1IC8A

Hepatocyte nuclear factor 1a bound to dna : mody3 gene product
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
190
structure length
170
Chain Sequence
KELENLSPEEAAHQKAVVETLLQEDPWRVAKMVKSYLQQHNIPQREVVDTTGLNQSHLSQHLNKGTPMKTQKRAALYTWYVRKQREVAQQFTHARNRFKWGPASQQILFQAYERQKNPSKEERETLVEECNRAECIQRGVSPSQAQGLGSNLVTEVRVYNWFANRRKEEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*CP*TP*TP*GP*GP*TP*TP*AP*AP*TP*AP*AP*TP*TP*CP*AP*CP*CP*
publication title Diabetes mutations delineate an atypical POU domains in HNF1-Alpha
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 50
structure length 170
sequence length 190
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-03-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1ic8A02
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 1ic8A01
1X2LA 2O49A 5C4XJ 1RZRD 1MH3A 4CYCB 5J1YA 2DA5A 2LR8A 4PU8A 3S1RJ 3RQIA 1QPIA 1RIOA 2CJJA 1FEXA 1QRYA 2EZIA 2N8GA 2L7MP 1VFCA 3LNQA 1PUFB 1JFTA 1UG2A 3ZOBA 3LISA 1X2MA 3CQZJ 2OF7A 2HOSA 1FIAA 1FTZA 1QP0A 2JA7J 4A3EJ 2EWTA 1BDHA 1AKHA 1JUSA 2R93J 3DNVB 3OQNA 3B6CA 2IVBA 3JXCL 3MN2A 2CUEA 3HBLA 4NDLA 4XICA 4BBSJ 2E2IJ 4BKXA 2L7FP 3JRHA 2X6OA 2CQXA 1TWCJ 1R69A 3TRBA 2R92J 2KPJA 2PMZN 3R1FA 4A3FJ 1PERL 4DZJA 4JCXA 3BR2A 1IC8A 3S16J 1RR7A 2LYSA 4A3BJ 4X6AJ 1ZKGA 2GRLA 2LKXA 1UTXA 1LFUP 3EUSA 5F0FA 2R5ZB 2IBDA 5EZGA 1RPWA 5J1RA 3RKQA 3GBGA 3S17J 1FJLA 1GDTA 1ETXA 2HINA 1QQAA 4I76A 1XG1A 2E19A 2LYKA 1MBFA 4DYRA 1IDYA 1QVUA 3TP0A 2X9DA 3HOVJ 3RZOJ 1GV2A 5M5XJ 2MQKA 1K83J 1DW9A 3SFIA 2Y0SN 2QF7A 1RESA 1B72A 5M5WJ 3S2DJ 4OB4A 3ZHMA 5JLWA 3MVPA 2M0CA 5DTDA 2KT0A 4IWRA 2E2HJ 4M3BA 3BR1A 2DMUA 3IVPA 2IAIA 2ECBA 2XRLA 3A01A 1OFCX 1GV5A 1UXCA 2LYRA 1QP7A 2Y2ZA 4A3JJ 3W6VA 1MBJA 3FYMA 2YU9J 3BD1A 3CCYA 4FE7A 3GTKJ 4M3GA 3Q3SA 3GTGJ 4GQMA 3A03A 1T33A 4Y52J 1PRVA 4A3IJ 2DTZA 2L9RA 2NOGA 3FK6A 2RAEA 2GM4A 2JA5J 2M8GX 4X4GA 4YG4A 1TWGJ 3B6AA 2HOTA 2PUBA 2LCVA 1ORKA 1SANA 1FIPA 9ANTA 1NEQA 4O8BA 2EZKA 3ZQCA 2XI8A 2MW8A 4I6RA 2CRGA 2HDDA 1HF0A 1MH4A 5IPAA 2ICTA 4Y7NJ 5E3NA 2FJRA 1JT0A 2Y30A 1QP4A 1MBEA 1JJ8C 1GVDA 2HXIA 2EBYA 3PM1A 5F0CA 4D5CA 2EF8A 4L5EA 4C3IJ 3JRAA 1ETKA 4XRSA 1YRNB 5E3MA 3BG5A 2AO9A 1DU6A 2LYJA 2DMPA 1JGGA 2PUCA 5IOYA 1UMQA 3G1MA 1BL0A 3BTLA 3FISA 2PUAA 1ZR4A 5HODA 5EGOA 1ZR2A 3U3WA 1IG7A 2D5VA 2GRMA 3HOUJ 2G0EA 3K2AA 2NS8A 1JFSA 3CDLA 5GP9A 3LSPA 2R0QC 2L8NA 3LSRA 1I3QJ 3GN5B 3SCHA 2XGCA 3K7AJ 2X48A 1LE8B 2GLOA 1B8IB 4J1XA 1ZZ9A 3JREA 2LY9A 4JX4A 2CQQA 4J1WA 5EEAA 5F04A 3ZQIA 1PRAA 4B3AA 1EFAA 4ABZA 3Q0UA 3F52A 4EEFG 3VK0A 3BR0A 1ZZBA 4IVZA 1W0UA 4FE4A 5EG0A 2R1JL 2VKVA 2XPUA 3IH4A 2VKEA 3LOCA 1BW6A 3IV5A 1POUA 1VI0A 4A3DJ 3JRFA 2O7OA 3FMYA 1MSEC 4UUSB 1OCPA 2EBIA 5F27A 5IYCJ 3QQ6A 2NVYJ 4S0HB 2I10A 4FISA 2LYPA 1HLVA 4PU4C 4I6ZA 1XWRA 3S8QA 3NARA 1S7EA 4BXXJ 1B0NA 2NVTJ 2EZHA 1G2HA 3Q0VA 2PUGA 2L0KA 2A6CA 2LK2A 1PNRA 4RDUA 3OP9A 2BNNA 4YARA 3HB9A 2HYJA 4BY1J 2LTPA 4Z5HA 3ZKCA 2E1OA 3LSJA 3WHCA 2ID6A 1APLC 3KJXA 1XS9A 2IV1A 4Z5DA 1PUFA 3BQZA 5EF6A 1JH9A 1MNMC 3F51A 1AKHB 3F0CA 3H5TA 1ETQA 3BTCA 3Q0WA 1SQ8A 4JX6A 3O8HA 4D7NA 3LFPA 3CLCA 3MKLA 3LSGA 2ECCA 1POGA 3QYXA 1BJZA 2JMWA 5FKOA 3MLFA 4M3FA 2AXVA 1GT0C 5JLXA 2E2JJ 2JA6J 1H8AC 1NK2P 2Y9YA 3O8GA 5IP6A 3GTQJ 2M2EA 3RZZA 2HOAA 4JP0A 4Y42A 1BDIA 2LLKA 3JXBC 4Z58A 2DA6A 2VPRA 3JRBA 2R5ZA 3PXPA 2LP0A 2IUOA 3QF3A 2PE5A 2WV1A 1ZTRA 4AYBN 2JVLA 2EQRA 4I6TA 1RZRA 1LFBA 1HDDC 3G1LA 2YS9A 3SDGA 3D1NI 2VUMJ 4B4CA 3ZHIA 5FLVA 5EYRA 3BG3A 1K61A 4JCYA 1B72B 1F36A 1W0TA 1X2NA 1JTXA 1Q1VA 3L1PA 1QVTA 2K9QA 3BT9A 2CSFA 1F43A 2KEJA 2O4AA 2K9SA 4D5FA 3BR6A 3OOUA 3E7LA 1U9OA 1CQTA 1ZZ6A 2B63J 3GTPJ 1Z0XA 3GTJJ 1RETA 4YG1A 5K7FA 2R5YA 1A6IA 1JKRC 2JCGA 4FN3A 1MBKA 3HZIB 3IH3A 4UUTA 2IVGA 1U78A 3FKIJ 1Y9QA 3S1NJ 2MEZA 1MBHA 1GUUA 2H1KA 4C3JJ 3F6WA 5A7LA 1WIZA 2LFBA 3BTJA 3HEFA 3SJMA 2NVQJ 4MFDA 5F0HA 3CROL 2XB5A 1XC5A 5C3EJ 3I4NJ 1Y1VJ 2DA2A 3HOYJ 1VNDA 3IH2A 2FX0A 2AXZA 4C2MJ 3FYAA 3BR5A 5GPCA 2R7ZJ 4F8DA 2PPXA 3FK7A 1P7JA 1ETWA 2KDZA 1ZS4A 1OSLA 2PIJA 4IEJA 4MFEA 1WI3A 1X57A 4PU7A 2CU7A 1DWKA 2PUDA 1ETVA 4B1RA 3M3YJ 2IVQA 4MLOA 2PUEA 4DZPA 5EDNA 1JWLA 1YRNA 2OPTA 4JQDA 2IU7A 3S1QJ 5M5YJ 4LOCA 5EGOB 3HGYA 3B7HA 3BDNA 3JRDA 3QQAA 2GZUA 3OIOA 4I8TA 4JX5A 2JN6A 2DJNA 1ZZCA 1R63A 1PRUA 2AXUA 4XRSG 4A69C 1Y1WJ 4IHYA 1I6HJ 2K9NA 4DYQA 4FTHA 3PO2J 2NS7A 2AW6A 4GHJA 3H3VK 2M9HA 1IRZA 1MSFC 5IOZA 2MSYA 2DA7A 4XIDA 1AHDP 5K7ZA 5J1UA 5DS9A 2XJ3A 2ID3A 3S15J 3TEDA 2FD5A 2TRTA 4DW6A 4Z59A 5FKNA 5EG0B 1U8BA 1Y7YA 1SFOJ 1UHSA 4M3EA 4YBAA 2DMQA 2DMTA 2WIUB 1OCTC 4CYCA 2TCTA 5EZHA 4X4EA 2B5AA 2BNMA 2OR1L 3TW7A 2JK3A 4X4CA 1IUFA 3H0GJ 3ZQHA 1LCDA 3OQMA 4A3MJ 5FKKA 1IJWC 1JJ6C 1ADRA 2KEKA 1ZZ7A 2L49A 2P81A 4A3GJ 4MCTA 3CMYA 2Y9ZA 2K40A 4V2GA 1AU7A 1ZVVA 3JR9A 2HQ5A 4IA8A 2IEKA 2DA4A 5GPAA 2COBA 5M3FJ 2XCJA 3TP3A 4HNVA 5E3OA 3S14J 1WCMJ 4RBOA 1WH6A 1ZZ8A 5IP9J 4IHXA 3JRIA 2KEIA 4X1EA 5C44J 4W97A 1O4XA 3HKZN 4X4IA 5E3LA 4QIWN 1RZSA 2XPVA 2JJ7A 3KXAA 3GBFA 4AUXA 3UFDA 2PUFA 1R9TJ 1RPEL 3O9XA 2ME0A 1BA5A 1ZK8A 2XB0X 1ZQ3P 4G12A 1JUPA 5K7HA 2NVXJ 1Z77A 1QQBA 4JYKA 4A3LJ 5BNGA 2H8RA 1A5JA 4X4DA 3RZDJ 2ICPA 4A93J 1JKOC 5IYBJ 3OQOA 1IV6A 3G7DA 3HM5A 1H89C 1H88C 1CJGA 1WETA 4X4BA 2GBYA 3WHBA 2OFYA 4M6VA 4BY7J 3ZQFA 3HOZJ 2M34A 5J3LA 3HOWJ 2XIUA 2O9LA 1ZAYA 3S1MJ 1TWFJ 1RKTA 3HOXJ 2JA8J 2ELKA 2XGDA 1DU0A 2MG4A 5IP7J 1BW5A 1ZPQA 2XSDC 4X4HA 3HDDA 3BR3A 2CROA 4A3KJ 3HGGA 3ZQLA 2VI6A 4BBRJ 2CUFA 2DMNA 3A01B 5FJ8J 2LYQA 1VPWA 2QCOA 1E3OC 4A3CJ 2FJ1A 2AUWA 2XGEA 3BTIA 2HXOA 2R63A 1I50J 2Y31A 4IHVA 3FIWA 2AHQA 2LVSA 1ZGWA 1NERA 3QWGA 4M3DA 1HCRA 1JT6A 1WH8A 2R5YB 3QPLA 2BNOA 4MO7A 2KZ8A 2LYLA 1WGXA 1JUMA 1P7IA 5M3MJ 4FCYA 1JKPC 1LCCA 1HDPA 2WB1N 1WH5A 4MIMA 2DA1A 4NDWA 1T56A 3C2BA 2ME6A 3JRCA 1YSEA 1TWHJ 4C3HJ 4W1UA 2AWIA 2XPWA 2EZLA 1ZUGA 4PU3C 2HSGA 3CECA 3PO3J 4MCXA 3M4OJ 3KZ3A 5IYDJ 1WH7A 2BJCA 3A02A 3VPRA 5F1JA 1LQCA 2DA3A 3ZQGA 4V2FA 1TWAJ 1U9NA 3TW6A 3BS3A 1LLIA 1ITYA 2O38A 1NTCA 5FLMJ 2FQ4A 2JWTA 3JRGA 4Z5CA 1ETOA 2HI3A 3BG9A 5FKLA 4QSHA 1HOMA 4XRMA 1EF4A 3G5GA 3SCFA 5C4JJ 1WPKA 3JXDL 3UKGA 1LMB3 4DYCA 3S2HJ 1FTTA 3GN5A 2MGQA 1X58A 3GTLJ 4AC0A 5FKMA 1LE8A 2W48A 1UXDA 1B8IA 3G1OA 3OSFA 4QTRA 3BQYA 3QPSA 4XK4A 4GFBA 5K98B 4IHWA 3GTMJ 4I6UA 2ZB9A 3DCFA 2LD5A 4D7MA 3I4MJ 3OSGA 1VF9A 4J19A 4X4FA 1JKQC 1RKWA 1TC3C 3SCGA 3NAUA 1OJLA 4YG7B 2EH3A 1ENHA 2O8KA 2WAQN 1L1MA 2L7ZA 2DN0A 1IDZA 5F08A 1D5YA 1JTYA 3OMTA 1IGNA 3DEWA 1QPZA 3GTOJ 1NK3P 1MBGA 1ETYA 4FBIA 2YUSA 2WUSR 4UUSA
chains in the Genus database with same CATH superfamily
1MH3A 1UG0A 2OCCH 5J1YA 2DOAA 1T0FA 2LR8A 2QKMB 4PU8A 2HTSA 2R7OA 4ESFA 3E5UA 3RQIA 1S72I 4YEJA 1FEXA 2EZIA 3GZ6A 2KDOA 3AG1H 1VFCA 3WE3A 1Y6IA 4L9NA 2K86A 5TISC 3OMYA 1MFQC 2PQ8A 2M7BA 4BE1A 3LISA 5H6QA 2GIZA 4OINF 2HOSA 4RGRA 2BXZA 1NG7A 2JA7J 2EWTA 2L1PA 1W7PB 4BUPA 1AKHA 1LVKA 3BZKA 4HQEA 3OQNA 3B6CA 3OYFA 4YFNF 2CUEA 3HBLA 2Z33A 4XICA 4BBSJ 2E2IJ 2FOKA 3ZMUA 3TRBA 5LRRA 3ZP5A 1JHFA 5FRMA 2ZO4A 4A3FJ 3M07A 1P6RA 4FASD 3IP4B 2MH2A 1O3RA 2MXDA 1PERL 2XF7A 3F6OA 3F8MA 2EIKH 3S16J 1D3YA 2KKOA 1VQ6I 2LYSA 4A3BJ 4LLGF 1ZKGA 4JBAA 3L00A 4XKBA 4EM1A 1STZA 5ICGA 2Y75A 4L18B 3EUSA 5E20A 3JSOA 2DXIA 5JVGF 2PN6A 2VQHA 5K5OA 3HG9A 3VFZA 4FT8A 3H92A 1MBFA 4DYRA 1QVUA 3RZOJ 3HOVJ 4LIUA 2F5FA 1GVJA 5M5XJ 1K83J 4WVLA 3DFGA 4RAZA 4G6DA 2L01A 4Y3OA 4Y33A 1J75A 2ESHA 3QAHA 3S2DJ 4OB4A 4N4NB 5JLWA 1LNWA 2HVSA 2L4AA 1BI1A 5DTDA 1AOYA 2E2HJ 1U0JA 5CQGA 4MEYF 5HS8A 1FP2A 3H5AA 5FROA 2Y2ZA 2PEXA 1YJWI 2EILH 2QYOA 3E6DA 4RLFA 1USSA 4I99C 2P7VB 5L3CA 3K4CA 1T33A 4XM3A 4Y52J 1T38A 4L0ZB 2CG4A 2L9RA 5D8LB 3FK6A 1WSUA 2E5ZA 4YG4A 3LA3A 2DU9A 3OYHA 3J7AO 2HOTA 1LDKB 1XGMA 3JAMZ 4HYEA 2PUBA 2WY7Q 4UY8I 1KQ0A 3OYEA 1E17A 2H8WA 4EM2A 1FOKA 1NEQA 4E4HA 1GXQA 4EZIA 2LRDA 1YIOA 4I6RA 2QQ8A 5D5XB 2OQGA 1XSVA 5E3NA 1HW5A 2FJRA 2IA1A 1TW2A 2EA4A 3IUOA 2UUZA 5E1XA 4HNUA 1I1SA 2O5RA 3GFLA 3BPXA 5F0CA 2XSJC 4L5EA 1MKMA 1ETKA 2AO9A 4KFCA 2V4JC 3KZIC 2B0LA 1R7JA 3KYCB 4EKGA 2GRMA 3HOUJ 2P0WA 3CDLA 3P9IA 2FQ3A 2XGCA 5HLIA 3GO5A 3H1CA 1YS6A 2LY9A 3CUQA 4JX4A 3GX4X 4EK9A 3L9FA 4RB0A 2ZKZA 5EEAA 2XAUA 1FT9A 4OIPF 3IWZA 3F52A 1RRJA 2L2OA 3BR0A 1ZZBA 4ZZDA 5DYMA 5EG0A 2VKVA 3IH4A 2X6XA 2PLYA 2VKEA 4IQJA 2PJRA 4B8XA 3P9KA 4I7HA 2KISA 5FFXA 2Q0OA 1OCPA 1IN4A 2VJJA 4EGYA 5IYCJ 3QQ6A 2NOJB 1A04A 4I6ZA 5CVIA 4AYBA 2YBDA 2NVTJ 2EZHA 3K4BA 4Q5SF 3NROA 4OWRB 3OP9A 2EIMH 4IJAA 4NC6A 3ABMH 1AA7A 4Z5HA 3ZKCA 2E1OA 2MD5A 4HRIA 2PJPA 2V3CC 1P2FA 4M71A 2VT2A 3OR1C 1AKHB 3HOTA 1ETQA 4BQOA 3OYNA 1SQ8A 2Y0MA 5J4VA 1QU3A 3KP3A 3V7RA 4J00A 2D45A 1B4AA 3RPQA 3MAJA 4JQFA 2ZMEA 2K85A 1ZAOA 2W82A 3TO6A 1XX5A 4XLFA 3IRQA 5FKOA 4M3FA 2AXVA 1GT0C 5JLXA 3J81Z 4FQGA 3OS2A 5JVTA 4CXFA 3NDBB 2Y9YA 1VQOI 2A69F 1P4WA 4IO9F 2DFFA 4CZCA 4JP0A 4AU7A 4WCGA 3S3OA 1FBSA 1MJAA 2LLKA 3BC8A 2IS1A 4XR6A 2R7SA 4JOMA 3K70D 4PJJA 2PE5A 2DODA 5AONA 2M8EA 1UELB 2EQRA 5CKTA 3IRRA 5LEJA 2O8XA 4LG3A 2NVUB 5BPDA 2YS9A 1J7KA 5FLVA 3IL2A 2ETHA 2ZNYA 2HDWA 4JCYA 1F36A 1X2NA 3TO9A 1Q1VA 3O6BB 5L3DA 3L2CA 5BPIA 2CSFA 1ACIA 2BY3A 4D5FA 3OL3A 2LNMA 1B9MA 1DGRM 2QQBA 3CLQA 2B63J 5KCMA 1RETA 2O3FA 3R60A 4YG1A 2QENA 4B3XA 4PGHA 2E5NA 5HVQC 3OYCA 2QZ8A 2V9PA 2IVGA 3F8CA 3QYEA 3CJRB 4KDPA 1IXCA 1T95A 4C3JJ 5A7LA 2PXPA 2E34A 3E5XA 2YU3A 3L2QA 4HNTA 2B7EA 3H3ZA 3I4NJ 3DEUA 3KZYA 4Y17A 3HOYJ 2LLWA 1UHWA 3BR5A 3GLXA 2R7UA 3FYAA 1SD4A 4Y15A 2FBIA 1T6SA 1B9NA 1X57A 1WI3A 4PU7A 1M1EB 2CU7A 1DWKA 1O7FA 3T5XA 3ASNH 1I5ZA 3AG3H 4DJAA 2P4WA 3NEUA 4MLOA 2PUEA 5EDNA 1YRNA 1DQUA 3DP7A 4U0VA 2HYFA 3J7YJ 2IU7A 2RQQA 4UV9A 3GUDA 4I8TA 2V26A 1K7AA 1ON2A 2V1XA 2HNHA 1X3UA 1R71A 2UXXA 1FC3A 2K9NA 3GF2A 4DYQA 3S32A 4KIBA 4LB6B 1CGPA 2O6GE 1KA8A 2EWNA 4KIGA 2FXAA 2DPDA 2PI0A 4K2EA 3H3VK 2FFHA 1OCZH 3L09A 2Q2EB 5GAHJ 3W2AA 5IOZA 3I59B 3PE5A 4XIDA 2XJ3A 5K7ZA 3S15J 2FD5A 2RREA 4Z6YA 2WC2A 4HX4A 4DW6A 2V1DA 1XGNA 5EG0B 4YIIA 2HZDA 2DMQA 3QP5A 4MQ9F 1DPUA 4X4EA 1OCRH 4KA4A 1W5TA 4BEHA 4A3MJ 2QLZA 1U5TA 1O7LA 2AXLA 4PGGA 2V7FA 4PJLA 2HQ5A 2K9LA 4LLLA 5HDKA 1WRJA 2XCJA 2ELHA 3TP3A 3S14J 3VDXA 3S93A 3HHHA 1ZZ8A 5H20A 3LMMA 2BBYA 3CCEI 1PYVA 1O4XA 1IO2A 1O3QA 1IF1A 1YW7A 2I8DA 3QODA 2VC1A 5J6XA 2XPVA 1EV7A 3BLYA 3UFDA 2A5WA 3O9XA 2ZMEB 3CLOA 3E6MA 5HDGA 1ZQ3P 5CVRA 1FBUA 3E5QA 1Z77A 4CCJA 1A5JA 2OCEA 3DPUA 1ON1A 1OYWA 