1IC8A

Hepatocyte nuclear factor 1a bound to dna : mody3 gene product
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
190
structure length
170
Chain Sequence
KELENLSPEEAAHQKAVVETLLQEDPWRVAKMVKSYLQQHNIPQREVVDTTGLNQSHLSQHLNKGTPMKTQKRAALYTWYVRKQREVAQQFTHARNRFKWGPASQQILFQAYERQKNPSKEERETLVEECNRAECIQRGVSPSQAQGLGSNLVTEVRVYNWFANRRKEEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Diabetes mutations delineate an atypical POU domains in HNF1-Alpha
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
molecule keywords 5'-D(*CP*TP*TP*GP*GP*TP*TP*AP*AP*TP*AP*AP*TP*TP*CP*AP*CP*CP*
total genus 50
structure length 170
sequence length 190
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-03-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1ic8A02
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 1ic8A01
1W0TA 3HOVJ 3FISA 1E3OC 3MLFA 3OP9A 3QYXA 1LFUP 4A3MJ 1MBHA 5FKOA 2XIUA 4I6UA 1MSFC 2PUCA 3G1MA 4G12A 1Y1VJ 2EWTA 4HNVA 4C3JJ 2R93J 3G7DA 2L7ZA 1JTXA 4AC0A 1AU7A 2KEIA 2JCGA 1WETA 2E2JJ 3R1FA 4X4CA 3OQOA 1B8IA 2MGQA 3CECA 2NVYJ 2AO9A 4FISA 3GTJJ 2EZKA 1BW5A 4X4HA 2WUSR 1QQAA 1RKWA 5E3LA 4C3HJ 1W0UA 3RQIA 3JRGA 2I10A 2XSDC 2KEKA 3UKGA 2LCVA 2O4AA 1XS9A 2WV1A 2ZB9A 3GN5B 3VK0A 2ECCA 1U9NA 1PERL 5IOZA 1HCRA 3ZQGA 1RETA 3OSGA 3PM1A 3E7LA 3SCGA 2NVQJ 4FE4A 2JA5J 2OR1L 2E1OA 3QWGA 1RZRD 5FKNA 1R69A 4UUSB 4M6VA 5JLXA 5M3MJ 2OF7A 2X6OA 2KT0A 2JVLA 5K7HA 2G0EA 2R5YA 2ID6A 5E3OA 1TWHJ 5IPAA 4MCTA 1HLVA 3BG9A 1TWGJ 1POUA 2O49A 4UUSA 2L7MP 1FIPA 4RBOA 1YRNA 1SFOJ 1ZPQA 4X1EA 2CQXA 4A3BJ 2HOSA 3GTOJ 3CLCA 3QQAA 5F0FA 3D1NI 4B4CA 1UTXA 3IVPA 2GRLA 1RPWA 3CCYA 3GN5A 4M3DA 4BXXJ 4F8DA 4YG7B 4BY1J 1ZAYA 4XK4A 2HXOA 4XRMA 2PE5A 2HQ5A 1WCMJ 2E2IJ 2DA2A 1WH7A 3LSPA 3RKQA 2MG4A 3M3YJ 1O4XA 2EZLA 1LE8A 3BS3A 3KJXA 3JRCA 