A;  1EF4 A;  4MFD A;  1AHD P;  2LCV A;  3OSG A;  2MEZ A;  4GQM A;  3IV5 A;  3QYX A;  1ETQ A;  3PO3 J;  3S1N J;  1MNM C;  5FLM J;  1HLV A;  2BJC A;  2EBI A;  1PUF B;  2AUW A;  3CCY A;  3DNV B;  4A3C J;  4M3F A;  1BDH A;  2GM4 A;  5C3E J;  4IHW A;  5EYR A;  3S17 J;  1ZZ7 A;  2O38 A;  4A69 C;  1AU7 A;  1MBH A;  3H0G J;  3JRF A;  3LSP A;  1DU0 A;  3BTL A;  3G1L A;  1GT0 C;  5GPA A;  4W97 A;  2EH3 A;  1QP0 A;  3IH3 A;  2Y9Z A;  5F0C A;  2WB1 N;  1VI0 A;  3QQA A;  1G2H A;  4A3D J;  4I76 A;  1F36 A;  2IAI A;  1FIA A;  1QQA A;  1A6I A;  2FJR A;  1PRV A;  3HOW J;  4QTR A;  4RDU A;  4A93 J;  3SCG A;  3BR1 A;  2G0E A;  3CQZ J;  2LKX A;  2JVL A;  1B72 A;  4BBR J;  3ZQG A;  4JX6 A;  4UUS A;  1IRZ A;  3JRG A;  4I6R A;  5E3O A;  1JT0 A;  2XPV A;  3HM5 A;  4DZJ A;  4X4E A;  1CQT A;  3MLF A;  2A6C A;  1ETW A;  3JXC L;  3GN5 B;  4PU3 C;  2MG4 A;  3FKI J;  5E3M A;  1JKQ C;  1OFC X;  4B4C A;  4A3G J;  3GTQ J;  2O49 A;  4V2F A;  3JR9 A;  3S8Q A;  1XS9 A;  3BR0 A;  1MBG A;  1IV6 A;  1NK2 P;  2PMZ N;  2GZU A;  4YG4 A;  3G5G A;  2L49 A;  3C2B A;  5JLW A;  2AXV A;  2KEK A;  3BD1 A;  2Y9Y A;  1GUU A;  3H5T A;  5FKN A;  1H8A C;  1XG1 A;  4JQD A;  3BTI A;  4PU4 C;  4FIS A;  1MBJ A;  3BDN A;  2GRL A;  4X4G A;  3CMY A;  5DTD A;  4X4C A;  1ZR2 A;  3DCF A;  4QSH A;  4IHV A;  4YG1 A;  2Y2Z A;  1FEX A;  2MQK A;  1LFB A;  2HOS A;  2JA7 J;  1SFO J;  4X6A J;  2EZK A;  1UG2 A;  1TWF J;  2LYK A;  1X57 A;  3L1P A;  5JLX A;  2NVY J;  5IP7 J;  3HZI B;  2NS7 A;  4BY7 J;  2E1O A;  2ID6 A;  4G12 A;  2YUS A;  5M3M J;  3DEW A;  1NER A;  2R63 A;  4OB4 A;  5C4J J;  3HDD A;  2GBY A;  5M5Y J;  2FD5 A;  1H88 C;  3BR2 A;  3F52 A;  3E7L A;  3SCH A;  1JUS A;  2HQ5 A;  4FCY A;  1JKO C;  5IOY A;  3UFD A;  2MSY A;  2NVT J;  3CRO L;  3A02 A;  1WPK A;  1ZVV A;  2O9L A;  2TCT A;  2IU7 A;  2R92 J;  3A01 B;  2CSF A;  3S2D J;  3WHC A;  3OSF A;  2XGC A;  1BW6 A;  4XID A;  3BR3 A;  3M4O J;  1BA5 A;  1QPZ A;  3OQM A;  1ETV A;  1HDP A;  5FKO A;  4F8D A;  4NDL A;  3HOZ J;  1POU A;  2WIU B;  4JCX A;  4NDW A;  1DU6 A;  2LVS A;  2E2I J;  2DJN A;  2K40 A;  1FTT A;  2VPR A;  2R1J L;  2XJ3 A;  2K9Q A;  4MLO A;  2M8G X;  1IUF A;  5K7Z A;  3ZOB A;  4ABZ A;  3HOY J;  3ZQI A;  3UKG A;  2LYS A;  3HEF A;  5F0H A;  4X4F A;  1WET A;  4MCX A;  3MKL A;  3LFP A;  5EZG A;  3FYM A;  2PUC A;  3LSR A;  3HGG A;  4YAR A;  2DMN A;  1I50 J;  1JTX A;  2NVX J;  3GTO J;  3Q3S A;  3BG9 A;  2KEJ A;  2KEI A;  2X48 A;  2CUE A;  2OPT A;  3TW7 A;  3JRC A;  1GV5 A;  1QVT A;  4GHJ A;  1BL0 A;  1QP4 A;  4A3K J;  4BKX A;  3FIW A;  5F08 A;  2BNN A;  2OF7 A;  3HBL A;  3LSJ A;  1HOM A;  3BTC A;  1GVD A;  3IH2 A;  4AUX A;  3JRA A;  2CRG A;  1RES A;  2DA4 A;  1LE8 B;  1PER L;  2DA6 A;  5A7L A;  2WAQ N;  3NAU A;  4M3D A;  1QQB A;  2R5Y A;  1WH5 A;  3F51 A;  1JKR C;  4Z58 A;  2L7M P;  1CJG A;  1B72 B;  1VND A;  3BG5 A;  1S7E A;  1U9O A;  2XGE A;  1I6H J;  1JFT A;  4W1U A;  5IYB J;  4C2M J;  3R1F A;  1RR7 A;  1TC3 C;  3S14 J;  1MBK A;  1D5Y A;  4QIW N;  1DWK A;  1WH8 A;  1P7J A;  3JRH A;  1TWG J;  2XI8 A;  4I6T A;  4M3B A;  2AWI A;  5F0F A;  1XWR A;  2GLO A;  4JYK A;  1K61 A;  4DYC A;  3BQY A;  1HDD C;  4FE7 A;  1YRN B;  2HIN A;  2BNO A;  3CDL A;  3D1N I;  3GTK J;  1O4X A;  5K98 B;  2PUA A;  4Z5D A;  3NAR A;  5FKM A;  2R5Z A;  2PE5 A;  3OMT A;  1RKT A;  5FLV A;  2LLK A;  4XK4 A;  1VFC A;  3GTJ J;  1MSE C;  4C3J J;  2K9N A;  5E3L A;  4DYQ A;  4X4I A;  5K7F A;  3BR5 A;  3HOX J;  3ZKC A;  1X2L A;  4D5F A;  3FK7 A;  3F6W A;  2XPW A;  1Y1V J;  1NK3 P;  1HCR A;  1MH4 A;  5F27 A;  3CEC A;  3SCF A;  1UXC A;  3QF3 A;  2D5V A;  2CRO A;  4FN3 A;  2PUE A;  4MFE A;  1ZS4 A;  1BJZ A;  2NOG A;  1YSE A;  2IV1 A;  2ZB9 A;  1MBF A;  5FKL A;  1FIP A;  1UMQ A;  1RIO A;  1ETK A;  3B6A A;  4D7N A;  2EF8 A;  5EEA A;  2COB A;  1H89 C;  2XGD A;  2HOT A;  2XCJ A;  1WI3 A;  1ZR4 A;  5IPA A;  3S1M J;  2R93 J;  2L7Z A;  2L9R A;  3QWG A;  3O8H A;  2PUD A;  1RKW A;  4I8T A;  1ZZB A;  2DA3 A;  1OSL A;  4O8B A;  1RZR D;  2JA5 J;  2JWT A;  1SQ8 A;  1IDZ A;  2HYJ A;  4I6Z A;  1ZK8 A;  3GBF A;  2NVQ J;  2TRT A;  1MSF C;  1A5J A;  2MGQ A;  3RZO J;  2Y30 A;  5M5X J;  1Y1W J;  1WCM J;  1IG7 A;  1TWC J;  1Z77 A;  3IH4 A;  2R7Z J;  5EGO B;  2EZI A;  2XB0 X;  3HB9 A;  2E2J J;  5E3N A;  1R69 A;  2LYR A;  1LCD A;  3LOC A;  2QF7 A;  2LYJ A;  3I4M J;  4Y42 A;  3JXD L;  2FX0 A;  2WV1 A;  3S2H J;  3S15 J;  5FKK A;  1ZAY A;  1P7I A;  2XRL A;  1ZZ9 A;  2JA8 J;  2ECB A;  1X2N A;  1Q1V A;  3Q0W A;  3RZZ A;  3B6C A;  5M5W J;  2O7O A;  3BG3 A;  4M3E A;  9ANT A;  1R9T J;  3IVP A;  2VI6 A;  2CQQ A;  4DYR A;  2XSD C;  4Z59 A;  4DW6 A;  2PUF A;  2ID3 A;  3Q0V A;  3TED A;  1QP7 A;  1JJ8 C;  4UUT A;  1ZTR A;  2LD5 A;  2DMT A;  2XPU A;  2ME0 A;  1EFA A;  4Z5H A;  2CUF A;  1WH7 A;  1POG A;  4A3J J;  1ADR A;  4I6U A;  1ZZC A;  3RQI A;  3BS3 A;  4XRS G;  3ZHI A;  2PUG A;  2DA2 A;  2LFB A;  3JRI A;  2AXZ A;  3HOU J;  4BXX J;  2B5A A;  2RAE A;  1LE8 A;  2M2E A;  2JCG A;  3B7H A;  1UHS A;  3A03 A;  3OOU A;  5EG0 A;  2DN0 A;  1AKH B;  4IHX A;  2EWT A;  2Y31 A;  3H3V K;  3BT9 A;  1ZKG A;  3JRE A;  2OFY A;  2M34 A;  3HGY A;  4JCY A;  3GTM J;  3G1M A;  1SAN A;  2P81 A;  3TP0 A;  3TRB A;  4HNV A;  4JP0 A;  5F04 A;  2X6O A;  1Z0X A;  2NS8 A;  4A3E J;  2ECC A;  4CYC B;  3QPL A;  1HF0 A;  2H1K A;  2IUO A;  3O8G A;  2W48 A;  2HSG A;  1IC8 A;  3JXB C;  3CLC A;  2L0K A;  5C4X J;  3FK6 A;  2VKE A;  2ME6 A;  1U8B A;  2LR8 A;  2JN6 A;  4A3B J;  3JRB A;  2BNM A;  3F0C A;  2KPJ A;  2DA5 A;  3KZ3 A;  5GPC A;  5DS9 A;  1ETO A;  2YU9 J;  1JKP C;  3KJX A;  3LNQ A;  3GTP J;  3QQ6 A;  1ZZ8 A;  3OQO A;  2HXI A;  4MCT A;  4C3H J;  3QPS A;  1LQC A;  3GN5 A;  1FTZ A;  4CYC A;  5IYC J;  1WH6 A;  2DA1 A;  3BTJ A;  4AC0 A;  3S1Q J;  5FJ8 J;  2GRM A;  2O8K A;  2JA6 J;  2E19 A;  1ZUG A;  1I3Q J;  3KXA A;  2L8N A;  4A3L J;  1IDY A;  2KZ8 A;  2PPX A;  1FJL A;  2KT0 A;  4S0H B;  5IP6 A;  5IYD J;  2N8G A;  5C44 J;  3TP3 A;  4A3F J;  2PUB A;  1GDT A;  1APL C;  5J1R A; 