4PCQA 5D4SA 2P7CB 4H4KC 3RCOA 3OQOA 1IV6A 3WTSC 4O3MA 1D1CA 3U9GA 1WETA 2BGCA 3MZ8A 4X4BA 2GBYA 4BY7J 4OU0A 1SC7A 3E1SA 5CJ9A 4CGZA 3PJRA 1T2KA 2K27A 3NWTA 4CCLA 2RNGA 1RKTA 1PJRA 4X4HA 4OIRF 2XXAA 3VYTB 2IGOA 1DGWY 5HLGA 2VI6A 1F4KA 3TKYA 4YRVA 3CCLI 1TLHB 1BC8C 5TGTA 1VPWA 2QCOA 4BYYA 3ECOA 3MEXA 2ZXJA 4IRIA 2PXFA 1I50J 2CQ7A 2DQLA 2ISYA 3ZN0A 3TO7A 2JZYA 3HXLA 3OYBA 2DK5A 3U21A 1WH8A 4IRGA 3F72A 1AWCA 3HUGB 4MO7A 1JUMA 1S7AA 2LNBA 1P7IA 3MCZA 3RPUA 1PVEA 3ZPLA 3SEZA 4RGSA 1JKPC 3S3MA 4MIMA 2DA1A 4AVPA 4BS9A 3QOWA 1T56A 2J5PA 3DKXA 3CD6I 4ZYAA 1YSEA 1TWHJ 4C3HJ 4AIDA 2XPWA 4PU3C 2A61A 2HTJA 4IOAF 3R0AA 2CQKA 3CJTB 3OYGA 3M4OJ 1RR8C 2MFZA 3BP8A 3VPRA 2WAFA 4A5NA 1I27A 1LLIA 4A0YA 5E8IA 1A35A 5DUIA 2R7QA 2MC4A 2RC4A 3KLNA 1UJ8A 2DOFA 3HYIA 2BW3A 4D1QA 2DAOA 3G5GA 1LMB3 2YSRA 3Q9SA 1YW8A 3OYAA 3S2HJ 3V42A 1FPQA 4C30A 1S6LA 4AC0A 3L7WA 2W48A 1UXDA 1Z3YA 5E1ZB 1FP1D 3G1OA 3OIQA 3CJNA 3F9KA 3GTMJ 2ZB9A 1KQ9A 2BY2A 4HDVA 1F9NA 4J19A 3TQNA 1JKQC 2C6YA 3LAPA 3T0YA 3NAUA 3H9GA 1OJLA 4YG7B 2HZTA 3CC7I 4QPOA 4L0YB 1L1MA 1ERDA 2VBZA 4PUSA 1FYKA 2WV0A 1JTYA 1QPZA 1NK3P 2HU9A 3MKYB 3NZLA 4OAYA 2RGVA 4UUSA 3IAM2 5IT9K 1X2LA 5HLTA 3WTYC 2KZGA 4RAYA 4F52A 3SXYA 1FYMA 3QYFA 4Q47A 2DA5A 3KP2A 1V5GA 3GEZA 1QPIA 1Z21A 1JI8A 1LEAA 3GZDC 1Z67A 3M9LA 1OPCA 4BJ6C 2D1VA 1U5TB 1PUFB 2EPFA 1UG2A 3ELKA 3ZOBA 4NC8A 1X2MA 2MLKA 1FLIA 2NNNA 1H9GA 3CO7C 1Y8RB 4UVAA 1TP4A 2ISZA 1JUSA 4HSRA 4XLAA 5TRDA 2IVBA 4X0GA 1V5EA 2ACJA 3JRHA 3FWEA 2CQXA 4WF2A 2ODRD 2VQGA 4UXNA 2PMZN 2XGXA 3PNYA 4A0ZA 2KPJA 4GRIA 4PSWA 2H6CA 4DZJA 4JCXA 3CCSI 3H5RA 3ZGKA 3ISPA 2LY2A 2VKHA 5IY5H 5J8CA 4HLYA 1LFUP 5EZGA 2Q1ZB 1BBYA 1E0EA 4XLEA 3WG9A 3GBGA 2X1DA 4ZC3A 3S17J 1GDTA 1ETXA 1MMAA 4I76A 2Y69H 1XG1A 2E19A 2LYKA 1U2ZA 2LH9A 5FLXZ 1G3SA 4OBMA 2MQKA 3BJOA 1E2XA 1QBJA 1HKQA 1R36A 3Q9VA 3ZMZA 4FETA 4BXUA 5M5WJ 2AQEA 1FOXA 2E71A 4A2UA 2M0CA 5D5VB 2FU4A 4RAFA 3ABUA 2JA2A 2KFDA 2ECBA 2XRLA 3A01A 1U8RA 1GV5A 1UXCA 2LYRA 2JT1A 3C7JA 2CH0A 3W6VA 2MC3A 3BD1A 2H1LA 4M3GA 3Q3SA 3X2QH 3GTGJ 1OQYA 3VODA 3A03A 2A07F 4GQMA 3H0DA 1PRVA 3DBHB 1TTYA 2HOEA 4II3A 1J09A 3K69A 4CA0A 5LHIA 4GO1A 3FXJA 2L9VA 2GM4A 2JA5J 4X4GA 2M8GX 1QZEA 1BN5A 1L0OC 3B6AA 3I64A 3L2RA 4IPAA 4RGUA 4XORA 3EUHA 5CVUA 3A9ZA 1ZHFA 1ORKA 3HHGA 2W1OA 1OYYA 5A2QK 9ANTA 2Z9OA 1FSHA 3ZQCA 2MW8A 2GAUA 4RM2A 3G6EI 2HDDA 2F2EA 4LIVA 4E6KG 3KP5A 1HF0A 3T1BA 1N78A 5IPAA 2DDBA 2XAQA 4LJZF 2CWEA 2HKXA 2VE8A 4HZFA 1QP4A 3UWPA 3CDIA 2HXIA 1K79A 4M6XA 2EF8A 4C3IJ 3KETA 2ZCWA 5E3MA 4BHCA 2DMPA 2PUCA 3G1MA 1BL0A 3FISA 5DCFA 5LHHA 1ZR4A 5HODA 2CUJA 5EGOA 1ZR2A 1NH3A 5LHGA 2D5VA 5ICCA 2G0EA 2IJLA 3CF2A 5GP9A 4F93B 1YG2A 3K7AJ 1VQLI 3FXRA 2DOEA 3DEEA 3VEPA 1K6YA 4DQ2A 2GLOA 3JREA 1GXPA 4J1WA 2PXVA 2M30A 5K5QA 1DP7P 3VK0A 4NQWA 1WJEA 5BMZA 3VWBA 4RA2A 4HSTA 4FE4A 1OR7A 2HS5A 4E7HA 3G4SI 3LOCA 1POUA 3F21A 4A3DJ 1HSJA 4HPQA 3JRFA 3FMYA 3RKYA 4YIFA 4UUSB 3MKWB 1HW2A 2XASA 1WFXA 1MDMA 5GADJ 4EGZA 2NVYJ 4FISA 2LYPA 1HLVA 4PU4C 5ILSA 1XMKA 1S7EA 3LA2A 4CCOA 1B0NA 3PNTA 3Q0VA 2A6CA 1PNRA 4RDUA 2RVCA 3OYMA 2FBKA 4YARA 3BJAA 3GZNB 2ZJQF 2F4OB 1BI2A 3WTXC 3AG4H 1APLC 3MQ0A 4CSWA 2OZ6A 3BQZA 2X0LA 3KE2A 4G9YA 2V6CA 3N4MA 3F0CA 4A12A 3BTCA 1JHHA 3G2BA 4JX6A 2H6BA 5DUKA 3DTKA 1XCBA 4PJ0C 1BI3A 1X1AA 2X1CA 2PXBA 5KNLA 5CVVA 4XOPA 1QZZA 2K3FA 1BJZA 3OY9A 2JMWA 3MLFA 4BU2A 1Z6RA 1Q1HA 4HV5A 2M2EA 3LAJA 4MHGA 5F1RA 1HC8A 2A3SA 1BDIA 1MW7A 4XNFA 3K4MA 3OYLA 1P4XA 1SFEA 4NUBA 4N4OB 2R5ZA 2IUOA 4GGGA 2P6TA 3PUBA 4AYBN 2JVLA 3QOXA 4I6TA 2YR2A 4LG0A 3ERED 1X19A 3LL7A 4OMYA 3SDGA 2XUBA 4ASNA 3ZHIA 2HCNA 4EATA 5EYRA 2NNYA 4BAYA 4E7IA 2W84A 1W0TA 1S5LC 4S05A 1G59A 3L1PA 3BT9A 5DCMA 3F23A 2O4AA 4HA8A 2R7RA 4HDUA 2L5QA 1U9OA 1A36A 3W3CA 4FX4A 4XSXF 2KIQA 3F22A 2MABA 4WWCA 5K7FA 4M73A 4FN3A 2HR3A 1H9TA 1VQ5I 4G6QA 3FHZA 3LSHA 2G7HA 2WTEA 1U78A 4XQFA 2HDCA 3S1NJ 3V8KA 2H1KA 1WIZA 3I0TA 5GAGJ 3BCAA 4I09A 2CSOA 3G73A 1Y56A 3G3ZA 2DBBA 3HEFA 1WHUA 2M45A 2OZUA 2NVQJ 2P6SA 2XB5A 4ETSA 3ASOH 2GOXB 2K3PA 3HRMA 2DA2A 3J80K 1VNDA 3IH2A 4KMFA 2BHZA 2JVHA 3WG7H 5GPCA 1FY7A 3FK7A 3I54A 4GXOA 3H35A 1XSDA 1ETWA 2IVMA 4IL6C 1KU7A 1ZS4A 2A5YB 2PIJA 3F6VA 2F5DA 1XN7A 2NAZA 3TOAA 5D6FA 3M3YJ 1YI2I 4DZPA 2FNAA 5CQEA 3F8FA 2V6EA 3WTWC 5M5YJ 5EGOB 3BDNA 4A0XA 1YFHA 1D5VA 4ESBA 3KIOA 2XKPA 1G3TA 3DU6A 4JX5A 4UV8A 3HSEA 2I5UA 1IV8A 2Z3YA 2ZSIB 1RUNA 1PRUA 3A2KA 2E1MC 2W57A 1RUOA 3PO2J 5D5WB 4EM0B 4YFKF 4QPQA 3GZCA 2M0MA 4CCMA 4IX7A 2PXKA 3CMMA 2MH9A 2DA7A 2E1NA 2PG4A 3FX3A 4NQWB 2JRMA 5J1UA 5DS9A 2CFOA 1BI0A 4I02A 3TEDA 2TRTA 3G71I 1SAXA 4E70A 2CV0A 1BIAA 1U8BA 1Y7YA 1G4DA 2ADUA 3ECHA 2KP6A 5E18F 2DMTA 3DM5A 2FSWA 5EZHA 3TW7A 1MDMB 4N9HA 1VQKI 4YFXF 4WXCA 3C3WA 5CLSA 1VZ0A 3H0GJ 4UB8C 1Z9CA 3HSRA 3AAFA 5FKKA 1ADRA 3HJEA 3LSTA 1SMTA 4CZZA 4L5JA 2P81A 1IAWA 4A3GJ 2PXEA 2DT7B 4P96A 4V2GA 3GVAA 2XIGA 2ZFUA 4NB5A 3M1CA 3JR9A 2XXQA 4RB1A 3BJ6A 2COBA 2M4GA 2RDPA 4IQ4A 1OLTA 4KIFA 3OR2C 5IP9J 3ZXSA 2R7VA 1IW7F 1R23A 4X1EA 4BJ5C 4W97A 2EK5A 5E3LA 4XONA 1IUYA 2ZXHA 2GIVA 1N25A 3QU6A 2QSGX 3QP6A 3SZPA 1UHMA 3CCUI 1R9TJ 1USTA 4F92B 4BDYA 1RPEL 5JR3A 3DV8A 1BA5A 3K10A 4XBFA 2R7XA 4G12A 1QQBA 5K7HA 2HWVA 1MMDA 3IAS2 3T8RA 5BNGA 2JPBA 5ED4A 2H8RA 2VOOA 1D8KA 1D0XA 2ICPA 2A6EF 1RNLA 1R4MB 1H89C 3I3LA 1H88C 1WVRA 5HLHA 3V7CA 3AL0B 4KYWA 1WJBA 3LWFA 4B48A 2M34A 4HW0A 2WAEA 3HIFA 5J3LA 4BE0A 2O9LA 3CCQI 1TWFJ 1X3ZB 5J47A 1R1TA 3BR3A 3ZQLA 1KZHA 3OYKA 1E3HA 1DUXC 4KITB 5ILVA 4I98B 1KU3A 3I9V2 3CCVI 1SMYF 2FJ1A 2WY8Q 2XGEA 3LSMA 2HXOA 2R63A 3JAMK 4IHVA 2FOWA 3GZ5A 1YHQI 1NERA 1PP8F 3I5UA 2KMUA 5FRNA 4HF2A 2LBFA 5J4YA 2EFNA 5L3GA 2LYLA 1ZELA 2HKOA 2JRTA 5K5RA 2LKPA 4F3QA 4OIOF 2DTRA 5ERIA 4CUGA 2WB1N 3HTSB 5HNHA 2ME6A 3JRCA 4FHTA 4PZJA 3OYJA 1TNSA 3P9CA 1OISA 2AWIA 1ZUGA 2EFOA 4EJUA 1IRXA 1LJ9A 4MCXA 5IYDJ 2BJCA 4TV7A 3RSNA 3A02A 5BQTA 3DTEA 3ZQGA 2W25A 4V2FA 1TWAJ 1U9NA 1QNTA 2JSCA 1MJ9A 2BYVE 2O38A 1HSTA 2YPRA 2XRNA 1HKSA 2FQ4A 2FF4A 2JWTA 2Y48A 5FKLA 3BG9A 2BV6A 2CV2A 2STTA 2ICWG 1G3WA 1JXSA 4XRMA 1EF4A 4G8XA 4R1HA 4IXAA 5C4JJ 3FM3A 4RGXA 3UKGA 3F8BA 3VSLA 5KVRA 1FTTA 2P5VA 5KHDA 2CFXA 5HOOA 3GN5A 1X58A 4HX8A 3CUQB 1O3SA 2CMPA 3GTLJ 2VASA 5FKMA 1B8IA 4QTRA 3QPSA 5K98B 4XK4A 3IC7A 3CCMI 4IHWA 1R1UA 1QO0D 3OWQA 2IW5A 3KYDB 3LQXA 2RN7A 3C18A 1RKWA 1QHGA 1TC3C 3SCGA 1TT0A 3V4GA 4ESJA 1I39A 2EV0A 2DJIA 2BY1A 2PMHA 5F08A 2PJRB 2R7WA 3QPTA 3DEWA 1IGNA 4KN7X 2HFZA 1MBGA 2EIJH 1ETYA 4QWQA 3W6KB 3NQOA 3K1NA 1W36C 1MMSA 2WUSR 1GLNA 3MZYA 3I56I 1VQPI 1JE8A 1RZRD 5DEQA 3ZN1A 4EV0A 1UCRA 4ENJA 2L3DA 1W5SA 1R6RA 3S1RJ 1RIOA 4HLXA 1IN5A 2CJJA 5GTIC 3E6CC 2N8GA 3H9QA 1JFTA 4Y4RA 3J81K 1TQIA 4A3EJ 2HQAA 1BDHA 3IKTA 2WBMA 2ZNZA 3RDIA 2R93J 1N75A 3DNVB 3TBIA 4BHPA 2QVOA 1FNNA 3RKXA 3JXCL 1R22A 2BZTA 4NDLA 1IXSB 4XSZF 1FBQA 2L7FP 1Y39A 1TWCJ 3MWMA 2F5CA 1S9HA 1WJDA 3DU5A 3ZRGA 3R1FA 1EH8A 2KIMA 1WZ2A 1K6OA 4ER7A 2DYRH 2W7NA 3BR2A 2UZKA 1IC8A 1RR7A 1K4SA 2WB1A 3EYYA 4MGRA 4X6AJ 1RC9A 2JQEA 4L9JA 3O2PE 3WE2A 3V8JA 1UB9A 3RKQA 1U2WA 4ZJZA 3M1EA 3CCJI 1FJLA 1T39A 1QQAA 2HINA 3TEPA 3DWLE 2OD5A 2IA2A 2PXUA 2L4MA 1Z6TA 5DDGA 1Z7LA 3EDPA 4F91B 4U0YA 3I53A 3TP0A 2X9DA 4ZYHA 2M4HA 1YX5A 3E97A 1GV2A 2DW4A 3MZHA 4RS8A 4B43A 2V9KA 2QF7A 4BDZA 4M9XA 4XN3A 1RZ4A 1B72A 2FBHA 2CGPA 1L3LA 4KISA 3FHNA 3MVPA 3WTVC 3RJPA 1WJFA 4M72A 3S2WA 2GA2A 3GYHX 1WWXA 1ZH5A 4DOZA 2XAFA 2DMUA 3IVPA 4UB6C 4DNCA 2IAIA 2CUZA 4LD5A 3FXKA 4IOCF 2ZSHB 4PJNA 2K5CA 3R4KA 4A3JJ 3FYMA 3CCYA 2VC0A 2LBFB 2DFEA 4ZYDA 3H36A 5E17F 1ZRCA 4A3IJ 2DTZA 1ODDA 2NOGA 2OTLI 2HFHA 2LMDA 4P5OA 4BQAA 5GAEJ 1MMGA 4PK4A 1FIPA 1J59A 1NHAA 1YITI 1Y0UA 4E7ZA 4NHJA 3QFIA 4XMYA 2EINH 5TJJA 4XLPF 2V1UA 2FEZA 4L9TA 1JT0A 2Y30A 1MBEA 2DYSH 1GVDA 2G7UA 3PM1A 1R5HA 1HKTA 1MD0A 3DPLC 1YRNB 3BG5A 1DU6A 1ZN2A 3DPTA 3AKZA 2VT3A 3BTLA 3EPZA 1W7PD 1JGSA 3BG7A 1IG7A 3U3WA 1G3YA 3GCMA 3D5SC 3K2AA 3U2RA 2NRAC 2NS8A 1JFSA 2R0QC 3LSPA 3GN5B 2VB6A 3PSIA 3DLLF 1I3QJ 4UVCA 3SCHA 5DRTA 2X48A 2JVGA 2Z16A 1B8IB 3RIRA 4J1XA 2V79A 4XN0A 1ZZ9A 2UXNA 3K4LA 3RYRA 2XV4S 2CQQA 4I0BA 4AD9A 5L3FA 2KIUA 3REOA 3DTIA 3ZQIA 1Y0NA 5LRSA 4ER3A 2DFIA 4B3AA 1EFAA 2DLLA 3Q0UA 2P5KA 2IT0A 1SFKA 3I4PA 4EJWA 5E79C 4FX0A 3ZQQA 4WXDA 1W0UA 1ZG3A 4L9VA 4CCKA 2VQCA 3IV5A 1VI0A 1IN7A 2O7OA 1MSEC 4EVIA 4BEHB 1HW1A 1LB2A 2OTJI 2FUG2 3SFZA 4S0HB 1YQAA 2M3AA 4CICA 3J7AY 1XWRA 4BXXJ 1LFPA 3W2VA 3S3NA 2J7UA 4E7LA 2L0KA 2VKDA 3D5RC 2LK2A 1VQ9I 4KICA 2BNNA 1D0ZA 1TBXA 3HB9A 1TNTA 5HDNA 2HYJA 2LTPA 3LSJA 4M9SA 3WHCA 4C2TA 2WA0A 2KIFA 5EF6A 3WTUC 3BCBA 1MNMC 1FMVA 1QZXA 1OR7C 1T0FC 2W24A 3O8HA 4D7NA 3LFPA 2XAHA 3CLCA 3MKLA 2IGMA 4Z2YA 3D0SA 3UNGC 2ECCA 4WK8F 3GFMA 3KP7A 1POGA 2XROA 1ZYRF 3HTUA 1ZRDA 3FXMA 2VJ5A 5LEKA 2NS0A 1S3JA 2BEOA 4WX9A 2X51A 1H8AC 1NK2P 3LSIA 3TELA 5DTMA 3RZZA 1QPMA 2HOAA 4EKIA 1LDDA 2HQNA 4G7HF 3OIPA 1T98A 3JXBC 2DA6A 2VPRA 3JRBA 1VQ7I 4KNYA 2LP0A 2XKOA 2OAZA 2WV1A 3U1KA 1VQ4I 1LFBA 1HDDC 2CW7A 3G1LA 1HQ1A 1LDJA 3ZMVA 3D1NI 4MNUA 4U7BA 3P7NA 4B4CA 1K61A 3BG3A 1FWZA 4I01A 3OYDA 1B72B 2VBXA 2ZXWH 4XLHA 3OWTA 1B59A 2J7WA 3K9TA 5GTHC 1H0MA 2GA1A 1XSXA 2PMUA 3E7LA 2P5LC 4IZZA 4R79A 1F5TA 3GTPJ 4CYDA 2Z1DA 4CHUA 2MYSA 4ZDPA 2VE9A 5IT3A 2KL4A 3MD2A 2QUFA 2KLOA 5JHUA 2R5YA 1HQCA 1A6IA 2JCGA 2R7TA 3HZIB 3ROUA 3IH3A 1X1DA 1S29A 2MEZA 1XB4A 1MBHA 1GUUA 3F6WA 1KU2A 1V4RA 2PXLA 1K4TA 2DI3A 3B73A 2WADA 2LFBA 5B5EC 2R4GA 3RI4A 1D8JA 5F0HA 3WU1B 1KGSA 3CROL 5AIQA 1XC5A 5C3EJ 3BY6A 1YLFA 1P9QC 4OMZA 2E7WA 2FX0A 2VQLA 2ZJRF 5JI6A 4MEXF 2AXZA 5F6FA 2KRHA 1BM9A 4B44A 4MTDA 3MKZA 4M74A 1ONVA 3BOQA 2GXBA 3LQRA 1Z1DA 4LB5A 4IEJA 3SR4A 2IPQX 3BZ6A 2BW3B 2Z99A 4NBQA 2OJED 2PUDA 1ETVA 4B1RA 2IVQA 3OL4A 3G0TA 2VJIA 2MD0A 3L2WA 2BHYA 1MMNA 2OPTA 4XKVA 3S1QJ 5LBQA 4OAZA 3A0HC 3HGYA 4PSXA 3ABKH 3JRDA 2GZUA 3OIOA 3TGNA 3GWZA 2JN6A 2DJNA 2HPIA 4CO8A 4RMNA 4XRSG 2L9SA 1HXDA 4A69C 4BH9A 1I6HJ 1R5GA 3VB2A 4FTHA 2CW0F 1I6XA 2NS7A 4LITA 1RI7A 2TDXA 2M4KA 1NG6A 4GYIA 4ITVA 4HRAA 2DDAA 1MSFC 2MSYA 2F5EA 3IWFA 3M8EA 4BXFA 3GZDA 4C2UA 1AHDP 3PQKA 2KRFA 1X1CA 1OCCH 3U1DA 2ID3A 4WXHA 2VPLA 3WTTC 1ZG1A 1WQ2A 2QQ9A 1QB2A 3K6GA 4BGDA 2R3SA 1SFOJ 3C2HA 4M3EA 4YBAA 4H0EA 3CUQC 2CV1A 1OCTC 2WIUB 4CYCA 1XDUA 2TCTA 1O3TA 3SZTA 2LSOA 3SQNA 3MFKA 1A6QA 1DP3A 5K1YA 5B3SH 2B5AA 1XMXA 4EJVA 1BR1A 2JK3A 2ZC2A 2YX7A 3SDBA 3ZQHA 2WWYA 4X4CA 3OQMA 2BOLA 4XKCA 