1IC8A

Hepatocyte nuclear factor 1a bound to dna : mody3 gene product
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
190
structure length
170
Chain Sequence
KELENLSPEEAAHQKAVVETLLQEDPWRVAKMVKSYLQQHNIPQREVVDTTGLNQSHLSQHLNKGTPMKTQKRAALYTWYVRKQREVAQQFTHARNRFKWGPASQQILFQAYERQKNPSKEERETLVEECNRAECIQRGVSPSQAQGLGSNLVTEVRVYNWFANRRKEEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords 5'-D(*CP*TP*TP*GP*GP*TP*TP*AP*AP*TP*AP*AP*TP*TP*CP*AP*CP*CP*
publication title Diabetes mutations delineate an atypical POU domains in HNF1-Alpha
pubmed doi rcsb
source organism Homo sapiens
total genus 50
structure length 170
sequence length 190
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-03-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1ic8A02
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 1ic8A01
1WH5A 4IVZA 1ZZ6A 3HZIB 4M3DA 4AC0A 5IPAA 4Y52J 3JXCL 1IUFA 2N8GA 4XK4A 2LYRA 4S0HB 3CQZJ 4A3CJ 1QP4A 1ETYA 1GV2A 2DA6A 3QPSA 2DMNA 1ZKGA 5IYDJ 1TWFJ 4M3FA 2PUDA 5F1JA 1NERA 1GUUA 3MVPA 3MN2A 4X4GA 3BG5A 1IV6A 4Z58A 1OJLA 3D1NI 4X4CA 1XG1A 3S1NJ 1ZZ7A 1AKHB 3HKZN 4I6TA 3FK7A 1R63A 1SQ8A 2LKXA 1WGXA 3NAUA 1W0TA 1DU0A 3A02A 1BL0A 2NS7A 3BR5A 2WUSR 2M34A 2EF8A 3H0GJ 1MBKA 3Q0UA 4IHWA 2B63J 3GTKJ 1TWCJ 1I3QJ 2X9DA 1ZR2A 4MFDA 3FIWA 4A3FJ 4V2FA 1U78A 1A5JA 2O4AA 2L7ZA 3TRBA 4NDLA 1RZRD 3GN5B 4FCYA 1LQCA 3BD1A 1MBGA 3BS3A 4JP0A 2LVSA 2A6CA 3CLCA 3ZQLA 1GVDA 3O9XA 3BR6A 2DN0A 1WH7A 4Z5HA 3GBGA 3CCYA 1JT0A 4D5FA 1UHSA 1W0UA 3HGGA 3K7AJ 2HINA 1NK3P 3BR0A 3BTLA 4A3GJ 3B6AA 1ETOA 3IH4A 3PM1A 1MBFA 4OB4A 4DZPA 1QRYA 5F04A 2OR1L 2VPRA 2IVQA 3HGYA 1YRNB 4X4HA 4UUSA 2YU9J 4C3HJ 4Z59A 1U9OA 2DMPA 1HDDC 4J19A 1MH3A 3JREA 3LFPA 1ZTRA 4NDWA 4BY7J 2X6OA 5K98B 3S2HJ 2B5AA 1QVTA 1ZGWA 5FKMA 1B8IA 3F6WA 2HOSA 1BW6A 1B0NA 1ZZ8A 5M3FJ 3KJXA 1ADRA 2JA5J 1Y1VJ 2R5ZA 1UTXA 1JKRC 3TP0A 3E7LA 3H3VK 4GFBA 2AUWA 3OP9A 4MIMA 3MKLA 2I10A 1Y1WJ 1RR7A 2XGCA 2NVQJ 2DMQA 3HOUJ 2IUOA 4M6VA 2E2IJ 5EGOB 3LSRA 3I4NJ 2FX0A 5EF6A 3KZ3A 3LSJA 2R5YA 1GV5A 5JLWA 2JMWA 3HOYJ 4YARA 4QSHA 1K61A 3SJMA 1ZZCA 3CROL 4HNVA 4FN3A 2MEZA 1LCCA 2VUMJ 5EZGA 3S1RJ 1MNMC 4MCTA 4BBSJ 3RKQA 1ZZ9A 3PXPA 1S7EA 3VK0A 1JKOC 2L8NA 2EBYA 1ZQ3P 3JRCA 2H8RA 2JA7J 2XIUA 1FTZA 3OOUA 1P7JA 2Y0SN 1VI0A 2XGDA 3DEWA 2PUBA 1A6IA 4I76A 5EZHA 2R93J 1LLIA 4X4EA 1IGNA 1MBEA 1X57A 1GDTA 1LFBA 4MO7A 2L7FP 5IOZA 1POUA 2DMTA 2XGEA 2Y30A 3OMTA 3A01B 5IYBJ 5J1RA 3CMYA 5GPAA 3JRHA 4FTHA 1RZRA 5E3MA 2LYKA 3HOVJ 3I4MJ 3QYXA 1IG7A 3ZQHA 3JRGA 3S16J 4PU7A 5IP9J 4BKXA 4IHXA 4XRMA 1RPWA 3FK6A 2JCGA 3U3WA 5IYCJ 5C3EJ 1ZR4A 1JFSA 1BDHA 1MBHA 5IP6A 1O4XA 2EZHA 1PUFA 4A3LJ 3JRBA 2IVBA 2KPJA 1MBJA 3LISA 2CUFA 1H89C 4A3DJ 4PU4C 2WV1A 1PRVA 3VPRA 3HDDA 5BNGA 3RZOJ 2L7MP 1PERL 3GTJJ 5M5YJ 1YSEA 2LFBA 1IC8A 5FLVA 1QPZA 1TWGJ 4JX6A 1NK2P 3FYAA 1K83J 2XPVA 1TC3C 5A7LA 1ENHA 4M3EA 3UKGA 9ANTA 2MSYA 1HCRA 1DU6A 4Y42A 2LLKA 2M2EA 4JQDA 3ZQCA 1SANA 2ELKA 2PMZN 2HOTA 2LYPA 2ID3A 2YUSA 1ITYA 3BR3A 2DMUA 2QCOA 2VI6A 2XSDC 1Y9QA 2L49A 1Y7YA 1B72B 2R7ZJ 4JX5A 2XB5A 1WI3A 2M9HA 2LR8A 1HLVA 1F43A 2LYSA 1AKHA 2AHQA 3S14J 2IAIA 5J3LA 1JKPC 2GRLA 2FQ4A 3BT9A 2PE5A 2ECCA 1JT6A 4YG7B 1G2HA 1JH9A 3K2AA 3FISA 1SFOJ 2PUAA 2HOAA 2CU7A 2GLOA 2VKVA 2MGQA 4I8TA 3UFDA 1H88C 5F0FA 4DW6A 1WH8A 3GN5A 3CECA 3RZZA 2ID6A 2LP0A 4JCYA 4B3AA 3DNVB 3O8HA 1F36A 1ZAYA 3G1MA 1APLC 1PNRA 3QPLA 1JJ8C 2L9RA 2HYJA 3C2BA 1E3OC 1BDIA 2DA5A 4V2GA 5FKKA 4Y7NJ 1R9TJ 4AUXA 2KDZA 1TWHJ 1FTTA 1QP7A 5EYRA 3ZHMA 2FJ1A 3O8GA 4W1UA 2NVTJ 2XI8A 2Y2ZA 1H8AC 2OF7A 5E3NA 2JA8J 1JFTA 1GT0C 1I50J 2DA4A 4B1RA 1OCTC 2PUFA 4IA8A 2Y9YA 2Y31A 3W6VA 2IVGA 2XJ3A 5FKLA 5FJ8J 1T56A 1ZK8A 4FBIA 3JR9A 2PUCA 2G0EA 3S17J 1NTCA 3NARA 4C3JJ 2WAQN 2HXIA 3BR2A 1ZVVA 2EZIA 1BA5A 1LCDA 1POGA 5E3LA 1X58A 2XCJA 3BDNA 1P7IA 4FE7A 3G5GA 1IDYA 1XC5A 1WIZA 4O8BA 3TP3A 4AYBN 1OSLA 2NVXJ 3ZKCA 1RZSA 4YG4A 2FD5A 4I6RA 3ZQFA 1IDZA 1MSEC 1RETA 4XRSA 4BBRJ 1U8BA 2IV1A 1OCPA 4CYCB 3FMYA 2JA6J 1DW9A 3F0CA 2OPTA 2MW8A 2IU7A 3B6CA 1QQBA 2X48A 1MH4A 4UUTA 4A3IJ 5IP7J 3H5TA 2D5VA 5K7FA 4X4DA 3GTPJ 5EGOA 3WHBA 2CROA 5IOYA 3QF3A 3FYMA 1ZUGA 5J1UA 2PUEA 1FIAA 1UXDA 2K40A 2XPWA 4YBAA 4W97A 3HEFA 2EZKA 1QQAA 2BNNA 3G1OA 1ETKA 5FKOA 5F27A 5C4JJ 1EF4A 3JRFA 1JGGA 5F08A 1JTYA 2WIUB 1QPIA 4XIDA 1LE8B 3OQMA 2BNMA 2MQKA 4DZJA 3ZHIA 1WH6A 2DTZA 3F51A 2EBIA 1AU7A 3SFIA 2QF7A 1FIPA 2DA3A 3M3YJ 1IRZA 4D5CA 2K9NA 4A3KJ 3JXBC 2JVLA 2JN6A 1PRUA 1ORKA 2EH3A 3A01A 4IWRA 4BXXJ 4RBOA 2E19A 4RDUA 2GZUA 1UG2A 2JJ7A 2XPUA 4Z5CA 3ZOBA 5EG0A 4IHYA 4MCXA 1ETXA 4X4IA 2NS8A 5GP9A 2JWTA 1BW5A 3BG9A 2LYLA 2AO9A 4QIWN 1U9NA 1X2NA 2O49A 1QP0A 2PIJA 4JX4A 3WHCA 4X4BA 3R1FA 3IVPA 2CQXA 2MG4A 3BQYA 4YG1A 3A03A 3GBFA 1ZPQA 4M3GA 2OFYA 3S1QJ 2AXVA 3QWGA 2LTPA 1MSFC 2R63A 2TCTA 4I6ZA 3PO3J 3B7HA 4J1WA 3G7DA 2DJNA 2YS9A 2O9LA 2Y9ZA 5E3OA 4XICA 2KEKA 1FJLA 3M4OJ 1UXCA 2ICPA 2K9SA 2W48A 4A3JJ 1X2MA 1XS9A 2E1OA 4IHVA 3S1MJ 2AXUA 2GRMA 3TW7A 3MLFA 2GBYA 1JJ6C 4EEFG 4L5EA 2VKEA 1VFCA 3IH3A 2AW6A 5F0HA 4A93J 4GQMA 3G1LA 4A3BJ 2NOGA 4BY1J 3OIOA 4J1XA 2LY9A 1D5YA 4QTRA 2AXZA 2FJRA 4A69C 2O7OA 5M5XJ 5FLMJ 1B72A 2LD5A 3F52A 5JLXA 3HOXJ 4A3EJ 1RKWA 1VF9A 2NVYJ 2HSGA 1WPKA 4UUSB 1HOMA 2HDDA 4X4FA 3QQAA 2PPXA 2JK3A 3SCHA 3SCFA 4X6AJ 4FE4A 3OSFA 3ZQGA 2KEJA 4M3BA 3S15J 4FISA 3OQOA 2R0QC 2DA1A 5GPCA 2XB0X 3IV5A 4A3MJ 2EQRA 1OFCX 2ECBA 1B8IB 2CUEA 2R1JL 5FKNA 3LSPA 1IJWC 2ICTA 5HODA 1T33A 2R5ZB 1PRAA 2LK2A 2K9QA 2H1KA 1YRNA 1FEXA 4XRSG 3OSGA 3TW6A 2P81A 5C44J 2IEKA 5EEAA 2CJJA 1AHDP 1L1MA 2ME6A 3EUSA 3Q3SA 3TEDA 1R69A 1RIOA 2PUGA 3RZDJ 4PU8A 1Z0XA 1Q1VA 4I6UA 3GTQJ 5F0CA 2R5YB 3CDLA 3BTCA 1TWAJ 2O8KA 3S2DJ 3JRAA 1ETQA 4DYRA 1VNDA 1Z77A 1HDPA 1NEQA 3L1PA 3LOCA 3GTMJ 3HOWJ 2ZB9A 3HM5A 2E2JJ 2O38A 3S8QA 5M3MJ 1ZZBA 3HOZJ 4DYCA 1I6HJ 2CQQA 3LNQA 1ETVA 1LFUP 2BJCA 2DA2A 2IBDA 3JRIA 4JYKA 2GM4A 3HB9A 5K7HA 4JCXA 3BQZA 3FKIJ 4PU3C 4MLOA 2HI3A 2EZLA 2TRTA 4DYQA 3DCFA 2ME0A 5K7ZA 3JRDA 2E2HJ 4CYCA 5M5WJ 2HXOA 1X2LA 1LMB3 3JXDL 3LSGA 3SDGA 1RESA 4X1EA 1ZS4A 1RPEL 1UMQA 1CQTA 1DWKA 1JKQC 3RQIA 4C3IJ 1CJGA 4MFEA 4D7MA 3BR1A 5J1YA 1EFAA 1WCMJ 2COBA 2CRGA 1QVUA 2M0CA 2LCVA 3BG3A 1BJZA 3Q0WA 3HBLA 5DS9A 2HQ5A 4Z5DA 1JUSA 2DA7A 3GTGJ 1RKTA 2KZ8A 3KXAA 3SCGA 4F8DA 1PUFB 1WETA 2KEIA 2XRLA 3GTLJ 4G12A 1LE8A 4B4CA 1JWLA 1HF0A 2AWIA 2M8GX 3IH2A 5DTDA 2R92J 5EG0B 2LYJA 3QQ6A 4GHJA 1VPWA 2LYQA 3BTJA 3OQNA 3GTOJ 4LOCA 4D7NA 2EWTA 2CSFA 2BNOA 1ETWA 1XWRA 2RAEA 2L0KA 1JTXA 1JUMA 2WB1N 5EDNA 3ZQIA 1JUPA 4ABZA 4C2MJ 3PO2J 3Q0VA 2KT0A 4IEJA 5C4XJ 3BTIA
chains in the Genus database with same CATH superfamily
1WH5A 1QQIA 1W5SA 3WE3A 4IRIA 3SZTA 1ZZ6A 1E17A 2Q2EA 4HAMA 2N8GA 4M71A 3F21A 4NUBA 2ZNZA 4S0HB 2RQPA 4HRAA 1S72I 4HRIA 2DA6A 1ZKGA 3ELKA 3WTWC 3ABMH 1U5TC 2PI0A 4HPQA 2VOPA 3HRMA 3K4BA 1QGPA 5GAHJ 2BHZA 3D1NI 2OA4A 3RTRA 2L9VA 1AKHB 3FK7A 3QPHA 1SQ8A 2LNBA 2LKXA 4UB8C 3KEYA 4M72A 1W0TA 1BI3A 3S3OA 1LQ1A 3G4SI 2LREA 2NS7A 4HF0A 2WUSR 2M34A 3F6VA 4WCGA 3Q0UA 1TWCJ 2X9DA 1ZR2A 4MFDA 3ZQ7A 1OYIA 4U87A 2O4AA 1WJFA 3CLQA 4NDLA 5J40A 4HDUA 3GN5B 1K6YA 1MBGA 3FXOA 2FBIA 2L54A 3BS3A 4JP0A 3EYIA 1BR4A 1O3QA 3ZQLA 4PUSA 1W7PD 2FOKA 1HW2A 3R60A 3AFHA 1H9TA 2DN0A 1WH7A 4Z5HA 2DYSH 1XD7A 5A2QK 2Z2SB 2HINA 1NK3P 3BR0A 4S05A 1NHAA 2XAUA 4EKGA 2LOOA 2VT2A 3B6AA 2IS1A 2DFHA 2HTJA 4NB5A 4DIQA 2MLKA 4DZPA 3TO7A 1QRYA 4G8XA 2VPRA 2IVQA 4E7LA 3DKWA 2DI3A 4JK1X 1V5GA 1ZG3A 2DMPA 3MZHA 4MEYF 4J19A 1XMKA 2Z1DA 4YELA 2X6OA 3WGIA 3S2HJ 1QVTA 2BXYA 3F8BA 3KE2A 1Z67A 2VJ5A 4TV7A 2L5QA 3J7YJ 4R79A 5L3CA 3CCSI 1IV8A 2KLOA 3KP4A 5M3FJ 3I59B 2BW3A 2QEXI 5D6FA 3BWGA 1MD0A 2ZXJA 1JKRC 3PE5A 1ZG1A 1VQMI 3H3VK 3IWZA 2AUWA 2A5WA 3OP9A 3OR2C 2HQNA 2I10A 3I5UA 1LVAA 1S3JA 1Y1WJ 2QZ8A 4IRGA 2DMQA 2J5OA 2EFPA 5CPRB 5E20A 3HUGA 5CYVA 2DPDA 3LSJA 3DFGA 5FLXZ 3QU6A 5DDGA 4RMNA 2KIMA 1B9MA 1R1VA 3MQ0A 3HJEA 1K61A 2JPBA 4HNVA 4ENJA 2VUMJ 5EZGA 3KEOA 3S1RJ 2E1MC 3KYDB 5B5EC 2Q0OA 4RAYA 2AQEA 1ZQ3P 2E35A 3OOUA 4DQ2A 4EZIA 2VQGA 1YYVA 4YFXF 4I76A 1MBEA 3M1EA 1YIJI 1X57A 3FXJA 4LLLA 2DMTA 2VJ4A 2XGEA 2HNHA 3HC7A 4OAZA 3OS0A 2EK5A 1A31A 3A01B 2G9WA 4G6TB 5GPAA 1RZRA 2ZFWA 5TRDA 3DPLC 2LC2A 4CSWA 2HEOA 2HVSA 2LYKA 4M9ZA 1IG7A 2YR2A 1A35A 3ABTA 3QRFF 2JTVA 2X0LA 2R7TA 5B1BH 2OUMA 2PJPA 4EV0A 1P6RA 1R5HA 5C3EJ 1ZR4A 1VQ6I 3DP7A 4UXNA 4GRIA 1MBHA 2E1NA 2EZHA 1PUFA 2VE8A 3HRTA 1Z91A 3GLXA 3L2WA 2KPJA 5AIQA 1MBJA 3J81Z 3LISA 3Q5FA 2FUG2 2KP6A 2OV7A 1OKRA 4I09A 5BNGA 1PRVA 3OY9A 2KQRA 2OTJI 2L7MP 1YE9A 3LA2A 4OOIA 4C2UA 2AXLA 3FKJA 3GTJJ 2QQAA 4LK1F 4PZJA 1QHGA 2V9VA 4RAFA 3U2RA 1QPZA 2W4SA 1NK2P 1K83J 1ON2A 1ONVA 2F5DA 2XPVA 3CP8A 2OQRA 3MKYB 2J5PA 2MSYA 1DU6A 1ZG5A 2LLKA 1KU3A 1X19A 2M2EA 5J8FA 3H0DA 5JVGF 3QP5A 1KU7A 5E8GA 3SZPA 2PMZN 3CC2I 2PEXA 2LYPA 4PGHA 2W00A 2ID3A 3KZYA 3TMOA 1ITYA 1OLTA 2QCOA 3OYMA 4E7HA 5E8IA 4A12A 2AS5F 1ZGAA 5DTRA 3TELA 4ESJA 3Q9VA 2HVRA 3C2GA 2M9HA 1HLVA 3CJRB 3ZMSA 2VKDA 3S14J 3SR4A 3AKZA 1J59A 4WF2A 4RGSA 4IO9F 4PJMA 1WJ5A 2OCEA 1G2HA 1SFOJ 3PFIA 2PUAA 3J7AY 2DTRA 4ENNA 1DULA 1U5TB 3L2RA 1MMNA 5H2FC 3J80K 4AIDA 1FT9A 5HLTA 4PGGA 4XKCA 2M8EA 1JE8A 1KQ9A 4DW6A 4KISA 3RZZA 4JCYA 2ID6A 4IQ4A 3F8FA 3CCMI 1F36A 2FEZA 2VC1A 3KLNA 1APLC 1PNRA 1JJ8C 1GVJA 4A5MA 2XKPA 4Y7NJ 1CF7A 1BDIA 1TWHJ 1CGPA 2FJ1A 4EK9A 3JTGA 1U2ZA 4M9XA 2QGUA 2HTSA 4AIHA 5E3NA 4B48A 1OCTC 2PUFA 1QA6A 5AIPA 2OAZA 4XN0A 4NC6A 5FJ8J 3DQVC 1ZK8A 4OIQF 1D8KA 1KU2A 5LHIA 1T8IA 2L9SA 3S17J 2CQNA 3BR2A 3CZ6A 1ZVVA 2VEOA 3M8EA 2P0WA 4ZZLA 2P6TA 5E3LA 5D4SA 3BDNA 1P7IA 4FE7A 2W82A 1IDYA 3OYEA 1OSLA 3ZKCA 1MSEC 2PXVA 1HKSA 3RQ4A 4CYCB 3OYFA 5L3EA 3F0CA 2OPTA 4I0BA 1ZRCA 1WFXA 3LSHA 1V54H 1ZGJA 2JSCA 3H5TA 5K7FA 4X4DA 3M9LA 4F55A 3GTPJ 5EGOA 2P4WA 3BJ6A 2GOMA 4P9FA 3FYMA 3H9JA 5J1UA 2QM3A 1MMSA 2X1EA 1Z7LA 1I1GA 2IA2A 3OYDA 1FIAA 1UXDA 3H1CA 2A07F 4W97A 3HEFA 1VQ5I 2WAQA 2BVLA 1FX7A 4XRFA 5CVJA 1I6XA 2NOJB 2Z16A 5C4JJ 2ESNA 1JGGA 5JUWA 1JTYA 1LJ9A 1QPIA 4XIDA 3V8LA 2QVOA 4XKVA 3U21A 4AYBA 4F92B 5D5UB 4DZJA 3GF2A 3GO5A 3MAJA 1ZLJA 2LSOA 1FIPA 1IRZA 4D5CA 5DM6F 4LLNA 2BZTA 5BPIA 2P5VA 2XUBA 1PRUA 4I01A 1OR7C 2E1MB 2GXGA 5JFRA 4BXXJ 4RBOA 2GZUA 1UG2A 2F4OB 1BR1A 5L3BA 1O3RA 4Z5CA 1VQ9I 4MCXA 1FP2A 1FMVA 2A6TA 2F2EA 4P96A 2LYLA 2A05A 2PXDA 3RCOA 1IXCA 2QSGX 3PSIA 3TOAA 2K4BA 4ITVA 3GWZA 2GXBA 2O49A 1S8NA 2FSWA 1TP4A 1X4PA 1LNWA 2EFWA 5CVRA 1BR2A 