1ZGWA 3IH2A 4C2MJ 2LYPA 1VNDA 1MBGA 3BR3A 3O8GA 1H88C 1Y7YA 2LYRA 1AKHA 1GV2A 2ME0A 3JRDA 2LYJA 4IA8A 3JXCL 5FLVA 3S16J 5J3LA 3RZOJ 3Q0WA 3A03A 5FKKA 1DW9A 1I6HJ 4DW6A 3MVPA 2PUBA 3G1OA 3ZQHA 4JX5A 1IRZA 3GBFA 5GP9A 4UUTA 5EF6A 1S7EA 4PU3C 2DA6A 3OSFA 2DTZA 2PMZN 5E3MA 1IC8A 2LTPA 4MLOA 2K9NA 1FEXA 1UMQA 5J1UA 4NDWA 1Z0XA 3RZDJ 4CYCB 2DMUA 2KDZA 2GLOA 5K98B 2NVXJ 1OCPA 2Y31A 4BBSJ 1QPZA 5EG0B 3FK6A 4XIDA 2XPVA 3MKLA 1TWCJ 1AHDP 1LFBA 2L49A 1T56A 2QCOA 1JKOC 4MO7A 2AUWA 1Y9QA 1IV6A 4IHYA 1QVTA 1PRVA 1GVDA 2PUGA 1UHSA 2HOTA 4EEFG 2O7OA 3G5GA 1JFTA 1JKQC 2EF8A 2WIUB 3SFIA 3HKZN 1WH8A 2HINA 1DWKA 4I8TA 5F0HA 3G1LA 1X2NA 4IHWA 1MH3A 2M34A 1FJLA 5EZGA 1MSEC 3A01B 1R63A 4X4DA 3O8HA 3RZZA 2XPUA 5IP6A 2CRGA 5M5YJ 3H3VK 4M3FA 1ZTRA 2HDDA 2FD5A 3PO2J 2EBYA 2DMTA 3OQMA 4YARA 5FKMA 4FBIA 1BDHA 1RESA 2ID3A 3OIOA 1QRYA 2RAEA 1B8IB 2CJJA 3BG5A 2NS7A 4RDUA 4GQMA 4JX4A 2JA6J 4XICA 1JGGA 2X9DA 3JRBA 3TW7A 2M2EA 3Q3SA 2XB5A 1T33A 4LOCA 1CQTA 1VI0A 2JK3A 1NERA 1ZZ6A 1MBFA 2E19A 1UXDA 1ZUGA 2QF7A 2LFBA 2BNNA 2IVGA 1BDIA 4A93J 1R9TJ 1ZZ7A 2OFYA 4CYCA 2R5ZB 2JMWA 2O8KA 4A69C 2XPWA 1MBEA 5IYCJ 1NK3P 3FMYA 4PU4C 1VPWA 3BR1A 2H1KA 5F27A 3HOZJ 2W48A 3MN2A 3B6AA 4Y52J 1MBKA 1VFCA 2XGCA 1DU0A 3DCFA 2YUSA 4D5CA 3F51A 3TP3A 2DA3A 2LD5A 3C2BA 1I50J 3HM5A 1BJZA 4A3KJ 1IDZA 2YS9A 5IP9J 3VPRA 2PUDA 2X48A 3CROL 4A3GJ 3ZQIA 2BNMA 4W97A 3HOUJ 1G2HA 1F43A 1ZZ9A 1ETKA 1PNRA 4XRSA 5K7FA 1B72A 2K40A 4DZPA 1X57A 1ZZBA 4I6TA 1ZR4A 2M0CA 5EGOA 4FCYA 2FX0A 2IEKA 5IOYA 5C3EJ 3DEWA 3M4OJ 3O9XA 2LYSA 1NTCA 3WHCA 1MBJA 1SANA 3FYAA 2PIJA 4O8BA 1UG2A 1MNMC 1L1MA 3JRHA 3OMTA 2NS8A 1P7JA 2FQ4A 4B1RA 3K7AJ 2LYLA 4I6RA 3PXPA 4IVZA 4X4FA 3K2AA 3TEDA 1QP0A 4QSHA 1LCDA 4Y7NJ 4A3JJ 2P81A 4QTRA 4IHVA 2AW6A 3QPSA 3ZHIA 1FIAA 3S1QJ 2L7FP 1APLC 1BL0A 1JKPC 1GT0C 