1JJ6C 4HOBA 2KEKA 2L49A 3LFKA 4MCTA 2Y9ZA 2K40A 3EUAA 1AU7A 5DTQA 4N0BA 4HV6A 2EB7A 1XDSA 1QGPA 1YW9A 3FBIB 4IA8A 3BPVA 1TT5B 4HNVA 5E3OA 1WCMJ 3HC7A 4RBOA 2XC7A 1WH6A 3A9YA 4IHXA 4NC7A 1XGOA 4C9YA 4O6JA 3FMQA 3HKZN 1S8NA 3HOSA 1J0RA 4QIWN 5B1AH 3JTHA 1FX7A 4XL9A 2UWMA 1YX3A 2JJ7A 3KXAA 4AUXA 2QSHX 5FLXK 3QPHA 1ZGJA 3KEOA 2XXPA 1SFUA 2JTVA 1SEUA 1W4MA 3HRUA 3ZMSA 5DSXA 2XB0X 1WJ5A 2GOMA 2NVXJ 5GAHi 4JYKA 4A3LJ 3A9XA 2QM3A 2LF7A 3K2ZA 3LFUA 4X4DA 2H09A 3RZDJ 1HBXG 4A93J 2J5OA 4KUMA 1JKOC 3GUUA 3QU3A 3RYPA 3FMSA 1CJGA 4ANJA 4AVZA 2OFYA 4ZDLA 2VOPA 3HOZJ 4GYGA 3KP4A 2IS6A 1GHCA 4B09A 2ZMEC 2XIUA 4RAGA 4KN4X 1ZAYA 2GXAA 4P55A 3HOXJ 4ZYGA 2ELKA 2MG4A 2QGUA 3GMEA 5ICEA 5IP7J 2XSDC 3HDDA 2O61A 1BW5A 4A3KJ 3ABLH 4XLNF 2CUFA 2DMNA 2MA3A 4HAMA 3PIOF 3A01B 2BY0A 3BZCA 2PXTA 3DXJF 2VBWA 1E3OC 2STWA 3M8FA 1WKMA 2AUWA 3LA7A 1U3EM 1ZRFA 3JCUC 4YELA 2Y31A 1ZLKA 4PJMA 3I55I 3FIWA 5DRYA 2AHQA 4LK1F 1ZGWA 3QWGA 1XPXA 4M3DA 2JUCA 3ME5A 4KT6A 1RIOH 1JT6A 1Z7UA 2R5YB 4F55A 2BNOA 3PFYA 3BROA 4BACA 1LEBA 1WGXA 2OQRA 5KAIC 4ENMA 3J7ZI 4G7ZF 2FE3A 1LCCA 4FCYA 1BOBA 1QHHD 3EETA 4EQZA 3NXHA 2CYYA 3C2BA 4NDWA 3K4JA 2CQNA 2PXDA 2BE5F 1G8XA 2WAQA 4W1UA 2HSGA 3V7SA 1R1VA 4QLCU 5F64A 1B1BA 2RV8A 4RM3A 2HPMA 3PO3J 2D2WA 3KZ3A 4DBRA 4ENNA 5D8KB 3H3UA 3K1PA 1BIBA 5CYVA 2DA3A 3TMOA 3TW6A 5LLQA 5DT2A 3GFJA 2VBYA 3I58A 2K9MA 2DK8A 5FLMJ 5B66C 3E6BA 3CDHA 3IHUA 2HI3A 4LMYA 4Z5CA 2VXDA 4QSHA 2FA5A 4MTEA 1HOMA 3CMAI 3M9AA 5JUWA 1LPQA 3SCFA 1WPKA 3JXDL 4EMSA 4DYCA 3CF5F 1QA6A 1D1BA 1LVAA 4E7KA 5EJCA 2IA0A 2E36A 1UZCA 3HKZA 1LE8A 4MQVA 3SEQA 1J2XA 3BQYA 2QWWA 3K70C 2CW8A 3DCFA 3NWSA 1V55H 3CESA 3I4MJ 3FF5A 4B47A 5L3BA 1VF9A 2VLAA 2XDVA 4X4FA 1FSEA 4BL0B 1V3FA 3VYRB 3QWLA 3RQ4A 2EH3A 2O8KA 3PIPF 4J01A 1OYIA 3C1DA 2L7ZA 2DN0A 3WU2C 4U87A 2Q2EA 2KHMA 3S8PA 1D5YA 3OMTA 2L02A 3I59A 3GTOJ 5J40A 1EA3A 5EEGA 3SZGA 3TOBA 4U7DA 2YUSA 2EV5A 2XF6A 1T08B 3FMRA 4U0WA 1ZARA 2O49A 1S7OA 5C4XJ 4CYCB 1YS7A 1Z05A 3KFWX 4LLNA 3FZVA 1OKRA 3EQLF 3GLLA 2X6YA 1QRYA 4IKFA 5D4RA 2L7MP 4Q2JA 2QA4I 3CJQB 3W6JB 3LNQA 1X1BA 3CQZJ 3T8TA 2OF7A 2EFQA 1FIAA 1J9IA 2XAJA 1FTZA 1QP0A 3DKWA 4Q48A 1YJNI 5AIPA 5D5UB 1R00A 3TDUC 4UNOA 4AM3A 3MN2A 3OKZA 1MNDA 3ZMDA 2DT6A 4LFUA 4BKXA 2X6OA 2H27A 1R69A 2R92J 2QSFX 1U5TC 1KYZA 4II2A 3TFLA 5LFAA 3RTRA 1TW3A 2ZFWA 2IS2A 3OS0A 3H5NA 4A6EA 2KPMA 4ZDOA 3JW4A 2GRLA 1R4NB 2LKXA 3M8JA 1UTXA 1FZPB 2KRCA 5F0FA 2IBDA 2M7AA 2R5ZB 2AS5F 1RPWA 3DBRB 3C2GA 5J1RA 2OC6A 3OYIA 4LG0B 1A31A 2MLGA 4KT5C 4N9IA 2O0YA 2ZXIA 3WU0A 2ELJA 1IDYA 2NXNB 1N77A 1W1WE 2RKHA 1FMWA 4IHSA 1DW9A 3SFIA 2Y0SN 2VL8A 5E1WA 4A6DA 1RESA 5BOXA 4G6TB 4P9FA 5CVJA 2G9WA 3R09A 5DCMB 3ZQ7A 4G7OF 3ZHMA 1U6GA 3TDZC 4BHBA 1XMAA 3BDDA 4U88A 5B1BH 2KT0A 4IWRA 4M3BA 1XGSA 3BR1A 1DULA 4ON0A 3L2UA 2GQQA 1BJAA 1ZLJA 1OFCX 2JSPA 3R6SA 2QEXI 1QP7A 3KP6A 1V54H 1MBJA 4BNCA 5FD5A 1ZGAA 2YU9J 2VIXA 1P92A 2LC2A 4FE7A 3GTKJ 2X6WA 3UR3C 2LDUA 1KYWA 3GFIA 3ONQA 2BVLA 2RAEA 3HUGA 2KQRA 1TWGJ 5LD2C 3FDYA 5FD6A 3VSKA 2OV7A 2LCVA 1SANA 3FXOA 3JTGA 4O8BA 1QZYA 1V5FA 2EZKA 3VWSA 2XI8A 3DKYA 2CRGA 2HQRA 4XKWA 1E3PA 1LKXA 1MH4A 1XD7A 2M1BA 5CPRB 4Y7NJ 2LY1A 2K02A 2ICTA 5DTRA 1J5YA 4IVNA 4XRFA 1JJ8C 1F1ZA 3N05A 2EBYA 1R5ID 2O03A 3SYTA 4D5CA 3JRAA 4XRSA 3F3XA 3M7GA 1KU9A 4UHTA 1BC7C 2LYJA 1YIJI 1JGGA 3R0JA 3FXUA 1UMQA 5IOYA 2LYCA 2IRFG 3ERMA 2PUAA 3PQJA 2R7DA 1SFXA 4S04A 1DDNA 1NW3A 2W85A 3CTAA 2L8NA 1SVOA 3LSRA 2QQAA 1X3WB 2V1NA 2HVQA 2X85A 3DF8A 1LE8B 1SD6A 1Z91A 1O57A 1G6NA 2V9VA 4P9UA 4XOTA 1KQ8A 3TL4X 5F04A 1PRAA 5DV5A 2X1EA 4DIQA 2A6HF 1ZREA 2JQ7A 2K7LA 4ABZA 1SVLA 4GCVA 3E3VA 3GW2A 4EEFG 1VQNI 2BXYA 1TZLA 4IVZA 2Z2SB 3HZJA 2XPUA 2R1JL 1MIJA 2OR1L 3CP2A 1BW6A 1I3AA 3V8LA 3K4NA 2P8TA 4RLQA 2EBIA 3HRTA 5F27A 1ZG5A 4ZTJA 3CC4I 3HSFA 5H6RA 4EJOA 2I10A 3SX0A 1X1PA 4D9JA 2F4IA 2Y0SA 3NARA 2AQFA 1G2HA 2PUGA 3Q5FA 1DPRA 4HQMA 1FOYA 3AFHA 5DM7F 2OUMA 4BY1J 1YYVA 1SD5A 3KJXA 2ID6A 1XS9A 2IV1A 4Z5DA 3KX2A 4HEA2 4A5MA 1X4PA 1PUFA 2QBYA 1JH9A 1PUEE 2L9NA 5H2FC 5IT9Z 3F51A 1B6AA 1YTYA 1PDNC 3H5TA 3Q0WA 5ICFA 3COAC 3O3KA 2IS4A 3LSGA 4PFOA 4Y13A 5HS9A 2IGNA 3RPUD 3QYXA 2W4SA 3VYSB 4DGWB 2VODA 3KYLA 2IGKA 3WTZA 1YO5C 2E2JJ 2F5VA 2JA6J 1SD7A 3HPHA 4I2OA 3O8GA 1K78A 3KZZA 5IP6A 3BWGA 3GTQJ 3CCRI 4Y42A 4DE9A 2H94A 4DE8A 1SAUA 2VN2A 4BE2A 4Z58A 3PXPA 3QF3A 4HG2A 1ZTRA 5FO5A 2BVMA 1RZRA 3QRFF 1BOAA 2FNPA 5LGTA 1IN6A 1VQMI 3A0BC 5EEHA 4R8HA 3CO6C 2D1HA 2VEOA 2VUMJ 1WI9A 2QKLB 1KONA 4M9ZA 2XVCA 1EH6A 1XCVA 1JTXA 2CS3A 3FBNB 1W36D 1QVTA 2K9QA 3ULQB 3MMYB 4AIKA 2ZJ2A 2A68F 4IF4A 1F43A 2KEJA 5FFZA 2K9SA 1EJ9A 3BR6A 3K4KA 3OOUA 1CQTA 2DQRA 2HGCA 1ZZ6A 4ER5A 4P1WA 3VOEA 1Z0XA 3GTJJ 1QQIA 2F6CA 5D6EA 2KJBA 3ZR8X 5ILUA 5FB2A 3P5JA 2K4JA 2PXQA 1JKRC 1HA8A 1MBKA 2LG4A 3GXOA 4UUTA 4YG2F 3MEJA 3FKIJ 3PFIA 3PL8A 2VJ4A 4LK0F 4AIHA 1Y9QA 1Z3XA 2IP2A 3B02A 1X4OA 2IXSA 1VTNC 2LOOA 3BTJA 3HPGA 3PSFA 3SJMA 3KPHA 4MFDA 1YJ9I 3WGGA 4ER0A 1Y1VJ 2K4BA 3CUOA 1EKEA 4O5VA 3ZMTA 3QOEA 1TL8A 3FM5A 3FXLA 4C2MJ 2R7ZJ 4F8DA 2PPXA 1Y8QB 1P7JA 2KDZA 2PX9A 4ZZLA 2FRHA 1OSLA 4MFEA 1IRFA 2E1MB 3QYBA 3EUHC 2ZBKA 2XF5A 3W2WA 4DBQA 3CC2I 1D0YA 5A2QZ 1JWLA 4JQDA 5DD4A 3BG6A 1ULYA 2KJCA 4LOCA 2FMYA 3WGIA 4ZTFA 4HF1A 3B7HA 3QQAA 5J8FA 4UUVA 2E7XA 2FMLA 1CF7A 4LGWA 1ZZCA 1UAAA 1R63A 2AXUA 3SHFA 1Y1WJ 4IHYA 2HEOA 3E0JB 3A4CA 4KMUX 3L2VA 2DFHA 4BJTA 2AW6A 4GHJA 3K0LA 2M9HA 1IRZA 2MBFA 2KZVA 1SVMA 3F8NA 1YE9A 2XAGA 3DLAA 2EFPA 1LQ1A 2E60A 2LREA 3CMEI 5GAGi 4Z59A 2PBIA 2A6TA 3HRSA 3ESWB 5FKNA 3ML6A 2L54A 1UHSA 2PFBA 4XLCA 4CH7A 3H9JA 2GXGA 2BNMA 5E8GA 3K1MA 4EJTA 2DCEA 1IUFA 1LCDA 1IZ1A 1IJWC 3I71A 1ZZ7A 1FYLA 4V19K 2CO5A 3WGHA 4ZYEA 3CMYA 1T8IA 1WJCA 4G94A 2LKSA 1ZVVA 5JHFA 2ESNA 3OS1A 2IEKA 2DA4A 2NYXA 3R61A 5GPAA 5M3FJ 2VONA 2ZJPF 1W7PA 3NRVA 3DQVC 2F4MB 4I0AA 5HS7A 2QBYB 1TQPA 4IRHA 3JRIA 4ZH4F 2KEIA 5C44J 4EQQA 1IXRC 1EH7A 4PDKA 4X4IA 4YIRX 3PUFA 3KEYA 5LGUA 4BQQA 1RZSA 3GBFA 2PUFA 3N97A 1IN8A 4E7JA 2B9SA 1C0WA 2ME0A 3CZ6A 1ZK8A 1JUPA 4BQNA 3AG2H 4IHTA 3KLOA 2E35A 2HVRA 2OU2A 3PNVA 1K78B 5DD8A 5IYBJ 3FXQA 3G7DA 3HM5A 2EA2A 3DBLB 2DT5A 2GZWA 3A1YA 3EYIA 3WHBA 4GDFA 4M6VA 2HCSA 1MNEA 1UFMA 2M87A 3WODF 3ZQFA 3EUKL 4F7ZA 3HOWJ 1YOVB 2LLVA 2M5WA 3S1MJ 4E7SA 2JA8J 5FGMA 2XGDA 1DU0A 1ZPQA 3S8QA 4M6YA 1MZBA 2CROA 3HGGA 4BBRJ 2R7FA 5FJ8J 2LYQA 5KAFC 6PAXA 3VYUB 4A3CJ 2COMA 2OA4A 3BTIA 4HBLA 3AL0C 2Z5UA 1PP7U 2LF8A 2JPCA 4KJZA 4CDGA 2LVSA 2OBPA 2HYGD 4RB3C 1BR4A 2RNJA 2L7KA 1HCRA 3HL2A 4RB2C 2X4HA 2EV6A 1MGTA 3QPLA 5LGNA 2Q8KA 3KEQA 1TQMA 3LSKA 1OCOH 4AWXB 2KZ8A 4Q4ZF 3OV8A 2EJRA 5KK1A 4HF0A 5M3MJ 1HDPA 1WH5A 1MJBA 3ZCOA 3FKJA 4JK1X 4AIJA 4PFPA 2UV1A 5BS6A 2EFWA 4L5IA 5HNFA 1REPC 3RKWA 2EZLA 3KCCA 5JFRA 3CECA 2GWRA 4OOIA 1WH7A 2VXZA 5F1JA 1R49A 1IRGA 2A05A 3IKVA 1LQCA 4UVBA 3ABTA 1W5CC 3BS3A 1ITYA 4D0PA 1NTCA 1LUJB 3OOPA 3JRGA 3ZPXA 1ETOA 1VQ8I 1OMIA 1P4AA 2E1CA 2W00A 5DM6F 1WJAA 4NNJA 3J80Z 5L3EA 2MGQA 3QOPA 4HX7A 4OIQF 1CF7B 3OSFA 4ER6A 4GFBA 3CP8A 2DPUA 4ENKA 4I6UA 2LD5A 2XHKA 4D7MA 3OSGA 4CCNA 1I1GA 2AXTC 3D5LA 1BR2A 2PMZA 1D1AA 1ENHA 3JSPA 2WAQN 3LQQA 1XTAA 3KL4A 2DO7A 1IDZA 1FOWA 1R58A 2YX4A 2RQPA 4FBIA 2JUGA 2F48A
chains in the Genus database with same CATH topology
1X2LA 2O49A 5C4XJ 1RZRD 1MH3A 4CYCB 5J1YA 2DA5A 2LR8A 4PU8A 3S1RJ 3RQIA 1QPIA 1RIOA 2CJJA 1FEXA 1QRYA 2EZIA 2N8GA 2L7MP 1VFCA 3LNQA 1PUFB 1JFTA 1UG2A 3ZOBA 3LISA 1X2MA 3CQZJ 2OF7A 2HOSA 1FIAA 1FTZA 1QP0A 2JA7J 4A3EJ 2EWTA 1BDHA 1AKHA 1JUSA 2R93J 3DNVB 3OQNA 3B6CA 2IVBA 3JXCL 3MN2A 2CUEA 3HBLA 4NDLA 4XICA 4BBSJ 2E2IJ 4BKXA 2L7FP 3JRHA 2X6OA 2CQXA 1TWCJ 1R69A 3TRBA 2R92J 2KPJA 2PMZN 3R1FA 4A3FJ 1PERL 4DZJA 4JCXA 3BR2A 1IC8A 3S16J 1RR7A 2LYSA 4A3BJ 4X6AJ 1ZKGA 2GRLA 2LKXA 1UTXA 1LFUP 3EUSA 5F0FA 2R5ZB 2IBDA 5EZGA 1RPWA 5J1RA 3RKQA 3GBGA 3S17J 1FJLA 1GDTA 1ETXA 2HINA 1QQAA 4I76A 1XG1A 2E19A 2LYKA 1MBFA 4DYRA 1IDYA 1QVUA 3TP0A 2X9DA 3HOVJ 3RZOJ 1GV2A 5M5XJ 2MQKA 1K83J 1DW9A 3SFIA 2Y0SN 2QF7A 1RESA 1B72A 5M5WJ 3S2DJ 4OB4A 3ZHMA 5JLWA 3MVPA 2M0CA 5DTDA 2KT0A 4IWRA 2E2HJ 4M3BA 3BR1A 2DMUA 3IVPA 2IAIA 2ECBA 2XRLA 3A01A 1OFCX 1GV5A 1UXCA 2LYRA 1QP7A 2Y2ZA 4A3JJ 3W6VA 1MBJA 3FYMA 2YU9J 3BD1A 3CCYA 4FE7A 3GTKJ 4M3GA 3Q3SA 3GTGJ 4GQMA 3A03A 1T33A 4Y52J 1PRVA 4A3IJ 2DTZA 2L9RA 2NOGA 3FK6A 2RAEA 2GM4A 2JA5J 2M8GX 4X4GA 4YG4A 1TWGJ 3B6AA 2HOTA 2PUBA 2LCVA 1ORKA 1SANA 1FIPA 9ANTA 1NEQA 4O8BA 2EZKA 3ZQCA 2XI8A 2MW8A 4I6RA 2CRGA 2HDDA 1HF0A 1MH4A 5IPAA 2ICTA 4Y7NJ 5E3NA 2FJRA 1JT0A 2Y30A 1QP4A 1MBEA 1JJ8C 1GVDA 2HXIA 2EBYA 3PM1A 5F0CA 4D5CA 2EF8A 4L5EA 4C3IJ 3JRAA 1ETKA 4XRSA 1YRNB 5E3MA 3BG5A 2AO9A 1DU6A 2LYJA 2DMPA 1JGGA 2PUCA 5IOYA 1UMQA 3G1MA 1BL0A 3BTLA 3FISA 2PUAA 1ZR4A 5HODA 5EGOA 1ZR2A 3U3WA 1IG7A 2D5VA 2GRMA 3HOUJ 2G0EA 3K2AA 2NS8A 1JFSA 3CDLA 5GP9A 3LSPA 2R0QC 2L8NA 3LSRA 1I3QJ 3GN5B 3SCHA 2XGCA 3K7AJ 2X48A 1LE8B 2GLOA 1B8IB 4J1XA 1ZZ9A 3JREA 2LY9A 4JX4A 2CQQA 4J1WA 5EEAA 5F04A 3ZQIA 1PRAA 4B3AA 1EFAA 4ABZA 3Q0UA 3F52A 4EEFG 3VK0A 3BR0A 1ZZBA 4IVZA 1W0UA 4FE4A 5EG0A 2R1JL 2VKVA 2XPUA 3IH4A 2VKEA 3LOCA 1BW6A 3IV5A 1POUA 1VI0A 4A3DJ 3JRFA 2O7OA 3FMYA 1MSEC 4UUSB 1OCPA 2EBIA 5F27A 5IYCJ 3QQ6A 2NVYJ 4S0HB 2I10A 4FISA 2LYPA 1HLVA 4PU4C 4I6ZA 1XWRA 3S8QA 3NARA 1S7EA 4BXXJ 1B0NA 2NVTJ 2EZHA 1G2HA 3Q0VA 2PUGA 2L0KA 2A6CA 2LK2A 1PNRA 4RDUA 3OP9A 2BNNA 4YARA 3HB9A 2HYJA 4BY1J 2LTPA 4Z5HA 3ZKCA 2E1OA 3LSJA 3WHCA 2ID6A 1APLC 3KJXA 1XS9A 2IV1A 4Z5DA 1PUFA 3BQZA 5EF6A 1JH9A 1MNMC 3F51A 1AKHB 3F0CA 3H5TA 1ETQA 3BTCA 3Q0WA 1SQ8A 4JX6A 3O8HA 4D7NA 3LFPA 3CLCA 3MKLA 3LSGA 2ECCA 1POGA 3QYXA 1BJZA 2JMWA 5FKOA 3MLFA 4M3FA 2AXVA 1GT0C 5JLXA 2E2JJ 2JA6J 1H8AC 1NK2P 2Y9YA 3O8GA 5IP6A 3GTQJ 2M2EA 3RZZA 2HOAA 4JP0A 4Y42A 1BDIA 2LLKA 3JXBC 4Z58A 2DA6A 2VPRA 3JRBA 2R5ZA 3PXPA 2LP0A 2IUOA 3QF3A 2PE5A 2WV1A 1ZTRA 4AYBN 2JVLA 2EQRA 4I6TA 1RZRA 1LFBA 1HDDC 3G1LA 2YS9A 3SDGA 3D1NI 2VUMJ 4B4CA 3ZHIA 5FLVA 5EYRA 3BG3A 1K61A 4JCYA 1B72B 1F36A 1W0TA 1X2NA 1JTXA 1Q1VA 3L1PA 1QVTA 2K9QA 3BT9A 2CSFA 1F43A 2KEJA 2O4AA 2K9SA 4D5FA 3BR6A 3OOUA 3E7LA 1U9OA 1CQTA 1ZZ6A 2B63J 3GTPJ 1Z0XA 3GTJJ 1RETA 4YG1A 5K7FA 2R5YA 1A6IA 1JKRC 2JCGA 4FN3A 1MBKA 3HZIB 3IH3A 4UUTA 2IVGA 1U78A 3FKIJ 1Y9QA 3S1NJ 2MEZA 1MBHA 1GUUA 2H1KA 4C3JJ 3F6WA 5A7LA 1WIZA 2LFBA 3BTJA 3HEFA 3SJMA 2NVQJ 4MFDA 5F0HA 3CROL 2XB5A 1XC5A 5C3EJ 3I4NJ 1Y1VJ 2DA2A 3HOYJ 1VNDA 3IH2A 2FX0A 2AXZA 