2EFNA 4ENKA 3OYJA 3QOWA 4YG1A 1ZPQA 3GZDC 2OFYA 1BM9A 2R7VA 2LTPA 1T38A 1MSFC 4D1QA 2HQRA 4ETSA 3MEXA 2R63A 3A2KA 2A6HF 3G7DA 3DU6A 3ZMDA 3DLLF 2O9LA 3QOPA 2Q8KA 1B1BA 3VSLA 4XICA 1TW2A 3S3NA 3M4OJ 3BZ6A 3C1DA 2VQCA 2DT5A 4RA2A 2K9SA 3MLFA 5HDKA 2GRMA 2O6GE 2GBYA 4GCVA 4HNUA 4L5EA 3IH3A 4E7ZA 3K69A 4GQMA 2KMUA 3HTSB 3I9V2 2HKXA 4BY1J 4CHUA 4QTRA 5DCMB 5DSXA 5M5XJ 1J09A 1HBXG 3F52A 2W1OA 5JLXA 2OJED 2HSGA 1VF9A 2NVYJ 3A0BC 3E97A 1WPKA 1MNEA 4FHTA 2HDDA 3RPUD 2JQ7A 3DBLB 2LF8A 3SCFA 2ZFUA 1GHCA 4II2A 3R09A 1J75A 4M3BA 2P8TA 5J6XA 5ED4A 3PIPF 3LA3A 4I7HA 3ZP5A 5K5OA 2ECBA 2HKOA 2R1JL 5FKNA 1IJWC 2MC3A 3HKZA 1T33A 2LF7A 3CDHA 2W7NA 1JHFA 3WE2A 3BDDA 3FM3A 1YRNA 3WTUC 3TW6A 3OYIA 4AIKA 3N4MA 2IEKA 2CJJA 5D4RA 5D5VB 3EUSA 3K4LA 2BY2A 4KICA 2PXFA 4PU8A 1FWZA 1Q1VA 3GTQJ 2FU4A 4MQ9F 1TWAJ 2O8KA 3S2DJ 3LWFA 1AOYA 3LAPA 2FF4A 4DYRA 1Z77A 1ZREA 3L1PA 3PNVA 2XXAA 2BY3A 2V1XA 2ZB9A 3HM5A 4EM1A 4D0PA 1EV7A 2VBZA 4AD9A 3R61A 2XAGA 2K85A 2CQQA 1ETVA 1LFUP 5GAGi 3JRIA 4BACA 4G7ZF 1WQ2A 1VQLI 3LSMA 4WVLA 2HI3A 4BEHB 1BI0A 4ZDPA 2EZLA 3V7CA 4DYQA 2DBBA 1X1PA 4N9IA 4CH7A 4HV6A 2COMA 3ONQA 4AVPA 1LUJB 2HVQA 1YITI 4BYYA 2XV4S 1CQTA 4ZYDA 1SAUA 2GXAA 1DWKA 5E79C 1JKQC 3ASNH 2G7HA 2KDOA 4L18B 4AIJA 2Y0MA 2CRGA 5E1WA 3MFKA 2KRFA 2LCVA 2HGCA 4Q48A 2LYCA 3BG3A 2FBHA 1BJZA 1FSEA 1TT5B 2UWMA 4UHTA 1SVLA 4KNYA 3KXAA 3BJOA 1WETA 2KEIA 4BDZA 2XRLA 3ZCOA 2QENA 3TDUC 1P2FA 3QOEA 1HF0A 3FX3A 3IH2A 3ABUA 2R92J 2PXBA 3RYRA 4JOMA 3MZYA 5ICCA 2EJRA 3BJAA 1ZELA 3CMMA 3PQKA 2QSHX 2BNOA 4DNCA 2WB1N 3ECOA 4NQWB 2DQLA 2DW4A 4GYIA 3VB2A 2AXTC 4Y4RA 5C4XJ 2K4JA 3GUUA 3IUOA 4EGYA 4X4HA 5FROA 3CMEI 2Y75A 4L5IA 3DXJF 2CS3A 1WWXA 3JXCL 3KZZA 1IUFA 4XK4A 3WTTC 2LYRA 1OCCH 3C2HA 3PNYA 1Y6IA 2W24A 1QP4A 1SMYF 1K4SA 4CDGA 3K9TA 5E18F 2VBYA 2OBPA 4HQMA 2DMNA 1XCVA 1Z3XA 1TWFJ 1Z6RA 3AG3H 4N9HA 2LBFB 3TO6A 1GUUA 5CVIA 3W2WA 5CVVA 5F1JA 4X4GA 2KZVA 3DPTA 4XQFA 1IV6A 4Z58A 1PUEE 4YEJA 1IXRC 1ZZ7A 4RB2C 1D1BA 1R63A 2XXQA 2A69F 3BCAA 2BOLA 3ML6A 1WGXA 3OL3A 3NAUA 2DOFA 4IQJA 3A02A 1BL0A 3OIQA 1USSA 3NXHA 3FXLA 2EF8A 3MZ8A 1Z05A 4XSZF 3W2VA 4IHWA 4U88A 1XDUA 1BI1A 1UCRA 2LNMA 1R1UA 4XL9A 3TEPA 5LRRA 1N75A 2HDWA 3ZPXA 4E4HA 3V8JA 1QB2A 1KA8A 5LD2C 2RNGA 2BV6A 3K4KA 1LQCA 2HWVA 4FX4A 2J7WA 3ZQQA 3SX0A 2LVSA 3CLCA 2M5WA 1GVDA 3QYEA 2M7BA 3IAS2 3CCYA 2LY2A 2A5YB 4ON0A 4KMFA 4EJUA 1UHSA 3GX4X 4HX4A 1I39A 3H5RA 3BTLA 3LL7A 1RRJA 3I71A 3PM1A 1MBFA 5F04A 2JPCA 3HGYA 3AG1H 3W2AA 5D6EA 3GUDA 5CKTA 3WGGA 1C0WA 4C3HJ 2XAQA 3HL2A 3WGHA 3KFWX 1MH3A 3JREA 2HDCA 4BY7J 2XGXA 5LLQA 2B5AA 4BUPA 1ZGWA 2MD5A 2M4KA 2W25A 1B8IA 2JUGA 1OMIA 3MCZA 3F6WA 1BW6A 3DTIA 2IGKA 3DF8A 4DBRA 1Y1VJ 2VB6A 1YO5C 3CP2A 3GYHX 1OISA 2R3SA 2YSRA 5K5QA 4GFBA 3OYAA 2WY8Q 1RR7A 2A3SA 2V4JC 2VQLA 2ZJ2A 1VQNI 2NVQJ 3HOUJ 2UUZA 2IUOA 4M6VA 2E2IJ 3I4NJ 2R7XA 1SD6A 1V55H 3KZ3A 3TOBA 4IHTA 2R5YA 3H3UA 1MDMB 1GV5A 5JLWA 1IN5A 4FT8A 3HOYJ 4RGXA 3L7WA 1Z21A 5LGUA 4FN3A 1ZYRF 2K9LA 1QBJA 2XXPA 1TL8A 3N05A 4BBSJ 4LIVA 1MNDA 1TNTA 1ZZ9A 5LHGA 5DD4A 2KIUA 4P55A 2CYYA 4OMZA 4LB5A 2R7OA 3JRCA 2H8RA 2XIUA 3UWPA 3DEWA 1G6NA 1YOVB 2O8XA 3I3LA 2NYXA 2OTLI 2NXNB 1POUA 5HS7A 4EJOA 5IOZA 4ER6A 2Y30A 1OYWA 2GOXB 5EJCA 2BYVE 2DJIA 2E1CA 2PQ8A 2HQAA 3F72A 3RI4A 3RPQA 1UHWA 3I4MJ 5E17F 2R4GA 1VQ4I 1ON1A 4HNTA 4Q47A 3UR3C 1J7KA 4PU7A 3JRGA 2D2WA 5IP9J 1Y39A 4ER7A 4BKXA 1X1BA 2MLGA 4HX8A 3NDBB 1Z7UA 4XRMA 1RUNA 1RPWA 3FK6A 3WTVC 1L3LA 3L09A 1BDHA 3R0AA 5JHUA 5A2QZ 1MMAA 2EIKH 1QZEA 3H9GA 1IAWA 4A3LJ 5FB2A 2IVBA 2YPRA 3FBIB 3VPRA 3HDDA 4RB0A 4BXUA 2CMPA 4CICA 4L9TA 2ZSHB 3EUHA 2CQ7A 1I27A 4G7HF 3M8JA 4KT5C 1F1ZA 2HZDA 1ENHA 4M3EA 4Y13A 5HNHA 3GZCA 2A6EF 1FOXA 5IT9K 1K79A 1UFMA 1V5FA 2ELKA 3BY6A 4MQVA 3X2QH 1D8JA 3DKXA 2DMUA 2RC4A 4M6XA 2VI6A 3G2BA 2E36A 1Y7YA 4JBAA 1B72B 1ZN2A 4JX5A 5CQEA 3OWQA 1IN6A 1WI3A 2LYSA 3V42A 5B3SH 1AKHA 2AHQA 4EKIA 3QAHA 2YU3A 1JKPC 2GRLA 2FQ4A 2PE5A 1JT6A 4K2EA 2OD5A 4UNOA 3DWLE 4ASNA 2XF6A 1ULYA 4KUMA 2IRFG 3RSNA 2VKVA 3FXUA 3IWFA 3QODA 1FBSA 5F0FA 2HR3A 4A2UA 1GXPA 1R7JA 3CC7I 2E5NA 3GFLA 3CECA 3TL4X 4HLYA 3GN5A 4ER3A 4DBQA 3DNVB 4YIRX 3FMQA 2X6YA 1HSTA 2OZUA 4XSXF 4YIFA 4W1UA 3CD6I 2XI8A 1BIBA 3OS2A 1GT0C 2EA2A 2BHYA 4EVIA 2Y9YA 2Y31A 3W6VA 2M45A 2XJ3A 3RKWA 1I5ZA 3JSPA 1YG2A 4XKWA 2JA2A 3ZRGA 3LSIA 1TTYA 1NTCA 1K7AA 1S6LA 2WAQN 2HXIA 2BEOA 2DQRA 1Q1HA 3V7SA 4EGZA 2PN6A 1BA5A 4IPAA 4CCNA 3E1SA 1X58A 3G5GA 4O8BA 5KCMA 1USTA 4AYBN 1S9HA 2DU9A 4YG4A 2D1HA 3WODF 3I59A 2RN7A 3OYGA 4BBRJ 1U8BA 1OCPA 3FMYA 3FXQA 1DW9A 2O3FA 1U2WA 4B8XA 4ENMA 4KITB 3HHGA 1QQBA 2X48A 3KYLA 5HS9A 3BCBA 4UUTA 4A3IJ 4UVAA 2VE9A 1OCOH 3K10A 3SQNA 3WHBA 6PAXA 2CW8A 5H6QA 1ZUGA 1KYZA 4HA8A 4PSWA 5TGTA 2PUEA 4OAYA 3N97A 1DP7P 1IRFA 3LQXA 1QQAA 2EZKA 3G1OA 5DD8A 2FMYA 3M7GA 5F08A 2YBDA 5HOOA 2WIUB 3KL4A 1LE8B 2L7KA 5L3DA 3G71I 2BNMA 2PXKA 4PJNA 2MQKA 4NC8A 3ZHIA 3F51A 2CW7A 2JRMA 5J8CA 1MFQC 4BGDA 2DFFA 3PQJA 4A3KJ 1L0OC 3IHUA 3WTSC 2JVLA 2ZMEC 3JTHA 4CZCA 3JSOA 4CA0A 2J7UA 4AVZA 3A01A 4KDPA 2E19A 4DE8A 3HRUA 3J80Z 4EMSA 1J5YA 2JJ7A 2XPUA 3FXKA 3QYFA 3ZOBA 4IX7A 5EG0A 1KYWA 4CZZA 5DCFA 3CO6C 1ETXA 1MKMA 4X4IA 1T08B 5GP9A 2ETHA 3F8NA 3IKVA 2PXTA 1R23A 3S3MA 4XKBA 1TQPA 1U9NA 2ADUA 2B0LA 3GFMA 3EUKL 2GA1A 3ZGKA 3WHCA 2QBYB 2PIJA 2PXQA 2XAHA 5DM7F 3BQYA 3A9ZA 3WU1B 4CCKA 1Z3YA 3GBFA 4HV5A 2AXVA 3NWTA 5F6FA 4WXDA 3AG4H 3H3ZA 1MW7A 2DLLA 4I6ZA 3PO3J 3B7HA 1X3WB 1SVOA 3E6BA 4KN4X 3GZ5A 3Q9SA 4UB6C 1SEUA 4LG0B 5K1YA 2KEKA 1FJLA 2AQFA 2VJIA 1YW9A 1J9IA 2W48A 1NG6A 4EM2A 1X2MA 4LITA 2E1OA 4ZH4F 4A3JJ 1XS9A 4G7OF 4NHJA 1JJ6C 2NRAC 2CUJA 2KJBA 2L3DA 1VFCA 2AW6A 2M7AA 4OINF 5K5RA 4A5NA 1R58A 4A3BJ 5FFXA 2DOAA 2QWWA 3G3ZA 4J1XA 2EFQA 3K4NA 4RAZA 1ERDA 2PMHA 2AXZA 4A69C 3ISPA 4CYDA 3KETA 4NNJA 3T0YA 2KL4A 4ANJA 1O3SA 3ROUA 2D45A 4XONA 4XLEA 4UUSB 3I0TA 2EINH 4X4FA 3CC4I 3QQAA 3CCRI 2PPXA 4BS9A 3FF5A 4D9JA 3SCHA 2JZYA 2KEJA 1V3FA 4UY8I 1UG0A 2H94A 3OQOA 2V26A 4OIRF 2FA5A 3BZKA 2DFIA 2RNJA 2EB7A 1R22A 3CJQB 2K9MA 1U5TA 1B6AA 2CUZA 2EQRA 2XHKA 3IV5A 3H9QA 4H4KC 3LSPA 2ICTA 2BE5F 5HODA 2R5ZB 4ESFA 1G4DA 2LK2A 2K9QA 3T5XA 3PNTA 3RJPA 4XRSG 1G3TA 3S2WA 4FX0A 3OSGA 1YJ9I 2LMDA 3PUBA 3HYIA 1AHDP 1L1MA 1SD4A 3H36A 1QZZA 2F5CA 3WU2C 4XLAA 4L9JA 4I6UA 2MFZA 1LEAA 3A1YA 1PJRA 2LY1A 3K1PA 2MH9A 4ZYEA 1TW3A 2OCCH 3WG7H 1HDPA 1P4AA 2F5VA 1EKEA 4BJ6C 2HZTA 4BE0A 1ZZBA 1YW7A 2CO5A 4FETA 4RB1A 3HOZJ 1LFPA 4DYCA 1N78A 2VQHA 2EV0A 3IRRA 1REPC 1R49A 1IN4A 4PJLA 1BN5A 2F5FA 3PUFA 5CQGA 2QLZA 3HTUA 2B9SA 2L1PA 2V3CC 3ZPLA 3E5QA 4I02A 2TRTA 4LGWA 4ZZDA 2VIXA 4AU7A 4F91B 4IZZA 4CYCA 1X2LA 3DTEA 3JXDL 3KIOA 1RESA 1RPEL 1UMQA 4NC7A 3R4KA 4DOZA 3CUQA 4RB3C 3MKZA 2GIVA 3A9XA 3RQIA 4D7MA 2O0YA 2COBA 4B43A 4U0WA 1R4MB 1QVUA 1T95A 2FRHA 1KONA 5DS9A 2HQ5A 4Z5DA 1JUSA 2KZ8A 3SCGA 5JI6A 2K27A 4EM0B 4BHBA 3ZR8X 1T2KA 4ZTFA 2O61A 4EJWA 1PYVA 1JWLA 4GHJA 4IF4A 1YIOA 4CCOA 4IVNA 3GFIA 3L2UA 3BTJA 1ACIA 1LDKB 1MJAA 3GTOJ 1RNLA 4LOCA 4D7NA 5DUKA 2CSFA 1ETWA 1VQOI 5EDNA 3PSFA 4A6DA 4HYEA 3PO2J 4C2MJ 1IUYA 4IEJA 3FMSA 5IPAA 4Y52J 3HZIB 3JAMK 3S32A 3RDIA 4ZTJA 3CCJI 3CQZJ 1FYKA 2DT7B 1UELB 2MYSA 3KP7A 3QPSA 4FASD 5IYDJ 3BG5A 1LEBA 2XVCA 2ZMEB 2VONA 1OJLA 5LRSA 4A6EA 1K78A 4RAGA 3PFYA 4X4CA 1XG1A 2KFDA 3C7JA 1AA7A 3FHZA 2DYRH 3S1NJ 4I6TA 3TBIA 5IY5H 2V6CA 2ZNYA 1O3TA 1TLHB 5FGMA 2C6YA 1FSHA 4OBMA 1G3WA 4B3XA 1TQMA 4BXFA 3HXLA 5BOXA 3NEUA 1T0FC 1MBKA 2B63J 3GTKJ 3KP5A 1I3QJ 3PJRA 4A3FJ 2IA1A 1A6QA 1U78A 2A61A 2WAFA 4QLCU 2XASA 2ACJA 1OQYA 2L7ZA 2BGCA 1RZRD 4FCYA 5LEKA 1BBYA 3NZLA 3KYCB 2JSPA 1SD5A 2A6CA 4XORA 2KJCA 2V7FA 3GBGA 3GEZA 1JT0A 4Y15A 1D0XA 1W0UA 3HGGA 5DCMA 4CGZA 3E6DA 3F22A 1ETOA 2QA4I 3IH4A 4OB4A 4KYWA 4V19K 3GW2A 3ZMZA 1W5TA 2ELHA 2E7WA 3VYSB 2FQ3A 2TDXA 1YRNB 1RUOA 2L9NA 2PMZA 2IJLA 2JRTA 1K4TA 4Z59A 1HDDC 3LFPA 5KNLA 1X3ZB 2DOEA 5K98B 1FC3A 3CCVI 5H6RA 5FRNA 3R0JA 2ZSIB 3HG9A 4CO8A 1U3EM 4BL0B 3W6JB 4LG3A 3BP8A 3I53A 1ZZ8A 2ODRD 4ZC3A 2Y69H 3JCUC 5HVQC 3E7LA 4RGRA 4MIMA 3MKLA 2XGCA 1DUXC 4BE1A 2X1DA 2OC6A 3AL0C 2FX0A 4CCMA 5EF6A 4Y3OA 2HPMA 3I64A 5ICFA 1IO2A 1FBQA 1XGNA 1LVKA 1ZHFA 2JMWA 4LMYA 4PFPA 5AONA 5F64A 1RR8C 4YARA 4QSHA 4IJAA 5GTHC 5ILVA 2X1CA 1ZZCA 3CROL 2GQQA 2MEZA 1LCCA 1N25A 1TT0A 3FMRA 1XN7A 5FO5A 4XBFA 4IOAF 4ZDOA 2QYOA 3PXPA 2WV0A 1S7EA 1SFXA 2IS6A 3FWEA 1JKOC 4M6YA 4P5OA 1J2XA 1VI0A 1QU3A 1Y0NA 1RC9A 2W57A 2XGDA 5HDNA 1A6IA 2STTA 1E3PA 3ZN0A 5EZHA 1LLIA 3DKYA 1GDTA 4MO7A 3OMTA 2VBXA 3IP4B 4YG2F 3U9GA 2CV0A 3BLYA 3KX2A 1K6OA 1S5LC 3W3CA 1FPQA 5IYBJ 2VODA 2PJRB 1F9NA 2RDPA 3ME5A 4FTHA 4C9YA 1LB2A 3LQRA 5E3MA 1QPMA 2QUFA 3QYXA 3JW4A 1PDNC 4BE2A 1W36C 1W7PA 3S16J 1I3AA 1YQAA 2V79A 3U1KA 1QNTA 3G0TA 2IGMA 2JCGA 2QQ8A 3OWTA 1H9GA 1Y8QB 1UB9A 2QQBA 1JFSA 1MJ9A 1WJBA 5DV5A 1Y0UA 1QHHD 4CXFA 5DEQA 1O4XA 1O7FA 1O57A 2Y0SA 2R7QA 1H89C 1SAXA 2WV1A 5D5XB 4P9UA 1WVRA 1PERL 2LH9A 3IRQA 2ESHA 5M5YJ 1YSEA 1IC8A 1TWGJ 3L9FA 3G6EI 4JX6A 2VPLA 3FYAA 1YFHA 1TC3C 3OYNA 2VL8A 3UKGA 5A7LA 9ANTA 3L2CA 2LLWA 4Y42A 2V1NA 4LJZF 1G3YA 1A36A 2L02A 5B1AH 2YX4A 4WWCA 4F7ZA 3REOA 1OYYA 2EIJH 2YUSA 4MGRA 3S8PA 1PP7U 1ZARA 1WI9A 2LBFA 2XSDC 2MXDA 2A68F 3ZMTA 2IP2A 4XLCA 1GLNA 4XNFA 2LKSA 3ULQB 1EJ9A 2PMUA 4LB6B 2XB5A 1BC8C 1F43A 5DRTA 4C30A 1HXDA 1OR7A 1TZLA 2IAIA 1X1CA 4XLHA 1YLFA 2XC7A 2ECCA 5EEGA 4QPQA 5GTIC 5GAGJ 2VBWA 3OYBA 1BC7C 2NAZA 1JH9A 2RVCA 3I4PA 3MWMA 3DEEA 5KK1A 2JUCA 4UVCA 2GLOA 3M8FA 2IA0A 3NQOA 1XTAA 1WH8A 2DK8A 3O6BB 1WKMA 5KHDA 3VDXA 3G1MA 2H6CA 3F8MA 1BOAA 1IXSB 1WJEA 2HYJA 3QPLA 4LK0F 1E3OC 1R9TJ 4OU0A 2KDZA 3ZHMA 4XOPA 5EYRA 1QP7A 2F5EA 3O8GA 2LKPA 2LDUA 4ZDLA 2JA8J 1JFTA 4PCQA 4B1RA 3SDBA 4L0ZB 2BVMA 4I0AA 4I99C 4BJTA 4IA8A 3K4MA 2O03A 3E6CC 1WJDA 2K02A 5FKLA 4FBIA 3VYUB 2NNNA 2PUCA 3OYCA 4Q5SF 4YIIA 2VT3A 3E5UA 4PJ0C 1HC8A 2F6CA 2RQQA 2EZIA 1XGSA 1POGA 2XCJA 1EA3A 5ILUA 1XC5A 3TP3A 3GZNB 4WXHA 4Y17A 1RZSA 1D0YA 4R8HA 4I6RA 2DXIA 3ZQFA 1IDZA 2HCSA 2MH2A 3BROA 1H0MA 4BH9A 3DM5A 4B47A 2GIZA 3LMMA 3EUAA 2JA6J 3VEPA 2IU7A 2MW8A 3DU5A 4G6DA 3B6CA 2PXEA 1UAAA 2ZBKA 1MH4A 3DBHB 3OR1C 2VN2A 2D5VA 2M0MA 4U0VA 2IT0A 1IN8A 3LQQA 3OMYA 1XSVA 3OS1A 3QF3A 1FP1D 4KA4A 1MDMA 2H27A 2EWNA 1XGMA 2HOEA 2R7DA 2XPWA 2JT1A 5IT9Z 2LRDA 3PL8A 5F27A 1EF4A 3JRFA 4EQQA 1MIJA 2E34A 3OQMA 4IHSA 3AL0B 3CESA 1R6RA 3ABLH 4G6QA 2Y48A 2XAFA 1TQIA 3HSFA 2DTZA 2CV2A 1WH6A 4GGGA 1AU7A 3V7RA 3T1BA 