4PU8A 2GBYA 3QPLA 2EZIA 1FTTA 1GUUA 2XCJA 1GDTA 1ETYA 3LISA 5C44J 2XI8A 1ETWA 3BDNA 4B3AA 2DMPA 2LLKA 4Z5DA 3BTCA 3ZHMA 3GTLJ 1RKTA 3BT9A 1NK2P 4GFBA 1B72B 4X4GA 4AYBN 1ITYA 4J1XA 3BQZA 5F0CA 1WH6A 4M3GA 1A6IA 1ZK8A 2CUFA 2R92J 2R7ZJ 4JCXA 3B6CA 1WH5A 4A3EJ 1ZZ8A 2IVBA 1EFAA 3OOUA 5FLMJ 1JUMA 2L8NA 2PUEA 3QF3A 3FK7A 4IHXA 3H0GJ 5IYDJ 1ORKA 1PRAA 3LOCA 3S1MJ 3S15J 4A3FJ 2XGEA 1OCTC 1ETQA 1U78A 1U8BA 2GRMA 3GTMJ 2GZUA 1I3QJ 3BD1A 1UXCA 1IGNA 2CROA 3SCHA 3JXBC 2IUOA 4Z5CA 2MSYA 1JWLA 1PRUA 5GPCA 3S14J 4JX6A 3BR5A 2O9LA 1ZQ3P 3CMYA 4MCXA 2EZHA 1JJ8C 3GTKJ 1JKRC 2Y2ZA 1H89C 3GTGJ 1X58A 1Z77A 1ZZCA 1Y1WJ 2LR8A 3GBGA 3FIWA 3ZQCA 4ABZA 3LNQA 2K9QA 2M9HA 3QQ6A 1ZVVA 3F0CA 3TW6A 1B0NA 3BTIA 2PUFA 5JLWA 5C4JJ 2HXIA 3UFDA 3S1NJ 2MQKA 3KZ3A 1U9OA 3Q0UA 4YG1A 3LSJA 3JREA 3U3WA 4MIMA 3OQNA 4JQDA 2R5ZA 3EUSA 1P7IA 1X2LA 3HOYJ 4MFDA 4DYQA 3L1PA 2VPRA 3LSRA 1WGXA 1ETOA 1ZKGA 2D5VA 1OFCX 3PO3J 3HZIB 2DA1A 3ZQLA 4J1WA 1LLIA 2WB1N 4D7NA 2R5YB 3FKIJ 2EQRA 1JT6A 5F08A 5F04A 3HGYA 3LSGA 2CU7A 1ETXA 2N8GA 2HOAA 3S2HJ 3HDDA 2IBDA 2R1JL 2DJNA 1D5YA 2JA8J 2COBA 2DN0A 1K61A 2B5AA 5FJ8J 4X4EA 2IVQA 5IP7J 2ELKA 4OB4A 4J19A 2AXZA 1LMB3 2KPJA 3A01A 3LFPA 4V2FA 2JN6A 3H5TA 4IWRA 2VI6A 1ZR2A 1RZRA 1PUFA 1DU6A 4I76A 2DA7A 4IEJA 3ZOBA 5K7ZA 2IU7A 4X4BA 3IH3A 2NVTJ 2AXUA 1OSLA 2HYJA 3ZKCA 1XG1A 3NARA 1XC5A 5FKLA 2DMQA 4X4IA 4YG4A 3JRIA 3JRFA 3NAUA 2XB0X 4X6AJ 4JYKA 5E3NA 1K83J 3F52A 2YU9J 2FJRA 1QQBA 2LY9A 4DYRA 2VKVA 4S0HB 5EDNA 1POGA 3IH4A 5GPAA 1JTYA 5EYRA 1HF0A 3SDGA 5EZHA 2Y0SN 2VKEA 1TWFJ 1QPIA 3SJMA 3CQZJ 3HB9A 4AUXA 4D5FA 2JJ7A 2Y30A 3BR6A 1JUPA 2LKXA 1QP7A 1ETVA 2VUMJ 4XRSG 3A02A 1WI3A 2HI3A 4FE7A 3BQYA 1IG7A 2KZ8A 4Z59A 2KEJA 4M3EA 2AHQA 1JJ6C 4BBRJ 5M5WJ 5DS9A 3W6VA 2NOGA 1IUFA 3BTJA 4L5EA 2PUAA 1ENHA 2EH3A 3S2DJ 2LYQA 2CQQA 5F1JA 