4C2MJ 3FYAA 3BR5A 5GPCA 2R7ZJ 4F8DA 2PPXA 3FK7A 1P7JA 1ETWA 2KDZA 1ZS4A 1OSLA 2PIJA 4IEJA 4MFEA 1WI3A 1X57A 4PU7A 2CU7A 1DWKA 2PUDA 1ETVA 4B1RA 3M3YJ 2IVQA 4MLOA 2PUEA 4DZPA 5EDNA 1JWLA 1YRNA 2OPTA 4JQDA 2IU7A 3S1QJ 5M5YJ 4LOCA 5EGOB 3HGYA 3B7HA 3BDNA 3JRDA 3QQAA 2GZUA 3OIOA 4I8TA 4JX5A 2JN6A 2DJNA 1ZZCA 1R63A 1PRUA 2AXUA 4XRSG 4A69C 1Y1WJ 4IHYA 1I6HJ 2K9NA 4DYQA 4FTHA 3PO2J 2NS7A 2AW6A 4GHJA 3H3VK 2M9HA 1IRZA 1MSFC 5IOZA 2MSYA 2DA7A 4XIDA 1AHDP 5K7ZA 5J1UA 5DS9A 2XJ3A 2ID3A 3S15J 3TEDA 2FD5A 2TRTA 4DW6A 4Z59A 5FKNA 5EG0B 1U8BA 1Y7YA 1SFOJ 1UHSA 4M3EA 4YBAA 2DMQA 2DMTA 2WIUB 1OCTC 4CYCA 2TCTA 5EZHA 4X4EA 2B5AA 2BNMA 2OR1L 3TW7A 2JK3A 4X4CA 1IUFA 3H0GJ 3ZQHA 1LCDA 3OQMA 4A3MJ 5FKKA 1IJWC 1JJ6C 1ADRA 2KEKA 1ZZ7A 2L49A 2P81A 4A3GJ 4MCTA 3CMYA 2Y9ZA 2K40A 4V2GA 1AU7A 1ZVVA 3JR9A 2HQ5A 4IA8A 2IEKA 2DA4A 5GPAA 2COBA 5M3FJ 2XCJA 3TP3A 4HNVA 5E3OA 3S14J 1WCMJ 4RBOA 1WH6A 1ZZ8A 5IP9J 4IHXA 3JRIA 2KEIA 4X1EA 5C44J 4W97A 1O4XA 3HKZN 4X4IA 5E3LA 4QIWN 1RZSA 2XPVA 2JJ7A 3KXAA 3GBFA 4AUXA 3UFDA 2PUFA 1R9TJ 1RPEL 3O9XA 2ME0A 1BA5A 1ZK8A 2XB0X 1ZQ3P 4G12A 1JUPA 5K7HA 2NVXJ 1Z77A 1QQBA 4JYKA 4A3LJ 5BNGA 2H8RA 1A5JA 4X4DA 3RZDJ 2ICPA 4A93J 1JKOC 5IYBJ 3OQOA 1IV6A 3G7DA 3HM5A 1H89C 1H88C 1CJGA 1WETA 4X4BA 2GBYA 3WHBA 2OFYA 4M6VA 4BY7J 3ZQFA 3HOZJ 2M34A 5J3LA 3HOWJ 2XIUA 2O9LA 1ZAYA 3S1MJ 1TWFJ 1RKTA 3HOXJ 2JA8J 2ELKA 2XGDA 1DU0A 2MG4A 5IP7J 1BW5A 1ZPQA 2XSDC 4X4HA 3HDDA 3BR3A 2CROA 4A3KJ 3HGGA 3ZQLA 2VI6A 4BBRJ 2CUFA 2DMNA 3A01B 5FJ8J 2LYQA 1VPWA 2QCOA 1E3OC 4A3CJ 2FJ1A 2AUWA 2XGEA 3BTIA 2HXOA 2R63A 1I50J 2Y31A 4IHVA 3FIWA 2AHQA 2LVSA 1ZGWA 1NERA 3QWGA 4M3DA 1HCRA 1JT6A 1WH8A 2R5YB 3QPLA 2BNOA 4MO7A 2KZ8A 2LYLA 1WGXA 1JUMA 1P7IA 5M3MJ 4FCYA 1JKPC 1LCCA 1HDPA 2WB1N 1WH5A 4MIMA 2DA1A 4NDWA 1T56A 3C2BA 2ME6A 3JRCA 1YSEA 1TWHJ 4C3HJ 4W1UA 2AWIA 2XPWA 2EZLA 1ZUGA 4PU3C 2HSGA 3CECA 3PO3J 4MCXA 3M4OJ 3KZ3A 5IYDJ 1WH7A 2BJCA 3A02A 3VPRA 5F1JA 1LQCA 2DA3A 3ZQGA 4V2FA 1TWAJ 1U9NA 3TW6A 3BS3A 1LLIA 1ITYA 2O38A 1NTCA 5FLMJ 2FQ4A 2JWTA 3JRGA 4Z5CA 1ETOA 2HI3A 3BG9A 5FKLA 4QSHA 1HOMA 4XRMA 1EF4A 3G5GA 3SCFA 5C4JJ 1WPKA 3JXDL 3UKGA 1LMB3 4DYCA 3S2HJ 1FTTA 3GN5A 2MGQA 1X58A 3GTLJ 4AC0A 5FKMA 1LE8A 2W48A 1UXDA 1B8IA 3G1OA 3OSFA 4QTRA 3BQYA 3QPSA 4XK4A 4GFBA 5K98B 4IHWA 3GTMJ 4I6UA 2ZB9A 3DCFA 2LD5A 4D7MA 3I4MJ 3OSGA 1VF9A 4J19A 4X4FA 1JKQC 1RKWA 1TC3C 3SCGA 3NAUA 1OJLA 4YG7B 2EH3A 1ENHA 2O8KA 2WAQN 1L1MA 2L7ZA 2DN0A 1IDZA 5F08A 1D5YA 1JTYA 3OMTA 1IGNA 3DEWA 1QPZA 3GTOJ 1NK3P 1MBGA 1ETYA 4FBIA 2YUSA 2WUSR 4UUSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X2L A;  2O49 A;  5C4X J;  1RZR D;  1MH3 A;  4CYC B;  5J1Y A;  2DA5 A;  2LR8 A;  4PU8 A;  3S1R J;  3RQI A;  1QPI A;  1RIO A;  2CJJ A;  1FEX A;  1QRY A;  2EZI A;  2N8G A;  2L7M P;  1VFC A;  3LNQ A;  1PUF B;  1JFT A;  1UG2 A;  3ZOB A;  3LIS A;  1X2M A;  3CQZ J;  2OF7 A;  2HOS A;  1FIA A;  1FTZ A;  1QP0 A;  2JA7 J;  4A3E J;  2EWT A;  1BDH A;  1AKH A;  1JUS A;  2R93 J;  3DNV B;  3OQN A;  3B6C A;  2IVB A;  3JXC L;  3MN2 A;  2CUE A;  3HBL A;  4NDL A;  4XIC A;  4BBS J;  2E2I J;  4BKX A;  2L7F P;  3JRH A;  2X6O A;  2CQX A;  1TWC J;  1R69 A;  3TRB A;  2R92 J;  2KPJ A;  2PMZ N;  3R1F A;  4A3F J;  1PER L;  4DZJ A;  4JCX A;  3BR2 A;  1IC8 A;  3S16 J;  1RR7 A;  2LYS A;  4A3B J;  4X6A J;  1ZKG A;  2GRL A;  2LKX A;  1UTX A;  1LFU P;  3EUS A;  5F0F A;  2R5Z B;  2IBD A;  5EZG A;  1RPW A;  5J1R A;  3RKQ A;  3GBG A;  3S17 J;  1FJL A;  1GDT A;  1ETX A;  2HIN A;  1QQA A;  4I76 A;  1XG1 A;  2E19 A;  2LYK A;  1MBF A;  4DYR A;  1IDY A;  1QVU A;  3TP0 A;  2X9D A;  3HOV J;  3RZO J;  1GV2 A;  5M5X J;  2MQK A;  1K83 J;  1DW9 A;  3SFI A;  2Y0S N;  2QF7 A;  1RES A;  1B72 A;  5M5W J;  3S2D J;  4OB4 A;  3ZHM A;  5JLW A;  3MVP A;  2M0C A;  5DTD A;  2KT0 A;  4IWR A;  2E2H J;  4M3B A;  3BR1 A;  2DMU A;  3IVP A;  2IAI A;  2ECB A;  2XRL A;  3A01 A;  1OFC X;  1GV5 A;  1UXC A;  2LYR A;  1QP7 A;  2Y2Z A;  4A3J J;  3W6V A;  1MBJ A;  3FYM A;  2YU9 J;  3BD1 A;  3CCY A;  4FE7 A;  3GTK J;  4M3G A;  3Q3S A;  3GTG J;  4GQM A;  3A03 A;  1T33 A;  4Y52 J;  1PRV A;  4A3I J;  2DTZ A;  2L9R A;  2NOG A;  3FK6 A;  2RAE A;  2GM4 A;  2JA5 J;  2M8G X;  4X4G A;  4YG4 A;  1TWG J;  3B6A A;  2HOT A;  2PUB A;  2LCV A;  1ORK A;  1SAN A;  1FIP A;  9ANT A;  1NEQ A;  4O8B A;  2EZK A;  3ZQC A;  2XI8 A;  2MW8 A;  4I6R A;  2CRG A;  2HDD A;  1HF0 A;  1MH4 A;  5IPA A;  2ICT A;  4Y7N J;  5E3N A;  2FJR A;  1JT0 A;  2Y30 A;  1QP4 A;  1MBE A;  1JJ8 C;  1GVD A;  2HXI A;  2EBY A;  3PM1 A;  5F0C A;  4D5C A;  2EF8 A;  4L5E A;  4C3I J;  3JRA A;  1ETK A;  4XRS A;  1YRN B;  5E3M A;  3BG5 A;  2AO9 A;  1DU6 A;  2LYJ A;  2DMP A;  1JGG A;  2PUC A;  5IOY A;  1UMQ A;  3G1M A;  1BL0 A;  3BTL A;  3FIS A;  2PUA A;  1ZR4 A;  5HOD A;  5EGO A;  1ZR2 A;  3U3W A;  1IG7 A;  2D5V A;  2GRM A;  3HOU J;  2G0E A;  3K2A A;  2NS8 A;  1JFS A;  3CDL A;  5GP9 A;  3LSP A;  2R0Q C;  2L8N A;  3LSR A;  1I3Q J;  3GN5 B;  3SCH A;  2XGC A;  3K7A J;  2X48 A;  1LE8 B;  2GLO A;  1B8I B;  4J1X A;  1ZZ9 A;  3JRE A;  2LY9 A;  4JX4 A;  2CQQ A;  4J1W A;  5EEA A;  5F04 A;  3ZQI A;  1PRA A;  4B3A A;  1EFA A;  4ABZ A;  3Q0U A;  3F52 A;  4EEF G;  3VK0 A;  3BR0 A;  1ZZB A;  4IVZ A;  1W0U A;  4FE4 A;  5EG0 A;  2R1J L;  2VKV A;  2XPU A;  3IH4 A;  2VKE A;  3LOC A;  1BW6 A;  3IV5 A;  1POU A;  1VI0 A;  4A3D J;  3JRF A;  2O7O A;  3FMY A;  1MSE C;  4UUS B;  1OCP A;  2EBI A;  5F27 A;  5IYC J;  3QQ6 A;  2NVY J;  4S0H B;  2I10 A;  4FIS A;  2LYP A;  1HLV A;  4PU4 C;  4I6Z A;  1XWR A;  3S8Q A;  3NAR A;  1S7E A;  4BXX J;  1B0N A;  2NVT J;  2EZH A;  1G2H A;  3Q0V A;  2PUG A;  2L0K A;  2A6C A;  2LK2 A;  1PNR A;  4RDU A;  3OP9 A;  2BNN A;  4YAR A;  3HB9 A;  2HYJ A;  4BY1 J;  2LTP A;  4Z5H A;  3ZKC A;  2E1O A;  3LSJ A;  3WHC A;  2ID6 A;  1APL C;  3KJX A;  1XS9 A;  2IV1 A;  4Z5D A;  1PUF A;  3BQZ A;  5EF6 A;  1JH9 A;  1MNM C;  3F51 A;  1AKH B;  3F0C A;  3H5T A;  1ETQ A;  3BTC A;  3Q0W A;  1SQ8 A;  4JX6 A;  3O8H A;  4D7N A;  3LFP A;  3CLC A;  3MKL A;  3LSG A;  2ECC A;  1POG A;  3QYX A;  1BJZ A;  2JMW A;  5FKO A;  3MLF A;  4M3F A;  2AXV A;  1GT0 C;  5JLX A;  2E2J J;  2JA6 J;  1H8A C;  1NK2 P;  2Y9Y A;  3O8G A;  5IP6 A;  3GTQ J;  2M2E A;  3RZZ A;  2HOA A;  4JP0 A;  4Y42 A;  1BDI A;  2LLK A;  3JXB C;  4Z58 A;  2DA6 A;  2VPR A;  3JRB A;  2R5Z A;  3PXP A;  2LP0 A;  2IUO A;  3QF3 A;  2PE5 A;  2WV1 A;  1ZTR A;  4AYB N;  2JVL A;  2EQR A;  4I6T A;  1RZR A;  1LFB A;  1HDD C;  3G1L A;  2YS9 A;  3SDG A;  3D1N I;  2VUM J;  4B4C A;  3ZHI A;  5FLV A;  5EYR A;  3BG3 A;  1K61 A;  4JCY A;  1B72 B;  1F36 A;  1W0T A;  1X2N A;  1JTX A;  1Q1V A;  3L1P A;  1QVT A;  2K9Q A;  3BT9 A;  2CSF A;  1F43 A;  2KEJ A;  2O4A A;  2K9S A;  4D5F A;  3BR6 A;  3OOU A;  3E7L A;  1U9O A;  1CQT A;  1ZZ6 A;  2B63 J;  3GTP J;  1Z0X A;  3GTJ J;  1RET A;  4YG1 A;  5K7F A;  2R5Y A;  1A6I A;  1JKR C;  2JCG A;  4FN3 A;  1MBK A;  3HZI B;  3IH3 A;  4UUT A;  2IVG A;  1U78 A;  3FKI J;  1Y9Q A;  3S1N J;  2MEZ A;  1MBH A;  1GUU A;  2H1K A;  4C3J J;  3F6W A;  5A7L A;  1WIZ A;  2LFB A;  3BTJ A;  3HEF A;  3SJM A;  2NVQ J;  4MFD A;  5F0H A;  3CRO L;  2XB5 A;  1XC5 A;  5C3E J;  3I4N J;  1Y1V J;  2DA2 A;  3HOY J;  1VND A;  3IH2 A;  2FX0 A;  2AXZ A;  4C2M J;  3FYA A;  3BR5 A;  5GPC A;  2R7Z J;  4F8D A;  2PPX A;  3FK7 A;  1P7J A;  1ETW A;  2KDZ A;  1ZS4 A;  1OSL A;  2PIJ A;  4IEJ A;  4MFE A;  1WI3 A;  1X57 A;  4PU7 A;  2CU7 A;  1DWK A;  2PUD A;  1ETV A;  4B1R A;  3M3Y J;  2IVQ A;  4MLO A;  2PUE A;  4DZP A;  5EDN A;  1JWL A;  1YRN A;  2OPT A;  4JQD A;  2IU7 A;  3S1Q J;  5M5Y J;  4LOC A;  5EGO B;  3HGY A;  3B7H A;  3BDN A;  3JRD A;  3QQA A;  2GZU A;  3OIO A;  4I8T A;  4JX5 A;  2JN6 A;  2DJN A;  1ZZC A;  1R63 A;  1PRU A;  2AXU A;  4XRS G;  4A69 C;  1Y1W J;  4IHY A;  1I6H J;  2K9N A;  4DYQ A;  4FTH A;  3PO2 J;  2NS7 A;  2AW6 A;  4GHJ A;  3H3V K;  2M9H A;  1IRZ A;  1MSF C;  5IOZ A;  2MSY A;  2DA7 A;  4XID A;  1AHD P;  5K7Z A;  5J1U A;  5DS9 A;  2XJ3 A;  2ID3 A;  3S15 J;  3TED A;  2FD5 A;  2TRT A;  4DW6 A;  4Z59 A;  5FKN A;  5EG0 B;  1U8B A;  1Y7Y A;  1SFO J;  1UHS A;  4M3E A;  4YBA A;  2DMQ A;  2DMT A;  2WIU B;  1OCT C;  4CYC A;  2TCT A;  5EZH A;  4X4E A;  2B5A A;  2BNM A;  2OR1 L;  3TW7 A;  2JK3 A;  4X4C A;  1IUF A;  3H0G J;  3ZQH A;  1LCD A;  3OQM A;  4A3M J;  5FKK A;  1IJW C;  1JJ6 C;  1ADR A;  2KEK A;  1ZZ7 A;  2L49 A;  2P81 A;  4A3G J;  4MCT A;  3CMY A;  2Y9Z A;  2K40 A;  4V2G A;  1AU7 A;  1ZVV A;  3JR9 A;  2HQ5 A;  4IA8 A;  2IEK A;  2DA4 A;  5GPA A;  2COB A;  5M3F J;  2XCJ A;  3TP3 A;  4HNV A;  5E3O A;  3S14 J;  1WCM J;  4RBO A;  1WH6 A;  1ZZ8 A;  5IP9 J;  4IHX A;  3JRI A;  2KEI A;  4X1E A;  5C44 J;  4W97 A;  1O4X A;  3HKZ N;  4X4I A;  5E3L A;  4QIW N;  1RZS A;  2XPV A;  2JJ7 A;  3KXA A;  3GBF A;  4AUX A;  3UFD A;  2PUF A;  1R9T J;  1RPE L;  3O9X A;  2ME0 A;  1BA5 A;  1ZK8 A;  2XB0 X;  1ZQ3 P;  4G12 A;  1JUP A;  5K7H A;  2NVX J;  1Z77 A;  1QQB A;  4JYK A;  4A3L J;  5BNG A;  2H8R A;  1A5J A;  4X4D A;  3RZD J;  2ICP A;  4A93 J;  1JKO C;  5IYB J;  3OQO A;  1IV6 A;  3G7D A;  3HM5 A;  1H89 C;  1H88 C;  1CJG A;  1WET A;  4X4B A;  2GBY A;  3WHB A;  2OFY A;  4M6V A;  4BY7 J;  3ZQF A;  3HOZ J;  2M34 A;  5J3L A;  3HOW J;  2XIU A;  2O9L A;  1ZAY A;  3S1M J;  1TWF J;  1RKT A;  3HOX J;  2JA8 J;  2ELK A;  2XGD A;  1DU0 A;  2MG4 A;  5IP7 J;  1BW5 A;  1ZPQ A;  2XSD C;  4X4H A;  3HDD A;  3BR3 A;  2CRO A;  4A3K J;  3HGG A;  3ZQL A;  2VI6 A;  4BBR J;  2CUF A;  2DMN A;  3A01 B;  5FJ8 J;  2LYQ A;  1VPW A;  2QCO A;  1E3O C;  4A3C J;  2FJ1 A;  2AUW A;  2XGE A;  3BTI A;  2HXO A;  2R63 A;  1I50 J;  2Y31 A;  4IHV A;  3FIW A;  2AHQ A;  2LVS A;  1ZGW A;  1NER A;  3QWG A;  4M3D A;  1HCR A;  1JT6 A;  1WH8 A;  2R5Y B;  3QPL A;  2BNO A;  4MO7 A;  2KZ8 A;  2LYL A;  1WGX A;  1JUM A;  1P7I A;  5M3M J;  4FCY A;  1JKP C;  1LCC A;  1HDP A;  2WB1 N;  1WH5 A;  4MIM A;  2DA1 A;  4NDW A;  1T56 A;  3C2B A;  2ME6 A;  3JRC A;  1YSE A;  1TWH J;  4C3H J;  4W1U A;  2AWI A;  2XPW A;  2EZL A;  1ZUG A;  4PU3 C;  2HSG A;  3CEC A;  3PO3 J;  4MCX A;  3M4O J;  3KZ3 A;  5IYD J;  1WH7 A;  2BJC A;  3A02 A;  3VPR A;  5F1J A;  1LQC A;  2DA3 A;  3ZQG A;  4V2F A;  1TWA J;  1U9N A;  3TW6 A;  3BS3 A;  1LLI A;  1ITY A;  2O38 A;  1NTC A;  5FLM J;  2FQ4 A;  2JWT A;  3JRG A;  4Z5C A;  1ETO A;  2HI3 A;  3BG9 A;  5FKL A;  4QSH A;  1HOM A;  4XRM A;  1EF4 A;  3G5G A;  3SCF A;  5C4J J;  1WPK A;  3JXD L;  3UKG A;  1LMB 3;  4DYC A;  3S2H J;  1FTT A;  3GN5 A;  2MGQ A;  1X58 A;  3GTL J;  4AC0 A;  5FKM A;  1LE8 A;  2W48 A;  1UXD A;  1B8I A;  3G1O A;  3OSF A;  4QTR A;  3BQY A;  3QPS A;  4XK4 A;  4GFB A;  5K98 B;  4IHW A;  3GTM J;  4I6U A;  2ZB9 A;  3DCF A;  2LD5 A;  4D7M A;  3I4M J;  3OSG A;  1VF9 A;  4J19 A;  4X4F A;  1JKQ C;  1RKW A;  1TC3 C;  3SCG A;  3NAU A;  1OJL A;  4YG7 B;  2EH3 A;  1ENH A;  2O8K A;  2WAQ N;  1L1M A;  2L7Z A;  2DN0 A;  1IDZ A;  5F08 A;  1D5Y A;  1JTY A;  3OMT A;  1IGN A;  3DEW A;  1QPZ A;  3GTO J;  1NK3 P;  1MBG A;  1ETY A;  4FBI A;  2YUS A;  2WUS R;  4UUS A; 