#chains in the Genus database with same CATH topology
 1T0F C;  3E6D A;  1JJ6 C;  3HKZ A;  4AYB N;  2VIX A;  2VAS A;  3HOS A;  3WGG A;  4Q2J A;  3OYM A;  3RYR A;  2EB7 A;  2V1N A;  4RMN A;  2BXY A;  3F8C A;  1ZZ6 A;  2HKX A;  1RZS A;  4D5C A;  3CMM A;  2LYP A;  5F1J A;  1JGS A;  1WGX A;  4M72 A;  1OMI A;  5IP9 J;  3PIP F;  3ZMZ A;  1VF9 A;  3FMS A;  3OIP A;  2M4K A;  2XIU A;  4XLP F;  1GV2 A;  4DE9 A;  3JW4 A;  1QHG A;  5LHH A;  3A2K A;  4WWC A;  4Z6Y A;  2RQP A;  1F9N A;  1OCO H;  2ZFU A;  1Y9Q A;  5D5W B;  3BQZ A;  3V8K A;  1BIA A;  2QUF A;  1K83 J;  3QYE A;  2DMP A;  2QA4 I;  1PRA A;  3OY9 A;  2K4J A;  3RKQ A;  2M45 A;  1H9T A;  1HKS A;  4LD5 A;  1QVU A;  2AQE A;  5KVR A;  2VL8 A;  2I10 A;  5CYV A;  1HQ1 A;  4OIP F;  2VC1 A;  2CV1 A;  3MFK A;  3RKX A;  1ONV A;  2JMW A;  2ZNZ A;  4JK1 X;  1ZQ3 P;  1LCC A;  1R1V A;  2Y48 A;  5K7H A;  2K02 A;  2ICP A;  2LTP A;  3ZQ7 A;  2F4I A;  2PXD A;  3CJQ B;  3OYF A;  5J3L A;  4E7S A;  2DW4 A;  2BHY A;  5EZH A;  1QPI A;  2DA7 A;  2P6T A;  4D7M A;  2HXO A;  2VQC A;  1Y7Y A;  2FU4 A;  4CIC A;  2L7F P;  3IRQ A;  3JTH A;  1ZG1 A;  5LRS A;  3VEP A;  4GRI A;  3CC4 I;  3A9Z A;  4CZC A;  2IVB A;  1KGS A;  1L3L A;  2IS1 A;  1ZLK A;  1UXD A;  2W1O A;  3H5A A;  3ZN0 A;  3BCB A;  2FJ1 A;  1L1M A;  2BY3 A;  4M9Z A;  3GZD A;  2EBY A;  2DMQ A;  5HLT A;  1ETX A;  1PUE E;  1HA8 A;  4KIC A;  4HLY A;  1LFP A;  4UB6 C;  4CSW A;  2VN2 A;  3HYI A;  2WUS R;  2H8R A;  5KAI C;  1X3U A;  5KHD A;  4XRF A;  4M71 A;  1IN4 A;  3IAM 2;  5E20 A;  3RKY A;  3S3M A;  4OMZ A;  5JR3 A;  1TWA J;  2Y0S N;  3AG1 H;  3KLN A;  3ERM A;  2DTZ A;  4DJA A;  1OYY A;  5L3F A;  3O9X A;  2XDV A;  5ICF A;  3CES A;  2NVU B;  1WJB A;  1K78 B;  2ELK A;  3ZMU A;  3OP9 A;  1RZR A;  1Q1H A;  3H1C A;  3CCV I;  1NH3 A;  3CF2 A;  3E6M A;  4KIF A;  1LFU P;  3K2A A;  4B3X A;  4KN7 X;  2KIS A;  5JI6 A;  5GTH C;  2CQX A;  3FIS A;  4RLF A;  1M1E B;  1OCT C;  5FLX Z;  2ESH A;  1SAX A;  1I3A A;  1UTX A;  3JRD A;  4ZYD A;  1YRN A;  5J1U A;  2EIK H;  4Q48 A;  2ZXW H;  1LPQ A;  2WWY A;  5DSX A;  1QPM A;  2EIL H;  1QRY A;  2OCE A;  3I71 A;  2DYS H;  2FNP A;  4L9V A;  2O4A A;  3KZY A;  5BMZ A;  2HI3 A;  3UR3 C;  2P8T A;  4XIC A;  3G0T A;  2YPR A;  2EFW A;  4HRA A;  2YS9 A;  1ITY A;  4XMY A;  3ZMD A;  5BPI A;  3DTK A;  3M1C A;  4WXD A;  2LCV A;  1I1S A;  4KFC A;  4WXH A;  2KIF A;  4GQM A;  3NEU A;  1MNM C;  3MWM A;  2DFI A;  3Q9V A;  2BJC A;  2H1L A;  1Z7L A;  2GM4 A;  1ZYR F;  1S7A A;  5C3E J;  1XTA A;  1G3S A;  3ZN1 A;  3S17 J;  1Z7U A;  2O38 A;  3IL2 A;  4A69 C;  1YW8 A;  3H0G J;  2QM3 A;  4I7H A;  5ERI A;  2PX9 A;  3EET A;  3LSP A;  1QO0 D;  2EH3 A;  3MKZ A;  4BYY A;  3SEZ A;  2FOK A;  1WKM A;  3QQA A;  1G2H A;  5L3D A;  4A3D J;  4XON A;  2F4O B;  1LEA A;  2V1X A;  3S8P A;  3FBN B;  4RGR A;  3EUA A;  1LQ1 A;  3BR1 A;  4DOZ A;  3Q9S A;  3TGN A;  3ZQG A;  4UUS A;  5LBQ A;  2R7Q A;  1JT0 A;  4Y13 A;  3HM5 A;  2VT3 A;  4LFU A;  3MLF A;  1QNT A;  5FFZ A;  2WBM A;  5JVG F;  4RM2 A;  3GCM A;  2HQN A;  4YFK F;  2Z9O A;  3F8N A;  1KQ9 A;  1XCV A;  2PMZ N;  1T6S A;  2ZCW A;  4OIR F;  2QZ8 A;  2XGX A;  5E17 F;  2NS0 A;  3BD1 A;  2F5D A;  3OL3 A;  3DM5 A;  4ZZD A;  2GIZ A;  1IRF A;  1F5T A;  4FIS A;  1ZRE A;  2KRF A;  4X4G A;  5DTD A;  2UZK A;  1S72 I;  4X4C A;  4QWQ A;  1KU2 A;  3DCF A;  4IHV A;  3K4K A;  2WY7 Q;  5GAG J;  1MNE A;  3ME5 A;  5L3B A;  2V4J C;  4HA8 A;  4X6A J;  3EPZ A;  2LY2 A;  3VWB A;  2CV2 A;  3RQ4 A;  2AXT C;  2HNH A;  5JLX A;  3K1P A;  3FZV A;  2D1V A;  4BY7 J;  1W7P A;  2YUS A;  2EV6 A;  4LJZ F;  3DBL B;  3H9J A;  2R63 A;  3OYA A;  2OA4 A;  5HOO A;  5M5Y J;  2JQ7 A;  3CJR B;  2FD5 A;  4BNC A;  3F52 A;  3DLA A;  3AKZ A;  3MMY B;  1JUS A;  3LST A;  1JKO C;  2MSY A;  5A2Q K;  2NVT J;  2V1U A;  4MGR A;  2M30 A;  5HS8 A;  2DK8 A;  4BHB A;  2FSW A;  2KMU A;  4ZZL A;  3QOE A;  1R1T A;  3QOX A;  1D8K A;  1BA5 A;  4PZJ A;  5EEH A;  3KP3 A;  3OQM A;  5FKO A;  4BGD A;  1W5S A;  4NDL A;  3R0J A;  1POU A;  4NDW A;  1DU6 A;  3TQN A;  3QP6 A;  2Z33 A;  1FLI A;  2E2I J;  2DJN A;  1YYV A;  4LG0 A;  2R1J L;  3HG9 A;  2XJ3 A;  2ZKZ A;  1A6Q A;  2K9Q A;  4MLO A;  5K7Z A;  3VSK A;  3ZOB A;  4ABZ A;  4X4F A;  3HEF A;  3LFP A;  1FP2 A;  3FYM A;  3HGG A;  2HPI A;  2ZO4 A;  3BJ6 A;  3K4C A;  2DMN A;  2KP6 A;  1I50 J;  2QQ9 A;  3WTT C;  2VC0 A;  3KIO A;  1OR7 C;  3N05 A;  3MZH A;  1BR1 A;  5FRN A;  2O8X A;  2OPT A;  4N9H A;  1QVT A;  5DD4 A;  3RPU A;  3A0H C;  3CC2 I;  1BL0 A;  1BOA A;  3UNG C;  2YSR A;  5F08 A;  4IKF A;  3FXL A;  3HBL A;  3LSJ A;  1HOM A;  4ER0 A;  1XGM A;  2VKH A;  3IH2 A;  4ZH4 F;  1DPR A;  1FMW A;  3CUQ B;  1XSD A;  2VJ4 A;  3RJP A;  3OYH A;  2JSC A;  2WAE A;  1Z6R A;  4N9I A;  4LK1 F;  1T08 B;  2DA6 A;  3F6V A;  3CMA I;  5A7L A;  1FC3 A;  2VXD A;  1WH5 A;  3KCC A;  3F51 A;  2EFQ A;  3CJT B;  2JVH A;  2L7M P;  2LSO A;  1R36 A;  5LHG A;  1K4S A;  1U9O A;  1I6H J;  1YJN I;  5BS6 A;  1BI2 A;  3KP7 A;  4HF0 A;  1MBK A;  3W6K B;  3PQK A;  4L18 B;  4EZI A;  1P7J A;  1SD4 A;  1SMY F;  1YS7 A;  1EH6 A;  1JI8 A;  2XI8 A;  2XXP A;  4I6T A;  5LEJ A;  2VLA A;  2AWI A;  3IKV A;  1FBS A;  5F0F A;  2HQA A;  2J7U A;  3DBR B;  4JYK A;  2NRA C;  4XOP A;  1YRN B;  2BNO A;  1J7K A;  3GTK J;  1LVA A;  3OYN A;  3KLO A;  3LFU A;  2PUA A;  2A3S A;  2EPF A;  3F6O A;  2PE5 A;  1RKT A;  3PFY A;  3SXY A;  2LLK A;  2ISZ A;  1RZ4 A;  4MTD A;  2QKM B;  4C3J J;  2K9N A;  1WRJ A;  4DYQ A;  3IWF A;  2VBX A;  1HST A;  3J81 