3S8QA 4A3LJ 1EF4A 2HSGA 1JUSA 2LK2A 4BKXA 3S17J 3HEFA 5HODA 2WAQN 9ANTA 1OJLA 2L9RA 5J1YA 1RPEL 3TP0A 1IJWC 2TCTA 4A3CJ 1BA5A 2O38A 2FJ1A 1JH9A 2LP0A 4Z5HA 2XGDA 1HDPA 3Q0VA 4MFEA 1PUFB 1ZS4A 2GM4A 1FTZA 1BW6A 4Y42A 3GTQJ 1ADRA 5EEAA 2AXVA 1SQ8A 2R0QC 3ZQFA 2OPTA 1F36A 3BG3A 1LCCA 3DNVB 1WIZA 4NDLA 2K9SA 2LVSA 3HOWJ 3I4NJ 2BJCA 3HOXJ 4JP0A 1Q1VA 1RZSA 1YRNB 1RR7A 3TRBA 4A3DJ 1A5JA 5BNGA 3FYMA 3BR2A 2A6CA 1QVUA 2EBIA 2JA7J 4V2GA 2TRTA 1JFSA 3B7HA 2Y9YA 2ICPA 3HBLA 2XRLA 2DA5A 4DYCA 2DMNA 5EG0A 2E2HJ 4D7MA 2AWIA 2ME6A 1HDDC 1HOMA 2DA4A 3BR0A 1MH4A 1NEQA 5IYBJ 3JR9A 3SCFA 5M3FJ 3IV5A 1YSEA 2MEZA 3S1RJ 1GV5A 4JCYA 1XWRA 2ECBA 2MW8A 4PU7A 1TC3C 2IAIA 4YBAA 2IV1A 4A3IJ 3JRAA 3BTLA 4QIWN 1VF9A 2CUEA 5A7LA 2Y9ZA 1RIOA 3HGGA 4Z58A 2R63A 5EGOB 1LQCA 3CDLA 5J1RA 5DTDA 1H8AC 3F6WA 1AKHB 2LYKA 5M5XJ 4M3BA 1WPKA 2L0KA 2BNOA 2JWTA 2XJ3A 2M8GX 2PPXA 3KXAA 4BY7J 1X2MA 2CSFA 2H8RA 2ICTA 1QP4A 1IDYA 3WHBA 4I6ZA 1LE8B 2B63J 4GHJA 4C3IJ 4W1UA 5C4XJ 4FTHA 3GTPJ 1JT0A 3I4MJ 1TWAJ 4DZJA 4FN3A 1CJGA 3JXDL
chains in the Genus database with same CATH superfamily
2CWEA 3OP9A 3MLFA 4DGWB 2X51A 3LSIA 4EQZA 2XRNA 3QOEA 1MBHA 3CLOA 5FKOA 3A4CA 3U21A 1MSFC 2CUJA 3G73A 4LD5A 2EWTA 2OQRA 1WJBA 4C3JJ 2K9MA 3ZQ7A 5FRMA 2X1DA 3O3KA 4AC0A 2F5DA 1WETA 4ER6A 2E2JJ 3R1FA 4U0YA 3RPUD 3KETA 2VJ5A 3OQOA 1B8IA 3IUOA 3K1PA 1BC7C 4FISA 1LUJB 1B4AA 1BW5A 2F5FA 2W00A 2I10A 2K9LA 3UKGA 1GXPA 4CCKA 1U5TA 2LCVA 3TBIA 5JHFA 4ZZDA 1JE8A 2O4AA 4DQ2A 1OLTA 1U9NA 2KKOA 4UNOA 3QAHA 5CKTA 3ZQGA 2XKOA 1KU9A 3OSGA 3U1DA 1UELB 2BE5F 1X3ZB 1FMWA 3FBNB 3V8LA 1MD0A 3BJ6A 2NYXA 4R1HA 3ABUA 1R69A 5LGNA 4UUSB 4NC7A 4M6VA 2HKOA 4HX4A 4XKVA 4DOZA 2NXNB 2E1MC 5GAHJ 2OF7A 1O3SA 3TEPA 2O61A 2JVLA 2G0EA 3WE2A 2ID6A 5FGMA 1MW7A 3H3ZA 4BU2A 5LGUA 2XAJA 4XKBA 5D4SA 1TL8A 1ZARA 