#chains in the Genus database with same CATH topology
 1MH3 A;  1UG0 A;  2OCC H;  5J1Y A;  2DOA A;  1T0F A;  2LR8 A;  2QKM B;  4PU8 A;  2HTS A;  2R7O A;  4ESF A;  3E5U A;  3RQI A;  1S72 I;  4YEJ A;  1FEX A;  2EZI A;  3GZ6 A;  2KDO A;  3AG1 H;  1VFC A;  3WE3 A;  1Y6I A;  4L9N A;  2K86 A;  5TIS C;  3OMY A;  1MFQ C;  2PQ8 A;  2M7B A;  4BE1 A;  3LIS A;  5H6Q A;  2GIZ A;  4OIN F;  2HOS A;  4RGR A;  2BXZ A;  1NG7 A;  2JA7 J;  2EWT A;  2L1P A;  1W7P B;  4BUP A;  1AKH A;  1LVK A;  3BZK A;  4HQE A;  3OQN A;  3B6C A;  3OYF A;  4YFN F;  2CUE A;  3HBL A;  2Z33 A;  4XIC A;  4BBS J;  2E2I J;  2FOK A;  3ZMU A;  3TRB A;  5LRR A;  3ZP5 A;  1JHF A;  5FRM A;  2ZO4 A;  4A3F J;  3M07 A;  1P6R A;  4FAS D;  3IP4 B;  2MH2 A;  1O3R A;  2MXD A;  1PER L;  2XF7 A;  3F6O A;  3F8M A;  2EIK H;  3S16 J;  1D3Y A;  2KKO A;  1VQ6 I;  2LYS A;  4A3B J;  4LLG F;  1ZKG A;  4JBA A;  3L00 A;  4XKB A;  4EM1 A;  1STZ A;  5ICG A;  2Y75 A;  4L18 B;  3EUS A;  5E20 A;  3JSO A;  2DXI A;  5JVG F;  2PN6 A;  2VQH A;  5K5O A;  3HG9 A;  3VFZ A;  4FT8 A;  3H92 A;  1MBF A;  4DYR A;  1QVU A;  3RZO J;  3HOV J;  4LIU A;  2F5F A;  1GVJ A;  5M5X J;  1K83 J;  4WVL A;  3DFG A;  4RAZ A;  4G6D A;  2L01 A;  4Y3O A;  4Y33 A;  1J75 A;  2ESH A;  3QAH A;  3S2D J;  4OB4 A;  4N4N B;  5JLW A;  1LNW A;  2HVS A;  2L4A A;  1BI1 A;  5DTD A;  1AOY A;  2E2H J;  1U0J A;  5CQG A;  4MEY F;  5HS8 A;  1FP2 A;  3H5A A;  5FRO A;  2Y2Z A;  2PEX A;  1YJW I;  2EIL H;  2QYO A;  3E6D A;  4RLF A;  1USS A;  4I99 C;  2P7V B;  5L3C A;  3K4C A;  1T33 A;  4XM3 A;  4Y52 J;  1T38 A;  4L0Z B;  2CG4 A;  2L9R A;  5D8L B;  3FK6 A;  1WSU A;  2E5Z A;  4YG4 A;  3LA3 A;  2DU9 A;  3OYH A;  3J7A O;  2HOT A;  1LDK B;  1XGM A;  3JAM Z;  4HYE A;  2PUB A;  2WY7 Q;  4UY8 I;  1KQ0 A;  3OYE A;  1E17 A;  2H8W A;  4EM2 A;  1FOK A;  1NEQ A;  4E4H A;  1GXQ A;  4EZI A;  2LRD A;  1YIO A;  4I6R A;  2QQ8 A;  5D5X B;  2OQG A;  1XSV A;  5E3N A;  1HW5 A;  2FJR A;  2IA1 A;  1TW2 A;  2EA4 A;  3IUO A;  2UUZ A;  5E1X A;  4HNU A;  1I1S A;  2O5R A;  3GFL A;  3BPX A;  5F0C A;  2XSJ C;  4L5E A;  1MKM A;  1ETK A;  2AO9 A;  4KFC A;  2V4J C;  3KZI C;  2B0L A;  1R7J A;  3KYC B;  4EKG A;  2GRM A;  3HOU J;  2P0W A;  3CDL A;  3P9I A;  2FQ3 A;  2XGC A;  5HLI A;  3GO5 A;  3H1C A;  1YS6 A;  2LY9 A;  3CUQ A;  4JX4 A;  3GX4 X;  4EK9 A;  3L9F A;  4RB0 A;  2ZKZ A;  5EEA A;  2XAU A;  1FT9 A;  4OIP F;  3IWZ A;  3F52 A;  1RRJ A;  2L2O A;  3BR0 A;  1ZZB A;  4ZZD A;  5DYM A;  5EG0 A;  2VKV A;  3IH4 A;  2X6X A;  2PLY A;  2VKE A;  4IQJ A;  2PJR A;  4B8X A;  3P9K A;  4I7H A;  2KIS A;  5FFX A;  2Q0O A;  1OCP A;  1IN4 A;  2VJJ A;  4EGY A;  5IYC J;  3QQ6 A;  2NOJ B;  1A04 A;  4I6Z A;  5CVI A;  4AYB A;  2YBD A;  2NVT J;  2EZH A;  3K4B A;  4Q5S F;  3NRO A;  4OWR B;  3OP9 A;  2EIM H;  4IJA A;  4NC6 A;  3ABM H;  1AA7 A;  4Z5H A;  3ZKC A;  2E1O A;  2MD5 A;  4HRI A;  2PJP A;  2V3C C;  1P2F A;  4M71 A;  2VT2 A;  3OR1 C;  1AKH B;  3HOT A;  1ETQ A;  4BQO A;  3OYN A;  1SQ8 A;  2Y0M A;  5J4V A;  1QU3 A;  3KP3 A;  3V7R A;  4J00 A;  2D45 A;  1B4A A;  3RPQ A;  3MAJ A;  4JQF A;  2ZME A;  2K85 A;  1ZAO A;  2W82 A;  3TO6 A;  1XX5 A;  4XLF A;  3IRQ A;  5FKO A;  4M3F A;  2AXV A;  1GT0 C;  5JLX A;  3J81 Z;  4FQG A;  3OS2 A;  5JVT A;  4CXF A;  3NDB B;  2Y9Y A;  1VQO I;  2A69 F;  1P4W A;  4IO9 F;  2DFF A;  4CZC A;  4JP0 A;  4AU7 A;  4WCG A;  3S3O A;  1FBS A;  1MJA A;  2LLK A;  3BC8 A;  2IS1 A;  4XR6 A;  2R7S A;  4JOM A;  3K70 D;  4PJJ A;  2PE5 A;  2DOD A;  5AON A;  2M8E A;  1UEL B;  2EQR A;  5CKT A;  3IRR A;  5LEJ A;  2O8X A;  4LG3 A;  2NVU B;  5BPD A;  2YS9 A;  1J7K A;  5FLV A;  3IL2 A;  2ETH A;  2ZNY A;  2HDW A;  4JCY A;  1F36 A;  1X2N A;  3TO9 A;  1Q1V A;  3O6B B;  5L3D A;  3L2C A;  5BPI A;  2CSF A;  1ACI A;  2BY3 A;  4D5F A;  3OL3 A;  2LNM A;  1B9M A;  1DGR M;  2QQB A;  3CLQ A;  2B63 J;  5KCM A;  1RET A;  2O3F A;  3R60 A;  4YG1 A;  2QEN A;  4B3X A;  4PGH A;  2E5N A;  5HVQ C;  3OYC A;  2QZ8 A;  2V9P A;  2IVG A;  3F8C A;  3QYE A;  3CJR B;  4KDP A;  1IXC A;  1T95 A;  4C3J J;  5A7L A;  2PXP A;  2E34 A;  3E5X A;  2YU3 A;  3L2Q A;  4HNT A;  2B7E A;  3H3Z A;  3I4N J;  3DEU A;  3KZY A;  4Y17 A;  3HOY J;  2LLW A;  1UHW A;  3BR5 A;  3GLX A;  2R7U A;  3FYA A;  1SD4 A;  4Y15 A;  2FBI A;  1T6S A;  1B9N A;  1X57 A;  1WI3 A;  4PU7 A;  1M1E B;  2CU7 A;  1DWK A;  1O7F A;  3T5X A;  3ASN H;  1I5Z A;  3AG3 H;  4DJA A;  2P4W A;  3NEU A;  4MLO A;  2PUE A;  5EDN A;  1YRN A;  1DQU A;  3DP7 A;  4U0V A;  2HYF A;  3J7Y J;  2IU7 A;  2RQQ A;  4UV9 A;  3GUD A;  4I8T A;  2V26 A;  1K7A A;  1ON2 A;  2V1X A;  2HNH A;  1X3U A;  1R71 A;  2UXX A;  1FC3 A;  2K9N A;  3GF2 A;  4DYQ A;  3S32 A;  4KIB A;  4LB6 B;  1CGP A;  2O6G E;  1KA8 A;  2EWN A;  4KIG A;  2FXA A;  2DPD A;  2PI0 A;  4K2E A;  3H3V K;  2FFH A;  1OCZ H;  3L09 A;  2Q2E B;  5GAH J;  3W2A A;  5IOZ A;  3I59 B;  3PE5 A;  4XID A;  2XJ3 A;  5K7Z A;  3S15 J;  2FD5 A;  2RRE A;  4Z6Y A;  2WC2 A;  4HX4 A;  4DW6 A;  2V1D A;  1XGN A;  5EG0 B;  4YII A;  2HZD A;  2DMQ A;  3QP5 A;  4MQ9 F;  1DPU A;  4X4E A;  1OCR H;  4KA4 A;  1W5T A;  4BEH A;  4A3M J;  2QLZ A;  1U5T A;  1O7L A;  2AXL A;  4PGG A;  2V7F A;  4PJL A;  2HQ5 A;  2K9L A;  4LLL A;  5HDK A;  1WRJ A;  2XCJ A;  2ELH A;  3TP3 A;  3S14 J;  3VDX A;  3S93 A;  3HHH A;  1ZZ8 A;  5H20 A;  3LMM A;  2BBY A;  3CCE I;  1PYV A;  1O4X A;  1IO2 A;  1O3Q A;  1IF1 A;  1YW7 A;  2I8D A;  3QOD A;  2VC1 A;  5J6X A;  2XPV A;  1EV7 A;  3BLY A;  3UFD A;  2A5W A;  3O9X A;  2ZME B;  3CLO A;  3E6M A;  5HDG A;  1ZQ3 P;  5CVR A;  1FBU A;  3E5Q A;  1Z77 A;  4CCJ A;  1A5J A;  2OCE A;  3DPU A;  1ON1 A;  1OYW A;  4PCQ A;  5D4S A;  2P7C B;  4H4K C;  3RCO A;  3OQO A;  1IV6 A;  3WTS C;  4O3M A;  1D1C A;  3U9G A;  1WET A;  2BGC A;  3MZ8 A;  4X4B A;  2GBY A;  4BY7 J;  4OU0 A;  1SC7 A;  3E1S A;  5CJ9 A;  4CGZ A;  3PJR A;  1T2K A;  2K27 A;  3NWT A;  4CCL A;  2RNG A;  1RKT A;  1PJR A;  4X4H A;  4OIR F;  2XXA A;  3VYT B;  2IGO A;  1DGW Y;  5HLG A;  2VI6 A;  1F4K A;  3TKY A;  4YRV A;  3CCL I;  1TLH B;  1BC8 C;  5TGT A;  1VPW A;  2QCO A;  4BYY A;  3ECO A;  3MEX A;  2ZXJ A;  4IRI A;  2PXF A;  1I50 J;  2CQ7 A;  2DQL A;  2ISY A;  3ZN0 A;  3TO7 A;  2JZY A;  3HXL A;  3OYB A;  2DK5 A;  3U21 A;  1WH8 A;  4IRG A;  3F72 A;  1AWC A;  3HUG B;  4MO7 A;  1JUM A;  1S7A A;  2LNB A;  1P7I A;  3MCZ A;  3RPU A;  1PVE A;  3ZPL A;  3SEZ A;  4RGS A;  1JKP C;  3S3M A;  4MIM A;  2DA1 A;  4AVP A;  4BS9 A;  3QOW A;  1T56 A;  2J5P A;  3DKX A;  3CD6 I;  4ZYA A;  1YSE A;  1TWH J;  4C3H J;  4AID A;  2XPW A;  4PU3 C;  2A61 A;  2HTJ A;  4IOA F;  3R0A A;  2CQK A;  3CJT B;  3OYG A;  3M4O J;  1RR8 C;  2MFZ A;  3BP8 A;  3VPR A;  2WAF A;  4A5N A;  1I27 A;  1LLI A;  4A0Y A;  5E8I A;  1A35 A;  5DUI A;  2R7Q A;  2MC4 A;  2RC4 A;  3KLN A;  1UJ8 A;  2DOF A;  3HYI A;  2BW3 A;  4D1Q A;  2DAO A;  3G5G A;  1LMB 3;  2YSR A;  3Q9S A;  1YW8 A;  3OYA A;  3S2H J;  3V42 A;  1FPQ A;  4C30 A;  1S6L A;  4AC0 A;  3L7W A;  2W48 A;  1UXD A;  1Z3Y A;  5E1Z B;  1FP1 D;  3G1O A;  3OIQ A;  3CJN A;  3F9K A;  3GTM J;  2ZB9 A;  1KQ9 A;  2BY2 A;  4HDV A;  1F9N A;  4J19 A;  3TQN A;  1JKQ C;  2C6Y A;  3LAP A;  3T0Y A;  3NAU A;  3H9G A;  1OJL A;  4YG7 B;  2HZT A;  3CC7 I;  4QPO A;  4L0Y B;  1L1M A;  1ERD A;  2VBZ A;  4PUS A;  1FYK A;  2WV0 A;  1JTY A;  1QPZ A;  1NK3 P;  2HU9 A;  3MKY B;  3NZL A;  4OAY A;  2RGV A;  4UUS A;  3IAM 2;  5IT9 K;  1X2L A;  5HLT A;  3WTY C;  2KZG A;  4RAY A;  4F52 A;  3SXY A;  1FYM A;  3QYF A;  4Q47 A;  2DA5 A;  3KP2 A;  1V5G A;  3GEZ A;  1QPI A;  1Z21 A;  1JI8 A;  1LEA A;  3GZD C;  1Z67 A;  3M9L A;  1OPC A;  4BJ6 C;  2D1V A;  1U5T B;  1PUF B;  2EPF A;  1UG2 A;  3ELK A;  3ZOB A;  4NC8 A;  1X2M A;  2MLK A;  1FLI A;  2NNN A;  1H9G A;  3CO7 C;  1Y8R B;  4UVA A;  1TP4 A;  2ISZ A;  1JUS A;  4HSR A;  4XLA A;  5TRD A;  2IVB A;  4X0G A;  1V5E A;  2ACJ A;  3JRH A;  3FWE A;  2CQX A;  4WF2 A;  2ODR D;  2VQG A;  4UXN A;  2PMZ N;  2XGX A;  3PNY A;  4A0Z A;  2KPJ A;  4GRI A;  4PSW A;  2H6C A;  4DZJ A;  4JCX A;  3CCS I;  3H5R A;  3ZGK A;  3ISP A;  2LY2 A;  2VKH A;  5IY5 H;  5J8C A;  4HLY A;  1LFU P;  5EZG A;  2Q1Z B;  1BBY A;  1E0E A;  4XLE A;  3WG9 A;  3GBG A;  2X1D A;  4ZC3 A;  3S17 J;  1GDT A;  1ETX A;  1MMA A;  4I76 A;  2Y69 H;  1XG1 A;  2E19 A;  2LYK A;  1U2Z A;  2LH9 A;  5FLX Z;  1G3S A;  4OBM A;  2MQK A;  3BJO A;  1E2X A;  1QBJ A;  1HKQ A;  1R36 A;  3Q9V A;  3ZMZ A;  4FET A;  4BXU A;  5M5W J;  2AQE A;  1FOX A;  2E71 A;  4A2U A;  2M0C A;  5D5V B;  2FU4 A;  4RAF A;  3ABU A;  2JA2 A;  2KFD A;  2ECB A;  2XRL A;  3A01 A;  1U8R A;  1GV5 A;  1UXC A;  2LYR A;  2JT1 A;  3C7J A;  2CH0 A;  3W6V A;  2MC3 A;  3BD1 A;  2H1L A;  4M3G A;  3Q3S A;  3X2Q H;  3GTG J;  1OQY A;  3VOD A;  3A03 A;  2A07 F;  4GQM A;  3H0D A;  1PRV A;  3DBH B;  1TTY A;  2HOE A;  4II3 A;  1J09 A;  3K69 A;  4CA0 A;  5LHI A;  4GO1 A;  3FXJ A;  2L9V A;  2GM4 A;  2JA5 J;  4X4G A;  2M8G X;  1QZE A;  1BN5 A;  1L0O C;  3B6A A;  3I64 A;  3L2R A;  4IPA A;  4RGU A;  4XOR A;  3EUH A;  5CVU A;  3A9Z A;  1ZHF A;  1ORK A;  3HHG A;  2W1O A;  1OYY A;  5A2Q K;  9ANT A;  2Z9O A;  1FSH A;  3ZQC A;  2MW8 A;  2GAU A;  4RM2 A;  3G6E I;  2HDD A;  2F2E A;  4LIV A;  4E6K G;  3KP5 A;  1HF0 A;  3T1B A;  1N78 A;  5IPA A;  2DDB A;  2XAQ A;  4LJZ F;  2CWE A;  2HKX A;  2VE8 A;  4HZF A;  1QP4 A;  3UWP A;  3CDI A;  2HXI A;  1K79 A;  4M6X A;  2EF8 A;  4C3I J;  3KET A;  2ZCW A;  5E3M A;  4BHC A;  2DMP A;  2PUC A;  3G1M A;  1BL0 