2ISYA 4ZYAA 1VQKI 3SFIA 3SYTA 2K3FA 2K9NA 1R1TA 1VQ8I 3H5NA 2ZO4A 4PJJA 1XSDA 1FNNA 2JN6A 4HW0A 2V1UA 2RV8A 2EH3A 1T39A 5LBQA 2Q2EB 4BQQA 4RDUA 1ZAOA 3A4CA 1T6SA 5L3FA 3HHHA 2HYFA 2OU2A 3K4CA 1BW5A 2JWTA 2D1VA 4F52A 2AO9A 3CJTB 3CJNA 3H92A 4U7BA 1I1SA 1NH3A 2WWYA 4BQAA 2QKMB 1D3YA 1S29A 1QP0A 4JX4A 4X4BA 5FRMA 2KPMA 3R1FA 4YRVA 3IVPA 1U8RA 5CJ9A 3A03A 1R5ID 2V9KA 1XMAA 3QWGA 2PXUA 2VKHA 4XLFA 2LG4A 3R6SA 4A0XA 4BHPA 2DPUA 5BS6A 3L2QA 2YS9A 1KU9A 5E3OA 4HF1A 3O3KA 2BXZA 4GXOA 1UXCA 2HPIA 4AWXB 3S1MJ 2AXUA 3TW7A 1ZRDA 3K70C 3IC7A 3LSKA 3G1LA 2MABA 4ZYGA 3WTYC 2NOGA 1YHQI 3OIOA 2LY9A 2UV1A 2WB1A 3QP6A 1D5YA 2FJRA 1JHHA 1KQ0A 5ICEA 2EPFA 5FLMJ 1B72A 1IN7A 3KP3A 4XOTA 2F48A 1RKWA 3CCLI 1OPCA 4I98B 2CW0F 4N4OB 2DDAA 3LA7A 5J4YA 2JK3A 4M73A 3F23A 4HSRA 3ZQGA 4KMUX 3H35A 3S15J 5DRYA 4Q2JA 2VC0A 5LEJA 2XRNA 2DT6A 2XB0X 5GPCA 4A3MJ 4EJTA 2CUEA 5LFAA 3PIOF 2BW3B 4PSXA 1W5CC 1B4AA 1E2XA 2CFOA 2H1KA 2P81A 2VXZA 2K3PA 4LIUA 1WJAA 2ME6A 3WU0A 3Q3SA 3DLAA 2EV6A 3HUGB 3CUQC 3E5XA 3O2PE 1FLIA 1Z0XA 4M9SA 1P4XA 4E7SA 1S7OA 5CLSA 3GMEA 3L2VA 3BTCA 5DUIA 2R7SA 1VZ0A 2Z9OA 3U1DA 1VNDA 1RIOH 1NEQA 4MTEA 4F3QA 3LOCA 3IAM2 1HKQA 1O7LA 3DBRB 3OIPA 4HEA2 5TJJA 3GTMJ 3DEUA 3S8QA 2I5UA 4HDVA 2IVMA 3CUOA 2NVUB 4E70A 3I55I 4QPOA 1R71A 2DA2A 1G59A 2IBDA 2VXDA 4BDYA 4JCXA 3BQZA 3GXOA 4OIPF 1V4RA 4MNUA 4II3A 2CH0A 2KZGA 2BY0A 2W85A 1DGRM 4J00A 1YW8A 2ME0A 5K7ZA 4KIGA 3JRDA 5M5WJ 1LMB3 3P9IA 1OCZH 3SDGA 3TKYA 3TGNA 3LAJA 1J0RA 3FHNA 1XDSA 1ZS4A 2H6BA 1F4KA 2EV5A 3D5SC 2PXPA 4C3IJ 1CJGA 4MFEA 1VTNC 2PG4A 1U6GA 1WCMJ 1IF1A 4HZFA 1X4OA 2M0CA 1OCRH 2VASA 3I54A 3HBLA 1SVMA 4HX7A 1P92A 2DA7A 1PP8F 3ZMUA 4BU2A 4F8DA 1PUFB 3B73A 3GTLJ 4UV9A 4G12A 1LE8A 4B4CA 1ODDA 1X1DA 4WX9A 1D5VA 3QQ6A 5DTDA 5EG0B 2LYJA 2LYQA 3RPUA 3OQNA 5ICGA 4OWRB 1QO0D 3GFJA 2EWTA 3TFLA 1F5TA 2RAEA 2L0KA 3CTAA 1JUMA 5L3GA 1FOKA 2VLAA 4PK4A 3ZQIA 1JUPA 4ABZA 4EQZA 2Z33A 2KT0A 3UNGC 3BPVA 5EEAA 5FLXK 3L00A 2XIGA 2I8DA 4IVZA 3KPHA 4M3DA 3WG9A 4AC0A 1JGSA 4XR6A 5HDGA 5HLIA 4R1HA 2CV1A 3VFZA 4A3CJ 1UHMA 4WXCA 1IRGA 1ETYA 1GV2A 2EIMH 4RS8A 3SEQA 2PUDA 4M3FA 3V4GA 1NERA 3MVPA 3MN2A 2G7UA 1R36A 2GAUA 3IKTA 3HIFA 4BQNA 2ZJQF 1RZ4A 1ZRFA 3HKZN 2QBYA 2CQKA 5ILSA 2QSFX 3C18A 1DU0A 2X4HA 5GAEJ 1WJCA 1WRJA 2X85A 3BR5A 3VSKA 2FBKA 4KIBA 1R00A 2R7UA 3H0GJ 3ERED 3MMYB 5FD5A 1JXSA 4RM3A 1DQUA 3E0JB 1BIAA 1G8XA 5BQTA 3KEQA 3QFIA 1WHUA 4LG0A 3FIWA 3M1CA 4V2FA 5H20A 4E7JA 1A5JA 1YS6A 2ZXHA 2DO7A 3TRBA 2HU9A 3DTKA 4MHGA 3BD1A 1STZA 1YS7A 4IXAA 3O9XA 3BR6A 1CF7B 4B44A 2ICWG 3ABKH 4KIFA 5F1RA 4D5FA 5HS8A 3HPHA 4HQEA 3K7AJ 1XCBA 3OL4A 1YX5A 2KIFA 3J81K 4A3GJ 2V9PA 2CWEA 3ZMVA 4HG2A 2OR1L 2IGOA 2M1BA 1XGOA 2XSJC 4UUSA 4F93B 1X3UA 1DPRA 1Z6TA 3G73A 2YU9J 3RYPA 1E0EA 1U9OA 4WK8F 2FMLA 4IOCF 1ZTRA 3NROA 4NDWA 3I58A 2B7EA 2KIQA 4KT6A 4OMYA 2KKOA 5FKMA 4KFCA 3T8TA 5FD6A 2IS4A 2FXAA 2HOSA 1B0NA 1ADRA 3SEZA 4QWQA 3KJXA 2JA5J 4Y33A 2R5ZA 1UTXA 2E7XA 1R5GA 2BBYA 3TP0A 1BI2A 2L4AA 1W36D 1KZHA 4ZJZA 3NWSA 2PXLA 5EGOB 3LSRA 3CCUI 5DYMA 1Y8RB 4IRHA 2MD0A 5JVTA 1IW7F 3CLOA 4G9YA 3JAMZ 2QKLB 2HFHA 4GDFA 3W6KB 3MEJA 3SJMA 3IL2A 5HNFA 3A9YA 1EH7A 3P7NA 2P7CB 1MNMC 3KZIC 1YJWI 4MCTA 3RKQA 4A0YA 5D5WB 5GADJ 3WTZA 3CUQB 4Z2YA 3SZGA 3VK0A 2L8NA 2EBYA 1XB4A 4JQFA 3SFZA 3CCQI 2P5LC 2JA7J 4NBQA 3ASOH 1FTZA 1P7JA 2Y0SN 2NNYA 2PUBA 4HLXA 2R93J 4X4EA 1IGNA 2X6XA 3S93A 4I2OA 1LFBA 1IZ1A 2L7FP 2WA0A 4HF2A 4PDKA 1LDDA 2L2OA 5E1ZB 2GA2A 2IW5A 1P4WA 5J1RA 2Z99A 3CMYA 3JRHA 5LHHA 2XDVA 4XM3A 3HOVJ 3HZJA 4LFUA 3ZQHA 2IS2A 2ELJA 4DJAA 2RGVA 1LDJA 4IHXA 3QWLA 3U3WA 5IYCJ 3FZVA 3BPXA 1W1WE 5IP6A 2CG4A 4DGWB 4C2TA 2ZJRF 3P5JA 2KHMA 1Z9CA 2VOOA 3OOPA 2VJJA 1B59A 4B09A 3JRBA 4N0BA 4BAYA 3TQNA 2CUFA 4A3DJ 2MBFA 4PU4C 2R7WA 1E3HA 3QYBA 3J7AO 1HQCA 3RZOJ 3ZN1A 5KVRA 1G3SA 3F9KA 3OV8A 1X1AA 1HW1A 2K5CA 3OYHA 1XMXA 3LFUA 3VWSA 2LFBA 3KP2A 2R7RA 4FQGA 1YJNI 5FLVA 2FNAA 2XF5A 5KAIC 2GZWA 1FBUA 4U0YA 1K78B 2UZKA 4M74A 2EFOA 1LPQA 3A0HC 1HCRA 4Q4ZF 3K1NA 2PX9A 1FYMA 2WY7Q 3ZQCA 1SANA 1DPUA 2IXSA 2HOTA 3LSTA 1GXQA 3BR3A 3CF5F 1SC7A 1Y9QA 3GCMA 2L49A 2ZXIA 4CCLA 2ZMEA 2R7ZJ 3TDZC 3WTXC 2LR8A 1M1EB 1VQ7I 3VWBA 1KQ8A 5LGNA 5J3LA 4J01A 4MTDA 3BT9A 2V6EA 2WAEA 2MC4A 2DK5A 3ERMA 4YG7B 3K2AA 3FISA 2RKHA 3FM5A 2FFHA 4S04A 1FY7A 2HOAA 3CCEI 2CU7A 2GWRA 2MGQA 4I8TA 3UFDA 1H88C 4UVBA 3OYLA 3LFKA 2LP0A 3EPZA 4B3AA 1SMTA 3O8HA 3ZXSA 3F3XA 1ZAYA 1PVEA 3ECHA 2M30A 1S7AA 2L9RA 3BC8A 3C2BA 2DA5A 4V2GA 5FKKA 1WSUA 4AUXA 4UV8A 1FTTA 2E60A 2NVTJ 2DDBA 2Y2ZA 3EYYA 5FFZA 2OF7A 3BOQA 4LLGF 1H8AC 1I50J 2DA4A 2DODA 2XF7A 1JI8A 4AM3A 1HW5A 1BOBA 2IVGA 2Z5UA 4KJZA 5DTMA 1T56A 2ISZA 1MGTA 3JR9A 2G0EA 3J7ZI 1T98A 4RLFA 1QZXA 3NARA 3DPUA 3QU3A 4P1WA 2M87A 4RM2A 4C3JJ 1DDNA 4H0EA 4BHCA 5JHFA 3EDPA 1LCDA 4XLPF 5HLHA 5DTQA 1WIZA 2HFZA 2NVXJ 2FD5A 1RETA 5D8LB 4XRSA 1YTYA 1UZCA 2IV1A 1BJAA 1RI7A 3BZCA 5B66C 2Q1ZB 2M4GA 4XN3A 2E5ZA 1D0ZA 3AAFA 4N4NB 5IP7J 1FMWA 2K7LA 2CROA 2V1DA 5IOYA 3FDYA 1HSJA 2IPQX 1SFUA 5D8KB 4BEHA 4ZYHA 3RKYA 4HSTA 4YFNF 3COAC 2K40A 3EUHC 1A04A 4YBAA 3BG6A 4ER5A 3FBNB 4XMYA 4L0YB 2BNNA 1ETKA 2Z3YA 3ESWB 5FKOA 1XX5A 3CDIA 3HOSA 3EETA 1MJBA 4PFOA 4L5JA 4BQOA 1FZPB 4ER0A 2ZXWH 4BJ5C 2ZKZA 3VODA 2EBIA 4E7KA 4O5VA 2H8WA 3GLLA 2W84A 2L01A 1W7PB 3B02A 2E71A 2KISA 2QF7A 3M3YJ 2DA3A 3D5RC 3JXBC 4O6JA 4EATA 3K70D 2K86A 2PLYA 1NW3A 3FXMA 3M07A 3OKZA 1ORKA 4IWRA 1HKTA 1NG7A 4XLNF 2PJRA 3CMAI 2F4IA 3D0SA 4UUVA 1N77A 5JR3A 4HOBA 4IHYA 2WTEA 2XAJA 2FNPA 2NS8A 1QZYA 3BG9A 4QIWN 3SHFA 3D5LA 3F6OA 1XSXA 1X2NA 3E3VA 4NQWA 3OYKA 2OZ6A 2STWA 5ERIA 1WZ2A 5HLGA 4A0ZA 2CQXA 2MA3A 2MG4A 1Z1DA 2FOWA 3QOXA 2EILH 5IT3A 4M3GA 3S1QJ 2CGPA 3HRSA 3HOTA 2CFXA 2TCTA 4J1WA 2DJNA 3GVAA 4E7IA 4GYGA 5BMZA 2Y9ZA 2X6WA 4LD5A 3NRVA 1FOWA 3K2ZA 2H1LA 2WADA 2YX7A 4E6KG 5LGTA 2ICPA 3MD2A 4JQDA 4IHVA 1YI2I 4EEFG 2LLVA 1MZBA 1AWCA 2VKEA 2JVGA 5F0HA 1HQ1A 4A93J 2M4HA 5E1XA 5TISC 2ZJPF 3TO9A 1VQPI 2O7OA 5J4VA 1DGWY 3RKXA 2LD5A 3K0LA 2IGNA 3HOXJ 1FOYA 3FXRA 4A3EJ 2M3AA 1EH6A 1HOMA 2JQEA 3GZDA 1R4NB 3CF2A 3KP6A 1MMDA 4X6AJ 2HYGD 4FE4A 3OSFA 1EH8A 4FISA 1UJ8A 4RLQA 2R0QC 4L9VA 1TNSA 2PFBA 2DA1A 3BG7A 2WBMA 1B8IB 2ZC2A 1OFCX 1SFEA 3SXYA 3CO7C 1ZH5A 1HA8A 2JVHA 1PRAA 5GAHi 1FYLA 1FEXA 1SD7A 4ESBA 3GZ6A 5KAFC 5C44J 3P9KA 3T8RA 1D1CA 5CVUA 2EA4A 2O5RA 3TEDA 1R69A 4EJVA 1RIOA 3RZDJ 1T0FA 2PUGA 2DCEA 5F0CA 2R5YB 1TBXA 2PBIA 3CDLA 2RREA 2CSOA 3AG2H 2BY1A 1ETQA 4G94A 3JRAA 2P6SA 1MMGA 4MEXF 3VYTB 3HOWJ 2O38A 2E2JJ 3H5AA 5M3MJ 4CUGA 1D1AA 1I6HJ 3LNQA 3P9CA 4GO1A 2FE3A 2P7VB 4O3MA 2BJCA 1W4MA 4JYKA 2DAOA 3HB9A 2GM4A 5K7HA 1ZLKA 2HS5A 2OQGA 2X51A 2R7FA 3FKIJ 4MLOA 4BNCA 3RIRA 4PU3C 1YX3A 1B9NA 1P9QC 2ZCWA 3V8KA 2P5KA 2QQ9A 3VYRB 4X0GA 3DCFA 1Y56A 2E2HJ 3HSRA 2HXOA 4KN7X 3LSGA 1DP3A 4X1EA 3F8CA 3EQLF 4U7DA 4L9NA 3VOEA 5DT2A 4OIOF 3K6GA 4Z6YA 2L4MA 3K4JA 2KRHA 2HCNA 3HSEA 2NS0A 5EEHA 3BR1A 3QPTA 4YFKF 2WC2A 5J1YA 1XPXA 1EFAA 1U0JA 4IKFA 2DFEA 5J47A 4DE9A 1KGSA 3Q0WA 3E6MA 1V5EA 3GTGJ 2XROA 1RKTA 3MKWB 3M9AA 2UXXA 4CCJA 2UXNA 3KCCA 2AWIA 3HPGA 2M8GX 1VPWA 4HBLA 1LKXA 3DV8A 2KRCA 3C3WA 2XKOA 2F4MB 3KLOA 1SFKA 4RGUA 3I56I 1XWRA 1JTXA 5BPDA 3K1MA 1IRXA 3Q0VA 4IL6C 3BTIA 2H09A
chains in the Genus database with same CATH topology
1WH5A 4IVZA 1ZZ6A 3HZIB 4M3DA 4AC0A 5IPAA 4Y52J 3JXCL 1IUFA 2N8GA 4XK4A 2LYRA 4S0HB 3CQZJ 4A3CJ 1QP4A 1ETYA 1GV2A 2DA6A 3QPSA 2DMNA 1ZKGA 5IYDJ 1TWFJ 4M3FA 2PUDA 5F1JA 1NERA 1GUUA 3MVPA 3MN2A 4X4GA 3BG5A 1IV6A 4Z58A 1OJLA 3D1NI 4X4CA 1XG1A 3S1NJ 1ZZ7A 1AKHB 3HKZN 4I6TA 3FK7A 1R63A 1SQ8A 2LKXA 1WGXA 3NAUA 1W0TA 1DU0A 3A02A 1BL0A 2NS7A 3BR5A 2WUSR 2M34A 2EF8A 3H0GJ 1MBKA 3Q0UA 4IHWA 2B63J 3GTKJ 1TWCJ 1I3QJ 2X9DA 1ZR2A 4MFDA 3FIWA 4A3FJ 4V2FA 1U78A 1A5JA 2O4AA 2L7ZA 3TRBA 4NDLA 1RZRD 3GN5B 4FCYA 1LQCA 3BD1A 1MBGA 3BS3A 4JP0A 2LVSA 2A6CA 3CLCA 3ZQLA 1GVDA 3O9XA 3BR6A 2DN0A 1WH7A 4Z5HA 3GBGA 3CCYA 1JT0A 4D5FA 1UHSA 1W0UA 3HGGA 3K7AJ 2HINA 1NK3P 3BR0A 3BTLA 4A3GJ 3B6AA 1ETOA 3IH4A 3PM1A 1MBFA 4OB4A 4DZPA 1QRYA 5F04A 2OR1L 2VPRA 2IVQA 3HGYA 1YRNB 4X4HA 4UUSA 2YU9J 4C3HJ 4Z59A 1U9OA 2DMPA 1HDDC 4J19A 1MH3A 3JREA 3LFPA 1ZTRA 4NDWA 4BY7J 2X6OA 5K98B 3S2HJ 2B5AA 1QVTA 1ZGWA 5FKMA 1B8IA 3F6WA 2HOSA 1BW6A 1B0NA 1ZZ8A 5M3FJ 3KJXA 1ADRA 2JA5J 1Y1VJ 2R5ZA 1UTXA 1JKRC 3TP0A 3E7LA 3H3VK 4GFBA 2AUWA 3OP9A 4MIMA 3MKLA 2I10A 1Y1WJ 1RR7A 2XGCA 2NVQJ 2DMQA 3HOUJ 2IUOA 4M6VA 2E2IJ 5EGOB 3LSRA 3I4NJ 2FX0A 5EF6A 3KZ3A 3LSJA 2R5YA 1GV5A 5JLWA 2JMWA 3HOYJ 4YARA 4QSHA 1K61A 3SJMA 1ZZCA 3CROL 4HNVA 4FN3A 2MEZA 1LCCA 2VUMJ 5EZGA 3S1RJ 1MNMC 4MCTA 4BBSJ 3RKQA 1ZZ9A 3PXPA 1S7EA 3VK0A 1JKOC 2L8NA 2EBYA 1ZQ3P 3JRCA 2H8RA 2JA7J 2XIUA 1FTZA 3OOUA 1P7JA 2Y0SN 1VI0A 2XGDA 3DEWA 2PUBA 1A6IA 4I76A 5EZHA 2R93J 1LLIA 4X4EA 1IGNA 1MBEA 1X57A 1GDTA 1LFBA 4MO7A 2L7FP 5IOZA 1POUA 2DMTA 2XGEA 2Y30A 3OMTA 3A01B 5IYBJ 5J1RA 3CMYA 5GPAA 3JRHA 4FTHA 1RZRA 5E3MA 2LYKA 3HOVJ 3I4MJ 3QYXA 1IG7A 3ZQHA 3JRGA 3S16J 4PU7A 5IP9J 4BKXA 4IHXA 4XRMA 1RPWA 3FK6A 2JCGA 3U3WA 5IYCJ 5C3EJ 1ZR4A 1JFSA 1BDHA 1MBHA 5IP6A 1O4XA 2EZHA 1PUFA 4A3LJ 3JRBA 2IVBA 2KPJA 1MBJA 3LISA 2CUFA 1H89C 4A3DJ 4PU4C 2WV1A 1PRVA 3VPRA 3HDDA 5BNGA 3RZOJ 2L7MP 1PERL 3GTJJ 5M5YJ 1YSEA 2LFBA 1IC8A 5FLVA 1QPZA 1TWGJ 4JX6A 1NK2P 3FYAA 1K83J 2XPVA 1TC3C 5A7LA 1ENHA 4M3EA 3UKGA 9ANTA 2MSYA 1HCRA 1DU6A 4Y42A 2LLKA 2M2EA 4JQDA 3ZQCA 1SANA 2ELKA 2PMZN 2HOTA 2LYPA 2ID3A 2YUSA 1ITYA 3BR3A 2DMUA 2QCOA 2VI6A 2XSDC 1Y9QA 2L49A 1Y7YA 1B72B 2R7ZJ 4JX5A 2XB5A 1WI3A 2M9HA 2LR8A 1HLVA 1F43A 2LYSA 1AKHA 2AHQA 3S14J 2IAIA 5J3LA 1JKPC 2GRLA 2FQ4A 3BT9A 2PE5A 2ECCA 1JT6A 4YG7B 1G2HA 1JH9A 3K2AA 3FISA 1SFOJ 2PUAA 2HOAA 2CU7A 2GLOA 2VKVA 2MGQA 4I8TA 3UFDA 1H88C 5F0FA 4DW6A 1WH8A 3GN5A 3CECA 3RZZA 2ID6A 2LP0A 4JCYA 4B3AA 3DNVB 3O8HA 1F36A 1ZAYA 3G1MA 1APLC 1PNRA 3QPLA 1JJ8C 2L9RA 2HYJA 3C2BA 1E3OC 1BDIA 2DA5A 4V2GA 5FKKA 4Y7NJ 1R9TJ 4AUXA 2KDZA 1TWHJ 1FTTA 1QP7A 5EYRA 3ZHMA 2FJ1A 3O8GA 4W1UA 2NVTJ 2XI8A 2Y2ZA 1H8AC 2OF7A 5E3NA 2JA8J 1JFTA 1GT0C 1I50J 2DA4A 4B1RA 1OCTC 2PUFA 4IA8A 2Y9YA 2Y31A 3W6VA 2IVGA 2XJ3A 5FKLA 5FJ8J 1T56A 1ZK8A 4FBIA 3JR9A 2PUCA 2G0EA 3S17J 1NTCA 3NARA 4C3JJ 2WAQN 2HXIA 3BR2A 1ZVVA 2EZIA 1BA5A 1LCDA 1POGA 5E3LA 1X58A 2XCJA 3BDNA 1P7IA 4FE7A 3G5GA 1IDYA 1XC5A 1WIZA 4O8BA 3TP3A 4AYBN 1OSLA 2NVXJ 3ZKCA 1RZSA 4YG4A 2FD5A 4I6RA 3ZQFA 1IDZA 1MSEC 1RETA 4XRSA 4BBRJ 1U8BA 2IV1A 1OCPA 4CYCB 