Z;  2M4H A;  4X4I A;  3MEX A;  2M3A A;  3BR5 A;  3BG7 A;  4CCK A;  3FM5 A;  4FT8 A;  5CJ9 A;  3DPL C;  1SEU A;  1OIS A;  2EK5 A;  3FK7 A;  3F6W A;  2XPW A;  1ODD A;  4AYB A;  1YJW I;  5DTR A;  5F27 A;  1N78 A;  3SCF A;  2W84 A;  3WTV C;  1P4X A;  1XPX A;  2Z99 A;  4XKB A;  3CCM I;  3H5R A;  4FN3 A;  3F21 A;  1ZS4 A;  1BJZ A;  2NOG A;  4Y4R A;  3OYD A;  3B6A A;  2XAF A;  2COB A;  1H89 C;  3FXR A;  1P4A A;  1WI3 A;  2E36 A;  5B1B H;  2L9R A;  3DFG A;  2CW8 A;  3ZPL A;  2DA3 A;  1HXD A;  2L54 A;  4O8B A;  4OWR B;  3WU1 B;  2L5Q A;  4ENJ A;  2KZG A;  4RGU A;  1SQ8 A;  3E1S A;  5TGT A;  3GBF A;  1MSF C;  2MGQ A;  3M9A A;  3R09 A;  1Y6I A;  3X2Q H;  2R7Z J;  4UVA A;  2JUC A;  3NQO A;  4WX9 A;  2EZI A;  2X51 A;  3HB9 A;  4CGZ A;  2IXS A;  2HFH A;  4Y42 A;  1S3J A;  2M87 A;  4HBL A;  2WV1 A;  2LH9 A;  3S15 J;  3WGI A;  4AU7 A;  1X3Z B;  1ZZ9 A;  3Q0W A;  3BG3 A;  4ITV A;  3ZMT A;  2PFB A;  5ICC A;  4Z59 A;  1FOK A;  3PNT A;  4F93 B;  4PSW A;  2E7W A;  3TED A;  2MC3 A;  4LIV A;  2KRH A;  4YFN F;  1ZTR A;  2XPU A;  1EFA A;  3B02 A;  2CUF A;  1WH7 A;  4U87 A;  1LNW A;  3I54 A;  3GW2 A;  3WTY C;  1EV7 A;  4EGZ A;  3I59 B;  2AXL A;  3QWL A;  3F22 A;  2IS4 A;  3L7W A;  3JRI A;  4GCV A;  1VTN C;  4IHS A;  2AXZ A;  3K4N A;  3KP4 A;  2B5A A;  5E79 C;  2IA0 A;  5D4S A;  5EG0 A;  2Y31 A;  4IVN A;  2IGM A;  4F3Q A;  3JRE A;  3GFJ A;  4MQ9 F;  3CCE I;  2H8W A;  4JCY A;  3GTM J;  3LQX A;  1HSJ A;  2P81 A;  4DGW B;  1FNN A;  3TRB A;  2R7W A;  2NS8 A;  4CYC B;  2H1K A;  3QPL A;  2JUG A;  2GXG A;  2QLZ A;  2ELJ A;  1FMV A;  2L0K A;  4PUS A;  3FK6 A;  4R8H A;  2WTE A;  1AOY A;  2KKO A;  2DJI A;  2RVC A;  2A61 A;  3ABU A;  4A0Y A;  1D0Y A;  2CUZ A;  4HG2 A;  4BQN A;  2ZNY A;  2CYY A;  2V9V A;  4XQF A;  1XCB A;  3OQO A;  3IUO A;  2UV1 A;  3QPS A;  4KJZ A;  1YHQ I;  1S29 A;  3GN5 A;  4CYC A;  5IYC J;  2EIJ H;  3FXJ A;  4U0W A;  1J59 A;  1XMK A;  2PMH A;  1OKR A;  2E19 A;  2H27 A;  3VYR B;  4E7J A;  1VZ0 A;  1SVM A;  1S8N A;  2O5R A;  2Q1Z B;  2PJP A;  5IP6 A;  4A12 A;  2N8G A;  2FNA A;  2L4M A;  4RA2 A;  3TBI A;  4HF2 A;  2IGN A;  5CVV A;  3TP3 A;  2MD0 A;  1UHW A;  3TKY A;  4J00 A;  2LBF B;  2OR1 L;  2DAO A;  1KYZ A;  1IW7 F;  3HXL A;  4AD9 A;  3V42 A;  2MFZ A;  2MH9 A;  3A1Y A;  4NC8 A;  4A3M J;  2E2H J;  2A05 A;  4P5O A;  3L2Q A;  4PJL A;  4E6K G;  4ZYE A;  3OKZ A;  2QSF X;  2VE9 A;  5DTM A;  3CCU I;  4LK0 F;  2QVO A;  1ZPQ A;  3U9G A;  3G4S I;  1Z3X A;  5DD8 A;  4WK8 F;  4L5E A;  3CCQ I;  1ZRC A;  1UAA A;  3HTS B;  3ISP A;  4Y52 J;  5H2F C;  1DW9 A;  4Z5C A;  3G71 I;  3VWS A;  1X2M A;  1MIJ A;  2MH2 A;  1MND A;  1YOV B;  1HKQ A;  4BJ6 C;  3BJA A;  2Q2E A;  5AON A;  3I53 A;  1B0N A;  4S05 A;  1IZ1 A;  4IOC F;  4CDG A;  2M0M A;  4JX5 A;  4Y3O A;  2VPL A;  2YX7 A;  2LY1 A;  4S04 A;  2FEZ A;  1QGP A;  3VOE A;  4XRS A;  1T38 A;  2E1C A;  5GAH J;  2AXU A;  4PU8 A;  1KQ8 A;  4FBI A;  2BVM A;  2ICT A;  1LLI A;  1NTC A;  3R60 A;  1R00 A;  4X4D A;  1Z1D A;  3LL7 A;  1A31 A;  1NG6 A;  1FSH A;  3CJN A;  4HV6 A;  2PJR A;  1ZN2 A;  4IEJ A;  2KDZ A;  1XC5 A;  1PVE A;  3QYF A;  4DZP A;  1R22 A;  1XD7 A;  2BOL A;  2M7A A;  4RBO A;  4TV7 A;  1LMB 3;  3QRF F;  2JJ7 A;  3S3N A;  2OTL I;  1ENH A;  2BHZ A;  5HLH A;  1X1A A;  1XGN A;  2FE3 A;  2FQ4 A;  2XXQ A;  3M3Y J;  2IGK A;  3T8R A;  3HZJ A;  2G7H A;  4FE4 A;  4M74 A;  3J7A O;  2WAD A;  2BE5 F;  3W2W A;  2HGC A;  2ELH A;  3IRR A;  1VPW A;  5LLQ A;  2XC7 A;  4GGG A;  5CVI A;  5B1A H;  3G7D A;  3LSG A;  3ZQH A;  3U1K A;  1V3F A;  4UY8 I;  3FXQ A;  1FBU A;  1E3P A;  3W2A A;  3G1O A;  4HQE A;  2XF6 A;  3IKT A;  1T33 A;  3V7R A;  1T56 A;  2CUJ A;  3R0A A;  5DDG A;  4BBS J;  3I58 A;  2L9V A;  5J40 A;  1X1D A;  4CYD A;  1U2Z A;  3RTR A;  3K2Z A;  3FMY A;  2GXB A;  2P7V B;  2X9D A;  4L9J A;  2NAZ A;  1G3Y A;  2M9H A;  3VFZ A;  4HNU A;  2IA1 A;  1F43 A;  2K3P A;  3LA2 A;  2FA5 A;  4A2U A;  1OCR H;  1BOB A;  4KIB A;  2DMU A;  3P7N A;  3Q0U A;  3DU5 A;  5A2Q Z;  1W0T A;  4Z2Y A;  2LG4 A;  3GF2 A;  4HLX A;  2LC2 A;  4GFB A;  2QQA A;  1EKE A;  3OV8 A;  3BRO A;  4IL6 C;  4DBQ A;  4FAS D;  1JGG A;  3PJR A;  2IVQ A;  3PXP A;  2DBB A;  1QP7 A;  1W0U A;  2VUM J;  1YIJ I;  3MEJ A;  5DRT A;  4EQQ A;  1FYM A;  2IGO A;  1TWH J;  3PQJ A;  1U5T C;  1MMN A;  1IO2 A;  1WSU A;  1QB2 A;  2IVG A;  3C7J A;  3OIO A;  2LNM A;  1B59 A;  1R4N B;  5DM7 F;  2Y75 A;  4IX7 A;  4F92 B;  4IA8 A;  1IGN A;  2B63 J;  1W7P B;  4ZTF A;  2Z16 A;  4UUV A;  5J8F A;  4E7K A;  3FYA A;  2X1D A;  1SVL A;  4MFD A;  1AHD P;  2X6W A;  3I55 I;  1ETQ A;  3L2U A;  2CFO A;  5FLM J;  3CME I;  5ICG A;  1O7L A;  1XN7 A;  3DKX A;  5HVQ C;  2AUW A;  4YEL A;  3WE3 A;  3I59 A;  3CCY A;  1REP C;  1B4A A;  3BLY A;  5D5X B;  4CO8 A;  5FO5 A;  1R5I D;  1ZRD A;  1P2F A;  2O61 A;  1JXS A;  5GAH i;  4XOR A;  4NHJ A;  5D8L B;  1ZH5 A;  3PE5 A;  2R7D A;  4RB1 A;  1UB9 A;  4N4N B;  3G1L A;  1V5E A;  5LFA A;  1S9H A;  1Y0N A;  2EWN A;  5CVJ A;  2Y9Z A;  3KYL A;  5F0C A;  5DCM A;  1VI0 A;  2X1E A;  3GWZ A;  5IY5 H;  1F36 A;  2IAI A;  1QQA A;  5DTQ A;  1D1A A;  2LKX A;  2JVL A;  1B72 A;  2RGV A;  2JRM A;  1DUL A;  2OUM A;  3JRG A;  5J4V A;  1V54 H;  1P4W A;  1K78 A;  1WWX A;  2E71 A;  1BBY A;  1VQL I;  4DZJ A;  1ERD A;  2J7W A;  3ZPX A;  4X4E A;  1CQT A;  2QGU A;  2A6C A;  2L4A A;  1MMA A;  2HYF A;  3GN5 B;  1K6Y A;  2DQR A;  3AFH A;  4FX4 A;  5E3M A;  1OFC X;  4EJW A;  4KT6 A;  4V2F A;  3HRT A;  3JR9 A;  3PNY A;  1XS9 A;  1TNT A;  1XDU A;  3CZ6 A;  4XM3 A;  3QP5 A;  2GZU A;  3J7Z I;  2ADU A;  3QU6 A;  3G5G A;  2L9S A;  2AXV A;  2XAH A;  4BHC A;  4FQG A;  2E60 A;  3LSM A;  4ENM A;  3O3K A;  3O6B B;  4AVZ A;  1MFQ C;  3BTI A;  1MBJ A;  3BDN A;  2GRL A;  2L02 A;  3BZK A;  3S32 A;  4EVI