A;  3FIS A;  5DCF A;  5LHH A;  1ZR4 A;  5HOD A;  2CUJ A;  5EGO A;  1ZR2 A;  1NH3 A;  5LHG A;  2D5V A;  5ICC A;  2G0E A;  2IJL A;  3CF2 A;  5GP9 A;  4F93 B;  1YG2 A;  3K7A J;  1VQL I;  3FXR A;  2DOE A;  3DEE A;  3VEP A;  1K6Y A;  4DQ2 A;  2GLO A;  3JRE A;  1GXP A;  4J1W A;  2PXV A;  2M30 A;  5K5Q A;  1DP7 P;  3VK0 A;  4NQW A;  1WJE A;  5BMZ A;  3VWB A;  4RA2 A;  4HST A;  4FE4 A;  1OR7 A;  2HS5 A;  4E7H A;  3G4S I;  3LOC A;  1POU A;  3F21 A;  4A3D J;  1HSJ A;  4HPQ A;  3JRF A;  3FMY A;  3RKY A;  4YIF A;  4UUS B;  3MKW B;  1HW2 A;  2XAS A;  1WFX A;  1MDM A;  5GAD J;  4EGZ A;  2NVY J;  4FIS A;  2LYP A;  1HLV A;  4PU4 C;  5ILS A;  1XMK A;  1S7E A;  3LA2 A;  4CCO A;  1B0N A;  3PNT A;  3Q0V A;  2A6C A;  1PNR A;  4RDU A;  2RVC A;  3OYM A;  2FBK A;  4YAR A;  3BJA A;  3GZN B;  2ZJQ F;  2F4O B;  1BI2 A;  3WTX C;  3AG4 H;  1APL C;  3MQ0 A;  4CSW A;  2OZ6 A;  3BQZ A;  2X0L A;  3KE2 A;  4G9Y A;  2V6C A;  3N4M A;  3F0C A;  4A12 A;  3BTC A;  1JHH A;  3G2B A;  4JX6 A;  2H6B A;  5DUK A;  3DTK A;  1XCB A;  4PJ0 C;  1BI3 A;  1X1A A;  2X1C A;  2PXB A;  5KNL A;  5CVV A;  4XOP A;  1QZZ A;  2K3F A;  1BJZ A;  3OY9 A;  2JMW A;  3MLF A;  4BU2 A;  1Z6R A;  1Q1H A;  4HV5 A;  2M2E A;  3LAJ A;  4MHG A;  5F1R A;  1HC8 A;  2A3S A;  1BDI A;  1MW7 A;  4XNF A;  3K4M A;  3OYL A;  1P4X A;  1SFE A;  4NUB A;  4N4O B;  2R5Z A;  2IUO A;  4GGG A;  2P6T A;  3PUB A;  4AYB N;  2JVL A;  3QOX A;  4I6T A;  2YR2 A;  4LG0 A;  3ERE D;  1X19 A;  3LL7 A;  4OMY A;  3SDG A;  2XUB A;  4ASN A;  3ZHI A;  2HCN A;  4EAT A;  5EYR A;  2NNY A;  4BAY A;  4E7I A;  2W84 A;  1W0T A;  1S5L C;  4S05 A;  1G59 A;  3L1P A;  3BT9 A;  5DCM A;  3F23 A;  2O4A A;  4HA8 A;  2R7R A;  4HDU A;  2L5Q A;  1U9O A;  1A36 A;  3W3C A;  4FX4 A;  4XSX F;  2KIQ A;  3F22 A;  2MAB A;  4WWC A;  5K7F A;  4M73 A;  4FN3 A;  2HR3 A;  1H9T A;  1VQ5 I;  4G6Q A;  3FHZ A;  3LSH A;  2G7H A;  2WTE A;  1U78 A;  4XQF A;  2HDC A;  3S1N J;  3V8K A;  2H1K A;  1WIZ A;  3I0T A;  5GAG J;  3BCA A;  4I09 A;  2CSO A;  3G73 A;  1Y56 A;  3G3Z A;  2DBB A;  3HEF A;  1WHU A;  2M45 A;  2OZU A;  2NVQ J;  2P6S A;  2XB5 A;  4ETS A;  3ASO H;  2GOX B;  2K3P A;  3HRM A;  2DA2 A;  3J80 K;  1VND A;  3IH2 A;  4KMF A;  2BHZ A;  2JVH A;  3WG7 H;  5GPC A;  1FY7 A;  3FK7 A;  3I54 A;  4GXO A;  3H35 A;  1XSD A;  1ETW A;  2IVM A;  4IL6 C;  1KU7 A;  1ZS4 A;  2A5Y B;  2PIJ A;  3F6V A;  2F5D A;  1XN7 A;  2NAZ A;  3TOA A;  5D6F A;  3M3Y J;  1YI2 I;  4DZP A;  2FNA A;  5CQE A;  3F8F A;  2V6E A;  3WTW C;  5M5Y J;  5EGO B;  3BDN A;  4A0X A;  1YFH A;  1D5V A;  4ESB A;  3KIO A;  2XKP A;  1G3T A;  3DU6 A;  4JX5 A;  4UV8 A;  3HSE A;  2I5U A;  1IV8 A;  2Z3Y A;  2ZSI B;  1RUN A;  1PRU A;  3A2K A;  2E1M C;  2W57 A;  1RUO A;  3PO2 J;  5D5W B;  4EM0 B;  4YFK F;  4QPQ A;  3GZC A;  2M0M A;  4CCM A;  4IX7 A;  2PXK A;  3CMM A;  2MH9 A;  2DA7 A;  2E1N A;  2PG4 A;  3FX3 A;  4NQW B;  2JRM A;  5J1U A;  5DS9 A;  2CFO A;  1BI0 A;  4I02 A;  3TED A;  2TRT A;  3G71 I;  1SAX A;  4E70 A;  2CV0 A;  1BIA A;  1U8B A;  1Y7Y A;  1G4D A;  2ADU A;  3ECH A;  2KP6 A;  5E18 F;  2DMT A;  3DM5 A;  2FSW A;  5EZH A;  3TW7 A;  1MDM B;  4N9H A;  1VQK I;  4YFX F;  4WXC A;  3C3W A;  5CLS A;  1VZ0 A;  3H0G J;  4UB8 C;  1Z9C A;  3HSR A;  3AAF A;  5FKK A;  1ADR A;  3HJE A;  3LST A;  1SMT A;  4CZZ A;  4L5J A;  2P81 A;  1IAW A;  4A3G J;  2PXE A;  2DT7 B;  4P96 A;  4V2G A;  3GVA A;  2XIG A;  2ZFU A;  4NB5 A;  3M1C A;  3JR9 A;  2XXQ A;  4RB1 A;  3BJ6 A;  2COB A;  2M4G A;  2RDP A;  4IQ4 A;  1OLT A;  4KIF A;  3OR2 C;  5IP9 J;  3ZXS A;  2R7V A;  1IW7 F;  1R23 A;  4X1E A;  4BJ5 C;  4W97 A;  2EK5 A;  5E3L A;  4XON A;  1IUY A;  2ZXH A;  2GIV A;  1N25 A;  3QU6 A;  2QSG X;  3QP6 A;  3SZP A;  1UHM A;  3CCU I;  1R9T J;  1UST A;  4F92 B;  4BDY A;  1RPE L;  5JR3 A;  3DV8 A;  1BA5 A;  3K10 A;  4XBF A;  2R7X A;  4G12 A;  1QQB A;  5K7H A;  2HWV A;  1MMD A;  3IAS 2;  3T8R A;  5BNG A;  2JPB A;  5ED4 A;  2H8R A;  2VOO A;  1D8K A;  1D0X A;  2ICP A;  2A6E F;  1RNL A;  1R4M B;  1H89 C;  3I3L A;  1H88 C;  1WVR A;  5HLH A;  3V7C A;  3AL0 B;  4KYW A;  1WJB A;  3LWF A;  4B48 A;  2M34 A;  4HW0 A;  2WAE A;  3HIF A;  5J3L A;  4BE0 A;  2O9L A;  3CCQ I;  1TWF J;  1X3Z B;  5J47 A;  1R1T A;  3BR3 A;  3ZQL A;  1KZH A;  3OYK A;  1E3H A;  1DUX C;  4KIT B;  5ILV A;  4I98 B;  1KU3 A;  3I9V 2;  3CCV I;  1SMY F;  2FJ1 A;  2WY8 Q;  2XGE A;  3LSM A;  2HXO A;  2R63 A;  3JAM K;  4IHV A;  2FOW A;  3GZ5 A;  1YHQ I;  1NER A;  1PP8 F;  3I5U A;  2KMU A;  5FRN A;  4HF2 A;  2LBF A;  5J4Y A;  2EFN A;  5L3G A;  2LYL A;  1ZEL A;  2HKO A;  2JRT A;  5K5R A;  2LKP A;  4F3Q A;  4OIO F;  2DTR A;  5ERI A;  4CUG A;  2WB1 N;  3HTS B;  5HNH A;  2ME6 A;  3JRC A;  4FHT A;  4PZJ A;  3OYJ A;  1TNS A;  3P9C A;  1OIS A;  2AWI A;  1ZUG A;  2EFO A;  4EJU A;  1IRX A;  1LJ9 A;  4MCX A;  5IYD J;  2BJC A;  4TV7 A;  3RSN A;  3A02 A;  5BQT A;  3DTE A;  3ZQG A;  2W25 A;  4V2F A;  1TWA J;  1U9N A;  1QNT A;  2JSC A;  1MJ9 A;  2BYV E;  2O38 A;  1HST A;  2YPR A;  2XRN A;  1HKS A;  2FQ4 A;  2FF4 A;  2JWT A;  2Y48 A;  5FKL A;  3BG9 A;  2BV6 A;  2CV2 A;  2STT A;  2ICW G;  1G3W A;  1JXS A;  4XRM A;  1EF4 A;  4G8X A;  4R1H A;  4IXA A;  5C4J J;  3FM3 A;  4RGX A;  3UKG A;  3F8B A;  3VSL A;  5KVR A;  1FTT A;  2P5V A;  5KHD A;  2CFX A;  5HOO A;  3GN5 A;  1X58 A;  4HX8 A;  3CUQ B;  1O3S A;  2CMP A;  3GTL J;  2VAS A;  5FKM A;  1B8I A;  4QTR A;  3QPS A;  5K98 B;  4XK4 A;  3IC7 A;  3CCM I;  4IHW A;  1R1U A;  1QO0 D;  3OWQ A;  2IW5 A;  3KYD B;  3LQX A;  2RN7 A;  3C18 A;  1RKW A;  1QHG A;  1TC3 C;  3SCG A;  1TT0 A;  3V4G A;  4ESJ A;  1I39 A;  2EV0 A;  2DJI A;  2BY1 A;  2PMH A;  5F08 A;  2PJR B;  2R7W A;  3QPT A;  3DEW A;  1IGN A;  4KN7 X;  2HFZ A;  1MBG A;  2EIJ H;  1ETY A;  4QWQ A;  3W6K B;  3NQO A;  3K1N A;  1W36 C;  1MMS A;  2WUS R;  1GLN A;  3MZY A;  3I56 I;  1VQP I;  1JE8 A;  1RZR D;  5DEQ A;  3ZN1 A;  4EV0 A;  1UCR A;  4ENJ A;  2L3D A;  1W5S A;  1R6R A;  3S1R J;  1RIO A;  4HLX A;  1IN5 A;  2CJJ A;  5GTI C;  3E6C C;  2N8G A;  3H9Q A;  1JFT A;  4Y4R A;  3J81 K;  1TQI A;  4A3E J;  2HQA A;  1BDH A;  3IKT A;  2WBM A;  2ZNZ A;  3RDI A;  2R93 J;  1N75 A;  3DNV B;  3TBI A;  4BHP A;  2QVO A;  1FNN A;  3RKX A;  3JXC L;  1R22 A;  2BZT A;  4NDL A;  1IXS B;  4XSZ F;  1FBQ A;  2L7F P;  1Y39 A;  1TWC J;  3MWM A;  2F5C A;  1S9H A;  1WJD A;  3DU5 A;  3ZRG A;  3R1F A;  1EH8 A;  2KIM A;  1WZ2 A;  1K6O A;  4ER7 A;  2DYR H;  2W7N A;  3BR2 A;  2UZK A;  1IC8 A;  1RR7 A;  1K4S A;  2WB1 A;  3EYY A;  4MGR A;  4X6A J;  1RC9 A;  2JQE A;  4L9J A;  3O2P E;  3WE2 A;  3V8J A;  1UB9 A;  3RKQ A;  1U2W A;  4ZJZ A;  3M1E A;  3CCJ I;  1FJL A;  1T39 A;  1QQA A;  2HIN A;  3TEP A;  3DWL E;  2OD5 A;  2IA2 A;  2PXU A;  2L4M A;  1Z6T A;  5DDG A;  1Z7L A;  3EDP A;  4F91 B;  4U0Y A;  3I53 A;  3TP0 A;  2X9D A;  4ZYH A;  2M4H A;  1YX5 A;  3E97 A;  1GV2 A;  2DW4 A;  3MZH A;  4RS8 A;  4B43 A;  2V9K A;  2QF7 A;  4BDZ A;  4M9X A;  4XN3 A;  1RZ4 A;  1B72 A;  2FBH A;  2CGP A;  1L3L A;  4KIS A;  3FHN A;  3MVP A;  3WTV C;  3RJP A;  1WJF A;  4M72 A;  3S2W A;  2GA2 A;  3GYH X;  1WWX A;  1ZH5 A;  4DOZ A;  2XAF A;  2DMU A;  3IVP A;  4UB6 C;  4DNC A;  2IAI A;  2CUZ A;  4LD5 A;  3FXK A;  4IOC F;  2ZSH B;  4PJN A;  2K5C A;  3R4K A;  4A3J J;  3FYM A;  3CCY A;  2VC0 A;  2LBF B;  2DFE A;  4ZYD A;  3H36 A;  5E17 F;  1ZRC A;  4A3I J;  2DTZ A;  1ODD A;  2NOG A;  2OTL I;  2HFH A;  2LMD A;  4P5O A;  4BQA A;  5GAE J;  1MMG A;  4PK4 A;  1FIP A;  1J59 A;  1NHA A;  1YIT I;  1Y0U A;  4E7Z A;  4NHJ A;  3QFI A;  4XMY A;  2EIN H;  5TJJ A;  4XLP F;  2V1U A;  2FEZ A;  4L9T A;  1JT0 A;  2Y30 A;  1MBE A;  2DYS H;  1GVD A;  2G7U A;  3PM1 A;  1R5H A;  1HKT A;  1MD0 A;  3DPL C;  1YRN B;  3BG5 A;  1DU6 A;  1ZN2 A;  3DPT A;  3AKZ A;  2VT3 A;  3BTL A;  3EPZ A;  1W7P D;  1JGS A;  3BG7 A;  1IG7 A;  3U3W A;  1G3Y A;  3GCM A;  3D5S C;  3K2A A;  3U2R A;  2NRA C;  2NS8 A;  1JFS A;  2R0Q C;  3LSP A;  3GN5 B;  2VB6 A;  3PSI A;  3DLL F;  1I3Q J;  4UVC A;  3SCH A;  5DRT A;  2X48 A;  2JVG A;  2Z16 A;  1B8I B;  3RIR A;  4J1X A;  2V79 A;  4XN0 A;  1ZZ9 A;  2UXN A;  3K4L A;  3RYR A;  2XV4 S;  2CQQ A;  4I0B A;  4AD9 A;  5L3F A;  2KIU A;  3REO A;  3DTI A;  3ZQI A;  1Y0N A;  5LRS A;  4ER3 A;  2DFI A;  4B3A A;  1EFA A;  2DLL A;  3Q0U A;  2P5K A;  2IT0 A;  1SFK A;  3I4P A;  4EJW A;  5E79 C;  4FX0 A;  3ZQQ A;  4WXD A;  1W0U A;  1ZG3 A;  4L9V A;  4CCK A;  2VQC A;  3IV5 A;  1VI0 A;  1IN7 A;  2O7O A;  1MSE C;  4EVI A;  4BEH B;  1HW1 A;  1LB2 A;  2OTJ I;  2FUG 2;  3SFZ A;  4S0H B;  1YQA A;  2M3A A;  4CIC A;  3J7A Y;  1XWR A;  4BXX J;  1LFP A;  3W2V A;  3S3N A;  2J7U A;  4E7L A;  2L0K A;  2VKD A;  3D5R C;  2LK2 A;  1VQ9 I;  4KIC A;  2BNN A;  1D0Z A;  1TBX A;  3HB9 A;  1TNT A;  5HDN A;  2HYJ A;  2LTP A;  3LSJ A;  4M9S A;  3WHC A;  4C2T A;  2WA0 A;  2KIF A;  5EF6 A;  3WTU C;  3BCB A;  1MNM C;  1FMV A;  1QZX A;  1OR7 C;  1T0F C;  2W24 A;  3O8H A;  4D7N A;  3LFP A;  2XAH A;  3CLC A;  3MKL A;  2IGM A;  4Z2Y A;  3D0S A;  3UNG C;  2ECC A;  4WK8 F;  3GFM A;  3KP7 A;  1POG A;  2XRO A;  1ZYR F;  3HTU A;  1ZRD A;  3FXM A;  2VJ5 A;  5LEK A;  2NS0 A;  1S3J A;  2BEO A;  4WX9 A;  2X51 A;  1H8A C;  1NK2 P;  3LSI A;  3TEL A;  5DTM A;  3RZZ A;  1QPM A;  2HOA A;  4EKI A;  1LDD A;  2HQN A;  4G7H F;  3OIP A;  1T98 A;  3JXB C;  2DA6 A;  2VPR A;  3JRB A;  1VQ7 I;  4KNY A;  2LP0 A;  2XKO A;  2OAZ A;  2WV1 A;  3U1K A;  1VQ4 I;  1LFB A;  1HDD C;  2CW7 A;  3G1L A;  1HQ1 A;  1LDJ A;  3ZMV A;  3D1N I;  4MNU A;  4U7B A;  3P7N A;  4B4C A;  1K61 A;  3BG3 A;  1FWZ A;  4I01 A;  3OYD A;  1B72 B;  2VBX A;  2ZXW H;  4XLH A;  3OWT A;  1B59 A;  2J7W A;  3K9T A;  5GTH C;  1H0M A;  2GA1 A;  1XSX A;  2PMU A;  3E7L A;  2P5L C;  4IZZ A;  4R79 A;  1F5T A;  3GTP J;  4CYD A;  2Z1D A;  4CHU A;  2MYS A;  4ZDP A;  2VE9 A;  5IT3 A;  2KL4 A;  3MD2 A;  2QUF A;  2KLO A;  5JHU A;  2R5Y A;  1HQC A;  1A6I A;  2JCG A;  2R7T A;  3HZI B;  3ROU A;  3IH3 A;  1X1D A;  1S29 A;  2MEZ A;  1XB4 A;  1MBH A;  1GUU A;  3F6W A;  1KU2 A;  1V4R A;  2PXL A;  1K4T A;  2DI3 A;  3B73 A;  2WAD A;  2LFB A;  5B5E C;  2R4G A;  3RI4 A;  1D8J A;  5F0H A;  3WU1 B;  1KGS A;  3CRO L;  5AIQ A;  1XC5 A;  5C3E J;  3BY6 A;  1YLF A;  1P9Q C;  4OMZ A;  2E7W A;  2FX0 