3FMYA 2JA6J 1DW9A 3F0CA 2OPTA 2MW8A 2IU7A 3B6CA 1QQBA 2X48A 1MH4A 4UUTA 4A3IJ 5IP7J 3H5TA 2D5VA 5K7FA 4X4DA 3GTPJ 5EGOA 3WHBA 2CROA 5IOYA 3QF3A 3FYMA 1ZUGA 5J1UA 2PUEA 1FIAA 1UXDA 2K40A 2XPWA 4YBAA 4W97A 3HEFA 2EZKA 1QQAA 2BNNA 3G1OA 1ETKA 5FKOA 5F27A 5C4JJ 1EF4A 3JRFA 1JGGA 5F08A 1JTYA 2WIUB 1QPIA 4XIDA 1LE8B 3OQMA 2BNMA 2MQKA 4DZJA 3ZHIA 1WH6A 2DTZA 3F51A 2EBIA 1AU7A 3SFIA 2QF7A 1FIPA 2DA3A 3M3YJ 1IRZA 4D5CA 2K9NA 4A3KJ 3JXBC 2JVLA 2JN6A 1PRUA 1ORKA 2EH3A 3A01A 4IWRA 4BXXJ 4RBOA 2E19A 4RDUA 2GZUA 1UG2A 2JJ7A 2XPUA 4Z5CA 3ZOBA 5EG0A 4IHYA 4MCXA 1ETXA 4X4IA 2NS8A 5GP9A 2JWTA 1BW5A 3BG9A 2LYLA 2AO9A 4QIWN 1U9NA 1X2NA 2O49A 1QP0A 2PIJA 4JX4A 3WHCA 4X4BA 3R1FA 3IVPA 2CQXA 2MG4A 3BQYA 4YG1A 3A03A 3GBFA 1ZPQA 4M3GA 2OFYA 3S1QJ 2AXVA 3QWGA 2LTPA 1MSFC 2R63A 2TCTA 4I6ZA 3PO3J 3B7HA 4J1WA 3G7DA 2DJNA 2YS9A 2O9LA 2Y9ZA 5E3OA 4XICA 2KEKA 1FJLA 3M4OJ 1UXCA 2ICPA 2K9SA 2W48A 4A3JJ 1X2MA 1XS9A 2E1OA 4IHVA 3S1MJ 2AXUA 2GRMA 3TW7A 3MLFA 2GBYA 1JJ6C 4EEFG 4L5EA 2VKEA 1VFCA 3IH3A 2AW6A 5F0HA 4A93J 4GQMA 3G1LA 4A3BJ 2NOGA 4BY1J 3OIOA 4J1XA 2LY9A 1D5YA 4QTRA 2AXZA 2FJRA 4A69C 2O7OA 5M5XJ 5FLMJ 1B72A 2LD5A 3F52A 5JLXA 3HOXJ 4A3EJ 1RKWA 1VF9A 2NVYJ 2HSGA 1WPKA 4UUSB 1HOMA 2HDDA 4X4FA 3QQAA 2PPXA 2JK3A 3SCHA 3SCFA 4X6AJ 4FE4A 3OSFA 3ZQGA 2KEJA 4M3BA 3S15J 4FISA 3OQOA 2R0QC 2DA1A 5GPCA 2XB0X 3IV5A 4A3MJ 2EQRA 1OFCX 2ECBA 1B8IB 2CUEA 2R1JL 5FKNA 3LSPA 1IJWC 2ICTA 5HODA 1T33A 2R5ZB 1PRAA 2LK2A 2K9QA 2H1KA 1YRNA 1FEXA 4XRSG 3OSGA 3TW6A 2P81A 5C44J 2IEKA 5EEAA 2CJJA 1AHDP 1L1MA 2ME6A 3EUSA 3Q3SA 3TEDA 1R69A 1RIOA 2PUGA 3RZDJ 4PU8A 1Z0XA 1Q1VA 4I6UA 3GTQJ 5F0CA 2R5YB 3CDLA 3BTCA 1TWAJ 2O8KA 3S2DJ 3JRAA 1ETQA 4DYRA 1VNDA 1Z77A 1HDPA 1NEQA 3L1PA 3LOCA 3GTMJ 3HOWJ 2ZB9A 3HM5A 2E2JJ 2O38A 3S8QA 5M3MJ 1ZZBA 3HOZJ 4DYCA 1I6HJ 2CQQA 3LNQA 1ETVA 1LFUP 2BJCA 2DA2A 2IBDA 3JRIA 4JYKA 2GM4A 3HB9A 5K7HA 4JCXA 3BQZA 3FKIJ 4PU3C 4MLOA 2HI3A 2EZLA 2TRTA 4DYQA 3DCFA 2ME0A 5K7ZA 3JRDA 2E2HJ 4CYCA 5M5WJ 2HXOA 1X2LA 1LMB3 3JXDL 3LSGA 3SDGA 1RESA 4X1EA 1ZS4A 1RPEL 1UMQA 1CQTA 1DWKA 1JKQC 3RQIA 4C3IJ 1CJGA 4MFEA 4D7MA 3BR1A 5J1YA 1EFAA 1WCMJ 2COBA 2CRGA 1QVUA 2M0CA 2LCVA 3BG3A 1BJZA 3Q0WA 3HBLA 5DS9A 2HQ5A 4Z5DA 1JUSA 2DA7A 3GTGJ 1RKTA 2KZ8A 3KXAA 3SCGA 4F8DA 1PUFB 1WETA 2KEIA 2XRLA 3GTLJ 4G12A 1LE8A 4B4CA 1JWLA 1HF0A 2AWIA 2M8GX 3IH2A 5DTDA 2R92J 5EG0B 2LYJA 3QQ6A 4GHJA 1VPWA 2LYQA 3BTJA 3OQNA 3GTOJ 4LOCA 4D7NA 2EWTA 2CSFA 2BNOA 1ETWA 1XWRA 2RAEA 2L0KA 1JTXA 1JUMA 2WB1N 5EDNA 3ZQIA 1JUPA 4ABZA 4C2MJ 3PO2J 3Q0VA 2KT0A 4IEJA 5C4XJ 3BTIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WH5 A;  4IVZ A;  1ZZ6 A;  3HZI B;  4M3D A;  4AC0 A;  5IPA A;  4Y52 J;  3JXC L;  1IUF A;  2N8G A;  4XK4 A;  2LYR A;  4S0H B;  3CQZ J;  4A3C J;  1QP4 A;  1ETY A;  1GV2 A;  2DA6 A;  3QPS A;  2DMN A;  1ZKG A;  5IYD J;  1TWF J;  4M3F A;  2PUD A;  5F1J A;  1NER A;  1GUU A;  3MVP A;  3MN2 A;  4X4G A;  3BG5 A;  1IV6 A;  4Z58 A;  1OJL A;  3D1N I;  4X4C A;  1XG1 A;  3S1N J;  1ZZ7 A;  1AKH B;  3HKZ N;  4I6T A;  3FK7 A;  1R63 A;  1SQ8 A;  2LKX A;  1WGX A;  3NAU A;  1W0T A;  1DU0 A;  3A02 A;  1BL0 A;  2NS7 A;  3BR5 A;  2WUS R;  2M34 A;  2EF8 A;  3H0G J;  1MBK A;  3Q0U A;  4IHW A;  2B63 J;  3GTK J;  1TWC J;  1I3Q J;  2X9D A;  1ZR2 A;  4MFD A;  3FIW A;  4A3F J;  4V2F A;  1U78 A;  1A5J A;  2O4A A;  2L7Z A;  3TRB A;  4NDL A;  1RZR D;  3GN5 B;  4FCY A;  1LQC A;  3BD1 A;  1MBG A;  3BS3 A;  4JP0 A;  2LVS A;  2A6C A;  3CLC A;  3ZQL A;  1GVD A;  3O9X A;  3BR6 A;  2DN0 A;  1WH7 A;  4Z5H A;  3GBG A;  3CCY A;  1JT0 A;  4D5F A;  1UHS A;  1W0U A;  3HGG A;  3K7A J;  2HIN A;  1NK3 P;  3BR0 A;  3BTL A;  4A3G J;  3B6A A;  1ETO A;  3IH4 A;  3PM1 A;  1MBF A;  4OB4 A;  4DZP A;  1QRY A;  5F04 A;  2OR1 L;  2VPR A;  2IVQ A;  3HGY A;  1YRN B;  4X4H A;  4UUS A;  2YU9 J;  4C3H J;  4Z59 A;  1U9O A;  2DMP A;  1HDD C;  4J19 A;  1MH3 A;  3JRE A;  3LFP A;  1ZTR A;  4NDW A;  4BY7 J;  2X6O A;  5K98 B;  3S2H J;  2B5A A;  1QVT A;  1ZGW A;  5FKM A;  1B8I A;  3F6W A;  2HOS A;  1BW6 A;  1B0N A;  1ZZ8 A;  5M3F J;  3KJX A;  1ADR A;  2JA5 J;  1Y1V J;  2R5Z A;  1UTX A;  1JKR C;  3TP0 A;  3E7L A;  3H3V K;  4GFB A;  2AUW A;  3OP9 A;  4MIM A;  3MKL A;  2I10 A;  1Y1W J;  1RR7 A;  2XGC A;  2NVQ J;  2DMQ A;  3HOU J;  2IUO A;  4M6V A;  2E2I J;  5EGO B;  3LSR A;  3I4N J;  2FX0 A;  5EF6 A;  3KZ3 A;  3LSJ A;  2R5Y A;  1GV5 A;  5JLW A;  2JMW A;  3HOY J;  4YAR A;  4QSH A;  1K61 A;  3SJM A;  1ZZC A;  3CRO L;  4HNV A;  4FN3 A;  2MEZ A;  1LCC A;  2VUM J;  5EZG A;  3S1R J;  1MNM C;  4MCT A;  4BBS J;  3RKQ A;  1ZZ9 A;  3PXP A;  1S7E A;  3VK0 A;  1JKO C;  2L8N A;  2EBY A;  1ZQ3 P;  3JRC A;  2H8R A;  2JA7 J;  2XIU A;  1FTZ A;  3OOU A;  1P7J A;  2Y0S N;  1VI0 A;  2XGD A;  3DEW A;  2PUB A;  1A6I A;  4I76 A;  5EZH A;  2R93 J;  1LLI A;  4X4E A;  1IGN A;  1MBE A;  1X57 A;  1GDT A;  1LFB A;  4MO7 A;  2L7F P;  5IOZ A;  1POU A;  2DMT A;  2XGE A;  2Y30 A;  3OMT A;  3A01 B;  5IYB J;  5J1R A;  3CMY A;  5GPA A;  3JRH A;  4FTH A;  1RZR A;  5E3M A;  2LYK A;  3HOV J;  3I4M J;  3QYX A;  1IG7 A;  3ZQH A;  3JRG A;  3S16 J;  4PU7 A;  5IP9 J;  4BKX A;  4IHX A;  4XRM A;  1RPW A;  3FK6 A;  2JCG A;  3U3W A;  5IYC J;  5C3E J;  1ZR4 A;  1JFS A;  1BDH A;  1MBH A;  5IP6 A;  1O4X A;  2EZH A;  1PUF A;  4A3L J;  3JRB A;  2IVB A;  2KPJ A;  1MBJ A;  3LIS A;  2CUF A;  1H89 C;  4A3D J;  4PU4 C;  2WV1 A;  1PRV A;  3VPR A;  3HDD A;  5BNG A;  3RZO J;  2L7M P;  1PER L;  3GTJ J;  5M5Y J;  1YSE A;  2LFB A;  1IC8 A;  5FLV A;  1QPZ A;  1TWG J;  4JX6 A;  1NK2 P;  3FYA A;  1K83 J;  2XPV A;  1TC3 C;  5A7L A;  1ENH A;  4M3E A;  3UKG A;  9ANT A;  2MSY A;  1HCR A;  1DU6 A;  4Y42 A;  2LLK A;  2M2E A;  4JQD A;  3ZQC A;  1SAN A;  2ELK A;  2PMZ N;  2HOT A;  2LYP A;  2ID3 A;  2YUS A;  1ITY A;  3BR3 A;  2DMU A;  2QCO A;  2VI6 A;  2XSD C;  1Y9Q A;  2L49 A;  1Y7Y A;  1B72 B;  2R7Z J;  4JX5 A;  2XB5 A;  1WI3 A;  2M9H A;  2LR8 A;  1HLV A;  1F43 A;  2LYS A;  1AKH A;  2AHQ A;  3S14 J;  2IAI A;  5J3L A;  1JKP C;  2GRL A;  2FQ4 A;  3BT9 A;  2PE5 A;  2ECC A;  1JT6 A;  4YG7 B;  1G2H A;  1JH9 A;  3K2A A;  3FIS A;  1SFO J;  2PUA A;  2HOA A;  2CU7 A;  2GLO A;  2VKV A;  2MGQ A;  4I8T A;  3UFD A;  1H88 C;  5F0F A;  4DW6 A;  1WH8 A;  3GN5 A;  3CEC A;  3RZZ A;  2ID6 A;  2LP0 A;  4JCY A;  4B3A A;  3DNV B;  3O8H A;  1F36 A;  1ZAY A;  3G1M A;  1APL C;  1PNR A;  3QPL A;  1JJ8 C;  2L9R A;  2HYJ A;  3C2B A;  1E3O C;  1BDI A;  2DA5 A;  4V2G A;  5FKK A;  4Y7N J;  1R9T J;  4AUX A;  2KDZ A;  1TWH J;  1FTT A;  1QP7 A;  5EYR A;  3ZHM A;  2FJ1 A;  3O8G A;  4W1U A;  2NVT J;  2XI8 A;  2Y2Z A;  1H8A C;  2OF7 A;  5E3N A;  2JA8 J;  1JFT A;  1GT0 C;  1I50 J;  2DA4 A;  4B1R A;  1OCT C;  2PUF A;  4IA8 A;  2Y9Y A;  2Y31 A;  3W6V A;  2IVG A;  2XJ3 A;  5FKL A;  5FJ8 J;  1T56 A;  1ZK8 A;  4FBI A;  3JR9 A;  2PUC A;  2G0E A;  3S17 J;  1NTC A;  3NAR A;  4C3J J;  2WAQ N;  2HXI A;  3BR2 A;  1ZVV A;  2EZI A;  1BA5 A;  1LCD A;  1POG A;  5E3L A;  1X58 A;  2XCJ A;  3BDN A;  1P7I A;  4FE7 A;  3G5G A;  1IDY A;  1XC5 A;  1WIZ A;  4O8B A;  3TP3 A;  4AYB N;  1OSL A;  2NVX J;  3ZKC A;  1RZS A;  4YG4 A;  2FD5 A;  4I6R A;  3ZQF A;  1IDZ A;  1MSE C;  1RET A;  4XRS A;  4BBR J;  1U8B A;  2IV1 A;  1OCP A;  4CYC B;  3FMY A;  2JA6 J;  1DW9 A;  3F0C A;  2OPT A;  2MW8 A;  2IU7 A;  3B6C A;  1QQB A;  2X48 A;  1MH4 A;  4UUT A;  4A3I J;  5IP7 J;  3H5T A;  2D5V A;  5K7F A;  4X4D A;  3GTP J;  5EGO A;  3WHB A;  2CRO A;  5IOY A;  3QF3 A;  3FYM A;  1ZUG A;  5J1U A;  2PUE A;  1FIA A;  1UXD A;  2K40 A;  2XPW A;  4YBA A;  4W97 A;  3HEF A;  2EZK A;  1QQA A;  2BNN A;  3G1O A;  1ETK A;  5FKO A;  5F27 A;  5C4J J;  1EF4 A;  3JRF A;  1JGG A;  5F08 A;  1JTY A;  2WIU B;  1QPI A;  4XID A;  1LE8 B;  3OQM A;  2BNM A;  2MQK A;  4DZJ A;  3ZHI A;  1WH6 A;  2DTZ A;  3F51 A;  2EBI A;  1AU7 A;  3SFI A;  2QF7 A;  1FIP A;  2DA3 A;  3M3Y J;  1IRZ A;  4D5C A;  2K9N A;  4A3K J;  3JXB C;  2JVL A;  2JN6 A;  1PRU A;  1ORK A;  2EH3 A;  3A01 A;  4IWR A;  4BXX J;  4RBO A;  2E19 A;  4RDU A;  2GZU A;  1UG2 A;  2JJ7 A;  2XPU A;  4Z5C A;  3ZOB A;  5EG0 A;  4IHY A;  4MCX A;  1ETX A;  4X4I A;  2NS8 A;  5GP9 A;  2JWT A;  1BW5 A;  3BG9 A;  2LYL A;  2AO9 A;  4QIW N;  1U9N A;  1X2N A;  2O49 A;  1QP0 A;  2PIJ A;  4JX4 A;  3WHC A;  4X4B A;  3R1F A;  3IVP A;  2CQX A;  2MG4 A;  3BQY A;  4YG1 A;  3A03 A;  3GBF A;  1ZPQ A;  4M3G A;  2OFY A;  3S1Q J;  2AXV A;  3QWG A;  2LTP A;  1MSF C;  2R63 A;  2TCT A;  4I6Z A;  3PO3 J;  3B7H A;  4J1W A;  3G7D A;  2DJN A;  2YS9 A;  2O9L A;  2Y9Z A;  5E3O A;  4XIC A;  2KEK A;  1FJL A;  3M4O J;  1UXC A;  2ICP A;  2K9S A;  2W48 A;  4A3J J;  1X2M A;  1XS9 A;  2E1O A;  4IHV A;  3S1M J;  2AXU A;  2GRM A;  3TW7 A;  3MLF A;  2GBY A;  1JJ6 C;  4EEF G;  4L5E A;  2VKE A;  1VFC A;  3IH3 A;  2AW6 A;  5F0H A;  4A93 J;  4GQM A;  3G1L A;  4A3B J;  2NOG A;  4BY1 J;  3OIO A;  4J1X A;  2LY9 A;  1D5Y A;  4QTR A;  2AXZ A;  2FJR A;  4A69 C;  2O7O A;  5M5X J;  5FLM J;  1B72 A;  2LD5 A;  3F52 A;  5JLX A;  3HOX J;  4A3E J;  1RKW A;  1VF9 A;  2NVY J;  2HSG A;  1WPK A;  4UUS B;  1HOM A;  2HDD A;  4X4F A;  3QQA A;  2PPX A;  2JK3 A;  3SCH A;  3SCF A;  4X6A J;  4FE4 A;  3OSF A;  3ZQG A;  2KEJ A;  4M3B A;  3S15 J;  4FIS A;  3OQO A;  2R0Q C;  2DA1 A;  5GPC A;  2XB0 X;  3IV5 A;  4A3M J;  2EQR A;  1OFC X;  2ECB A;  1B8I B;  2CUE A;  2R1J L;  5FKN A;  3LSP A;  1IJW C;  2ICT A;  5HOD A;  1T33 A;  2R5Z B;  1PRA A;  2LK2 A;  2K9Q A;  2H1K A;  1YRN A;  1FEX A;  4XRS G;  3OSG A;  3TW6 A;  2P81 A;  5C44 J;  2IEK A;  5EEA A;  2CJJ A;  1AHD P;  1L1M A;  2ME6 A;  3EUS A;  3Q3S A;  3TED A;  1R69 A;  1RIO A;  2PUG A;  3RZD J;  4PU8 A;  1Z0X A;  1Q1V A;  4I6U A;  3GTQ J;  5F0C A;  2R5Y B;  3CDL A;  3BTC A;  1TWA J;  2O8K A;  3S2D J;  3JRA A;  1ETQ A;  4DYR A;  1VND A;  1Z77 A;  1HDP A;  1NEQ A;  3L1P A;  3LOC A;  3GTM J;  3HOW J;  2ZB9 A;  3HM5 A;  2E2J J;  2O38 A;  3S8Q A;  5M3M J;  1ZZB A;  3HOZ J;  4DYC A;  1I6H J;  2CQQ A;  3LNQ A;  1ETV A;  1LFU P;  2BJC A;  2DA2 A;  2IBD A;  3JRI A;  4JYK A;  2GM4 A;  3HB9 A;  5K7H A;  4JCX A;  3BQZ A;  3FKI J;  4PU3 C;  4MLO A;  2HI3 A;  2EZL A;  2TRT A;  4DYQ A;  3DCF A;  2ME0 A;  5K7Z A;  3JRD A;  2E2H J;  4CYC A;  5M5W J;  2HXO A;  1X2L A;  1LMB 3;  3JXD L;  3LSG A;  3SDG A;  1RES A;  4X1E A;  1ZS4 A;  1RPE L;  1UMQ A;  1CQT A;  1DWK A;  1JKQ C;  3RQI A;  4C3I J;  1CJG A;  4MFE A;  4D7M A;  3BR1 A;  5J1Y A;  1EFA A;  1WCM J;  2COB A;  2CRG A;  1QVU A;  2M0C A;  2LCV A;  3BG3 A;  1BJZ A;  3Q0W A;  3HBL A;  5DS9 A;  2HQ5 A;  4Z5D A;  1JUS A;  2DA7 A;  3GTG J;  1RKT A;  2KZ8 A;  3KXA A;  3SCG A;  4F8D A;  1PUF B;  1WET A;  2KEI A;  2XRL A;  3GTL J;  4G12 A;  1LE8 A;  4B4C A;  1JWL A;  1HF0 A;  2AWI A;  2M8G X;  3IH2 A;  5DTD A;  2R92 J;  5EG0 B;  2LYJ A;  3QQ6 A;  4GHJ A;  1VPW A;  2LYQ A;  3BTJ A;  3OQN A;  3GTO J;  4LOC A;  4D7N A;  2EWT A;  2CSF A;  2BNO A;  1ETW A;  1XWR A;  2RAE A;  2L0K A;  1JTX A;  1JUM A;  2WB1 N;  5EDN A;  3ZQI A;  1JUP A;  4ABZ A;  4C2M J;  3PO2 J;  3Q0V A;  2KT0 A;  4IEJ A;  5C4X J;  3BTI A; 