A;  3DBH B;  3REO A;  1FEX A;  2MQK A;  4DE8 A;  2JA7 J;  4MEY F;  3RPQ A;  2LYK A;  3PSF A;  4F55 A;  1X57 A;  3L1P A;  4U0Y A;  2WY8 Q;  2XRO A;  5K5O A;  5CLS A;  2HDC A;  1HC8 A;  4OB4 A;  2VJI A;  5KK1 A;  5HDK A;  2D1H A;  3HPG A;  5C4J J;  2HKO A;  3NRV A;  3CUO A;  4NUB A;  4JBA A;  2FXA A;  5GAG i;  2DT7 B;  4FCY A;  1WJC A;  4O5V A;  2QYO A;  1TT5 B;  3EYI A;  3LA7 A;  2R92 J;  2CSF A;  3FX3 A;  3S2D J;  1RUO A;  3OSF A;  4EM0 B;  3VB2 A;  2A6T A;  4PK4 A;  2C6Y A;  2GOM A;  1ETV A;  1QPZ A;  1HDP A;  3OIQ A;  5F64 A;  1RIO H;  2KL4 A;  1XSV A;  4YII A;  2LVS A;  2ZC2 A;  3P5J A;  3SDB A;  4D0P A;  4EM1 A;  2HPM A;  2K40 A;  1FTT A;  1R49 A;  2KIQ A;  3FXK A;  1QZX A;  1QZY A;  4QPQ A;  2RNG A;  4BAY A;  4YG2 F;  4D1Q A;  1FP1 D;  4MCX A;  3HRS A;  2BY1 A;  2DDB A;  2IJL A;  2A5Y B;  1FZP B;  1LDK B;  2CFX A;  4YAR A;  2UUZ A;  2NVX J;  3CLO A;  3M9L A;  2DOD A;  4MQV A;  4WF2 A;  1J2X A;  4PJM A;  3RYP A;  2KEI A;  3V7C A;  3E5U A;  3JRC A;  3TW7 A;  2B7E A;  2FOW A;  1WI9 A;  1Z9C A;  4IQJ A;  1YIT I;  4M6X A;  1KON A;  1CF7 A;  4NC7 A;  5LGT A;  2OF7 A;  4AUX A;  3U2R A;  3JRA A;  3NZL A;  1RES A;  2STT A;  1LDJ A;  2ZSI B;  4FHT A;  1LE8 B;  4KIS A;  2EJR A;  2WAQ N;  1SFU A;  2DDA A;  4M3D A;  2BYV E;  2HU9 A;  4G8X A;  4BS9 A;  3OMY A;  2XKO A;  3ZR8 X;  2A6E F;  4UNO A;  3KEO A;  2OV7 A;  1WJA A;  3SR4 A;  1CJG A;  2VQG A;  1R7J A;  3BG5 A;  4KIT B;  2PMU A;  1O3Q A;  3AG3 H;  5IYB J;  2VQL A;  3R1F A;  1YX5 A;  4IF4 A;  1RR7 A;  1YIO A;  3SYT A;  3W3C A;  3F9K A;  4QIW N;  3A4C A;  2F2E A;  3JRH A;  4M3B A;  2O3F A;  5EJC A;  3GZC A;  2XF5 A;  4DYC A;  3ABK H;  3BQY A;  1RRJ A;  1Y56 A;  3C2G A;  4FE7 A;  1HDD C;  3S3O A;  2CGP A;  3CDL A;  4IOA F;  1HQC A;  1O4X A;  3UWP A;  4ER6 A;  5K98 B;  2R7X A;  2JT1 A;  3NWS A;  2BW3 B;  5LHI A;  3OMT A;  3TEL A;  5LRR A;  4OMY A;  1GVJ A;  2ZBK A;  3CDI A;  3DEU A;  5E3L A;  5F1R A;  1SAU A;  2R7S A;  2K9M A;  2ZFW A;  3K70 C;  3GVA A;  4BE2 A;  4BXU A;  1DP7 P;  3HOX J;  2VQH A;  1L0O C;  1GDT A;  1IN5 A;  1EH8 A;  4E4H A;  3M07 A;  1Y1V J;  1NK3 P;  1HCR A;  2RC4 A;  2KDO A;  3TDZ C;  4G7Z F;  3QF3 A;  2YX4 A;  2D5V A;  1WFX A;  2LF8 A;  2CRO A;  2PUE A;  3SHF A;  2PXQ A;  1D1B A;  4B09 A;  1FIP A;  1UMQ A;  2L3D A;  3QOP A;  1ETK A;  5CVU A;  5EEA A;  3QAH A;  2Z1D A;  1ZR4 A;  3S1M J;  2PUD A;  2L7Z A;  4RB3 C;  2LKP A;  4G6D A;  4BQQ A;  1RZR D;  2WB1 A;  2JWT A;  2G9W A;  4I6Z A;  5DT2 A;  1W36 D;  1ZK8 A;  2TRT A;  4LLL A;  3RZO J;  2CG4 A;  1SD7 A;  2Y30 A;  4G7H F;  2VBZ A;  1WCM J;  2NXN B;  2F5C A;  3KEY A;  1Z77 A;  3IH4 A;  2XB0 X;  4ETS A;  5TJJ A;  5E3N A;  2R7R A;  2QF7 A;  1EA3 A;  4HST A;  5IT3 A;  3I4M J;  5E8G A;  1U5T B;  2DXI A;  2BBY A;  3S2H J;  5FKK A;  1ZAY A;  1P7I A;  2XRL A;  2K4B A;  1D8J A;  2H94 A;  2HR3 A;  1JHF A;  2COM A;  3D0S A;  1I5Z A;  2MBF A;  1K4T A;  1B9N A;  2HCS A;  2QSH X;  3OYJ A;  1R9T J;  9ANT A;  3HSF A;  4DYR A;  3HC7 A;  2HEO A;  3Q0V A;  4LB6 B;  4KT5 C;  4UXN A;  2IS2 A;  2CMP A;  2DMT A;  4E7Z A;  2LLV A;  1SFE A;  1PP7 U;  2IRF G;  2HCN A;  1ADR A;  4GYG A;  2OD5 A;  4I6U A;  4XLC A;  1LVK A;  3RQI A;  3TO7 A;  5J6X A;  3F8F A;  2DPD A;  2K7L A;  4L0Y B;  3LA3 A;  3FWE A;  1SD6 A;  2JCG A;  3F23 A;  4BU2 A;  1V5F A;  4F8D A;  2MA3 A;  2M8E A;  2EWT A;  3H3V K;  4EK9 A;  1ZKG A;  1MJB A;  1XGO A;  4KUM A;  2OFY A;  1G8X A;  2P0W A;  3G73 A;  2M34 A;  3GO5 A;  3HGY A;  2OZU A;  2DO7 A;  4BL0 B;  3M7G A;  2XAJ A;  4C30 A;  1HF0 A;  2IUO A;  3O8G A;  2W48 A;  2GQQ A;  1IC8 A;  2HSG A;  4I01 A;  3CLC A;  2BZT A;  4PSX A;  5D5V B;  1MMS A;  2ME6 A;  4R79 A;  2LR8 A;  1IRG A;  3FM3 A;  2HTJ A;  4A3B J;  2XHK A;  3F0C A;  3LWF A;  3WTX C;  3KZ3 A;  2LNB A;  4ER7 A;  2DQL A;  5GPC A;  2O0Y A;  2YU9 J;  4IJA A;  4HDU A;  3C18 A;  3GTP J;  2F5V A;  2A07 F;  4IRI A;  3PUB A;  4MCT A;  4C3H J;  1LQC A;  3KET A;  1WH6 A;  1HKT A;  4AC0 A;  3S1Q J;  2KZV A;  2FF4 A;  2F6C A;  1C0W A;  2A6H F;  4ZJZ A;  4IO9 F;  4CCO A;  3S93 A;  1T2K A;  1IDY A;  2O03 A;  2PPX A;  2P6S A;  5FRM A;  5IYD J;  4MHG A;  1SD5 A;  3K0L A;  3RCO A;  1Y8R B;  1APL C;  1FOW A;  4M6V A;  3I4N J;  1U5T A;  5KAF C;  5DM6 F;  4Q4Z F;  3ULQ B;  3EUH C;  1JH9 A;  4M3G A;  3DEE A;  3PIO F;  5EGO A;  2XSJ C;  4KMF A;  1ZEL A;  5JHF A;  1BI1 A;  2ZME B;  2MW8 A;  2LKS A;  2EIM H;  3GBG A;  3I0T A;  1U3E M;  2Z2S B;  1E2X A;  1U0J A;  4MNU A;  4I99 C;  4IPA A;  4OAY A;  2R0Q C;  2ETH A;  2M4G A;  3SZP A;  4KDP A;  2AW6 A;  1IXC A;  1R6R A;  4OBM A;  3L00 A;  3ZRG A;  4I98 B;  4PU7 A;  4MO7 A;  2HFZ A;  4IWR A;  2XUB A;  1EJ9 A;  2RQQ A;  3LIS A;  4YBA A;  4BEH B;  1T95 A;  1YW7 A;  1RPW A;  2X0L A;  4C3I J;  2ZJQ F;  4XN3 A;  2MLG A;  2PIJ A;  1V55 H;  4PGG A;  1JTY A;  4BE0 A;  3A01 A;  2EQR A;  2PMZ A;  3OR2 C;  3BCA A;  4RM3 A;  1ZLJ A;  1MMG A;  1ZGA A;  2PI0 A;  2IBD A;  4UUS B;  4A6D A;  4BEH A;  3ERE D;  3HOV J;  1MKM A;  2LP0 A;  4KN4 X;  5KCM A;  4ER3 A;  5HOD A;  1OYW A;  4HOB A;  2E35 A;  3QFI A;  1LUJ B;  2V9P A;  1R71 A;  3ABL H;  2VKV A;  2CO5 A;  2BW3 A;  4NBQ A;  1V5G A;  2G7U A;  2NYX A;  2CQK A;  3CLQ A;  2IEK A;  3RKW A;  1R63 A;  4AIJ A;  2LYQ A;  4ZTJ A;  1JFS A;  4FX0 A;  4CH7 A;  5E8I A;  1TW2 A;  1MDM A;  4P9U A;  2IPQ X;  3T1B A;  5LEK A;  4CCL A;  4B1R A;  5J1Y A;  2KFD A;  1TP4 A;  2RNJ A;  4RLQ A;  4PJ0 C;  3F72 A;  2DYR H;  2R4G A;  1WIZ A;  3OS1 A;  3IWZ A;  3MZY A;  1RPE L;  2L2O A;  3OR1 C;  2E1M C;  3SDG A;  5HNF A;  3DTI A;  4EEF G;  1BW5 A;  1P9Q C;  4PJJ A;  4LLG F;  1VQ6 I;  1ULY A;  1ETY A;  2BXZ A;  1X1C A;  1DP3 A;  3R6S A;  4N0B A;  1ORK A;  2CJJ A;  2PXB A;  1MBE A;  2BVL A;  4XOT A;  1X3W B;  2JK3 A;  