A;  2VQL A;  2ZJR F;  5JI6 A;  4MEX F;  2AXZ A;  5F6F A;  2KRH A;  1BM9 A;  4B44 A;  4MTD A;  3MKZ A;  4M74 A;  1ONV A;  3BOQ A;  2GXB A;  3LQR A;  1Z1D A;  4LB5 A;  4IEJ A;  3SR4 A;  2IPQ X;  3BZ6 A;  2BW3 B;  2Z99 A;  4NBQ A;  2OJE D;  2PUD A;  1ETV A;  4B1R A;  2IVQ A;  3OL4 A;  3G0T A;  2VJI A;  2MD0 A;  3L2W A;  2BHY A;  1MMN A;  2OPT A;  4XKV A;  3S1Q J;  5LBQ A;  4OAZ A;  3A0H C;  3HGY A;  4PSX A;  3ABK H;  3JRD A;  2GZU A;  3OIO A;  3TGN A;  3GWZ A;  2JN6 A;  2DJN A;  2HPI A;  4CO8 A;  4RMN A;  4XRS G;  2L9S A;  1HXD A;  4A69 C;  4BH9 A;  1I6H J;  1R5G A;  3VB2 A;  4FTH A;  2CW0 F;  1I6X A;  2NS7 A;  4LIT A;  1RI7 A;  2TDX A;  2M4K A;  1NG6 A;  4GYI A;  4ITV A;  4HRA A;  2DDA A;  1MSF C;  2MSY A;  2F5E A;  3IWF A;  3M8E A;  4BXF A;  3GZD A;  4C2U A;  1AHD P;  3PQK A;  2KRF A;  1X1C A;  1OCC H;  3U1D A;  2ID3 A;  4WXH A;  2VPL A;  3WTT C;  1ZG1 A;  1WQ2 A;  2QQ9 A;  1QB2 A;  3K6G A;  4BGD A;  2R3S A;  1SFO J;  3C2H A;  4M3E A;  4YBA A;  4H0E A;  3CUQ C;  2CV1 A;  1OCT C;  2WIU B;  4CYC A;  1XDU A;  2TCT A;  1O3T A;  3SZT A;  2LSO A;  3SQN A;  3MFK A;  1A6Q A;  1DP3 A;  5K1Y A;  5B3S H;  2B5A A;  1XMX A;  4EJV A;  1BR1 A;  2JK3 A;  2ZC2 A;  2YX7 A;  3SDB A;  3ZQH A;  2WWY A;  4X4C A;  3OQM A;  2BOL A;  4XKC A;  1JJ6 C;  4HOB A;  2KEK A;  2L49 A;  3LFK A;  4MCT A;  2Y9Z A;  2K40 A;  3EUA A;  1AU7 A;  5DTQ A;  4N0B A;  4HV6 A;  2EB7 A;  1XDS A;  1QGP A;  1YW9 A;  3FBI B;  4IA8 A;  3BPV A;  1TT5 B;  4HNV A;  5E3O A;  1WCM J;  3HC7 A;  4RBO A;  2XC7 A;  1WH6 A;  3A9Y A;  4IHX A;  4NC7 A;  1XGO A;  4C9Y A;  4O6J A;  3FMQ A;  3HKZ N;  1S8N A;  3HOS A;  1J0R A;  4QIW N;  5B1A H;  3JTH A;  1FX7 A;  4XL9 A;  2UWM A;  1YX3 A;  2JJ7 A;  3KXA A;  4AUX A;  2QSH X;  5FLX K;  3QPH A;  1ZGJ A;  3KEO A;  2XXP A;  1SFU A;  2JTV A;  1SEU A;  1W4M A;  3HRU A;  3ZMS A;  5DSX A;  2XB0 X;  1WJ5 A;  2GOM A;  2NVX J;  5GAH i;  4JYK A;  4A3L J;  3A9X A;  2QM3 A;  2LF7 A;  3K2Z A;  3LFU A;  4X4D A;  2H09 A;  3RZD J;  1HBX G;  4A93 J;  2J5O A;  4KUM A;  1JKO C;  3GUU A;  3QU3 A;  3RYP A;  3FMS A;  1CJG A;  4ANJ A;  4AVZ A;  2OFY A;  4ZDL A;  2VOP A;  3HOZ J;  4GYG A;  3KP4 A;  2IS6 A;  1GHC A;  4B09 A;  2ZME C;  2XIU A;  4RAG A;  4KN4 X;  1ZAY A;  2GXA A;  4P55 A;  3HOX J;  4ZYG A;  2ELK A;  2MG4 A;  2QGU A;  3GME A;  5ICE A;  5IP7 J;  2XSD C;  3HDD A;  2O61 A;  1BW5 A;  4A3K J;  3ABL H;  4XLN F;  2CUF A;  2DMN A;  2MA3 A;  4HAM A;  3PIO F;  3A01 B;  2BY0 A;  3BZC A;  2PXT A;  3DXJ F;  2VBW A;  1E3O C;  2STW A;  3M8F A;  1WKM A;  2AUW A;  3LA7 A;  1U3E M;  1ZRF A;  3JCU C;  4YEL A;  2Y31 A;  1ZLK A;  4PJM A;  3I55 I;  3FIW A;  5DRY A;  2AHQ A;  4LK1 F;  1ZGW A;  3QWG A;  1XPX A;  4M3D A;  2JUC A;  3ME5 A;  4KT6 A;  1RIO H;  1JT6 A;  1Z7U A;  2R5Y B;  4F55 A;  2BNO A;  3PFY A;  3BRO A;  4BAC A;  1LEB A;  1WGX A;  2OQR A;  5KAI C;  4ENM A;  3J7Z I;  4G7Z F;  2FE3 A;  1LCC A;  4FCY A;  1BOB A;  1QHH D;  3EET A;  4EQZ A;  3NXH A;  2CYY A;  3C2B A;  4NDW A;  3K4J A;  2CQN A;  2PXD A;  2BE5 F;  1G8X A;  2WAQ A;  4W1U A;  2HSG A;  3V7S A;  1R1V A;  4QLC U;  5F64 A;  1B1B A;  2RV8 A;  4RM3 A;  2HPM A;  3PO3 J;  2D2W A;  3KZ3 A;  4DBR A;  4ENN A;  5D8K B;  3H3U A;  3K1P A;  1BIB A;  5CYV A;  2DA3 A;  3TMO A;  3TW6 A;  5LLQ A;  5DT2 A;  3GFJ A;  2VBY A;  3I58 A;  2K9M A;  2DK8 A;  5FLM J;  5B66 C;  3E6B A;  3CDH A;  3IHU A;  2HI3 A;  4LMY A;  4Z5C A;  2VXD A;  4QSH A;  2FA5 A;  4MTE A;  1HOM A;  3CMA I;  3M9A A;  5JUW A;  1LPQ A;  3SCF A;  1WPK A;  3JXD L;  4EMS A;  4DYC A;  3CF5 F;  1QA6 A;  1D1B A;  1LVA A;  4E7K A;  5EJC A;  2IA0 A;  2E36 A;  1UZC A;  3HKZ A;  1LE8 A;  4MQV A;  3SEQ A;  1J2X A;  3BQY A;  2QWW A;  3K70 C;  2CW8 A;  3DCF A;  3NWS A;  1V55 H;  3CES A;  3I4M J;  3FF5 A;  4B47 A;  5L3B A;  1VF9 A;  2VLA A;  2XDV A;  4X4F A;  1FSE A;  4BL0 B;  1V3F A;  3VYR B;  3QWL A;  3RQ4 A;  2EH3 A;  2O8K A;  3PIP F;  4J01 A;  1OYI A;  3C1D A;  2L7Z A;  2DN0 A;  3WU2 C;  4U87 A;  2Q2E A;  2KHM A;  3S8P A;  1D5Y A;  3OMT A;  2L02 A;  3I59 A;  3GTO J;  5J40 A;  1EA3 A;  5EEG A;  3SZG A;  3TOB A;  4U7D A;  2YUS A;  2EV5 A;  2XF6 A;  1T08 B;  3FMR A;  4U0W A;  1ZAR A;  2O49 A;  1S7O A;  5C4X J;  4CYC B;  1YS7 A;  1Z05 A;  3KFW X;  4LLN A;  3FZV A;  1OKR A;  3EQL F;  3GLL A;  2X6Y A;  1QRY A;  4IKF A;  5D4R A;  2L7M P;  4Q2J A;  2QA4 I;  3CJQ B;  3W6J B;  3LNQ A;  1X1B A;  3CQZ J;  3T8T A;  2OF7 A;  2EFQ A;  1FIA A;  1J9I A;  2XAJ A;  1FTZ A;  1QP0 A;  3DKW A;  4Q48 A;  1YJN I;  5AIP A;  5D5U B;  1R00 A;  3TDU C;  4UNO A;  4AM3 A;  3MN2 A;  3OKZ A;  1MND A;  3ZMD A;  2DT6 A;  4LFU A;  4BKX A;  2X6O A;  2H27 A;  1R69 A;  2R92 J;  2QSF X;  1U5T C;  1KYZ A;  4II2 A;  3TFL A;  5LFA A;  3RTR A;  1TW3 A;  2ZFW A;  2IS2 A;  3OS0 A;  3H5N A;  4A6E A;  2KPM A;  4ZDO A;  3JW4 A;  2GRL A;  1R4N B;  2LKX A;  3M8J A;  1UTX A;  1FZP B;  2KRC A;  5F0F A;  2IBD A;  2M7A A;  2R5Z B;  2AS5 F;  1RPW A;  3DBR B;  3C2G A;  5J1R A;  2OC6 A;  3OYI A;  4LG0 B;  1A31 A;  2MLG A;  4KT5 C;  4N9I A;  2O0Y A;  2ZXI A;  3WU0 A;  2ELJ A;  1IDY A;  2NXN B;  1N77 A;  1W1W E;  2RKH A;  1FMW A;  4IHS A;  1DW9 A;  3SFI A;  2Y0S N;  2VL8 A;  5E1W A;  4A6D A;  1RES A;  5BOX A;  4G6T B;  4P9F A;  5CVJ A;  2G9W A;  3R09 A;  5DCM B;  3ZQ7 A;  4G7O F;  3ZHM A;  1U6G A;  3TDZ C;  4BHB A;  1XMA A;  3BDD A;  4U88 A;  5B1B H;  2KT0 A;  4IWR A;  4M3B A;  1XGS A;  3BR1 A;  1DUL A;  4ON0 A;  3L2U A;  2GQQ A;  1BJA A;  1ZLJ A;  1OFC X;  2JSP A;  3R6S A;  2QEX I;  1QP7 A;  3KP6 A;  1V54 H;  1MBJ A;  4BNC A;  5FD5 A;  1ZGA A;  2YU9 J;  2VIX A;  1P92 A;  2LC2 A;  4FE7 A;  3GTK J;  2X6W A;  3UR3 C;  2LDU A;  1KYW A;  3GFI A;  3ONQ A;  2BVL A;  2RAE A;  3HUG A;  2KQR A;  1TWG J;  5LD2 C;  3FDY A;  5FD6 A;  3VSK A;  2OV7 A;  2LCV A;  1SAN A;  3FXO A;  3JTG A;  4O8B A;  1QZY A;  1V5F A;  2EZK A;  3VWS A;  2XI8 A;  3DKY A;  2CRG A;  2HQR A;  4XKW A;  1E3P A;  1LKX A;  1MH4 A;  1XD7 A;  2M1B A;  5CPR B;  4Y7N J;  2LY1 A;  2K02 A;  2ICT A;  5DTR A;  1J5Y A;  4IVN A;  4XRF A;  1JJ8 C;  1F1Z A;  3N05 A;  2EBY A;  1R5I D;  2O03 A;  3SYT A;  4D5C A;  3JRA A;  4XRS A;  3F3X A;  3M7G A;  1KU9 A;  4UHT A;  1BC7 C;  2LYJ A;  1YIJ I;  1JGG A;  3R0J A;  3FXU A;  1UMQ A;  5IOY A;  2LYC A;  2IRF G;  3ERM A;  2PUA A;  3PQJ A;  2R7D A;  1SFX A;  4S04 A;  1DDN A;  1NW3 A;  2W85 A;  3CTA A;  2L8N A;  1SVO A;  3LSR A;  2QQA A;  1X3W B;  2V1N A;  2HVQ A;  2X85 A;  3DF8 A;  1LE8 B;  1SD6 A;  1Z91 A;  1O57 A;  1G6N A;  2V9V A;  4P9U A;  4XOT A;  1KQ8 A;  3TL4 X;  5F04 A;  1PRA A;  5DV5 A;  2X1E A;  4DIQ A;  2A6H F;  1ZRE A;  2JQ7 A;  2K7L A;  4ABZ A;  1SVL A;  4GCV A;  3E3V A;  3GW2 A;  4EEF G;  1VQN I;  2BXY A;  1TZL A;  4IVZ A;  2Z2S B;  3HZJ A;  2XPU A;  2R1J L;  1MIJ A;  2OR1 L;  3CP2 A;  1BW6 A;  1I3A A;  3V8L A;  3K4N A;  2P8T A;  4RLQ A;  2EBI A;  3HRT A;  5F27 A;  1ZG5 A;  4ZTJ A;  3CC4 I;  3HSF A;  5H6R A;  4EJO A;  2I10 A;  3SX0 A;  1X1P A;  4D9J A;  2F4I A;  2Y0S A;  3NAR A;  2AQF A;  1G2H A;  2PUG A;  3Q5F A;  1DPR A;  4HQM A;  1FOY A;  3AFH A;  5DM7 F;  2OUM A;  4BY1 J;  1YYV A;  1SD5 A;  3KJX A;  2ID6 A;  1XS9 A;  2IV1 A;  4Z5D A;  3KX2 A;  4HEA 2;  4A5M A;  1X4P A;  1PUF A;  2QBY A;  1JH9 A;  1PUE E;  2L9N A;  5H2F C;  5IT9 Z;  3F51 A;  1B6A A;  1YTY A;  1PDN C;  3H5T A;  3Q0W A;  5ICF A;  3COA C;  3O3K A;  2IS4 A;  3LSG A;  4PFO A;  4Y13 A;  5HS9 A;  2IGN A;  3RPU D;  3QYX A;  2W4S A;  3VYS B;  4DGW B;  2VOD A;  3KYL A;  2IGK A;  3WTZ A;  1YO5 C;  2E2J J;  2F5V A;  2JA6 J;  1SD7 A;  3HPH A;  4I2O A;  3O8G A;  1K78 A;  3KZZ A;  5IP6 A;  3BWG A;  3GTQ J;  3CCR I;  4Y42 A;  4DE9 A;  2H94 A;  4DE8 A;  1SAU A;  2VN2 A;  4BE2 A;  4Z58 A;  3PXP A;  3QF3 A;  4HG2 A;  1ZTR A;  5FO5 A;  2BVM A;  1RZR A;  3QRF F;  1BOA A;  2FNP A;  5LGT A;  1IN6 A;  1VQM I;  3A0B C;  5EEH A;  4R8H A;  3CO6 C;  2D1H A;  2VEO A;  2VUM J;  1WI9 A;  2QKL B;  1KON A;  4M9Z A;  2XVC A;  1EH6 A;  1XCV A;  1JTX A;  2CS3 A;  3FBN B;  1W36 D;  1QVT A;  2K9Q A;  3ULQ B;  3MMY B;  4AIK A;  2ZJ2 A;  2A68 F;  4IF4 A;  1F43 A;  2KEJ A;  5FFZ A;  2K9S A;  1EJ9 A;  3BR6 A;  3K4K A;  3OOU A;  1CQT A;  2DQR A;  2HGC A;  1ZZ6 A;  4ER5 A;  4P1W A;  3VOE A;  1Z0X A;  3GTJ J;  1QQI A;  2F6C A;  5D6E A;  2KJB A;  3ZR8 X;  5ILU A;  5FB2 A;  3P5J A;  2K4J A;  2PXQ A;  1JKR C;  1HA8 A;  1MBK A;  2LG4 A;  3GXO A;  4UUT A;  4YG2 F;  3MEJ A;  3FKI J;  3PFI A;  3PL8 A;  2VJ4 A;  4LK0 F;  4AIH A;  1Y9Q A;  1Z3X A;  2IP2 A;  3B02 A;  1X4O A;  2IXS A;  1VTN C;  2LOO A;  3BTJ A;  3HPG A;  3PSF A;  3SJM A;  3KPH A;  4MFD A;  1YJ9 I;  3WGG A;  4ER0 A;  1Y1V J;  2K4B A;  3CUO A;  1EKE A;  4O5V A;  3ZMT A;  3QOE A;  1TL8 A;  3FM5 A;  3FXL A;  4C2M J;  2R7Z J;  4F8D A;  2PPX A;  1Y8Q B;  1P7J A;  2KDZ A;  2PX9 A;  4ZZL A;  2FRH A;  1OSL A;  4MFE A;  1IRF A;  2E1M B;  3QYB A;  3EUH C;  2ZBK A;  2XF5 A;  3W2W A;  4DBQ A;  3CC2 I;  1D0Y A;  5A2Q Z;  1JWL A;  4JQD A;  5DD4 A;  3BG6 A;  1ULY A;  2KJC A;  4LOC A;  2FMY A;  3WGI A;  4ZTF A;  4HF1 A;  3B7H A;  3QQA A;  5J8F A;  4UUV A;  2E7X A;  2FML A;  1CF7 A;  4LGW A;  1ZZC A;  1UAA A;  1R63 A;  2AXU A;  3SHF A;  1Y1W J;  4IHY A;  2HEO A;  3E0J B;  3A4C A;  4KMU X;  3L2V A;  2DFH A;  4BJT A;  2AW6 A;  4GHJ A;  3K0L A;  2M9H A;  1IRZ A;  2MBF A;  2KZV A;  1SVM A;  3F8N A;  1YE9 A;  2XAG A;  3DLA A;  2EFP A;  1LQ1 A;  2E60 A;  2LRE A;  3CME I;  5GAG i;  4Z59 A;  2PBI A;  2A6T A;  3HRS A;  3ESW B;  5FKN A;  3ML6 A;  2L54 A;  1UHS A;  2PFB A;  4XLC A;  4CH7 A;  3H9J A;  2GXG A;  2BNM A;  5E8G A;  3K1M A;  4EJT A;  2DCE A;  1IUF A;  1LCD A;  1IZ1 A;  1IJW C;  3I71 A;  1ZZ7 A;  1FYL A;  4V19 K;  2CO5 A;  3WGH A;  4ZYE A;  3CMY A;  1T8I A;  1WJC A;  4G94 A;  2LKS A;  1ZVV A;  5JHF A;  2ESN A;  3OS1 A;  2IEK A;  2DA4 A;  2NYX A;  3R61 A;  5GPA A;  5M3F J;  2VON A;  2ZJP F;  1W7P A;  3NRV A;  3DQV C;  2F4M B;  4I0A A;  5HS7 A;  2QBY B;  1TQP A;  4IRH A;  3JRI A;  4ZH4 F;  2KEI A;  5C44 J;  4EQQ A;  1IXR C;  1EH7 A;  4PDK A;  4X4I A;  4YIR X;  3PUF A;  3KEY A;  5LGU A;  4BQQ A;  1RZS A;  3GBF A;  2PUF A;  3N97 A;  1IN8 A;  4E7J A;  2B9S A;  1C0W A;  2ME0 A;  3CZ6 A;  1ZK8 A;  1JUP A;  4BQN A;  3AG2 H;  4IHT A;  3KLO