#chains in the Genus database with same CATH topology
 1WH5 A;  1QQI A;  1W5S A;  3WE3 A;  4IRI A;  3SZT A;  1ZZ6 A;  1E17 A;  2Q2E A;  4HAM A;  2N8G A;  4M71 A;  3F21 A;  4NUB A;  2ZNZ A;  4S0H B;  2RQP A;  4HRA A;  1S72 I;  4HRI A;  2DA6 A;  1ZKG A;  3ELK A;  3WTW C;  3ABM H;  1U5T C;  2PI0 A;  4HPQ A;  2VOP A;  3HRM A;  3K4B A;  1QGP A;  5GAH J;  2BHZ A;  3D1N I;  2OA4 A;  3RTR A;  2L9V A;  1AKH B;  3FK7 A;  3QPH A;  1SQ8 A;  2LNB A;  2LKX A;  4UB8 C;  3KEY A;  4M72 A;  1W0T A;  1BI3 A;  3S3O A;  1LQ1 A;  3G4S I;  2LRE A;  2NS7 A;  4HF0 A;  2WUS R;  2M34 A;  3F6V A;  4WCG A;  3Q0U A;  1TWC J;  2X9D A;  1ZR2 A;  4MFD A;  3ZQ7 A;  1OYI A;  4U87 A;  2O4A A;  1WJF A;  3CLQ A;  4NDL A;  5J40 A;  4HDU A;  3GN5 B;  1K6Y A;  1MBG A;  3FXO A;  2FBI A;  2L54 A;  3BS3 A;  4JP0 A;  3EYI A;  1BR4 A;  1O3Q A;  3ZQL A;  4PUS A;  1W7P D;  2FOK A;  1HW2 A;  3R60 A;  3AFH A;  1H9T A;  2DN0 A;  1WH7 A;  4Z5H A;  2DYS H;  1XD7 A;  5A2Q K;  2Z2S B;  2HIN A;  1NK3 P;  3BR0 A;  4S05 A;  1NHA A;  2XAU A;  4EKG A;  2LOO A;  2VT2 A;  3B6A A;  2IS1 A;  2DFH A;  2HTJ A;  4NB5 A;  4DIQ A;  2MLK A;  4DZP A;  3TO7 A;  1QRY A;  4G8X A;  2VPR A;  2IVQ A;  4E7L A;  3DKW A;  2DI3 A;  4JK1 X;  1V5G A;  1ZG3 A;  2DMP A;  3MZH A;  4MEY F;  4J19 A;  1XMK A;  2Z1D A;  4YEL A;  2X6O A;  3WGI A;  3S2H J;  1QVT A;  2BXY A;  3F8B A;  3KE2 A;  1Z67 A;  2VJ5 A;  4TV7 A;  2L5Q A;  3J7Y J;  4R79 A;  5L3C A;  3CCS I;  1IV8 A;  2KLO A;  3KP4 A;  5M3F J;  3I59 B;  2BW3 A;  2QEX I;  5D6F A;  3BWG A;  1MD0 A;  2ZXJ A;  1JKR C;  3PE5 A;  1ZG1 A;  1VQM I;  3H3V K;  3IWZ A;  2AUW A;  2A5W A;  3OP9 A;  3OR2 C;  2HQN A;  2I10 A;  3I5U A;  1LVA A;  1S3J A;  1Y1W J;  2QZ8 A;  4IRG A;  2DMQ A;  2J5O A;  2EFP A;  5CPR B;  5E20 A;  3HUG A;  5CYV A;  2DPD A;  3LSJ A;  3DFG A;  5FLX Z;  3QU6 A;  5DDG A;  4RMN A;  2KIM A;  1B9M A;  1R1V A;  3MQ0 A;  3HJE A;  1K61 A;  2JPB A;  4HNV A;  4ENJ A;  2VUM J;  5EZG A;  3KEO A;  3S1R J;  2E1M C;  3KYD B;  5B5E C;  2Q0O A;  4RAY A;  2AQE A;  1ZQ3 P;  2E35 A;  3OOU A;  4DQ2 A;  4EZI A;  2VQG A;  1YYV A;  4YFX F;  4I76 A;  1MBE A;  3M1E A;  1YIJ I;  1X57 A;  3FXJ A;  4LLL A;  2DMT A;  2VJ4 A;  2XGE A;  2HNH A;  3HC7 A;  4OAZ A;  3OS0 A;  2EK5 A;  1A31 A;  3A01 B;  2G9W A;  4G6T B;  5GPA A;  1RZR A;  2ZFW A;  5TRD A;  3DPL C;  2LC2 A;  4CSW A;  2HEO A;  2HVS A;  2LYK A;  4M9Z A;  1IG7 A;  2YR2 A;  1A35 A;  3ABT A;  3QRF F;  2JTV A;  2X0L A;  2R7T A;  5B1B H;  2OUM A;  2PJP A;  4EV0 A;  1P6R A;  1R5H A;  5C3E J;  1ZR4 A;  1VQ6 I;  3DP7 A;  4UXN A;  4GRI A;  1MBH A;  2E1N A;  2EZH A;  1PUF A;  2VE8 A;  3HRT A;  1Z91 A;  3GLX A;  3L2W A;  2KPJ A;  5AIQ A;  1MBJ A;  3J81 Z;  3LIS A;  3Q5F A;  2FUG 2;  2KP6 A;  2OV7 A;  1OKR A;  4I09 A;  5BNG A;  1PRV A;  3OY9 A;  2KQR A;  2OTJ I;  2L7M P;  1YE9 A;  3LA2 A;  4OOI A;  4C2U A;  2AXL A;  3FKJ A;  3GTJ J;  2QQA A;  4LK1 F;  4PZJ A;  1QHG A;  2V9V A;  4RAF A;  3U2R A;  1QPZ A;  2W4S A;  1NK2 P;  1K83 J;  1ON2 A;  1ONV A;  2F5D A;  2XPV A;  3CP8 A;  2OQR A;  3MKY B;  2J5P A;  2MSY A;  1DU6 A;  1ZG5 A;  2LLK A;  1KU3 A;  1X19 A;  2M2E A;  5J8F A;  3H0D A;  5JVG F;  3QP5 A;  1KU7 A;  5E8G A;  3SZP A;  2PMZ N;  3CC2 I;  2PEX A;  2LYP A;  4PGH A;  2W00 A;  2ID3 A;  3KZY A;  3TMO A;  1ITY A;  1OLT A;  2QCO A;  3OYM A;  4E7H A;  5E8I A;  4A12 A;  2AS5 F;  1ZGA A;  5DTR A;  3TEL A;  4ESJ A;  3Q9V A;  2HVR A;  3C2G A;  2M9H A;  1HLV A;  3CJR B;  3ZMS A;  2VKD A;  3S14 J;  3SR4 A;  3AKZ A;  1J59 A;  4WF2 A;  4RGS A;  4IO9 F;  4PJM A;  1WJ5 A;  2OCE A;  1G2H A;  1SFO J;  3PFI A;  2PUA A;  3J7A Y;  2DTR A;  4ENN A;  1DUL A;  1U5T B;  3L2R A;  1MMN A;  5H2F C;  3J80 K;  4AID A;  1FT9 A;  5HLT A;  4PGG A;  4XKC A;  2M8E A;  1JE8 A;  1KQ9 A;  4DW6 A;  4KIS A;  3RZZ A;  4JCY A;  2ID6 A;  4IQ4 A;  3F8F A;  3CCM I;  1F36 A;  2FEZ A;  2VC1 A;  3KLN A;  1APL C;  1PNR A;  1JJ8 C;  1GVJ A;  4A5M A;  2XKP A;  4Y7N J;  1CF7 A;  1BDI A;  1TWH J;  1CGP A;  2FJ1 A;  4EK9 A;  3JTG A;  1U2Z A;  4M9X A;  2QGU A;  2HTS A;  4AIH A;  5E3N A;  4B48 A;  1OCT C;  2PUF A;  1QA6 A;  5AIP A;  2OAZ A;  4XN0 A;  4NC6 A;  5FJ8 J;  3DQV C;  1ZK8 A;  4OIQ F;  1D8K A;  1KU2 A;  5LHI A;  1T8I A;  2L9S A;  3S17 J;  2CQN A;  3BR2 A;  3CZ6 A;  1ZVV A;  2VEO A;  3M8E A;  2P0W A;  4ZZL A;  2P6T A;  5E3L A;  5D4S A;  3BDN A;  1P7I A;  4FE7 A;  2W82 A;  1IDY A;  3OYE A;  1OSL A;  3ZKC A;  1MSE C;  2PXV A;  1HKS A;  3RQ4 A;  4CYC B;  3OYF A;  5L3E A;  3F0C A;  2OPT A;  4I0B A;  1ZRC A;  1WFX A;  3LSH A;  1V54 H;  1ZGJ A;  2JSC A;  3H5T A;  5K7F A;  4X4D A;  3M9L A;  4F55 A;  3GTP J;  5EGO A;  2P4W A;  3BJ6 A;  2GOM A;  4P9F A;  3FYM A;  3H9J A;  5J1U A;  2QM3 A;  1MMS A;  2X1E A;  1Z7L A;  1I1G A;  2IA2 A;  3OYD A;  1FIA A;  1UXD A;  3H1C A;  2A07 F;  4W97 A;  3HEF A;  1VQ5 I;  2WAQ A;  2BVL A;  1FX7 A;  4XRF A;  5CVJ A;  1I6X A;  2NOJ B;  2Z16 A;  5C4J J;  2ESN A;  1JGG A;  5JUW A;  1JTY A;  1LJ9 A;  1QPI A;  4XID A;  3V8L A;  2QVO A;  4XKV A;  3U21 A;  4AYB A;  4F92 B;  5D5U B;  4DZJ A;  3GF2 A;  3GO5 A;  3MAJ A;  1ZLJ A;  2LSO A;  1FIP A;  1IRZ A;  4D5C A;  5DM6 F;  4LLN A;  2BZT A;  5BPI A;  2P5V A;  2XUB A;  1PRU A;  4I01 A;  1OR7 C;  2E1M B;  2GXG A;  5JFR A;  4BXX J;  4RBO A;  2GZU A;  1UG2 A;  2F4O B;  1BR1 A;  5L3B A;  1O3R A;  4Z5C A;  1VQ9 I;  4MCX A;  1FP2 A;  1FMV A;  2A6T A;  2F2E A;  4P96 A;  2LYL A;  2A05 A;  2PXD A;  3RCO A;  1IXC A;  2QSG X;  3PSI A;  3TOA A;  2K4B A;  4ITV A;  3GWZ A;  2GXB A;  2O49 A;  1S8N A;  2FSW A;  1TP4 A;  1X4P A;  1LNW A;  2EFW A;  5CVR A;  1BR2 A;  2EFN A;  4ENK A;  3OYJ A;  3QOW A;  4YG1 A;  1ZPQ A;  3GZD C;  2OFY A;  1BM9 A;  2R7V A;  2LTP A;  1T38 A;  1MSF C;  4D1Q A;  2HQR A;  4ETS A;  3MEX A;  2R63 A;  3A2K A;  2A6H F;  3G7D A;  3DU6 A;  3ZMD A;  3DLL F;  2O9L A;  3QOP A;  2Q8K A;  1B1B A;  3VSL A;  4XIC A;  1TW2 A;  3S3N A;  3M4O J;  3BZ6 A;  3C1D A;  2VQC A;  2DT5 A;  4RA2 A;  2K9S A;  3MLF A;  5HDK A;  2GRM A;  2O6G E;  2GBY A;  4GCV A;  4HNU A;  4L5E A;  3IH3 A;  4E7Z A;  3K69 A;  4GQM A;  2KMU A;  3HTS B;  3I9V 2;  2HKX A;  4BY1 J;  4CHU A;  4QTR A;  5DCM B;  5DSX A;  5M5X J;  1J09 A;  1HBX G;  3F52 A;  2W1O A;  5JLX A;  2OJE D;  2HSG A;  1VF9 A;  2NVY J;  3A0B C;  3E97 A;  1WPK A;  1MNE A;  4FHT A;  2HDD A;  3RPU D;  2JQ7 A;  3DBL B;  2LF8 A;  3SCF A;  2ZFU A;  1GHC A;  4II2 A;  3R09 A;  1J75 A;  4M3B A;  2P8T A;  5J6X A;  5ED4 A;  3PIP F;  3LA3 A;  4I7H A;  3ZP5 A;  5K5O A;  2ECB A;  2HKO A;  2R1J L;  5FKN A;  1IJW C;  2MC3 A;  3HKZ A;  1T33 A;  2LF7 A;  3CDH A;  2W7N A;  1JHF A;  3WE2 A;  3BDD A;  3FM3 A;  1YRN A;  3WTU C;  3TW6 A;  3OYI A;  4AIK A;  3N4M A;  2IEK A;  2CJJ A;  5D4R A;  5D5V B;  3EUS A;  3K4L A;  2BY2 A;  4KIC A;  2PXF A;  4PU8 A;  1FWZ A;  1Q1V A;  3GTQ J;  2FU4 A;  4MQ9 F;  1TWA J;  2O8K A;  3S2D J;  3LWF A;  1AOY A;  3LAP A;  2FF4 A;  4DYR A;  1Z77 A;  1ZRE A;  3L1P A;  3PNV A;  2XXA A;  2BY3 A;  2V1X A;  2ZB9 A;  3HM5 A;  4EM1 A;  4D0P A;  1EV7 A;  2VBZ A;  4AD9 A;  3R61 A;  2XAG A;  2K85 A;  2CQQ A;  1ETV A;  1LFU P;  5GAG i;  3JRI A;  4BAC A;  4G7Z F;  1WQ2 A;  1VQL I;  3LSM A;  4WVL A;  2HI3 A;  4BEH B;  1BI0 A;  4ZDP A;  2EZL A;  3V7C A;  4DYQ A;  2DBB A;  1X1P A;  4N9I A;  4CH7 A;  4HV6 A;  2COM A;  3ONQ A;  4AVP A;  1LUJ B;  2HVQ A;  1YIT I;  4BYY A;  2XV4 S;  1CQT A;  4ZYD A;  1SAU A;  2GXA A;  1DWK A;  5E79 C;  1JKQ C;  3ASN H;  2G7H A;  2KDO A;  4L18 B;  4AIJ A;  2Y0M A;  2CRG A;  5E1W A;  3MFK A;  2KRF A;  2LCV A;  2HGC A;  4Q48 A;  2LYC A;  3BG3 A;  2FBH A;  1BJZ A;  1FSE A;  1TT5 B;  2UWM A;  4UHT A;  1SVL A;  4KNY A;  3KXA A;  3BJO A;  1WET A;  2KEI A;  4BDZ A;  2XRL A;  3ZCO A;  2QEN A;  3TDU C;  1P2F A;  3QOE A;  1HF0 A;  3FX3 A;  3IH2 A;  3ABU A;  2R92 J;  2PXB A;  3RYR A;  4JOM A;  3MZY A;  5ICC A;  2EJR A;  3BJA A;  1ZEL A;  3CMM A;  3PQK A;  2QSH X;  2BNO A;  4DNC A;  2WB1 N;  3ECO A;  4NQW B;  2DQL A;  2DW4 A;  4GYI A;  3VB2 A;  2AXT C;  4Y4R A;  5C4X J;  2K4J A;  3GUU A;  3IUO A;  4EGY A;  4X4H A;  5FRO A;  3CME I;  2Y75 A;  4L5I A;  3DXJ F;  2CS3 A;  1WWX A;  3JXC L;  3KZZ A;  1IUF A;  4XK4 A;  3WTT C;  2LYR A;  1OCC H;  3C2H A;  3PNY A;  1Y6I A;  2W24 A;  1QP4 A;  1SMY F;  1K4S A;  4CDG A;  3K9T A;  5E18 F;  2VBY A;  2OBP A;  4HQM A;  2DMN A;  1XCV A;  1Z3X A;  1TWF J;  1Z6R A;  3AG3 H;  4N9H A;  2LBF B;  3TO6 A;  1GUU A;  5CVI A;  3W2W A;  5CVV A;  5F1J A;  4X4G A;  2KZV A;  3DPT A;  4XQF A;  1IV6 A;  4Z58 A;  1PUE E;  4YEJ A;  1IXR C;  1ZZ7 A;  4RB2 C;  1D1B A;  1R63 A;  2XXQ A;  2A69 F;  3BCA A;  2BOL A;  3ML6 A;  1WGX A;  3OL3 A;  3NAU A;  2DOF A;  4IQJ A;  3A02 A;  1BL0 A;  3OIQ A;  1USS A;  3NXH A;  3FXL A;  2EF8 A;  3MZ8 A;  1Z05 A;  4XSZ F;  3W2V A;  4IHW A;  4U88 A;  1XDU A;  1BI1 A;  1UCR A;  2LNM A;  1R1U A;  4XL9 A;  3TEP A;  5LRR A;  1N75 A;  2HDW A;  3ZPX A;  4E4H A;  3V8J A;  1QB2 A;  1KA8 A;  5LD2 C;  2RNG A;  2BV6 A;  3K4K A;  1LQC A;  2HWV A;  4FX4 A;  2J7W A;  3ZQQ A;  3SX0 A;  2LVS A;  3CLC A;  2M5W A;  1GVD A;  3QYE A;  2M7B A;  3IAS 2;  3CCY A;  2LY2 A;  2A5Y B;  4ON0 A;  4KMF A;  4EJU A;  1UHS A;  3GX4 X;  4HX4 A;  1I39 A;  3H5R A;  3BTL A;  3LL7 A;  1RRJ A;  3I71 A;  3PM1 A;  1MBF A;  5F04 A;  2JPC A;  3HGY A;  3AG1 H;  3W2A A;  5D6E A;  3GUD A;  5CKT A;  3WGG A;  1C0W A;  4C3H J;  2XAQ A;  3HL2 A;  3WGH A;  3KFW X;  1MH3 A;  3JRE A;  2HDC A;  4BY7 J;  2XGX A;  