2OC6 A;  4RB0 A;  4ANJ A;  5GTI C;  5KNL A;  2W7N A;  5ILV A;  2FFH A;  5E1W A;  1MJA A;  1WJ5 A;  5GP9 A;  4N4O B;  3WU0 A;  3MVP A;  4B3A A;  5L3G A;  5IT9 K;  2UXX A;  5DCF A;  1YTY A;  4XLN F;  3MD2 A;  2IT0 A;  3E6B A;  2AO9 A;  2XVC A;  4MTE A;  2VE8 A;  4DIQ A;  2P5L C;  1RNL A;  4X1E A;  2CW7 A;  2E34 A;  4G6T B;  3FXU A;  3RZD J;  1JUM A;  1KU3 A;  2K9S A;  3CP8 A;  4U88 A;  1B8I A;  3U3W A;  1AKH A;  2LK2 A;  5DV5 A;  1R5H A;  3P9C A;  4E7I A;  4ESJ A;  3K69 A;  3GZD C;  3EUH A;  4Y7N J;  3JSP A;  3CCR I;  4X4B A;  2HOE A;  3N97 A;  3I56 I;  3GXO A;  1V4R A;  4O3M A;  1ZG3 A;  1KU7 A;  3MN2 A;  3ZHM A;  3PUF A;  1PUF A;  3KYD B;  5DUK A;  4AWX B;  3RI4 A;  1TW3 A;  4UV8 A;  1OCC H;  2CU7 A;  4NC6 A;  1PDN C;  3VOD A;  3ZXS A;  3I9V 2;  5E18 F;  4LGW A;  1KA8 A;  4LOC A;  4V2G A;  1ZGW A;  4KYW A;  1EF4 A;  1FOY A;  4OOI A;  4EM2 A;  3HUG A;  3OSG A;  2RV8 A;  3HTU A;  3QOW A;  1N75 A;  3DV8 A;  3S1N J;  2PXT A;  1O3S A;  1K7A A;  3CTA A;  1UJ8 A;  2R3S A;  1Z6T A;  4A3C J;  2V26 A;  1BDH A;  4XKV A;  3LAP A;  3W6J B;  4IHW A;  4CCJ A;  2LOO A;  1ZZ7 A;  2YU3 A;  4BH9 A;  4HAM A;  1AU7 A;  4OIQ F;  4G9Y A;  1EH7 A;  2VBW A;  1VQN I;  1DU0 A;  3ZQQ A;  2V3C C;  1GT0 C;  5GPA A;  3H35 A;  2QKL B;  2JRT A;  1FIA A;  2H6B A;  1A6I A;  4PDK A;  5F6F A;  4L0Z B;  1TL8 A;  2FJR A;  4QTR A;  3FDY A;  4RDU A;  4A93 J;  1H9G A;  2G0E A;  3V8J A;  1IAW A;  5DRY A;  3GME A;  4BBR J;  1IRZ A;  4JX6 A;  3LAJ A;  2K5C A;  5E3O A;  1ON2 A;  3KP2 A;  3COA C;  4XKW A;  5TIS C;  1TQM A;  2MG4 A;  2RRE A;  4ZYA A;  1JKQ C;  4B4C A;  3S8Q A;  1WJF A;  4EQZ A;  3BR0 A;  4X0G A;  1MBG A;  1IV6 A;  1DGR M;  4BE1 A;  4YG4 A;  1OLT A;  3C2B A;  4GYI A;  2FUG 2;  3DPT A;  3ONQ A;  1H8A C;  1X4P A;  1ZAO A;  2MD5 A;  4JQD A;  2LF7 A;  2PLY A;  3CMY A;  3NDB B;  5GAE J;  1ZR2 A;  3CCS I;  1F4K A;  4GO1 A;  4YG1 A;  2Y2Z A;  4I0A A;  1YI2 I;  3V8L A;  3K10 A;  1SFO J;  5EEG A;  1UG2 A;  2EV5 A;  3OYB A;  1RC9 A;  4AID A;  3BPV A;  5IP7 J;  3HZI B;  2NS7 A;  2KRC A;  4NQW B;  2E1O A;  3ZMS A;  4ZDO A;  3RDI A;  5M3M J;  4UHT A;  3HDD A;  2CW0 F;  2GBY A;  1H88 C;  2XF7 A;  3RIR A;  2HVQ A;  1TLH B;  1X1B A;  3E7L A;  3SCH A;  2XV4 S;  4OAZ A;  1UG0 A;  2HQ5 A;  4IHT A;  5IOY A;  3UFD A;  3A02 A;  1WPK A;  2VT2 A;  2O9L A;  2TCT A;  2ZME C;  4J01 A;  2IW5 A;  2E1N A;  4L9T A;  4A6E A;  3A01 B;  3R4K A;  2W85 A;  1BW6 A;  2PJR B;  3KX2 A;  1IXS B;  2ZJR F;  3DPU A;  1TT0 A;  2JSP A;  3GLL A;  4C2U A;  2VB6 A;  3HL2 A;  1KZH A;  4JOM A;  3OL4 A;  5K5Q A;  4HX8 A;  1WJE A;  2W4S A;  2MYS A;  2L7K A;  3K4L A;  3FXO A;  4WCG A;  3FXM A;  4F52 A;  1UZC A;  1FWZ A;  3UKG A;  2EV0 A;  2DPU A;  2V9K A;  3KYC B;  2WAQ A;  1A36 A;  5EZG A;  3BZC A;  2JTV A;  1U6G A;  1J09 A;  5CPR B;  2M5W A;  4I09 A;  3LSR A;  2UXN A;  1JTX A;  2OTJ I;  2EIN H;  3Q3S A;  1MGT A;  2OQG A;  3ABT A;  3BG9 A;  2X48 A;  4ESF A;  3R61 A;  2WAF A;  4M9X A;  4HW0 A;  4GHJ A;  2QSG X;  1RR8 C;  5HS7 A;  3M8E A;  5D6E A;  1QP4 A;  2KLO A;  2QEN A;  4BKX A;  1JHH A;  3FIW A;  2BNN A;  2W24 A;  3ABM H;  5BQT A;  4CXF A;  2CRG A;  1OCZ H;  1KU9 A;  2K86 A;  4I02 A;  2EFN A;  2LLW A;  5DUI A;  3F3X A;  1PER L;  4Y15 A;  3NAU A;  1QQB A;  4O6J A;  3TOA A;  3ESW B;  3H3U A;  2R5Y A;  2CWE A;  4Z58 A;  5HNH A;  2VXZ A;  3DWL E;  3E5X A;  2VON A;  3SQN A;  3ECO A;  1FYK A;  1YX3 A;  1S7E A;  1SMT A;  3K1M A;  4BHP A;  1JFT A;  2DI3 A;  3SEQ A;  2E1M B;  3KL4 A;  2BY0 A;  3C1D A;  2X6Y A;  1TC3 C;  1ON1 A;  4NQW A;  1WH8 A;  4PFO A;  4DBR A;  3FMR A;  4LG3 A;  4PJN A;  2V6E A;  2GLO A;  4II3 A;  1XWR A;  1K61 A;  3P9K A;  3DLL F;  1TZL A;  3OWT A;  4JQF A;  1NW3 A;  5CQE A;  3HJE A;  2OCC H;  3BP8 A;  3D1N I;  3ROU A;  2L01 A;  3M8F A;  2WA0 A;  3OS2 A;  3ASO H;  2F48 A;  3NAR A;  2R5Z A;  3JTG A;  4L9N A;  3AAF A;  3J7A Y;  4XKC A;  3E3V A;  2HVR A;  3K6G A;  1S6L A;  3GTJ J;  3EDP A;  4ENN A;  3U21 A;  1MDM B;  4G94 A;  4Y17 A;  3ECH A;  3ELK A;  1O3R A;  2BGC A;  1BI3 A;  2JVG A;  4RGS A;  2P5K A;  4ON0 A;  3NXH A;  4YFX F;  2Z5U A;  3BOQ A;  4F91 B;  2DCE A;  3VDX A;  2EFP A;  3BWG A;  2ZB9 A;  1MBF A;  3HHH A;  3BC8 A;  1RIO A;  3H0D A;  2EA2 A;  4LB5 A;  5LGU A;  1ZRF A;  2XGD A;  2HOT A;  2A69 F;  2XCJ A;  5IPA A;  2R93 J;  1LB2 A;  4II2 A;  4I8T A;  3FKJ A;  2QEX I;  2GOX B;  1OSL A;  2JA5 J;  2HDW A;  4UB8 C;  3DTE A;  5L3C A;  2IP2 A;  1IDZ A;  1Z67 A;  4UVB A;  1NHA A;  1J5Y A;  2NVQ J;  4ASN A;  3J7Y J;  4EKI A;  1F1Z A;  2RDP A;  2R7V A;  1W5T A;  1IG7 A;  4DQ2 A;  1TWC J;  2ZSH B;  1IUY A;  3LFK A;  4IRH A;  2HWV A;  5HS9 A;  3QOD A;  1R69 A;  1LCD A;  2LYR A;  2LYC A;  3LOC A;  1IV8 A;  2Q0O A;  1VQ9 I;  3EUK L;  1X2N A;  1O7F A;  2XAG A;  1FYL A;  3I5U A;  4CA0 A;  3AL0 B;  2O7O A;  2GA1 A;  1G3W A;  2DFH A;  2R7U A;  2XAQ A;  3IVP A;  2VI6 A;  2CQQ A;  4EJO A;  1YW9 A;  1BN5 A;  1O57 A;  2XSD C;  2ID3 A;  1YFH A;  3EYY A;  2ZXH A;  4UUT A;  1LDD A;  4KMU X;  3W2V A;  2LD5 A;  2ME0 A;  2HZT A;  4E7L A;  4RAY A;  4HNT A;  5FD5 A;  1POG A;  2LRD A;  1ZZC A;  4M9S A;  2VKD A;  4IXA A;  1CF7 B;  2KPM A;  2IS6 A;  2PEX A;  4XRS G;  3BS3 A;  2PUG A;  2DA2 A;  1D3Y A;  2CQN A;  4BDZ A;  4BXX J;  1MD0 A;  2ZXI A;  2QWW A;  2L1P A;  1UHS A;  3A03 A;  1Z91 A;  2M1B A;  2RKH A;  2Y69 H;  1UCR A;  1UFM A;  2M7B A;  4HNV A;  5FLX K;  4JP0 A;  5E1X A;  4A3E J;  1Z0X A;  2ECC A;  1IN8 A;  3G3Z A;  2X1C A;  3JXB C;  3HHG A;  2PQ8 A;  2LRE A;  2VKE A;  4EJU A;  4KIG A;  2JN6 A;  3KPH A;  3JRB A;  2A68 F;  2DU9 A;  2KPJ A;  3IP4 B;  5DS9 A;  1ETO A;  3WTW C;  1JKP C;  2L9N A;  5AIP A;  3LNQ A;  3KJX A;  2V6C A;  5H6Q A;  4ESB A;  3QQ6 A;  1YS6 A;  5HDG A;  3S2W A;  3DF8 A;  2P5V