3VYTB 4X1EA 3S32A 3CC4I 4F55A 2NNNA 2X6XA 4NBQA 1Z3YA 1U5TB 4LG3A 2P7VB 3IVPA 2QEXI 4J00A 4YG7B 3J80K 3C18A 5D5XB 4CICA 4QPOA 4XRMA 2WB1A 2P0WA 5CPRB 1WCMJ 2E2IJ 2CW8A 1JHHA 3H5RA 1WH7A 1U3EM 2XF7A 3RKQA 2MG4A 1J0RA 2WV0A 1IAWA 4XRFA 3EYIA 2L02A 3KJXA 3B02A 2IS1A 3IH2A 2EFQA 1VNDA 1MBGA 2PFBA 3TDZC 3LSMA 3GFIA 5JR3A 5E8GA 1FZPB 3TOAA 1UB9A 1MGTA 3HTUA 2M87A 2VC1A 3QRFF 1WWXA 3BCBA 5FLVA 1IN5A 4EV0A 1DW9A 1W36D 1U2ZA 4DW6A 4IJAA 3G1OA 3ZQHA 1ONVA 3J81K 4Y3OA 3K4BA 2HWVA 4UUTA 2DA6A 2X6WA 3DPTA 3OS1A 2PMZN 5E3MA 1IC8A 2HCNA 4L0ZB 2ZXHA 3LA7A 4MLOA 2DTRA 4CYCB 3SZGA 1RR8C 1R1UA 1XDUA 2XPVA 3MKLA 3MEXA 2OD5A 4B44A 2BY1A 4XLFA 4MO7A 2AUWA 2OU2A 3W3CA 2DOAA 2P6TA 3GZNB 3F22A 2AXLA 3FX3A 2L4MA 2LC2A 1OMIA 3HSFA 4KUMA 3G5GA 1FBQA 2YX7A 1JFTA 1JKQC 4KICA 2UZKA 1D3YA 3A1YA 1CF7A 4JBAA 2HINA 4EM1A 3TO6A 4I01A 5HOOA 2XPUA 2CRGA 4M3FA 2HDDA 2ZJQF 1PYVA 1R36A 3VSLA 2ID3A 1Y39A 4ZJZA 1IRGA 3WGIA 2CJJA 3HUGA 3KZZA 3WTXC 4I0BA 3PE5A 3OYMA 2MA3A 4I2OA 3I3LA 1VQ4I 4U88A 5FB2A 2X9DA 5B66C 2M4GA 2JPCA 2XB5A 1TP4A 3NWSA 4LOCA 2BV6A 5FLXZ 3MWMA 5HS7A 3F6OA 2JK3A 4KT6A 1DGRM 1NERA 3GZCA 2AQEA 1SD7A 1HW1A 1E3HA 3RCOA 2OFYA 2E5NA 1O7FA 3LFKA 4BXUA 2O8KA 1IUYA 5IYCJ 2Q2EA 1QQIA 3HOZJ 5F27A 3CLQA 3K2ZA 1IXSB 3FWEA 1L0OC 4AM3A 1MBKA 3LL7A 5IT3A 3DCFA 4L9JA 3F51A 4LG0A 3OIPA 3HM5A 3GLXA 1A35A 4UHTA 3K10A 2B0LA 3BLYA 2NAZA 2YS9A 4AWXB 4FX4A 1T08B 3CROL 3MZHA 3BG7A 3KLNA 3ZQIA 1D0XA 1G2HA 3CTAA 2EA2A 1F43A 1Z6RA 4RM2A 3VEPA 2WAEA 1W7PA 1ZZ9A 1ETKA 1MMAA 1OYWA 2HU9A 4XRSA 1YIJI 1ZELA 4KITB 4I6TA 1QZZA 2EK5A 4RA2A 3PNTA 1I27A 4B43A 1ZR4A 4CYDA 5EGOA 4FCYA 1CGPA 2FX0A 1LQ1A 2IEKA 2WAFA 4RMNA 1OCZH 3DEWA 5C3EJ 3G3ZA 1MBJA 3DXJF 2Z9OA 2ZCWA 2OV7A 3OYEA 5BPIA 2FUG2 1R4NB 1MNMC 1KONA 2Z3YA 3KP4A 1IN7A 4AYBA 5BPDA 2D45A 4LIUA 1SMYF 2HYFA 