5LLQ A;  2B5A A;  4BUP A;  1ZGW A;  2MD5 A;  2M4K A;  2W25 A;  1B8I A;  2JUG A;  1OMI A;  3MCZ A;  3F6W A;  1BW6 A;  3DTI A;  2IGK A;  3DF8 A;  4DBR A;  1Y1V J;  2VB6 A;  1YO5 C;  3CP2 A;  3GYH X;  1OIS A;  2R3S A;  2YSR A;  5K5Q A;  4GFB A;  3OYA A;  2WY8 Q;  1RR7 A;  2A3S A;  2V4J C;  2VQL A;  2ZJ2 A;  1VQN I;  2NVQ J;  3HOU J;  2UUZ A;  2IUO A;  4M6V A;  2E2I J;  3I4N J;  2R7X A;  1SD6 A;  1V55 H;  3KZ3 A;  3TOB A;  4IHT A;  2R5Y A;  3H3U A;  1MDM B;  1GV5 A;  5JLW A;  1IN5 A;  4FT8 A;  3HOY J;  4RGX A;  3L7W A;  1Z21 A;  5LGU A;  4FN3 A;  1ZYR F;  2K9L A;  1QBJ A;  2XXP A;  1TL8 A;  3N05 A;  4BBS J;  4LIV A;  1MND A;  1TNT A;  1ZZ9 A;  5LHG A;  5DD4 A;  2KIU A;  4P55 A;  2CYY A;  4OMZ A;  4LB5 A;  2R7O A;  3JRC A;  2H8R A;  2XIU A;  3UWP A;  3DEW A;  1G6N A;  1YOV B;  2O8X A;  3I3L A;  2NYX A;  2OTL I;  2NXN B;  1POU A;  5HS7 A;  4EJO A;  5IOZ A;  4ER6 A;  2Y30 A;  1OYW A;  2GOX B;  5EJC A;  2BYV E;  2DJI A;  2E1C A;  2PQ8 A;  2HQA A;  3F72 A;  3RI4 A;  3RPQ A;  1UHW A;  3I4M J;  5E17 F;  2R4G A;  1VQ4 I;  1ON1 A;  4HNT A;  4Q47 A;  3UR3 C;  1J7K A;  4PU7 A;  3JRG A;  2D2W A;  5IP9 J;  1Y39 A;  4ER7 A;  4BKX A;  1X1B A;  2MLG A;  4HX8 A;  3NDB B;  1Z7U A;  4XRM A;  1RUN A;  1RPW A;  3FK6 A;  3WTV C;  1L3L A;  3L09 A;  1BDH A;  3R0A A;  5JHU A;  5A2Q Z;  1MMA A;  2EIK H;  1QZE A;  3H9G A;  1IAW A;  4A3L J;  5FB2 A;  2IVB A;  2YPR A;  3FBI B;  3VPR A;  3HDD A;  4RB0 A;  4BXU A;  2CMP A;  4CIC A;  4L9T A;  2ZSH B;  3EUH A;  2CQ7 A;  1I27 A;  4G7H F;  3M8J A;  4KT5 C;  1F1Z A;  2HZD A;  1ENH A;  4M3E A;  4Y13 A;  5HNH A;  3GZC A;  2A6E F;  1FOX A;  5IT9 K;  1K79 A;  1UFM A;  1V5F A;  2ELK A;  3BY6 A;  4MQV A;  3X2Q H;  1D8J A;  3DKX A;  2DMU A;  2RC4 A;  4M6X A;  2VI6 A;  3G2B A;  2E36 A;  1Y7Y A;  4JBA A;  1B72 B;  1ZN2 A;  4JX5 A;  5CQE A;  3OWQ A;  1IN6 A;  1WI3 A;  2LYS A;  3V42 A;  5B3S H;  1AKH A;  2AHQ A;  4EKI A;  3QAH A;  2YU3 A;  1JKP C;  2GRL A;  2FQ4 A;  2PE5 A;  1JT6 A;  4K2E A;  2OD5 A;  4UNO A;  3DWL E;  4ASN A;  2XF6 A;  1ULY A;  4KUM A;  2IRF G;  3RSN A;  2VKV A;  3FXU A;  3IWF A;  3QOD A;  1FBS A;  5F0F A;  2HR3 A;  4A2U A;  1GXP A;  1R7J A;  3CC7 I;  2E5N A;  3GFL A;  3CEC A;  3TL4 X;  4HLY A;  3GN5 A;  4ER3 A;  4DBQ A;  3DNV B;  4YIR X;  3FMQ A;  2X6Y A;  1HST A;  2OZU A;  4XSX F;  4YIF A;  4W1U A;  3CD6 I;  2XI8 A;  1BIB A;  3OS2 A;  1GT0 C;  2EA2 A;  2BHY A;  4EVI A;  2Y9Y A;  2Y31 A;  3W6V A;  2M45 A;  2XJ3 A;  3RKW A;  1I5Z A;  3JSP A;  1YG2 A;  4XKW A;  2JA2 A;  3ZRG A;  3LSI A;  1TTY A;  1NTC A;  1K7A A;  1S6L A;  2WAQ N;  2HXI A;  2BEO A;  2DQR A;  1Q1H A;  3V7S A;  4EGZ A;  2PN6 A;  1BA5 A;  4IPA A;  4CCN A;  3E1S A;  1X58 A;  3G5G A;  4O8B A;  5KCM A;  1UST A;  4AYB N;  1S9H A;  2DU9 A;  4YG4 A;  2D1H A;  3WOD F;  3I59 A;  2RN7 A;  3OYG A;  4BBR J;  1U8B A;  1OCP A;  3FMY A;  3FXQ A;  1DW9 A;  2O3F A;  1U2W A;  4B8X A;  4ENM A;  4KIT B;  3HHG A;  1QQB A;  2X48 A;  3KYL A;  5HS9 A;  3BCB A;  4UUT A;  4A3I J;  4UVA A;  2VE9 A;  1OCO H;  3K10 A;  3SQN A;  3WHB A;  6PAX A;  2CW8 A;  5H6Q A;  1ZUG A;  1KYZ A;  4HA8 A;  4PSW A;  5TGT A;  2PUE A;  4OAY A;  3N97 A;  1DP7 P;  1IRF A;  3LQX A;  1QQA A;  2EZK A;  3G1O A;  5DD8 A;  2FMY A;  3M7G A;  5F08 A;  2YBD A;  5HOO A;  2WIU B;  3KL4 A;  1LE8 B;  2L7K A;  5L3D A;  3G71 I;  2BNM A;  2PXK A;  4PJN A;  2MQK A;  4NC8 A;  3ZHI A;  3F51 A;  2CW7 A;  2JRM A;  5J8C A;  1MFQ C;  4BGD A;  2DFF A;  3PQJ A;  4A3K J;  1L0O C;  3IHU A;  3WTS C;  2JVL A;  2ZME C;  3JTH A;  4CZC A;  3JSO A;  4CA0 A;  2J7U A;  4AVZ A;  3A01 A;  4KDP A;  2E19 A;  4DE8 A;  3HRU A;  3J80 Z;  4EMS A;  1J5Y A;  2JJ7 A;  2XPU A;  3FXK A;  3QYF A;  3ZOB A;  4IX7 A;  5EG0 A;  1KYW A;  4CZZ A;  5DCF A;  3CO6 C;  1ETX A;  1MKM A;  4X4I A;  1T08 B;  5GP9 A;  2ETH A;  3F8N A;  3IKV A;  2PXT A;  1R23 A;  3S3M A;  4XKB A;  1TQP A;  1U9N A;  2ADU A;  2B0L A;  3GFM A;  3EUK L;  2GA1 A;  3ZGK A;  3WHC A;  2QBY B;  2PIJ A;  2PXQ A;  2XAH A;  5DM7 F;  3BQY A;  3A9Z A;  3WU1 B;  4CCK A;  1Z3Y A;  3GBF A;  4HV5 A;  2AXV A;  3NWT A;  5F6F A;  4WXD A;  3AG4 H;  3H3Z A;  1MW7 A;  2DLL A;  4I6Z A;  3PO3 J;  3B7H A;  1X3W B;  1SVO A;  3E6B A;  4KN4 X;  3GZ5 A;  3Q9S A;  4UB6 C;  1SEU A;  4LG0 B;  5K1Y A;  2KEK A;  1FJL A;  2AQF A;  2VJI A;  1YW9 A;  1J9I A;  2W48 A;  1NG6 A;  4EM2 A;  1X2M A;  4LIT A;  2E1O A;  4ZH4 F;  4A3J J;  1XS9 A;  4G7O F;  4NHJ A;  1JJ6 C;  2NRA C;  2CUJ A;  2KJB A;  2L3D A;  1VFC A;  2AW6 A;  2M7A A;  4OIN F;  5K5R A;  4A5N A;  1R58 A;  4A3B J;  5FFX A;  2DOA A;  2QWW A;  3G3Z A;  4J1X A;  2EFQ A;  3K4N A;  4RAZ A;  1ERD A;  2PMH A;  2AXZ A;  4A69 C;  3ISP A;  4CYD A;  3KET A;  4NNJ A;  3T0Y A;  2KL4 A;  4ANJ A;  1O3S A;  3ROU A;  2D45 A;  4XON A;  4XLE A;  4UUS B;  3I0T A;  2EIN H;  4X4F A;  3CC4 I;  3QQA A;  3CCR I;  2PPX A;  4BS9 A;  3FF5 A;  4D9J A;  3SCH A;  2JZY A;  2KEJ A;  1V3F A;  4UY8 I;  1UG0 A;  2H94 A;  3OQO A;  2V26 A;  4OIR F;  2FA5 A;  3BZK A;  2DFI A;  2RNJ A;  2EB7 A;  1R22 A;  3CJQ B;  2K9M A;  1U5T A;  1B6A A;  2CUZ A;  2EQR A;  2XHK A;  3IV5 A;  3H9Q A;  4H4K C;  3LSP A;  2ICT A;  2BE5 F;  5HOD A;  2R5Z B;  4ESF A;  1G4D A;  2LK2 A;  2K9Q A;  3T5X A;  3PNT A;  3RJP A;  4XRS G;  1G3T A;  3S2W A;  4FX0 A;  3OSG A;  1YJ9 I;  2LMD A;  3PUB A;  3HYI A;  1AHD P;  1L1M A;  1SD4 A;  3H36 A;  1QZZ A;  2F5C A;  3WU2 C;  4XLA A;  4L9J A;  4I6U A;  2MFZ A;  1LEA A;  3A1Y A;  1PJR A;  2LY1 A;  3K1P A;  2MH9 A;  4ZYE A;  1TW3 A;  2OCC H;  3WG7 H;  1HDP A;  1P4A A;  2F5V A;  1EKE A;  4BJ6 C;  2HZT A;  4BE0 A;  1ZZB A;  1YW7 A;  2CO5 A;  4FET A;  4RB1 A;  3HOZ J;  1LFP A;  4DYC A;  1N78 A;  2VQH A;  2EV0 A;  3IRR A;  1REP C;  1R49 A;  1IN4 A;  4PJL A;  1BN5 A;  2F5F A;  3PUF A;  5CQG A;  2QLZ A;  3HTU A;  2B9S A;  2L1P A;  2V3C C;  3ZPL A;  3E5Q A;  4I02 A;  2TRT A;  4LGW A;  4ZZD A;  2VIX A;  4AU7 A;  4F91 B;  4IZZ A;  4CYC A;  1X2L A;  3DTE A;  3JXD L;  3KIO A;  1RES A;  1RPE L;  1UMQ A;  4NC7 A;  3R4K A;  4DOZ A;  3CUQ A;  4RB3 C;  3MKZ A;  2GIV A;  3A9X A;  3RQI A;  4D7M A;  2O0Y A;  2COB A;  4B43 A;  4U0W A;  1R4M B;  1QVU A;  1T95 A;  2FRH A;  1KON A;  5DS9 A;  2HQ5 A;  4Z5D A;  1JUS A;  2KZ8 A;  3SCG A;  5JI6 A;  2K27 A;  4EM0 B;  4BHB A;  3ZR8 X;  1T2K A;  4ZTF A;  2O61 A;  4EJW A;  1PYV A;  1JWL A;  4GHJ A;  4IF4 A;  1YIO A;  4CCO A;  4IVN A;  3GFI A;  3L2U A;  3BTJ A;  1ACI A;  1LDK B;  1MJA A;  3GTO J;  1RNL A;  4LOC A;  4D7N A;  5DUK A;  2CSF A;  1ETW A;  1VQO I;  5EDN A;  3PSF A;  4A6D A;  4HYE A;  3PO2 J;  4C2M J;  1IUY A;  4IEJ A;  3FMS A;  5IPA A;  4Y52 J;  3HZI B;  3JAM K;  3S32 A;  3RDI A;  4ZTJ A;  3CCJ I;  3CQZ J;  1FYK A;  2DT7 B;  1UEL B;  2MYS A;  3KP7 A;  3QPS A;  4FAS D;  5IYD J;  3BG5 A;  1LEB A;  2XVC A;  2ZME B;  2VON A;  1OJL A;  5LRS A;  4A6E A;  1K78 A;  4RAG A;  3PFY A;  4X4C A;  1XG1 A;  2KFD A;  3C7J A;  1AA7 A;  3FHZ A;  2DYR H;  3S1N J;  4I6T A;  3TBI A;  5IY5 H;  2V6C A;  2ZNY A;  1O3T A;  1TLH B;  5FGM A;  2C6Y A;  1FSH A;  4OBM A;  1G3W A;  4B3X A;  1TQM A;  4BXF A;  3HXL A;  5BOX A;  3NEU A;  1T0F C;  1MBK A;  2B63 J;  3GTK J;  3KP5 A;  1I3Q J;  3PJR A;  4A3F J;  2IA1 A;  1A6Q A;  1U78 A;  2A61 A;  2WAF A;  4QLC U;  2XAS A;  2ACJ A;  1OQY A;  2L7Z A;  2BGC A;  1RZR D;  4FCY A;  5LEK A;  1BBY A;  3NZL A;  3KYC B;  2JSP A;  1SD5 A;  2A6C A;  4XOR A;  2KJC A;  2V7F A;  3GBG A;  3GEZ A;  1JT0 A;  4Y15 A;  1D0X A;  1W0U A;  3HGG A;  5DCM A;  4CGZ A;  3E6D A;  3F22 A;  1ETO A;  2QA4 I;  3IH4 A;  4OB4 A;  4KYW A;  4V19 K;  3GW2 A;  3ZMZ A;  1W5T A;  2ELH A;  2E7W A;  3VYS B;  2FQ3 A;  2TDX A;  1YRN B;  1RUO A;  2L9N A;  2PMZ A;  2IJL A;  2JRT A;  1K4T A;  4Z59 A;  1HDD C;  3LFP A;  5KNL A;  1X3Z B;  2DOE A;  5K98 B;  1FC3 A;  3CCV I;  5H6R A;  5FRN A;  3R0J A;  2ZSI B;  3HG9 A;  4CO8 A;  1U3E M;  4BL0 B;  3W6J B;  4LG3 A;  3BP8 A;  3I53 A;  1ZZ8 A;  2ODR D;  4ZC3 A;  2Y69 H;  3JCU C;  5HVQ C;  3E7L A;  4RGR A;  4MIM A;  3MKL A;  2XGC A;  1DUX C;  4BE1 A;  2X1D A;  2OC6 A;  3AL0 C;  2FX0 A;  4CCM A;  5EF6 A;  4Y3O A;  2HPM A;  3I64 A;  5ICF A;  1IO2 A;  1FBQ A;  1XGN A;  1LVK A;  1ZHF A;  2JMW A;  4LMY A;  4PFP A;  5AON A;  5F64 A;  1RR8 C;  4YAR A;  4QSH A;  4IJA A;  5GTH C;  5ILV A;  2X1C A;  1ZZC A;  3CRO L;  2GQQ A;  2MEZ A;  1LCC A;  1N25 A;  1TT0 A;  3FMR A;  1XN7 A;  5FO5 A;  4XBF A;  4IOA F;  4ZDO A;  2QYO A;  3PXP A;  2WV0 A;  1S7E A;  1SFX A;  2IS6 A;  3FWE A;  1JKO C;  4M6Y A;  4P5O A;  1J2X A;  1VI0 A;  1QU3 A;  1Y0N A;  1RC9 A;  2W57 A;  2XGD A;  5HDN A;  1A6I A;  2STT A;  1E3P A;  3ZN0 A;  5EZH A;  1LLI A;  3DKY A;  1GDT A;  4MO7 A;  3OMT A;  2VBX A;  3IP4 B;  4YG2 F;  3U9G A;  2CV0 A;  3BLY A;  3KX2 A;  1K6O A;  1S5L C;  3W3C A;  1FPQ A;  5IYB J;  2VOD A;  2PJR B;  1F9N A;  2RDP A;  3ME5 A;  4FTH A;  4C9Y A;  1LB2 A;  3LQR A;  5E3M A;  1QPM A;  2QUF A;  3QYX A;  3JW4 A;  1PDN C;  4BE2 A;  1W36 C;  1W7P A;  3S16 J;  1I3A A;  1YQA A;  2V79 A;  3U1K A;  1QNT A;  3G0T A;  2IGM A;  2JCG A;  2QQ8 A;  3OWT A;  1H9G A;  1Y8Q B;  1UB9 A;  2QQB A;  1JFS A;  1MJ9 A;  1WJB A;  5DV5 A;  1Y0U A;  1QHH D;  4CXF A;  5DEQ A;  1O4X A;  1O7F A;  1O57 A;  2Y0S A;  2R7Q A;  1H89 C;  1SAX A;  2WV1 A;  5D5X B;  4P9U A;  1WVR A;  1PER L;  2LH9 A;  3IRQ A;  2ESH A;  5M5Y J;  1YSE A;  1IC8 A;  1TWG J;  3L9F A;  3G6E I;  4JX6 A;  2VPL A;  3FYA A;  1YFH A;  1TC3 C;  3OYN A;  2VL8 A;  3UKG A;  5A7L A;  9ANT A;  3L2C A;  2LLW A;  4Y42 A;  2V1N A;  4LJZ F;  1G3Y A;  1A36 A;  2L02 A;  5B1A H;  2YX4 A;  4WWC A;  4F7Z A;  3REO A;  1OYY A;  2EIJ H;  2YUS A;  4MGR A;  3S8P A;  1PP7 U;  1ZAR A;  1WI9 A;  2LBF A;  2XSD C;  2MXD A;  2A68 F;  3ZMT A;  2IP2 A;  4XLC A;  1GLN A;  4XNF A;  2LKS A;  3ULQ B;  1EJ9 A;  2PMU A;  4LB6 B;  2XB5 A;  1BC8 C;  1F43 A;  5DRT A;  4C30 A;  1HXD A;  1OR7 A;  1TZL A;  2IAI A;  1X1C A;  4XLH A;  1YLF A;  2XC7 A;  2ECC A;  5EEG A;  4QPQ A;  5GTI C;  5GAG J;  2VBW A;  3OYB A;  1BC7 C;  2NAZ A;  1JH9 A;  2RVC A;  3I4P A;  3MWM A;  3DEE A;  5KK1 A;  2JUC A;  4UVC A;  2GLO A;  3M8F A;  2IA0 A;  3NQO A;  1XTA A;  1WH8 A;  2DK8 A;  3O6B B;  1WKM A;  5KHD A;  3VDX A;  3G1M A;  2H6C A;  3F8M A;  1BOA A;  1IXS B;  1WJE