A;  1LEB A;  1TQI A;  1FTZ A;  1QQI A;  3D5R C;  2VOP A;  2GRM A;  5FJ8 J;  1ZAR A;  2O8K A;  3PFI A;  3ZCO A;  1GXP A;  1BI0 A;  4C9Y A;  2L8N A;  4A3L J;  3ZP5 A;  1XDS A;  5JVT A;  2X4H A;  4BUP A;  4XLF A;  2KT0 A;  4XN0 A;  4S0H B;  1FJL A;  4L5I A;  5C44 J;  4B44 A;  3L2C A;  4A3F J;  5J1R A;  5IT9 Z;  4CZZ A;  1MMD A;  1S5L C;  1FSE A;  4X4H A;  4CHU A;  1YG2 A;  2D2W A;  1OQY A;  5H6R A;  3ML6 A;  2PXF A;  4BY1 J;  5FD6 A;  1YJ9 I;  1MH3 A;  1TBX A;  2O6G E;  3C3W A;  3DQV C;  3CUQ A;  1D0X A;  4HDV A;  4XSX F;  3OOP A;  5ICE A;  4IVZ A;  2HDD A;  2XB5 A;  4HF1 A;  1BDI A;  4UVC A;  2QCO A;  3VPR A;  1QA6 A;  2VJJ A;  4JX4 A;  2LY9 A;  1PNR A;  2M0C A;  3JAM Z;  1NEQ A;  5JHU A;  5FGM A;  2EZL A;  4J1W A;  2H6C A;  4UV9 A;  1JE8 A;  5DEQ A;  5LGN A;  2R5Y B;  1RET A;  2BY2 A;  3BG6 A;  1QHH D;  3ZMV A;  1W36 C;  1UHM A;  1VQP I;  1T39 A;  3FMQ A;  1U9N A;  1U78 A;  2FBK A;  2ZJ2 A;  4IHY A;  3CCJ I;  4U7B A;  4PFP A;  3VYS B;  1FX7 A;  1XX5 A;  2W57 A;  3DP7 A;  1CGP A;  1GXQ A;  1W7P D;  1VQ8 I;  3TL4 X;  2QQ8 A;  3OQN A;  1R1U A;  2Y0S A;  3S16 J;  4YG7 B;  3GTL J;  3RSN A;  2AHQ A;  5J47 A;  3PO2 J;  2MXD A;  4ZDL A;  4P9F A;  2IA2 A;  2I8D A;  3ZQC A;  3GEZ A;  2P4W A;  3GZ6 A;  4EV0 A;  1ACI A;  3BY6 A;  3TW6 A;  2F4M B;  4IRG A;  3CO6 C;  2B9S A;  5BNG A;  1G59 A;  2R5Z B;  3GYH X;  1W4M A;  2H09 A;  1WQ2 A;  3FHZ A;  1J9I A;  4M6Y A;  5J8C A;  3VK0 A;  1FT9 A;  3BR6 A;  1SFX A;  1P92 A;  1DPU A;  5D6F A;  2CS3 A;  1HW1 A;  1AWC A;  2FML A;  4OIN F;  3SJM A;  4CCN A;  3EUS A;  5L3E A;  1I1G A;  3K9T A;  5EDN A;  5J4Y A;  3S1R J;  1OPC A;  4XRM A;  4WVL A;  1TQP A;  2A5W A;  4J19 A;  2AQF A;  1FBQ A;  2OBP A;  5B5E C;  3WG7 H;  1G3T A;  4RAG A;  4HX7 A;  3SFI A;  2WC2 A;  4J1X A;  3GUU A;  4HX4 A;  2DLL A;  2GWR A;  1DGW Y;  3SZG A;  1PJR A;  1YLF A;  1E3O C;  3W6V A;  1D1C A;  1IJW C;  3HKZ N;  2DOA A;  5H20 A;  2E5Z A;  1MJ9 A;  2CQ7 A;  4YEJ A;  2QBY A;  2LMD A;  2V79 A;  3OYG A;  3GX4 X;  1IF1 A;  3ZQF A;  1B9M A;  3F8B A;  3WHB A;  3GUD A;  2VOO A;  2PG4 A;  2YR2 A;  1PRU A;  3H9G A;  2K9L A;  4M73 A;  2EZH A;  2PXV A;  1STZ A;  4FTH A;  3PM1 A;  5BPD A;  3ZQL A;  2DTR A;  2E7X A;  1JT6 A;  3L09 A;  2J5O A;  4I2O A;  1JWL A;  1WJD A;  3E97 A;  5IOZ A;  4XLA A;  5EG0 B;  3TOB A;  2K3F A;  2KIM A;  1OCP A;  1DQU A;  2ZXJ A;  5EF6 A;  2LYL A;  4QLC U;  3H92 A;  3RPU D;  2HOA A;  4HPQ A;  5M3F J;  4H4K C;  5FRO A;  4BJT A;  3DKY A;  3I4P A;  3J80 Z;  4MIM A;  2HYG D;  3LQQ A;  3Q5F A;  4A3I J;  2KJB A;  4ENK A;  3L2V A;  2FQ3 A;  1OJL A;  1A04 A;  3GTG J;  1JUP A;  4HRI A;  4LG0 B;  2JA2 A;  1X58 A;  3CUQ C;  3K7A J;  1B8I B;  2DOE A;  3V7S A;  4F7Z A;  1K6O A;  2KQR A;  3BZ6 A;  2MEZ A;  3BDD A;  3IV5 A;  3QYX A;  2R7F A;  3K70 D;  4H0E A;  3PO3 J;  2DK5 A;  3A9X A;  1IRX A;  2ICW G;  1HLV A;  4Y33 A;  3K1N A;  4P55 A;  4AVP A;  2XXA A;  2EBI A;  1PUF B;  1R23 A;  1K79 A;  3DNV B;  1T8I A;  2PXL A;  2V1D A;  3GLX A;  1D0Z A;  4M3F A;  1VQK I;  2KIU A;  1E17 A;  3EQL F;  4LMY A;  5EYR A;  5HLG A;  2R7T A;  3JCU C;  4EGY A;  4QPO A;  4LIT A;  4Q5S F;  3CF5 F;  1MBH A;  2GA2 A;  3JRF A;  3MZ8 A;  3BTL A;  1XMA A;  4W97 A;  1QP0 A;  3IH3 A;  1B1B A;  3FBI B;  1W1W E;  1WVR A;  2WB1 N;  4RB2 C;  1Y39 A;  3CC7 I;  1E3H A;  4I76 A;  2Q8K A;  1X19 A;  1IN6 A;  2E5N A;  3HOW J;  1PRV A;  5DYM A;  3SCG A;  1QZZ A;  3GZN B;  2HS5 A;  3GFI A;  3H5N A;  5D4R A;  4E7H A;  3CQZ J;  1UEL B;  2XRN A;  1E0E A;  2EA4 A;  1VQM I;  2JZY A;  2XIG A;  3MKW B;  4I6R A;  3KP6 A;  3AG2 H;  2AS5 F;  2EFO A;  3A0B C;  4KNY A;  2XPV A;  3DU6 A;  3C2H A;  1ETW A;  6PAX A;  4FET A;  3JXC L;  3HIF A;  4K2E A;  2VBY A;  3IC7 A;  3QU3 A;  5ILS A;  3ZGK A;  4PU3 C;  3FKI J;  3K4M A;  1AA7 A;  4A3G J;  3GTQ J;  2GXA A;  2O49 A;  1GLN A;  1OYI A;  3WTU C;  2ODR D;  1NK2 P;  2MAB A;  2L49 A;  5JLW A;  2KEK A;  1YO5 C;  5B66 C;  4XL9 A;  3IAS 2;  4ZDP A;  2Y9Y A;  1GUU A;  3H5T A;  5FKN A;  2X85 A;  4IZZ A;  3I64 A;  2OAZ A;  2HTS A;  4XNF A;  1XG1 A;  1NG7 A;  3QPH A;  3TO6 A;  1X4O A;  4PU4 C;  1MW7 A;  2WV0 A;  1O3T A;  4KA4 A;  3SFZ A;  1BC7 C;  3HSE A;  4ZYH A;  3T0Y A;  4QSH A;  1J0R A;  2K85 A;  1XSX A;  3BPX A;  2ESN A;  1LFB A;  2BV6 A;  2FMY A;  5FB2 A;  2HOS A;  2EZK A;  3M1E A;  1TWF J;  3U1D A;  2OZ6 A;  3QPT A;  1YE9 A;  3HUG B;  1P6R A;  2NVY J;  5ED4 A;  2JPC A;  4CUG A;  3LSH A;  2ID6 A;  1S7O A;  3KE2 A;  4G12 A;  4XLE A;  4Q47 A;  3DEW A;  1NER A;  3TMO A;  4L5J A;  1G6N A;  3TDU C;  3BR2 A;  3LMM A;  2I5U A;  2PXU A;  3KFW X;  1R4M B;  5FFX A;  3CRO L;  3PL8 A;  1ZVV A;  2IU7 A;  3B73 A;  1I39 A;  3V4G A;  3WHC A;  3FHN A;  2XGC A;  4XID A;  1XMX A;  3BR3 A;  2DT6 A;  3M4O J;  3M8J A;  1FY7 A;  1XGS A;  2NOJ B;  2V7F A;  4XBF A;  3HRM A;  4A5M A;  4YIF A;  3I3L A;  3L2W A;  1VQ4 I;  3HOZ J;  2WIU B;  4JCX A;  2NNY A;  4GDF A;  5HDN A;  2DFF A;  4GXO A;  3PSI A;  2VPR A;  1BJA A;  3LSK A;  1VQO I;  4V19 K;  2OQR A;  2M8G X;  1IUF A;  3KP5 A;  4EMS A;  4G6Q A;  3HOY J;  3ZQI A;  2LYS A;  5F0H A;  2VEO A;  1XB4 A;  1WET A;  1R5G A;  3H9Q A;  3MKL A;  4IQ4 A;  2PUC A;  2JPB A;  3K4B A;  3WG9 A;  3BJO A;  3HOT A;  4HSR A;  1D5V A;  2CV0 A;  3GTO J;  2MLK A;  3OYC A;  2W82 A;  3NRO A;  4HZF A;  2KEJ A;  3GFL A;  3MQ0 A;  3GZ5 A;  4PCQ A;  5D8K B;  3WTS C;  3JSO A;  2CUE A;  3L2R A;  4RGX A;  1KYW A;  1GV5 A;  1U8R A;  1R58 A;  3VYU B;  1IN7 A;  3DKW A;  4E70 A;  2Z3Y A;  4ZC3 A;  4A3K J;  3AG4 H;  1Z3Y A;  3KZI C;  2STW A;  1ZHF A;  3BTC A;  1GVD A;  2DA4 A;  2ACJ A;  2ZME A;  4B48 A;  2W25 A;  3G6E I;  3CD6 I;  3D5S C;  5DCM B;  1QU3 A;  2MC4 A;  3PNV A;  1TNS A;  3SZT A;  1T98 A;  1WZ2 A;  3J80 K;  4P96 A;  3ASN H;  1JKR