2PXEA 5J8CA 3K2AA 2DFFA 4IQ4A 3TEDA 1BN5A 4A3JJ 4DE9A 2OZUA 1WZ2A 2ZMEC 3DKYA 1Z91A 3Q9VA 2R7WA 1P9QC 3BG6A 3DBLB 5CQGA 3H9QA 5ICEA 4LK0F 4EMSA 3QPLA 2EZIA 5E20A 3RI4A 3ULQB 1U0JA 2W57A 2GWRA 3LISA 5TJJA 1ETWA 4HNTA 3BDNA 1S9HA 1IO2A 5BMZA 4EK9A 2ZO4A 3CJTB 2QQBA 3OYNA 4EJTA 3GTLJ 3O6BB 3F8CA 1YJWI 2H1LA 2EPFA 2QQAA 2P6SA 3F21A 1K4TA 1IRFA 4G7HF 1B72B 4J1XA 5HLIA 5BQTA 2WWYA 3RKWA 2CUFA 2VONA 1T98A 2QBYB 3B6CA 4OIRF 4A3EJ 4JCXA 2QVOA 1EFAA 4HZFA 1ON2A 3WTTC 1SFXA 3S3MA 1QU3A 3QF3A 4BQOA 4M73A 2X0LA 4IHXA 1YE9A 1PRAA 1J09A 3C2GA 1VQKI 4I0AA 4CHUA 1JI8A 3V8KA 3OYCA 3DKXA 3TL4X 4OWRB 4ZYAA 2GZUA 1I3QJ 3BD1A 4LK1F 1OCOH 4G8XA 3JXBC 3UR3C 3S14J 2VQGA 3NEUA 1MFQC 3BR5A 2O9LA 3MCZA 2EWNA 4U87A 3CMYA 2EZHA 2OZ6A 1PDNC 4OINF 3QPTA 4DE8A 3GFJA 3FDYA 1X58A 1PP7U 1Z77A 1ZZCA 2MFZA 5E18F 3OYIA 1VQ5I 3ERED 1UG0A 2M9HA 4IQJA 3F0CA 3TW6A 3BTIA 2VOPA 2OTLI 2CO5A 2O5RA 1TTYA 2ETHA 4YG1A 3GF2A 3GZ6A 3M8EA 1WSUA 3U3WA 3WG9A 2GOXB 1WHUA 2DU9A 2M8EA 4MIMA 4L9TA 5HNHA 2LF7A 1YW9A 2ELHA 1I1SA 3EYYA 3HOYJ 3A9YA 5FO5A 1ZH5A 1FBUA 3P9CA 3C7JA 1FX7A 1ZAOA 2XXQA 3HZIB 2DA1A 2H09A 2VN2A 4J1WA 4D7NA 2F4MB 2KMUA 2R5YB 1JT6A 4ZC3A 3LSGA 1A6QA 2QKLB 1ETXA 1MNDA 1DPRA 4NNJA 3GW2A 4H0EA 2IBDA 2E71A 2R1JL 3L2UA 2DT5A 2JA8J 1I1GA 4KN7X 2DDAA 3CMMA 5AIPA 1KQ9A 4U7BA 1BOAA 2B5AA 1MDMA 2GA2A 2IVQA 2QSHX 2R7RA 3CJRB 1KQ8A 2AXZA 3RYRA 3OR2C 3KE2A 4V2FA 3H5TA 1HQ1A 2VI6A 2K7LA 1HQCA 3LSKA 2DK8A 3MAJA 4FETA 5AONA 2CW7A 2P5VA 2YU3A 5HDKA 1ODDA 4IEJA 3ZOBA 1S8NA 5J47A 3I9V2 2ESHA 3SR4A 3R09A 2VKDA 3ZKCA 4IHTA 1RZ4A 2L4AA 4EQQA 2FNPA 3I54A 5FKLA 2DMQA 5GAGi 3BPVA 1W7PB 3JRIA 3S2WA 1UHMA 4X6AJ 4JYKA 5E3NA 1K83J 3KCCA 1B9MA 1S3JA 2R4GA 4I98B 3TQNA 3QODA 3P5JA 4L5IA 3CCEI 1R63A 2FJRA 1BJAA 3HKZA 5KAIC 5JVTA 4LG0B 1JTYA 1HF0A 3KP3A 1SC7A 1TW3A 2Y0SN 3RZZA 