A;  2HYJ A;  3QPL A;  4LK0 F;  1E3O C;  1R9T J;  4OU0 A;  2KDZ A;  3ZHM A;  4XOP A;  5EYR A;  1QP7 A;  2F5E A;  3O8G A;  2LKP A;  2LDU A;  4ZDL A;  2JA8 J;  1JFT A;  4PCQ A;  4B1R A;  3SDB A;  4L0Z B;  2BVM A;  4I0A A;  4I99 C;  4BJT A;  4IA8 A;  3K4M A;  2O03 A;  3E6C C;  1WJD A;  2K02 A;  5FKL A;  4FBI A;  3VYU B;  2NNN A;  2PUC A;  3OYC A;  4Q5S F;  4YII A;  2VT3 A;  3E5U A;  4PJ0 C;  1HC8 A;  2F6C A;  2RQQ A;  2EZI A;  1XGS A;  1POG A;  2XCJ A;  1EA3 A;  5ILU A;  1XC5 A;  3TP3 A;  3GZN B;  4WXH A;  4Y17 A;  1RZS A;  1D0Y A;  4R8H A;  4I6R A;  2DXI A;  3ZQF A;  1IDZ A;  2HCS A;  2MH2 A;  3BRO A;  1H0M A;  4BH9 A;  3DM5 A;  4B47 A;  2GIZ A;  3LMM A;  3EUA A;  2JA6 J;  3VEP A;  2IU7 A;  2MW8 A;  3DU5 A;  4G6D A;  3B6C A;  2PXE A;  1UAA A;  2ZBK A;  1MH4 A;  3DBH B;  3OR1 C;  2VN2 A;  2D5V A;  2M0M A;  4U0V A;  2IT0 A;  1IN8 A;  3LQQ A;  3OMY A;  1XSV A;  3OS1 A;  3QF3 A;  1FP1 D;  4KA4 A;  1MDM A;  2H27 A;  2EWN A;  1XGM A;  2HOE A;  2R7D A;  2XPW A;  2JT1 A;  5IT9 Z;  2LRD A;  3PL8 A;  5F27 A;  1EF4 A;  3JRF A;  4EQQ A;  1MIJ A;  2E34 A;  3OQM A;  4IHS A;  3AL0 B;  3CES A;  1R6R A;  3ABL H;  4G6Q A;  2Y48 A;  2XAF A;  1TQI A;  3HSF A;  2DTZ A;  2CV2 A;  1WH6 A;  4GGG A;  1AU7 A;  3V7R A;  3T1B A;  2ISY A;  4ZYA A;  1VQK I;  3SFI A;  3SYT A;  2K3F A;  2K9N A;  1R1T A;  1VQ8 I;  3H5N A;  2ZO4 A;  4PJJ A;  1XSD A;  1FNN A;  2JN6 A;  4HW0 A;  2V1U A;  2RV8 A;  2EH3 A;  1T39 A;  5LBQ A;  2Q2E B;  4BQQ A;  4RDU A;  1ZAO A;  3A4C A;  1T6S A;  5L3F A;  3HHH A;  2HYF A;  2OU2 A;  3K4C A;  1BW5 A;  2JWT A;  2D1V A;  4F52 A;  2AO9 A;  3CJT B;  3CJN A;  3H92 A;  4U7B A;  1I1S A;  1NH3 A;  2WWY A;  4BQA A;  2QKM B;  1D3Y A;  1S29 A;  1QP0 A;  4JX4 A;  4X4B A;  5FRM A;  2KPM A;  3R1F A;  4YRV A;  3IVP A;  1U8R A;  5CJ9 A;  3A03 A;  1R5I D;  2V9K A;  1XMA A;  3QWG A;  2PXU A;  2VKH A;  4XLF A;  2LG4 A;  3R6S A;  4A0X A;  4BHP A;  2DPU A;  5BS6 A;  3L2Q A;  2YS9 A;  1KU9 A;  5E3O A;  4HF1 A;  3O3K A;  2BXZ A;  4GXO A;  1UXC A;  2HPI A;  4AWX B;  3S1M J;  2AXU A;  3TW7 A;  1ZRD A;  3K70 C;  3IC7 A;  3LSK A;  3G1L A;  2MAB A;  4ZYG A;  3WTY C;  2NOG A;  1YHQ I;  3OIO A;  2LY9 A;  2UV1 A;  2WB1 A;  3QP6 A;  1D5Y A;  2FJR A;  1JHH A;  1KQ0 A;  5ICE A;  2EPF A;  5FLM J;  1B72 A;  1IN7 A;  3KP3 A;  4XOT A;  2F48 A;  1RKW A;  3CCL I;  1OPC A;  4I98 B;  2CW0 F;  4N4O B;  2DDA A;  3LA7 A;  5J4Y A;  2JK3 A;  4M73 A;  3F23 A;  4HSR A;  3ZQG A;  4KMU X;  3H35 A;  3S15 J;  5DRY A;  4Q2J A;  2VC0 A;  5LEJ A;  2XRN A;  2DT6 A;  2XB0 X;  5GPC A;  4A3M J;  4EJT A;  2CUE A;  5LFA A;  3PIO F;  2BW3 B;  4PSX A;  1W5C C;  1B4A A;  1E2X A;  2CFO A;  2H1K A;  2P81 A;  2VXZ A;  2K3P A;  4LIU A;  1WJA A;  2ME6 A;  3WU0 A;  3Q3S A;  3DLA A;  2EV6 A;  3HUG B;  3CUQ C;  3E5X A;  3O2P E;  1FLI A;  1Z0X A;  4M9S A;  1P4X A;  4E7S A;  1S7O A;  5CLS A;  3GME A;  3L2V A;  3BTC A;  5DUI A;  2R7S A;  1VZ0 A;  2Z9O A;  3U1D A;  1VND A;  1RIO H;  1NEQ A;  4MTE A;  4F3Q A;  3LOC A;  3IAM 2;  1HKQ A;  1O7L A;  3DBR B;  3OIP A;  4HEA 2;  5TJJ A;  3GTM J;  3DEU A;  3S8Q A;  2I5U A;  4HDV A;  2IVM A;  3CUO A;  2NVU B;  4E70 A;  3I55 I;  4QPO A;  1R71 A;  2DA2 A;  1G59 A;  2IBD A;  2VXD A;  4BDY A;  4JCX A;  3BQZ A;  3GXO A;  4OIP F;  1V4R A;  4MNU A;  4II3 A;  2CH0 A;  2KZG A;  2BY0 A;  2W85 A;  1DGR M;  4J00 A;  1YW8 A;  2ME0 A;  5K7Z A;  4KIG A;  3JRD A;  5M5W J;  1LMB 3;  3P9I A;  1OCZ H;  3SDG A;  3TKY A;  3TGN A;  3LAJ A;  1J0R A;  3FHN A;  1XDS A;  1ZS4 A;  2H6B A;  1F4K A;  2EV5 A;  3D5S C;  2PXP A;  4C3I J;  1CJG A;  4MFE A;  1VTN C;  2PG4 A;  1U6G A;  1WCM J;  1IF1 A;  4HZF A;  1X4O A;  2M0C A;  1OCR H;  2VAS A;  3I54 A;  3HBL A;  1SVM A;  4HX7 A;  1P92 A;  2DA7 A;  1PP8 F;  3ZMU A;  4BU2 A;  4F8D A;  1PUF B;  3B73 A;  3GTL J;  4UV9 A;  4G12 A;  1LE8 A;  4B4C A;  1ODD A;  1X1D A;  4WX9 A;  1D5V A;  3QQ6 A;  5DTD A;  5EG0 B;  2LYJ A;  2LYQ A;  3RPU A;  3OQN A;  5ICG A;  4OWR B;  1QO0 D;  3GFJ A;  2EWT A;  3TFL A;  1F5T A;  2RAE A;  2L0K A;  3CTA A;  1JUM A;  5L3G A;  1FOK A;  2VLA A;  4PK4 A;  3ZQI A;  1JUP A;  4ABZ A;  4EQZ A;  2Z33 A;  2KT0 A;  3UNG C;  3BPV A;  5EEA A;  5FLX K;  3L00 A;  2XIG A;  2I8D A;  4IVZ A;  3KPH A;  4M3D A;  3WG9 A;  4AC0 A;  1JGS A;  4XR6 A;  5HDG A;  5HLI A;  4R1H A;  2CV1 A;  3VFZ A;  4A3C J;  1UHM A;  4WXC A;  1IRG A;  1ETY A;  1GV2 A;  2EIM H;  4RS8 A;  3SEQ A;  2PUD A;  4M3F A;  3V4G A;  1NER A;  3MVP A;  3MN2 A;  2G7U A;  1R36 A;  2GAU A;  3IKT A;  3HIF A;  4BQN A;  2ZJQ F;  1RZ4 A;  1ZRF A;  3HKZ N;  2QBY A;  2CQK A;  5ILS A;  2QSF X;  3C18 A;  1DU0 A;  2X4H A;  5GAE J;  1WJC A;  1WRJ A;  2X85 A;  3BR5 A;  3VSK A;  2FBK A;  4KIB A;  1R00 A;  2R7U A;  3H0G J;  3ERE D;  3MMY B;  5FD5 A;  1JXS A;  4RM3 A;  1DQU A;  3E0J B;  1BIA A;  1G8X A;  5BQT A;  3KEQ A;  3QFI A;  1WHU A;  4LG0 A;  3FIW A;  3M1C A;  4V2F A;  5H20 A;  4E7J A;  1A5J A;  1YS6 A;  2ZXH A;  2DO7 A;  3TRB A;  2HU9 A;  3DTK A;  4MHG A;  3BD1 A;  1STZ A;  1YS7 A;  4IXA A;  3O9X A;  3BR6 A;  1CF7 B;  4B44 A;  2ICW G;  3ABK H;  4KIF A;  5F1R A;  4D5F A;  5HS8 A;  3HPH A;  4HQE A;  3K7A J;  1XCB A;  3OL4 A;  1YX5 A;  2KIF A;  3J81 K;  4A3G J;  2V9P A;  2CWE A;  3ZMV A;  4HG2 A;  2OR1 L;  2IGO A;  2M1B A;  1XGO A;  2XSJ C;  4UUS A;  4F93 B;  1X3U A;  1DPR A;  1Z6T A;  3G73 A;  2YU9 J;  3RYP A;  1E0E A;  1U9O A;  4WK8 F;  2FML A;  4IOC F;  1ZTR A;  3NRO A;  4NDW A;  3I58 A;  2B7E A;  2KIQ A;  4KT6 A;  4OMY A;  2KKO A;  5FKM A;  4KFC A;  3T8T A;  5FD6 A;  2IS4 A;  2FXA A;  2HOS A;  1B0N A;  1ADR A;  3SEZ A;  4QWQ A;  3KJX A;  2JA5 J;  4Y33 A;  2R5Z A;  1UTX A;  2E7X A;  1R5G A;  2BBY A;  3TP0 A;  1BI2 A;  2L4A A;  1W36 D;  1KZH A;  4ZJZ A;  3NWS A;  2PXL A;  5EGO B;  3LSR A;  3CCU I;  5DYM A;  1Y8R B;  4IRH A;  2MD0 A;  5JVT A;  1IW7 F;  3CLO A;  4G9Y A;  3JAM Z;  2QKL B;  2HFH A;  4GDF A;  3W6K B;  3MEJ A;  3SJM A;  3IL2 A;  5HNF A;  3A9Y A;  1EH7 A;  3P7N A;  2P7C B;  1MNM C;  3KZI C;  1YJW I;  4MCT A;  3RKQ A;  4A0Y A;  5D5W B;  5GAD J;  3WTZ A;  3CUQ B;  4Z2Y A;  3SZG A;  3VK0 A;  2L8N A;  2EBY A;  1XB4 A;  4JQF A;  3SFZ A;  3CCQ I;  2P5L C;  2JA7 J;  4NBQ A;  3ASO H;  1FTZ A;  1P7J A;  2Y0S N;  2NNY A;  2PUB A;  4HLX A;  2R93 J;  4X4E A;  1IGN A;  2X6X A;  3S93 A;  4I2O A;  1LFB A;  1IZ1 A;  2L7F P;  2WA0 A;  4HF2 A;  4PDK A;  1LDD A;  2L2O A;  5E1Z B;  2GA2 A;  2IW5 A;  1P4W A;  5J1R A;  2Z99 A;  3CMY A;  3JRH A;  5LHH A;  2XDV A;  4XM3 A;  3HOV J;  3HZJ A;  4LFU A;  3ZQH A;  2IS2 A;  2ELJ A;  4DJA A;  2RGV A;  1LDJ A;  4IHX A;  3QWL A;  3U3W A;  5IYC J;  3FZV A;  3BPX A;  1W1W E;  5IP6 A;  2CG4 A;  4DGW B;  4C2T A;  2ZJR F;  3P5J A;  2KHM A;  1Z9C A;  2VOO A;  3OOP A;  2VJJ A;  1B59 A;  4B09 A;  3JRB A;  4N0B A;  4BAY A;  3TQN A;  2CUF A;  4A3D J;  2MBF A;  4PU4 C;  2R7W A;  1E3H A;  3QYB A;  3J7A O;  1HQC A;  3RZO J;  3ZN1 A;  5KVR A;  1G3S A;  3F9K A;  3OV8 A;  1X1A A;  1HW1 A;  2K5C A;  3OYH A;  1XMX A;  3LFU A;  3VWS A;  2LFB A;  3KP2 A;  2R7R A;  4FQG A;  1YJN I;  5FLV A;  2FNA A;  2XF5 A;  5KAI C;  2GZW A;  1FBU A;  4U0Y A;  1K78 B;  2UZK A;  4M74 A;  2EFO A;  1LPQ A;  3A0H C;  1HCR A;  4Q4Z F;  3K1N A;  2PX9 A;  1FYM A;  2WY7 Q;  3ZQC A;  1SAN A;  1DPU A;  2IXS A;  2HOT A;  3LST A;  1GXQ A;  3BR3 A;  3CF5 F;  1SC7 A;  1Y9Q A;  3GCM A;  2L49 A;  2ZXI A;  4CCL A;  2ZME A;  2R7Z J;  3TDZ C;  3WTX C;  2LR8 A;  1M1E B;  1VQ7 I;  3VWB A;  1KQ8 A;  5LGN A;  5J3L A;  4J01 A;  4MTD A;  3BT9 A;  2V6E A;  2WAE A;  2MC4 A;  2DK5 A;  3ERM A;  4YG7 B;  3K2A A;  3FIS A;  2RKH A;  3FM5 A;  2FFH A;  4S04 A;  1FY7 A;  2HOA A;  3CCE I;  2CU7 A;  2GWR A;  2MGQ A;  4I8T A;  3UFD A;  1H88 C;  4UVB A;  3OYL A;  3LFK A;  2LP0 A;  3EPZ A;  4B3A A;  1SMT A;  3O8H A;  3ZXS A;  3F3X A;  1ZAY A;  1PVE A;  3ECH A;  2M30 A;  1S7A A;  2L9R A;  3BC8 A;  3C2B A;  2DA5 A;  4V2G A;  5FKK A;  1WSU A;  4AUX A;  4UV8 A;  1FTT A;  2E60 A;  2NVT J;  2DDB A;  2Y2Z A;  3EYY A;  5FFZ A;  2OF7 A;  3BOQ A;  4LLG F;  1H8A C;  1I50 J;  2DA4 A;  2DOD A;  2XF7 A;  1JI8 A;  4AM3 A;  1HW5 A;  1BOB A;  2IVG A;  2Z5U A;  4KJZ A;  5DTM A;  1T56 A;  2ISZ A;  1MGT A;  3JR9 A;  2G0E A;  3J7Z I;  1T98 A;  4RLF A;  1QZX A;  3NAR A;  3DPU A;  3QU3 A;  4P1W A;  2M87 A;  4RM2 A;  4C3J J;  1DDN A;  4H0E A;  4BHC A;  5JHF A;  3EDP A;  1LCD A;  4XLP F;  5HLH A;  5DTQ A;  1WIZ A;  2HFZ A;  2NVX J;  2FD5 A;  1RET A;  5D8L B;  4XRS A;  1YTY A;  1UZC A;  2IV1 A;  1BJA A;  1RI7 A;  3BZC A;  5B66 C;  2Q1Z B;  2M4G A;  4XN3 A;  2E5Z A;  1D0Z A;  3AAF A;  4N4N B;  5IP7 J;  1FMW A;  2K7L A;  2CRO A;  2V1D A;  5IOY A;  3FDY A;  1HSJ A;  2IPQ X;  1SFU A;  5D8K B;  4BEH A;  4ZYH A;  3RKY A;  4HST A;  4YFN F;  3COA C;  2K40 A;  3EUH C;  1A04 A;  4YBA A;  3BG6 A;  4ER5 A;  3FBN B;  4XMY A;  4L0Y B;  2BNN A;  1ETK A;  2Z3Y A;  3ESW B;  5FKO A;  1XX5 A;  3CDI A;  3HOS A;  3EET A;  1MJB A;  4PFO A;  4L5J A;  4BQO A;  1FZP B;  4ER0 A;  2ZXW H;  4BJ5 C;  2ZKZ A;  3VOD A;  2EBI A;  4E7K A;  4O5V A;  2H8W A;  3GLL A;  2W84 A;  2L01 A;  1W7P B;  3B02 A;  2E71 A;  2KIS A;  2QF7 A;  3M3Y J;  2DA3 A;  3D5R C;  3JXB C;  4O6J A;  4EAT A;  3K70 D;  2K86 A;  2PLY A;  1NW3 A;  3FXM A;  3M07 A;  3OKZ A;  1ORK A;  4IWR A;  1HKT A;  1NG7 A;  4XLN F;  2PJR A;  3CMA I;  2F4I A;  3D0S A;  4UUV A;  1N77 A;  5JR3 A;  4HOB A;  4IHY A;  2WTE A;  2XAJ A;  2FNP A;  2NS8 A;  1QZY A;  3BG9 A;  4QIW N;  3SHF A;  3D5L A;  3F6O A;  1XSX A;  1X2N A;  3E3V A;  4NQW A;  3OYK A;  2OZ6 A;  2STW A;  5ERI A;  1WZ2 A;  5HLG A;  4A0Z A;  2CQX A;  2MA3 A;  2MG4 A;  1Z1D A;  2FOW A;  3QOX A;  2EIL H;  5IT3 A;  4M3G A;  3S1Q J;  2CGP A;  3HRS A;  3HOT A;  2CFX A;  2TCT A;  4J1W A;  2DJN A;  3GVA A;  4E7I A;  4GYG A;  5BMZ A;  2Y9Z A;  2X6W A;  4LD5 A;  3NRV A;  1FOW A;  3K2Z A;  2H1L A;  2WAD A;  2YX7 A;  4E6K G;  5LGT A;  2ICP A;  3MD2 A;  4JQD A;  4IHV A;  1YI2 I;  4EEF G;  2LLV A;  1MZB A;  1AWC A;  2VKE A;  2JVG A;  5F0H A;  1HQ1 A;  4A93 J;  2M4H A;  5E1X A;  5TIS C;  2ZJP F;  3TO9 A;  1VQP I;  2O7O A;  5J4V A;  1DGW Y;  3RKX A;  2LD5 A;  3K0L A;  2IGN A;  3HOX J;  1FOY A;  3FXR A;  4A3E J;  2M3A A;  1EH6 A;  1HOM A;  2JQE A;  3GZD A;  1R4N B;  3CF2 