C;  2YBD A;  4A0X A;  2HQR A;  1BM9 A;  3QYB A;  2ZJP F;  1B72 B;  2CSO A;  5CKT A;  3HPH A;  1VND A;  3CCL I;  3TFL A;  2XGE A;  4W1U A;  2JQE A;  4C2M J;  1HW5 A;  2PXP A;  3WU2 C;  1KQ0 A;  3S14 J;  1D5Y A;  1DWK A;  2Q2E B;  2PXK A;  1N77 A;  1TWG J;  1YQA A;  3TEP A;  4PGH A;  3K4J A;  4HYE A;  2HIN A;  4I0B A;  1SFK A;  2XAS A;  3VYT B;  1BC8 C;  4NNJ A;  4CCM A;  4Z5D A;  4BXF A;  3WOD F;  1QBJ A;  5AIQ A;  2R7O A;  3T5X A;  5FKM A;  4OU0 A;  5FLV A;  1ZG5 A;  4AM3 A;  4XK4 A;  1ZGJ A;  2Y0M A;  1VFC A;  1MSE C;  3SX0 A;  2XKP A;  3OYK A;  1HW2 A;  3OWQ A;  4LLN A;  4P1W A;  3E6C C;  3KEQ A;  3OYL A;  4LIU A;  5K7F A;  4U7D A;  1B6A A;  2B0L A;  3ZKC A;  3HRU A;  1X2L A;  3E5Q A;  4D5F A;  2OJE D;  5HLI A;  1MH4 A;  4XLH A;  1Z21 A;  2P7C B;  2J5P A;  5K1Y A;  3CEC A;  1UXC A;  3HSR A;  4MFE A;  5ILU A;  2VOD A;  3CDH A;  1YSE A;  2IV1 A;  4RAF A;  5FKL A;  3TO9 A;  2RN7 A;  4B43 A;  3JAM K;  4D7N A;  2ISY A;  2EF8 A;  4G7O F;  1UST A;  1DUX C;  4EKG A;  1U2W A;  1Y0U A;  3QWG A;  2FBI A;  3O8H A;  2QBY B;  4B47 A;  3OYI A;  5TRD A;  1RKW A;  3AL0 C;  1ZZB A;  4A0Z A;  4ER5 A;  4ZYG A;  1PP8 F;  4C2T A;  1Y8Q B;  2HYJ A;  2IVM A;  3FF5 A;  4BQO A;  3DXJ F;  1SVO A;  1A5J A;  2DOF A;  1X1P A;  2HVS A;  5M5X J;  1Y1W J;  1QZE A;  4RS8 A;  1N25 A;  5EGO B;  5BOX A;  1SC7 A;  1FOX A;  3CP2 A;  2E2J J;  4EJT A;  5CVR A;  2LYJ A;  2VJ5 A;  3JXD L;  2FX0 A;  3IHU A;  3O2P E;  2BEO A;  2KJC A;  4U0V A;  4WXC A;  2JA8 J;  1IXR C;  2ECB A;  2OU2 A;  1Q1V A;  1G4D A;  1GHC A;  2F5F A;  2HZD A;  3B6C A;  5M5W J;  3RZZ A;  4NB5 A;  4M3E A;  4AIK A;  3GFM A;  3VSL A;  4DW6 A;  2PUF A;  1BIB A;  3G2B A;  2W00 A;  1JJ8 C;  3CO7 C;  2TDX A;  1LKX A;  2NNN A;  2QQB A;  4Z5H A;  4XSZ F;  4B8X A;  4A3J J;  1LJ9 A;  3MCZ A;  1PYV A;  1BR2 A;  2F5E A;  4D9J A;  4BJ5 C;  3LQR A;  5CQG A;  4DNC A;  3H36 A;  2DT5 A;  5K5R A;  3OYE A;  3ZHI A;  4HQM A;  2LFB A;  1H0M A;  3HOU J;  5JFR A;  4HEA 2;  2RAE A;  1LE8 A;  2M2E A;  3B7H A;  1I6X A;  3OOU A;  4IHX A;  1AKH B;  2DN0 A;  4A5N A;  5LD2 C;  4R1H A;  3BT9 A;  3H3Z A;  2FRH A;  2FBH A;  1W5C C;  1A35 A;  3G1M A;  3WGH A;  1SAN A;  2KHM A;  2X6X A;  3TP0 A;  5F04 A;  2X6O A;  3F8M A;  5JUW A;  2DFE A;  2PN6 A;  2PBI A;  4BDY A;  1RI7 A;  1MZB A;  4YRV A;  3J81 K;  4AIH A;  1RUN A;  5C4X J;  1U8B A;  1VQ7 I;  5B3S H;  4HV5 A;  1USS A;  4EJV A;  5D5U B;  2BNM A;  3NWT A;  1OR7 A;  4YIR X;  2DA5 A;  3KZZ A;  4BAC A;  3WE2 A;  4BQA A;  3LSI A;  3WTZ A;  4OIO F;  4EAT A;  1ZZ8 A;  2LBF A;  3P9I A;  2HXI A;  1TTY A;  4RAZ A;  2CH0 A;  3D5L A;  3T8T A;  1FPQ A;  1VQ5 I;  2GIV A;  2DA1 A;  3BTJ A;  3E0J B;  3N4M A;  1Z05 A;  3MKY B;  4XR6 A;  2JA6 J;  2LDU A;  3MAJ A;  3A9Y A;  1HBX G;  1J75 A;  2UWM A;  1DDN A;  1ZUG A;  1I3Q J;  3KXA A;  3OS0 A;  3L9F A;  2XAU A;  2KZ8 A;  2PXE A;  4MEX F;  1I27 A;  5E1Z B;  1T0F A;  2GZW A;  1BR4 A;  2GAU A;  5GAD J;  2D45 A;  1WHU A;  2PUB A;  2K27 A; 
#chains in the Genus database with same CATH homology
 4M6V A;  2OR1 L;  3I4N J;  1JJ6 C;  4AYB N;  4X4H A;  1JH9 A;  4M3G A;  4BY1 J;  5EGO A;  4A3M J;  2E2H J;  1ZZ6 A;  1MH3 A;  1RZS A;  4D5C A;  2MW8 A;  2LYP A;  3GBG A;  5F1J A;  4IVZ A;  1WGX A;  2HDD A;  2XB5 A;  5IP9 J;  1BDI A;  1VF9 A;  2QCO A;  3VPR A;  2R0Q C;  1ZPQ A;  4JX4 A;  2LY9 A;  2XIU A;  1PNR A;  1GV2 A;  2M0C A;  4L5E A;  4Y52 J;  1DW9 A;  1NEQ A;  2AW6 A;  4Z5C A;  4PU7 A;  4MO7 A;  2EZL A;  4IWR A;  4J1W A;  1X2M A;  1Y9Q A;  3LIS A;  4YBA A;  3BQZ A;  2R5Y B;  1RPW A;  1RET A;  4C3I J;  1K83 J;  1B0N A;  2DMP A;  1PRA A;  1U9N A;  2PIJ A;  3RKQ A;  1U78 A;  4JX5 A;  4IHY A;  1QVU A;  1JTY A;  3A01 A;  2EQR A;  4XRS A;  2I10 A;  2AXU A;  4PU8 A;  2JMW A;  4FBI A;  1ZQ3 P;  3OQN A;  2ICT A;  1LCC A;  1LLI A;  2IBD A;  1NTC A;  4UUS B;  5K7H A;  3HOV J;  3S16 J;  2LP0 A;  2LTP A;  3GTL J;  2ICP A;  2AHQ A;  3PO2 J;  4YG7 B;  4X4D A;  5HOD A;  5J3L A;  3ZQC A;  4IEJ A;  5EZH A;  2KDZ A;  1XC5 A;  1QPI A;  2DA7 A;  4D7M A;  2HXO A;  4DZP A;  2VKV A;  1Y7Y A;  2L7F P;  3TW6 A;  5BNG A;  4RBO A;  1LMB 3;  2JJ7 A;  2R5Z B;  2IVB A;  2IEK A;  1ENH A;  1R63 A;  1UXD A;  2LYQ A;  1JFS A;  3VK0 A;  2FJ1 A;  3BR6 A;  1L1M A;  2FQ4 A;  3M3Y J;  2EBY A;  2DMQ A;  1ETX A;  4FE4 A;  4B1R A;  5J1Y A;  3SJM A;  3EUS A;  5EDN A;  2H8R A;  2WUS R;  3S1R J;  1WIZ A;  4XRM A;  1RPE L;  4J19 A;  1VPW A;  3SDG A;  3G7D A;  4EEF G;  3LSG A;  3ZQH A;  1BW5 A;  3SFI A;  4J1X A;  1ETY A;  3G1O A;  1T33 A;  1E3O C;  1ORK A;  2CJJ A;  1TWA J;  1MBE A;  2Y0S N;  1T56 A;  3W6V A;  1IJW C;  4BBS J;  2DTZ A;  2JK3 A;  3O9X A;  3HKZ N;  2ELK A;  3OP9 A;  1RZR A;  5GP9 A;  3FMY A;  3ZQF A;  2X9D A;  3MVP A;  4B3A A;  2M9H A;  1F43 A;  1LFU P;  3WHB A;  3K2A A;  2DMU A;  3Q0U A;  1W0T A;  1PRU A;  2AO9 A;  2EZH A;  4FTH A;  3PM1 A;  4X1E A;  3ZQL A;  1JWL A;  1JT6 A;  4GFB A;  3RZD J;  1JUM A;  2CQX A;  2K9S A;  3FIS A;  1JGG A;  5IOZ A;  1B8I A;  2IVQ A;  5EG0 B;  1AKH A;  3PXP A;  3U3W A;  2LK2 A;  1W0U A;  1OCT C;  2VUM J;  1UTX A;  3JRD A;  1OCP A;  1YRN A;  5J1U A;  5EF6 A;  1TWH J;  2LYL A;  4Y7N J;  4X4B A;  2HOA A;  5M3F J;  1QRY A;  3MN2 A;  2IVG A;  3ZHM A;  2O4A A;  2HI3 A;  1PUF A;  3OIO A;  4MIM A;  2CU7 A;  4XIC A;  4A3I J;  4IA8 A;  1OJL A;  1IGN A;  3GTG J;  2B63 J;  2YS9 A;  1JUP A;  1ITY A;  1X58 A;  3K7A J;  1B8I B;  3FYA A;  4V2G A;  4LOC A;  1ZGW A;  1EF4 A;  4MFD A;  1AHD P;  2LCV A;  3OSG A;  2MEZ A;  4GQM A;  3IV5 A;  3QYX A;  1ETQ A;  3PO3 J;  3S1N J;  1MNM C;  5FLM J;  1HLV A;  2BJC A;  2EBI A;  1PUF B;  2AUW A;  3CCY A;  3DNV B;  4A3C J;  4M3F A;  1BDH A;  2GM4 A;  5C3E J;  4IHW A;  5EYR A;  3S17 J;  1ZZ7 A;  2O38 A;  4A69 C;  1AU7 A;  