A;  2E35 A;  2HVR A;  2OU2 A;  3PNV A;  1K78 B;  5DD8 A;  5IYB J;  3FXQ A;  3G7D A;  3HM5 A;  2EA2 A;  3DBL B;  2DT5 A;  2GZW A;  3A1Y A;  3EYI A;  3WHB A;  4GDF A;  4M6V A;  2HCS A;  1MNE A;  1UFM A;  2M87 A;  3WOD F;  3ZQF A;  3EUK L;  4F7Z A;  3HOW J;  1YOV B;  2LLV A;  2M5W A;  3S1M J;  4E7S A;  2JA8 J;  5FGM A;  2XGD A;  1DU0 A;  1ZPQ A;  3S8Q A;  4M6Y A;  1MZB A;  2CRO A;  3HGG A;  4BBR J;  2R7F A;  5FJ8 J;  2LYQ A;  5KAF C;  6PAX A;  3VYU B;  4A3C J;  2COM A;  2OA4 A;  3BTI A;  4HBL A;  3AL0 C;  2Z5U A;  1PP7 U;  2LF8 A;  2JPC A;  4KJZ A;  4CDG A;  2LVS A;  2OBP A;  2HYG D;  4RB3 C;  1BR4 A;  2RNJ A;  2L7K A;  1HCR A;  3HL2 A;  4RB2 C;  2X4H A;  2EV6 A;  1MGT A;  3QPL A;  5LGN A;  2Q8K A;  3KEQ A;  1TQM A;  3LSK A;  1OCO H;  4AWX B;  2KZ8 A;  4Q4Z F;  3OV8 A;  2EJR A;  5KK1 A;  4HF0 A;  5M3M J;  1HDP A;  1WH5 A;  1MJB A;  3ZCO A;  3FKJ A;  4JK1 X;  4AIJ A;  4PFP A;  2UV1 A;  5BS6 A;  2EFW A;  4L5I A;  5HNF A;  1REP C;  3RKW A;  2EZL A;  3KCC A;  5JFR A;  3CEC A;  2GWR A;  4OOI A;  1WH7 A;  2VXZ A;  5F1J A;  1R49 A;  1IRG A;  2A05 A;  3IKV A;  1LQC A;  4UVB A;  3ABT A;  1W5C C;  3BS3 A;  1ITY A;  4D0P A;  1NTC A;  1LUJ B;  3OOP A;  3JRG A;  3ZPX A;  1ETO A;  1VQ8 I;  1OMI A;  1P4A A;  2E1C A;  2W00 A;  5DM6 F;  1WJA A;  4NNJ A;  3J80 Z;  5L3E A;  2MGQ A;  3QOP A;  4HX7 A;  4OIQ F;  1CF7 B;  3OSF A;  4ER6 A;  4GFB A;  3CP8 A;  2DPU A;  4ENK A;  4I6U A;  2LD5 A;  2XHK A;  4D7M A;  3OSG A;  4CCN A;  1I1G A;  2AXT C;  3D5L A;  1BR2 A;  2PMZ A;  1D1A A;  1ENH A;  3JSP A;  2WAQ N;  3LQQ A;  1XTA A;  3KL4 A;  2DO7 A;  1IDZ A;  1FOW A;  1R58 A;  2YX4 A;  2RQP A;  4FBI A;  2JUG A;  2F48 A; 
#chains in the Genus database with same CATH homology
 1X2L A;  2O49 A;  5C4X J;  1RZR D;  1MH3 A;  4CYC B;  5J1Y A;  2DA5 A;  2LR8 A;  4PU8 A;  3S1R J;  3RQI A;  1QPI A;  1RIO A;  2CJJ A;  1FEX A;  1QRY A;  2EZI A;  2N8G A;  2L7M P;  1VFC A;  3LNQ A;  1PUF B;  1JFT A;  1UG2 A;  3ZOB A;  3LIS A;  1X2M A;  3CQZ J;  2OF7 A;  2HOS A;  1FIA A;  1FTZ A;  1QP0 A;  2JA7 J;  4A3E J;  2EWT A;  1BDH A;  1AKH A;  1JUS A;  2R93 J;  3DNV B;  3OQN A;  3B6C A;  2IVB A;  3JXC L;  3MN2 A;  2CUE A;  3HBL A;  4NDL A;  4XIC A;  4BBS J;  2E2I J;  4BKX A;  2L7F P;  3JRH A;  2X6O A;  2CQX A;  1TWC J;  1R69 A;  3TRB A;  2R92 J;  2KPJ A;  2PMZ N;  3R1F A;  4A3F J;  1PER L;  4DZJ A;  4JCX A;  3BR2 A;  1IC8 A;  3S16 J;  1RR7 A;  2LYS A;  4A3B J;  4X6A J;  1ZKG A;  2GRL A;  2LKX A;  1UTX A;  1LFU P;  3EUS A;  5F0F A;  2R5Z B;  2IBD A;  5EZG A;  1RPW A;  5J1R A;  3RKQ A;  3GBG A;  3S17 J;  1FJL A;  1GDT A;  1ETX A;  2HIN A;  1QQA A;  4I76 A;  1XG1 A;  2E19 A;  2LYK A;  1MBF A;  4DYR A;  1IDY A;  1QVU A;  3TP0 A;  2X9D A;  3HOV J;  3RZO J;  1GV2 A;  5M5X J;  2MQK A;  1K83 J;  1DW9 A;  3SFI A;  2Y0S N;  2QF7 A;  1RES A;  1B72 A;  5M5W J;  3S2D J;  4OB4 A;  3ZHM A;  5JLW A;  3MVP A;  2M0C A;  5DTD A;  2KT0 A;  4IWR A;  2E2H J;  4M3B A;  3BR1 A;  2DMU A;  3IVP A;  2IAI A;  2ECB A;  2XRL A;  3A01 A;  1OFC X;  1GV5 A;  1UXC A;  2LYR A;  1QP7 A;  2Y2Z A;  4A3J J;  3W6V A;  1MBJ A;  3FYM A;  2YU9 J;  3BD1 A;  3CCY A;  4FE7 A;  3GTK J;  4M3G A;  3Q3S A;  3GTG J;  4GQM A;  3A03 A;  1T33 A;  4Y52 J;  1PRV A;  4A3I J;  2DTZ A;  2L9R A;  2NOG A;  3FK6 A;  2RAE A;  2GM4 A;  2JA5 J;  2M8G X;  4X4G A;  4YG4 A;  1TWG J;  3B6A A;  2HOT A;  2PUB A;  2LCV A;  1ORK A;  1SAN A;  1FIP A;  9ANT A;  1NEQ A;  4O8B A;  2EZK A;  3ZQC A;  2XI8 A;  2MW8 A;  4I6R A;  2CRG A;  2HDD A;  1HF0 A;  1MH4 A;  5IPA A;  2ICT A;  4Y7N J;  5E3N A;  2FJR A;  1JT0 A;  2Y30 A;  1QP4 A;  1MBE A;  1JJ8 C;  1GVD A;  2HXI A;  2EBY A;  3PM1 A;  5F0C A;  4D5C A;  2EF8 A;  4L5E A;  4C3I J;  3JRA A;  1ETK A;  4XRS A;  1YRN B;  5E3M A;  3BG5 A;  2AO9 A;  1DU6 A;  2LYJ A;  2DMP A;  1JGG A;  2PUC A;  5IOY A;  1UMQ A;  3G1M A;  1BL0 A;  3BTL A;  3FIS A;  2PUA A;  1ZR4 A;  5HOD A;  5EGO A;  1ZR2 A;  3U3W A;  1IG7 A;  2D5V A;  2GRM A;  3HOU J;  2G0E A;  3K2A A;  2NS8 A;  1JFS A;  3CDL A;  5GP9 A;  3LSP A;  2R0Q C;  2L8N A;  3LSR A;  1I3Q J;  3GN5 B;  3SCH A;  2XGC A;  3K7A J;  2X48 A;  1LE8 B;  2GLO A;  1B8I B;  4J1X A;  1ZZ9 A;  3JRE A;  2LY9 A;  4JX4 A;  2CQQ A;  4J1W A;  5EEA A;  5F04 A;  3ZQI A;  1PRA A;  4B3A A;  1EFA A;  4ABZ A;  3Q0U A;  3F52 A;  4EEF G;  3VK0 A;  3BR0 A;  1ZZB A;  4IVZ A;  1W0U A;  4FE4 A;  5EG0 A;  2R1J L;  2VKV A;  2XPU A;  3IH4 A;  2VKE A;  3LOC A;  1BW6 A;  3IV5 A;  1POU A;  1VI0 A;  4A3D J;  3JRF A;  2O7O A;  3FMY A;  1MSE C;  4UUS B;  1OCP A;  2EBI A;  5F27 A;  5IYC J;  3QQ6 A;  2NVY J;  4S0H B;  2I10 A;  4FIS A;  2LYP A;  1HLV A;  4PU4 C;  4I6Z A;  1XWR A;  3S8Q A;  3NAR A;  1S7E A;  4BXX J;  1B0N A;  2NVT J;  2EZH A;  1G2H A;  3Q0V A;  2PUG A;  2L0K A;  2A6C A;  2LK2 A;  1PNR A;  4RDU A;  3OP9 A;  2BNN A;  4YAR A;  3HB9 A;  2HYJ A;  4BY1 J;  2LTP A;  4Z5H A;  3ZKC A;  2E1O A;  3LSJ A;  3WHC A;  2ID6 A;  1APL C;  3KJX A;  1XS9 A;  2IV1 A;  4Z5D A;  1PUF A;  3BQZ A;  5EF6 A;  1JH9 A;  1MNM C;  3F51 A;  1AKH B;  3F0C A;  3H5T A;  1ETQ A;  3BTC A;  3Q0W A;  1SQ8 A;  4JX6 A;  3O8H A;  4D7N A;  3LFP A;  3CLC A;  3MKL A;  3LSG A;  2ECC A;  1POG A;  3QYX A;  1BJZ A;  2JMW A;  5FKO A;  3MLF A;  4M3F A;  2AXV A;  1GT0 C;  5JLX A;  2E2J J;  2JA6 J;  1H8A C;  1NK2 P;  2Y9Y A;  3O8G A;  5IP6 A;  3GTQ J;  2M2E A;  3RZZ A;  2HOA A;  4JP0 A;  4Y42 A;  1BDI A;  2LLK A;  3JXB C;  4Z58 A;  2DA6 A;  2VPR A;  3JRB A;  2R5Z A;  3PXP A;  2LP0 A;  2IUO A;  3QF3 A;  2PE5 A;  2WV1 A;  1ZTR A;  4AYB N;  2JVL A;  2EQR A;  4I6T A;  1RZR A;  1LFB A;  1HDD C;  3G1L A;  2YS9 A;  3SDG A;  3D1N I;  2VUM J;  4B4C A;  3ZHI A;  5FLV A;  5EYR A;  3BG3 A;  1K61 A;  4JCY A;  1B72 B;  1F36 A;  1W0T A;  1X2N A;  1JTX A;  1Q1V A;  3L1P A;  1QVT A;  2K9Q A;  3BT9 A;  2CSF A;  1F43 A;  2KEJ A;  2O4A A;  2K9S A;  4D5F A;  3BR6 A;  3OOU A;  3E7L A;  1U9O A;  1CQT A;  1ZZ6 A;  2B63 J;  3GTP J;  1Z0X A;  3GTJ J;  1RET A;  4YG1 A;  5K7F A;  2R5Y A;  1A6I A;  1JKR C;  2JCG A;  4FN3 A;  1MBK A;  3HZI B;  3IH3 A;  4UUT A;  2IVG A;  1U78 A;  3FKI J;  1Y9Q A;  3S1N J;  2MEZ A;  1MBH A;  1GUU A;  2H1K A;  4C3J J;  3F6W A;  5A7L A;  1WIZ A;  2LFB A;  3BTJ A;  3HEF A;  3SJM A;  2NVQ J;  4MFD A;  5F0H A;  3CRO L;  2XB5 A;  1XC5 A;  5C3E J;  3I4N J;  1Y1V J;  2DA2 A;  3HOY J;  1VND A;  3IH2 A;  2FX0 A;  2AXZ A;  4C2M J;  3FYA A;  3BR5 A;  5GPC A;  2R7Z J;  4F8D A;  2PPX A;  3FK7 A;  1P7J A;  1ETW A;  2KDZ A;  1ZS4 A;  1OSL A;  2PIJ A;  4IEJ A;  4MFE A;  1WI3 A;  1X57 A;  4PU7 A;  2CU7 A;  1DWK A;  2PUD A;  1ETV A;  4B1R A;  3M3Y J;  2IVQ A;  4MLO A;  2PUE A;  4DZP A;  5EDN A;  1JWL A;  1YRN A;  2OPT A;  4JQD A;  2IU7 A;  3S1Q J;  5M5Y J;  4LOC A;  5EGO B;  3HGY A;  3B7H A;  3BDN A;  3JRD A;  3QQA A;  2GZU A;  3OIO A;  4I8T A;  4JX5 A;  2JN6 A;  2DJN A;  1ZZC A;  1R63 A;  1PRU A;  2AXU A;  4XRS G;  4A69 C;  1Y1W J;  4IHY A;  1I6H J;  2K9N A;  4DYQ A;  4FTH A;  3PO2 J;  2NS7 A;  2AW6 A;  4GHJ A;  3H3V K;  2M9H A;  1IRZ A;  1MSF C;  5IOZ A;  2MSY A;  2DA7 A;  4XID A;  1AHD P;  5K7Z A;  5J1U A;  5DS9 A;  2XJ3 A;  2ID3 A;  3S15 J;  3TED A;  2FD5 A;  2TRT A;  4DW6 A;  4Z59 A;  5FKN A;  5EG0 B;  1U8B A;  1Y7Y A;  1SFO J;  1UHS A;  4M3E A;  4YBA A;  2DMQ A;  2DMT A;  2WIU B;  1OCT C;  4CYC A;  2TCT A;  5EZH A;  4X4E A;  2B5A A;  2BNM A;  2OR1 L;  3TW7 A;  2JK3 A;  4X4C A;  1IUF A;  3H0G J;  3ZQH A;  1LCD A;  3OQM A;  4A3M J;  5FKK A;  1IJW C;  1JJ6 C;  1ADR A;  2KEK A;  1ZZ7 A;  2L49 A;  2P81 A;  4A3G J;  4MCT A;  3CMY A;  2Y9Z A;  2K40 A;  4V2G A;  1AU7 A;  1ZVV A;  3JR9 A;  2HQ5 A;  4IA8 A;  2IEK A;  2DA4 A;  5GPA A;  2COB A;  5M3F J;  2XCJ A;  3TP3 A;  4HNV A;  5E3O A;  3S14 J;  1WCM J;  4RBO A;  1WH6 A;  1ZZ8 A;  5IP9 J;  4IHX A;  3JRI A;  2KEI A;  4X1E A;  5C44 J;  4W97 A;  1O4X A;  3HKZ N;  4X4I A;  5E3L A;  4QIW N;  1RZS A;  2XPV A;  2JJ7 A;  3KXA A;  3GBF A;  4AUX A;  3UFD A;  2PUF A;  1R9T J;  1RPE L;  3O9X A;  2ME0 A;  1BA5 A;  1ZK8 A;  2XB0 X;  1ZQ3 P;  4G12 A;  1JUP A;  5K7H A;  2NVX J;  1Z77 A;  1QQB A;  4JYK A;  4A3L J;  5BNG A;  2H8R A;  1A5J A;  4X4D A;  3RZD J;  2ICP A;  4A93 J;  1JKO C;  5IYB J;  3OQO A;  1IV6 A;  3G7D A;  3HM5 A;  1H89 C;  1H88 C;  1CJG A;  1WET A;  4X4B A;  2GBY A;  3WHB A;  2OFY A;  4M6V A;  4BY7 J;  3ZQF A;  3HOZ J;  2M34 A;  5J3L A;  3HOW J;  2XIU A;  2O9L A;  1ZAY A;  3S1M J;  1TWF J;  1RKT A;  3HOX J;  2JA8 J;  2ELK A;  2XGD A;  1DU0 A;  2MG4 A;  5IP7 J;  1BW5 A;  1ZPQ A;  2XSD C;  4X4H A;  3HDD A;  3BR3 A;  2CRO A;  4A3K J;  3HGG A;  3ZQL A;  2VI6 A;  4BBR J;  2CUF A;  2DMN A;  3A01 B;  5FJ8 J;  2LYQ A;  1VPW A;  2QCO A;  1E3O C;  4A3C J;  2FJ1 A;  2AUW A;  2XGE A;  3BTI A;  2HXO A;  2R63 A;  1I50 J;  2Y31 A;  4IHV A;  3FIW A;  2AHQ A;  2LVS A;  1ZGW A;  1NER A;  3QWG A;  4M3D A;  1HCR A;  1JT6 A;  1WH8 A;  2R5Y B;  3QPL A;  2BNO A;  4MO7 A;  2KZ8 A;  2LYL A;  1WGX A;  1JUM A;  1P7I A;  5M3M J;  4FCY A;  1JKP C;  1LCC A;  1HDP A;  2WB1 N;  1WH5 A;  4MIM A;  2DA1 A;  4NDW A;  1T56 A;  3C2B A;  2ME6 A;  3JRC A;  1YSE A;  1TWH J;  4C3H J;  4W1U A;  2AWI A;  2XPW A;  2EZL A;  1ZUG A;  4PU3 C;  2HSG A;  3CEC A;  3PO3 J;  4MCX A;  3M4O J;  3KZ3 A;  5IYD J;  1WH7 A;  2BJC A;  3A02 A;  3VPR A;  5F1J A;  1LQC A;  2DA3 A;  3ZQG A;  4V2F A;  1TWA J;  1U9N A;  3TW6 A;  3BS3 A;  1LLI A;  1ITY A;  2O38 A;  1NTC A;  5FLM J;  2FQ4 A;  2JWT A;  3JRG A;  4Z5C A;  1ETO A;  2HI3 A;  3BG9 A;  5FKL A;  4QSH A;  1HOM A;  4XRM A;  1EF4 A;  3G5G A;  3SCF A;  5C4J J;  1WPK A;  3JXD L;  3UKG A;  1LMB 3;  4DYC A;  3S2H J;  1FTT A;  3GN5 A;  2MGQ A;  1X58 A;  3GTL J;  4AC0 A;  5FKM A;  1LE8 A;  2W48 A;  1UXD A;  1B8I A;  3G1O A;  3OSF A;  4QTR A;  3BQY A;  3QPS A;  4XK4 A;  4GFB A;  5K98 B;  4IHW A;  3GTM J;  4I6U A;  2ZB9 A;  3DCF A;  2LD5 A;  4D7M A;  3I4M J;  3OSG A;  1VF9 A;  4J19 A;  4X4F A;  1JKQ C;  1RKW A;  1TC3 C;  3SCG A;  3NAU A;  1OJL A;  4YG7 B;  2EH3 A;  1ENH A;  2O8K A;  2WAQ N;  1L1M A;  2L7Z A;  2DN0 A;  1IDZ A;  5F08 A;  1D5Y A;  1JTY A;  3OMT A;  1IGN A;  3DEW A;  1QPZ A;  3GTO J;  1NK3 P;  1MBG A;  1ETY A;  4FBI A;  2YUS A;  2WUS R;  4UUS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...