A;  3KP6 A;  1MMD A;  4X6A J;  2HYG D;  4FE4 A;  3OSF A;  1EH8 A;  4FIS A;  1UJ8 A;  4RLQ A;  2R0Q C;  4L9V A;  1TNS A;  2PFB A;  2DA1 A;  3BG7 A;  2WBM A;  1B8I B;  2ZC2 A;  1OFC X;  1SFE A;  3SXY A;  3CO7 C;  1ZH5 A;  1HA8 A;  2JVH A;  1PRA A;  5GAH i;  1FYL A;  1FEX A;  1SD7 A;  4ESB A;  3GZ6 A;  5KAF C;  5C44 J;  3P9K A;  3T8R A;  1D1C A;  5CVU A;  2EA4 A;  2O5R A;  3TED A;  1R69 A;  4EJV A;  1RIO A;  3RZD J;  1T0F A;  2PUG A;  2DCE A;  5F0C A;  2R5Y B;  1TBX A;  2PBI A;  3CDL A;  2RRE A;  2CSO A;  3AG2 H;  2BY1 A;  1ETQ A;  4G94 A;  3JRA A;  2P6S A;  1MMG A;  4MEX F;  3VYT B;  3HOW J;  2O38 A;  2E2J J;  3H5A A;  5M3M J;  4CUG A;  1D1A A;  1I6H J;  3LNQ A;  3P9C A;  4GO1 A;  2FE3 A;  2P7V B;  4O3M A;  2BJC A;  1W4M A;  4JYK A;  2DAO A;  3HB9 A;  2GM4 A;  5K7H A;  1ZLK A;  2HS5 A;  2OQG A;  2X51 A;  2R7F A;  3FKI J;  4MLO A;  4BNC A;  3RIR A;  4PU3 C;  1YX3 A;  1B9N A;  1P9Q C;  2ZCW A;  3V8K A;  2P5K A;  2QQ9 A;  3VYR B;  4X0G A;  3DCF A;  1Y56 A;  2E2H J;  3HSR A;  2HXO A;  4KN7 X;  3LSG A;  1DP3 A;  4X1E A;  3F8C A;  3EQL F;  4U7D A;  4L9N A;  3VOE A;  5DT2 A;  4OIO F;  3K6G A;  4Z6Y A;  2L4M A;  3K4J A;  2KRH A;  2HCN A;  3HSE A;  2NS0 A;  5EEH A;  3BR1 A;  3QPT A;  4YFK F;  2WC2 A;  5J1Y A;  1XPX A;  1EFA A;  1U0J A;  4IKF A;  2DFE A;  5J47 A;  4DE9 A;  1KGS A;  3Q0W A;  3E6M A;  1V5E A;  3GTG J;  2XRO A;  1RKT A;  3MKW B;  3M9A A;  2UXX A;  4CCJ A;  2UXN A;  3KCC A;  2AWI A;  3HPG A;  2M8G X;  1VPW A;  4HBL A;  1LKX A;  3DV8 A;  2KRC A;  3C3W A;  2XKO A;  2F4M B;  3KLO A;  1SFK A;  4RGU A;  3I56 I;  1XWR A;  1JTX A;  5BPD A;  3K1M A;  1IRX A;  3Q0V A;  4IL6 C;  3BTI A;  2H09 A; 
#chains in the Genus database with same CATH homology
 1WH5 A;  4IVZ A;  1ZZ6 A;  3HZI B;  4M3D A;  4AC0 A;  5IPA A;  4Y52 J;  3JXC L;  1IUF A;  2N8G A;  4XK4 A;  2LYR A;  4S0H B;  3CQZ J;  4A3C J;  1QP4 A;  1ETY A;  1GV2 A;  2DA6 A;  3QPS A;  2DMN A;  1ZKG A;  5IYD J;  1TWF J;  4M3F A;  2PUD A;  5F1J A;  1NER A;  1GUU A;  3MVP A;  3MN2 A;  4X4G A;  3BG5 A;  1IV6 A;  4Z58 A;  1OJL A;  3D1N I;  4X4C A;  1XG1 A;  3S1N J;  1ZZ7 A;  1AKH B;  3HKZ N;  4I6T A;  3FK7 A;  1R63 A;  1SQ8 A;  2LKX A;  1WGX A;  3NAU A;  1W0T A;  1DU0 A;  3A02 A;  1BL0 A;  2NS7 A;  3BR5 A;  2WUS R;  2M34 A;  2EF8 A;  3H0G J;  1MBK A;  3Q0U A;  4IHW A;  2B63 J;  3GTK J;  1TWC J;  1I3Q J;  2X9D A;  1ZR2 A;  4MFD A;  3FIW A;  4A3F J;  4V2F A;  1U78 A;  1A5J A;  2O4A A;  2L7Z A;  3TRB A;  4NDL A;  1RZR D;  3GN5 B;  4FCY A;  1LQC A;  3BD1 A;  1MBG A;  3BS3 A;  4JP0 A;  2LVS A;  2A6C A;  3CLC A;  3ZQL A;  1GVD A;  3O9X A;  3BR6 A;  2DN0 A;  1WH7 A;  4Z5H A;  3GBG A;  3CCY A;  1JT0 A;  4D5F A;  1UHS A;  1W0U A;  3HGG A;  3K7A J;  2HIN A;  1NK3 P;  3BR0 A;  3BTL A;  4A3G J;  3B6A A;  1ETO A;  3IH4 A;  3PM1 A;  1MBF A;  4OB4 A;  4DZP A;  1QRY A;  5F04 A;  2OR1 L;  2VPR A;  2IVQ A;  3HGY A;  1YRN B;  4X4H A;  4UUS A;  2YU9 J;  4C3H J;  4Z59 A;  1U9O A;  2DMP A;  1HDD C;  4J19 A;  1MH3 A;  3JRE A;  3LFP A;  1ZTR A;  4NDW A;  4BY7 J;  2X6O A;  5K98 B;  3S2H J;  2B5A A;  1QVT A;  1ZGW A;  5FKM A;  1B8I A;  3F6W A;  2HOS A;  1BW6 A;  1B0N A;  1ZZ8 A;  5M3F J;  3KJX A;  1ADR A;  2JA5 J;  1Y1V J;  2R5Z A;  1UTX A;  1JKR C;  3TP0 A;  3E7L A;  3H3V K;  4GFB A;  2AUW A;  3OP9 A;  4MIM A;  3MKL A;  2I10 A;  1Y1W J;  1RR7 A;  2XGC A;  2NVQ J;  2DMQ A;  3HOU J;  2IUO A;  4M6V A;  2E2I J;  5EGO B;  3LSR A;  3I4N J;  2FX0 A;  5EF6 A;  3KZ3 A;  3LSJ A;  2R5Y A;  1GV5 A;  5JLW A;  2JMW A;  3HOY J;  4YAR A;  4QSH A;  1K61 A;  3SJM A;  1ZZC A;  3CRO L;  4HNV A;  4FN3 A;  2MEZ A;  1LCC A;  2VUM J;  5EZG A;  3S1R J;  1MNM C;  4MCT A;  4BBS J;  3RKQ A;  1ZZ9 A;  3PXP A;  1S7E A;  3VK0 A;  1JKO C;  2L8N A;  2EBY A;  1ZQ3 P;  3JRC A;  2H8R A;  2JA7 J;  2XIU A;  1FTZ A;  3OOU A;  1P7J A;  2Y0S N;  1VI0 A;  2XGD A;  3DEW A;  2PUB A;  1A6I A;  4I76 A;  5EZH A;  2R93 J;  1LLI A;  4X4E A;  1IGN A;  1MBE A;  1X57 A;  1GDT A;  1LFB A;  4MO7 A;  2L7F P;  5IOZ A;  1POU A;  2DMT A;  2XGE A;  2Y30 A;  3OMT A;  3A01 B;  5IYB J;  5J1R A;  3CMY A;  5GPA A;  3JRH A;  4FTH A;  1RZR A;  5E3M A;  2LYK A;  3HOV J;  3I4M J;  3QYX A;  1IG7 A;  3ZQH A;  3JRG A;  3S16 J;  4PU7 A;  5IP9 J;  4BKX A;  4IHX A;  4XRM A;  1RPW A;  3FK6 A;  2JCG A;  3U3W A;  5IYC J;  5C3E J;  1ZR4 A;  1JFS A;  1BDH A;  1MBH A;  5IP6 A;  1O4X A;  2EZH A;  1PUF A;  4A3L J;  3JRB A;  2IVB A;  2KPJ A;  1MBJ A;  3LIS A;  2CUF A;  1H89 C;  4A3D J;  4PU4 C;  2WV1 A;  1PRV A;  3VPR A;  3HDD A;  5BNG A;  3RZO J;  2L7M P;  1PER L;  3GTJ J;  5M5Y J;  1YSE A;  2LFB A;  1IC8 A;  5FLV A;  1QPZ A;  1TWG J;  4JX6 A;  1NK2 P;  3FYA A;  1K83 J;  2XPV A;  1TC3 C;  5A7L A;  1ENH A;  4M3E A;  3UKG A;  9ANT A;  2MSY A;  1HCR A;  1DU6 A;  4Y42 A;  2LLK A;  2M2E A;  4JQD A;  3ZQC A;  1SAN A;  2ELK A;  2PMZ N;  2HOT A;  2LYP A;  2ID3 A;  2YUS A;  1ITY A;  3BR3 A;  2DMU A;  2QCO A;  2VI6 A;  2XSD C;  1Y9Q A;  2L49 A;  1Y7Y A;  1B72 B;  2R7Z J;  4JX5 A;  2XB5 A;  1WI3 A;  2M9H A;  2LR8 A;  1HLV A;  1F43 A;  2LYS A;  1AKH A;  2AHQ A;  3S14 J;  2IAI A;  5J3L A;  1JKP C;  2GRL A;  2FQ4 A;  3BT9 A;  2PE5 A;  2ECC A;  1JT6 A;  4YG7 B;  1G2H A;  1JH9 A;  3K2A A;  3FIS A;  1SFO J;  2PUA A;  2HOA A;  2CU7 A;  2GLO A;  2VKV A;  2MGQ A;  4I8T A;  3UFD A;  1H88 C;  5F0F A;  4DW6 A;  1WH8 A;  3GN5 A;  3CEC A;  3RZZ A;  2ID6 A;  2LP0 A;  4JCY A;  4B3A A;  3DNV B;  3O8H A;  1F36 A;  1ZAY A;  3G1M A;  1APL C;  1PNR A;  3QPL A;  1JJ8 C;  2L9R A;  2HYJ A;  3C2B A;  1E3O C;  1BDI A;  2DA5 A;  4V2G A;  5FKK A;  4Y7N J;  1R9T J;  4AUX A;  2KDZ A;  1TWH J;  1FTT A;  1QP7 A;  5EYR A;  3ZHM A;  2FJ1 A;  3O8G A;  4W1U A;  2NVT J;  2XI8 A;  2Y2Z A;  1H8A C;  2OF7 A;  5E3N A;  2JA8 J;  1JFT A;  1GT0 C;  1I50 J;  2DA4 A;  4B1R A;  1OCT C;  2PUF A;  4IA8 A;  2Y9Y A;  2Y31 A;  3W6V A;  2IVG A;  2XJ3 A;  5FKL A;  5FJ8 J;  1T56 A;  1ZK8 A;  4FBI A;  3JR9 A;  2PUC A;  2G0E A;  3S17 J;  1NTC A;  3NAR A;  4C3J J;  2WAQ N;  2HXI A;  3BR2 A;  1ZVV A;  2EZI A;  1BA5 A;  1LCD A;  1POG A;  5E3L A;  1X58 A;  2XCJ A;  3BDN A;  1P7I A;  4FE7 A;  3G5G A;  1IDY A;  1XC5 A;  1WIZ A;  4O8B A;  3TP3 A;  4AYB N;  1OSL A;  2NVX J;  3ZKC A;  1RZS A;  4YG4 A;  2FD5 A;  4I6R A;  3ZQF A;  1IDZ A;  1MSE C;  1RET A;  4XRS A;  4BBR J;  1U8B A;  2IV1 A;  1OCP A;  4CYC B;  3FMY A;  2JA6 J;  1DW9 A;  3F0C A;  2OPT A;  2MW8 A;  2IU7 A;  3B6C A;  1QQB A;  2X48 A;  1MH4 A;  4UUT A;  4A3I J;  5IP7 J;  3H5T A;  2D5V A;  5K7F A;  4X4D A;  3GTP J;  5EGO A;  3WHB A;  2CRO A;  5IOY A;  3QF3 A;  3FYM A;  1ZUG A;  5J1U A;  2PUE A;  1FIA A;  1UXD A;  2K40 A;  2XPW A;  4YBA A;  4W97 A;  3HEF A;  2EZK A;  1QQA A;  2BNN A;  3G1O A;  1ETK A;  5FKO A;  5F27 A;  5C4J J;  1EF4 A;  3JRF A;  1JGG A;  5F08 A;  1JTY A;  2WIU B;  1QPI A;  4XID A;  1LE8 B;  3OQM A;  2BNM A;  2MQK A;  4DZJ A;  3ZHI A;  1WH6 A;  2DTZ A;  3F51 A;  2EBI A;  1AU7 A;  3SFI A;  2QF7 A;  1FIP A;  2DA3 A;  3M3Y J;  1IRZ A;  4D5C A;  2K9N A;  4A3K J;  3JXB C;  2JVL A;  2JN6 A;  1PRU A;  1ORK A;  2EH3 A;  3A01 A;  4IWR A;  4BXX J;  4RBO A;  2E19 A;  4RDU A;  2GZU A;  1UG2 A;  2JJ7 A;  2XPU A;  4Z5C A;  3ZOB A;  5EG0 A;  4IHY A;  4MCX A;  1ETX A;  4X4I A;  2NS8 A;  5GP9 A;  2JWT A;  1BW5 A;  3BG9 A;  2LYL A;  2AO9 A;  4QIW N;  1U9N A;  1X2N A;  2O49 A;  1QP0 A;  2PIJ A;  4JX4 A;  3WHC A;  4X4B A;  3R1F A;  3IVP A;  2CQX A;  2MG4 A;  3BQY A;  4YG1 A;  3A03 A;  3GBF A;  1ZPQ A;  4M3G A;  2OFY A;  3S1Q J;  2AXV A;  3QWG A;  2LTP A;  1MSF C;  2R63 A;  2TCT A;  4I6Z A;  3PO3 J;  3B7H A;  4J1W A;  3G7D A;  2DJN A;  2YS9 A;  2O9L A;  2Y9Z A;  5E3O A;  4XIC A;  2KEK A;  1FJL A;  3M4O J;  1UXC A;  2ICP A;  2K9S A;  2W48 A;  4A3J J;  1X2M A;  1XS9 A;  2E1O A;  4IHV A;  3S1M J;  2AXU A;  2GRM A;  3TW7 A;  3MLF A;  2GBY A;  1JJ6 C;  4EEF G;  4L5E A;  2VKE A;  1VFC A;  3IH3 A;  2AW6 A;  5F0H A;  4A93 J;  4GQM A;  3G1L A;  4A3B J;  2NOG A;  4BY1 J;  3OIO A;  4J1X A;  2LY9 A;  1D5Y A;  4QTR A;  2AXZ A;  2FJR A;  4A69 C;  2O7O A;  5M5X J;  5FLM J;  1B72 A;  2LD5 A;  3F52 A;  5JLX A;  3HOX J;  4A3E J;  1RKW A;  1VF9 A;  2NVY J;  2HSG A;  1WPK A;  4UUS B;  1HOM A;  2HDD A;  4X4F A;  3QQA A;  2PPX A;  2JK3 A;  3SCH A;  3SCF A;  4X6A J;  4FE4 A;  3OSF A;  3ZQG A;  2KEJ A;  4M3B A;  3S15 J;  4FIS A;  3OQO A;  2R0Q C;  2DA1 A;  5GPC A;  2XB0 X;  3IV5 A;  4A3M J;  2EQR A;  1OFC X;  2ECB A;  1B8I B;  2CUE A;  2R1J L;  5FKN A;  3LSP A;  1IJW C;  2ICT A;  5HOD A;  1T33 A;  2R5Z B;  1PRA A;  2LK2 A;  2K9Q A;  2H1K A;  1YRN A;  1FEX A;  4XRS G;  3OSG A;  3TW6 A;  2P81 A;  5C44 J;  2IEK A;  5EEA A;  2CJJ A;  1AHD P;  1L1M A;  2ME6 A;  3EUS A;  3Q3S A;  3TED A;  1R69 A;  1RIO A;  2PUG A;  3RZD J;  4PU8 A;  1Z0X A;  1Q1V A;  4I6U A;  3GTQ J;  5F0C A;  2R5Y B;  3CDL A;  3BTC A;  1TWA J;  2O8K A;  3S2D J;  3JRA A;  1ETQ A;  4DYR A;  1VND A;  1Z77 A;  1HDP A;  1NEQ A;  3L1P A;  3LOC A;  3GTM J;  3HOW J;  2ZB9 A;  3HM5 A;  2E2J J;  2O38 A;  3S8Q A;  5M3M J;  1ZZB A;  3HOZ J;  4DYC A;  1I6H J;  2CQQ A;  3LNQ A;  1ETV A;  1LFU P;  2BJC A;  2DA2 A;  2IBD A;  3JRI A;  4JYK A;  2GM4 A;  3HB9 A;  5K7H A;  4JCX A;  3BQZ A;  3FKI J;  4PU3 C;  4MLO A;  2HI3 A;  2EZL A;  2TRT A;  4DYQ A;  3DCF A;  2ME0 A;  5K7Z A;  3JRD A;  2E2H J;  4CYC A;  5M5W J;  2HXO A;  1X2L A;  1LMB 3;  3JXD L;  3LSG A;  3SDG A;  1RES A;  4X1E A;  1ZS4 A;  1RPE L;  1UMQ A;  1CQT A;  1DWK A;  1JKQ C;  3RQI A;  4C3I J;  1CJG A;  4MFE A;  4D7M A;  3BR1 A;  5J1Y A;  1EFA A;  1WCM J;  2COB A;  2CRG A;  1QVU A;  2M0C A;  2LCV A;  3BG3 A;  1BJZ A;  3Q0W A;  3HBL A;  5DS9 A;  2HQ5 A;  4Z5D A;  1JUS A;  2DA7 A;  3GTG J;  1RKT A;  2KZ8 A;  3KXA A;  3SCG A;  4F8D A;  1PUF B;  1WET A;  2KEI A;  2XRL A;  3GTL J;  4G12 A;  1LE8 A;  4B4C A;  1JWL A;  1HF0 A;  2AWI A;  2M8G X;  3IH2 A;  5DTD A;  2R92 J;  5EG0 B;  2LYJ A;  3QQ6 A;  4GHJ A;  1VPW A;  2LYQ A;  3BTJ A;  3OQN A;  3GTO J;  4LOC A;  4D7N A;  2EWT A;  2CSF A;  2BNO A;  1ETW A;  1XWR A;  2RAE A;  2L0K A;  1JTX A;  1JUM A;  2WB1 N;  5EDN A;  3ZQI A;  1JUP A;  4ABZ A;  4C2M J;  3PO2 J;  3Q0V A;  2KT0 A;  4IEJ A;  5C4X J;  3BTI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...