1MBH A;  3H0G J;  3JRF A;  3LSP A;  1DU0 A;  3BTL A;  3G1L A;  1GT0 C;  5GPA A;  4W97 A;  2EH3 A;  1QP0 A;  3IH3 A;  2Y9Z A;  5F0C A;  2WB1 N;  1VI0 A;  3QQA A;  1G2H A;  4A3D J;  4I76 A;  1F36 A;  2IAI A;  1FIA A;  1QQA A;  1A6I A;  2FJR A;  1PRV A;  3HOW J;  4QTR A;  4RDU A;  4A93 J;  3SCG A;  3BR1 A;  2G0E A;  3CQZ J;  2LKX A;  2JVL A;  1B72 A;  4BBR J;  3ZQG A;  4JX6 A;  4UUS A;  1IRZ A;  3JRG A;  4I6R A;  5E3O A;  1JT0 A;  2XPV A;  3HM5 A;  4DZJ A;  4X4E A;  1CQT A;  3MLF A;  2A6C A;  1ETW A;  3JXC L;  3GN5 B;  4PU3 C;  2MG4 A;  3FKI J;  5E3M A;  1JKQ C;  1OFC X;  4B4C A;  4A3G J;  3GTQ J;  2O49 A;  4V2F A;  3JR9 A;  3S8Q A;  1XS9 A;  3BR0 A;  1MBG A;  1IV6 A;  1NK2 P;  2PMZ N;  2GZU A;  4YG4 A;  3G5G A;  2L49 A;  3C2B A;  5JLW A;  2AXV A;  2KEK A;  3BD1 A;  2Y9Y A;  1GUU A;  3H5T A;  5FKN A;  1H8A C;  1XG1 A;  4JQD A;  3BTI A;  4PU4 C;  4FIS A;  1MBJ A;  3BDN A;  2GRL A;  4X4G A;  3CMY A;  5DTD A;  4X4C A;  1ZR2 A;  3DCF A;  4QSH A;  4IHV A;  4YG1 A;  2Y2Z A;  1FEX A;  2MQK A;  1LFB A;  2HOS A;  2JA7 J;  1SFO J;  4X6A J;  2EZK A;  1UG2 A;  1TWF J;  2LYK A;  1X57 A;  3L1P A;  5JLX A;  2NVY J;  5IP7 J;  3HZI B;  2NS7 A;  4BY7 J;  2E1O A;  2ID6 A;  4G12 A;  2YUS A;  5M3M J;  3DEW A;  1NER A;  2R63 A;  4OB4 A;  5C4J J;  3HDD A;  2GBY A;  5M5Y J;  2FD5 A;  1H88 C;  3BR2 A;  3F52 A;  3E7L A;  3SCH A;  1JUS A;  2HQ5 A;  4FCY A;  1JKO C;  5IOY A;  3UFD A;  2MSY A;  2NVT J;  3CRO L;  3A02 A;  1WPK A;  1ZVV A;  2O9L A;  2TCT A;  2IU7 A;  2R92 J;  3A01 B;  2CSF A;  3S2D J;  3WHC A;  3OSF A;  2XGC A;  1BW6 A;  4XID A;  3BR3 A;  3M4O J;  1BA5 A;  1QPZ A;  3OQM A;  1ETV A;  1HDP A;  5FKO A;  4F8D A;  4NDL A;  3HOZ J;  1POU A;  2WIU B;  4JCX A;  4NDW A;  1DU6 A;  2LVS A;  2E2I J;  2DJN A;  2K40 A;  1FTT A;  2VPR A;  2R1J L;  2XJ3 A;  2K9Q A;  4MLO A;  2M8G X;  1IUF A;  5K7Z A;  3ZOB A;  4ABZ A;  3HOY J;  3ZQI A;  3UKG A;  2LYS A;  3HEF A;  5F0H A;  4X4F A;  1WET A;  4MCX A;  3MKL A;  3LFP A;  5EZG A;  3FYM A;  2PUC A;  3LSR A;  3HGG A;  4YAR A;  2DMN A;  1I50 J;  1JTX A;  2NVX J;  3GTO J;  3Q3S A;  3BG9 A;  2KEJ A;  2KEI A;  2X48 A;  2CUE A;  2OPT A;  3TW7 A;  3JRC A;  1GV5 A;  1QVT A;  4GHJ A;  1BL0 A;  1QP4 A;  4A3K J;  4BKX A;  3FIW A;  5F08 A;  2BNN A;  2OF7 A;  3HBL A;  3LSJ A;  1HOM A;  3BTC A;  1GVD A;  3IH2 A;  4AUX A;  3JRA A;  2CRG A;  1RES A;  2DA4 A;  1LE8 B;  1PER L;  2DA6 A;  5A7L A;  2WAQ N;  3NAU A;  4M3D A;  1QQB A;  2R5Y A;  1WH5 A;  3F51 A;  1JKR C;  4Z58 A;  2L7M P;  1CJG A;  1B72 B;  1VND A;  3BG5 A;  1S7E A;  1U9O A;  2XGE A;  1I6H J;  1JFT A;  4W1U A;  5IYB J;  4C2M J;  3R1F A;  1RR7 A;  1TC3 C;  3S14 J;  1MBK A;  1D5Y A;  4QIW N;  1DWK A;  1WH8 A;  1P7J A;  3JRH A;  1TWG J;  2XI8 A;  4I6T A;  4M3B A;  2AWI A;  5F0F A;  1XWR A;  2GLO A;  4JYK A;  1K61 A;  4DYC A;  3BQY A;  1HDD C;  4FE7 A;  1YRN B;  2HIN A;  2BNO A;  3CDL A;  3D1N I;  3GTK J;  1O4X A;  5K98 B;  2PUA A;  4Z5D A;  3NAR A;  5FKM A;  2R5Z A;  2PE5 A;  3OMT A;  1RKT A;  5FLV A;  2LLK A;  4XK4 A;  1VFC A;  3GTJ J;  1MSE C;  4C3J J;  2K9N A;  5E3L A;  4DYQ A;  4X4I A;  5K7F A;  3BR5 A;  3HOX J;  3ZKC A;  1X2L A;  4D5F A;  3FK7 A;  3F6W A;  2XPW A;  1Y1V J;  1NK3 P;  1HCR A;  1MH4 A;  5F27 A;  3CEC A;  3SCF A;  1UXC A;  3QF3 A;  2D5V A;  2CRO A;  4FN3 A;  2PUE A;  4MFE A;  1ZS4 A;  1BJZ A;  2NOG A;  1YSE A;  2IV1 A;  2ZB9 A;  1MBF A;  5FKL A;  1FIP A;  1UMQ A;  1RIO A;  1ETK A;  3B6A A;  4D7N A;  2EF8 A;  5EEA A;  2COB A;  1H89 C;  2XGD A;  2HOT A;  2XCJ A;  1WI3 A;  1ZR4 A;  5IPA A;  3S1M J;  2R93 J;  2L7Z A;  2L9R A;  3QWG A;  3O8H A;  2PUD A;  1RKW A;  4I8T A;  1ZZB A;  2DA3 A;  1OSL A;  4O8B A;  1RZR D;  2JA5 J;  2JWT A;  1SQ8 A;  1IDZ A;  2HYJ A;  4I6Z A;  1ZK8 A;  3GBF A;  2NVQ J;  2TRT A;  1MSF C;  1A5J A;  2MGQ A;  3RZO J;  2Y30 A;  5M5X J;  1Y1W J;  1WCM J;  1IG7 A;  1TWC J;  1Z77 A;  3IH4 A;  2R7Z J;  5EGO B;  2EZI A;  2XB0 X;  3HB9 A;  2E2J J;  5E3N A;  1R69 A;  2LYR A;  1LCD A;  3LOC A;  2QF7 A;  2LYJ A;  3I4M J;  4Y42 A;  3JXD L;  2FX0 A;  2WV1 A;  3S2H J;  3S15 J;  5FKK A;  1ZAY A;  1P7I A;  2XRL A;  1ZZ9 A;  2JA8 J;  2ECB A;  1X2N A;  1Q1V A;  3Q0W A;  3RZZ A;  3B6C A;  5M5W J;  2O7O A;  3BG3 A;  4M3E A;  9ANT A;  1R9T J;  3IVP A;  2VI6 A;  2CQQ A;  4DYR A;  2XSD C;  4Z59 A;  4DW6 A;  2PUF A;  2ID3 A;  3Q0V A;  3TED A;  1QP7 A;  1JJ8 C;  4UUT A;  1ZTR A;  2LD5 A;  2DMT A;  2XPU A;  2ME0 A;  1EFA A;  4Z5H A;  2CUF A;  1WH7 A;  1POG A;  4A3J J;  1ADR A;  4I6U A;  1ZZC A;  3RQI A;  3BS3 A;  4XRS G;  3ZHI A;  2PUG A;  2DA2 A;  2LFB A;  3JRI A;  2AXZ A;  3HOU J;  4BXX J;  2B5A A;  2RAE A;  1LE8 A;  2M2E A;  2JCG A;  3B7H A;  1UHS A;  3A03 A;  3OOU A;  5EG0 A;  2DN0 A;  1AKH B;  4IHX A;  2EWT A;  2Y31 A;  3H3V K;  3BT9 A;  1ZKG A;  3JRE A;  2OFY A;  2M34 A;  3HGY A;  4JCY A;  3GTM J;  3G1M A;  1SAN A;  2P81 A;  3TP0 A;  3TRB A;  4HNV A;  4JP0 A;  5F04 A;  2X6O A;  1Z0X A;  2NS8 A;  4A3E J;  2ECC A;  4CYC B;  3QPL A;  1HF0 A;  2H1K A;  2IUO A;  3O8G A;  2W48 A;  2HSG A;  1IC8 A;  3JXB C;  3CLC A;  2L0K A;  5C4X J;  3FK6 A;  2VKE A;  2ME6 A;  1U8B A;  2LR8 A;  2JN6 A;  4A3B J;  3JRB A;  2BNM A;  3F0C A;  2KPJ A;  2DA5 A;  3KZ3 A;  5GPC A;  5DS9 A;  1ETO A;  2YU9 J;  1JKP C;  3KJX A;  3LNQ A;  3GTP J;  3QQ6 A;  1ZZ8 A;  3OQO A;  2HXI A;  4MCT A;  4C3H J;  3QPS A;  1LQC A;  3GN5 A;  1FTZ A;  4CYC A;  5IYC J;  1WH6 A;  2DA1 A;  3BTJ A;  4AC0 A;  3S1Q J;  5FJ8 J;  2GRM A;  2O8K A;  2JA6 J;  2E19 A;  1ZUG A;  1I3Q J;  3KXA A;  2L8N A;  4A3L J;  1IDY A;  2KZ8 A;  2PPX A;  1FJL A;  2KT0 A;  4S0H B;  5IP6 A;  5IYD J;  2N8G A;  5C44 J;  3TP3 A;  4A3F J;  2PUB A;  1GDT A;  1APL C;  5J1R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...