2LKPA 4GDFA 2PXVA 3HB9A 3BZCA 4D5FA 2LKXA 3AG2H 3BR6A 5E17F 1QP7A 3JSOA 1R00A 1S5LC 1GLNA 3K4KA 4XRSG 1DPUA 3MKYB 4AU7A 4FE7A 2HI3A 3ZMTA 2I8DA 1V5FA 1IG7A 4XL9A 5ED4A 4PFOA 4M3EA 2BVLA 3FBIB 4BAYA 2J5OA 1JGSA 2I5UA 2HTJA 1IUFA 2RQQA 3L2QA 1ENHA 2CFOA 4EVIA 3AKZA 2CQQA 3I56I 1FOWA 2CUZA 4IO9F 4A3LJ 2OC6A 1W5TA 3SYTA 2EFNA 1OCCH 3W2WA 9ANTA 1P4AA 2YSRA 4X0GA 3TDUC 2DI3A 2EA4A 4A3CJ 2O38A 3AFHA 2LP0A 2CYYA 2ZFWA 1EV7A 1EKEA 1WJ5A 2XGDA 3E6DA 4MFEA 1ZS4A 4E6KG 1IZ1A 2VQHA 2ZXWH 3HC7A 1BW6A 1BR2A 5EEAA 3OYBA 2VPLA 5HNFA 2VBWA 2CQKA 1F36A 5LGTA 1BI0A 4MEYF 4PUSA 5GAEJ 1OKRA 2LVSA 3VOEA 3I4NJ 4L5JA 2KRCA 1PVEA 5D4RA 3VODA 1RR7A 3HRUA 5BNGA 5JHUA 5LHIA 1E0EA 3FXRA 2A6CA 1QVUA 3M8FA 2V79A 4V2GA 4JQFA 4CCMA 3QYEA 4CA0A 2FOKA 2PN6A 2STWA 4Q48A 2ME6A 2DA4A 2UUZA 2HQAA 1NEQA 3HPGA 3JR9A 2L9SA 4JK1X 4O6JA 4PJLA 2EIMH 2NNYA 1ZYRF 1T39A 1Z7LA 2ECBA 1I3AA 2MABA 1O3RA 1WJEA 1VF9A 3REOA 5D5UB 5A7LA 3HGGA 4Z58A 1R71A 2R63A 1D1CA 4G6QA 1LQCA 1BR1A 5J1RA 3X2QH 3L9FA 3MKWB 2E1NA 1ACIA 2LYKA 2L0KA 3HPHA 2XJ3A 2M8GX 4PDKA 3GFMA 2CSFA 4OAZA 3IWZA 2XHKA 2UWMA 1BIAA 1IDYA 2DJIA 3WHBA 2B63J 4DJAA 2LREA 3QFIA 3NDBB 4PJ0C 2FEZA 2KJCA 4DZJA 2FBHA 4B48A 3DPLC 3DTEA 3ASNH 4HA8A 4CGZA 1W0TA 2IGKA 4LLLA 5LEKA 1LFUP 3RQ4A 2BW3A 2V7FA 4HDUA 1EH7A 4WXHA 3ABKH 4I6UA 2PUCA 1XTAA 2PQ8A 2RREA 4G12A 1Y1VJ 1O7LA 2R93J 2L7ZA 4EZIA 1YX5A 1AU7A 3GYHX 3ME5A 1YITI 3Q5FA 4UVBA 2LMDA 4KISA 2PXBA 4X4CA 2BOLA 4HRIA 1SD6A 2MGQA 3K9TA 2NVYJ 2EZKA 1P4WA 1SFUA 4M9SA 1RKWA 3HHGA 3HZJA 5ILSA 1W0UA 1H9TA 3PFYA 2O6GE 4WVLA 5H6RA 3F8BA 2IGOA 2WV1A 3MMYB 2EV0A 2LF8A 2RQPA 1X19A 2JUGA 3WG7H 1HW2A 4PJNA 3PM1A 2HVSA 2M4HA 4E70A 2KIMA 1K6YA 1X4PA 2JA5J 3DP7A 1RZRD 1NG6A 3DV8A 3QWGA 4YG2F 3NQOA 5JLXA 3U2RA 1X4OA 1Z3XA 3N97A 4A6DA 2KT0A 1XCVA 2CSOA 4Y17A 2H8WA 4BJTA 1BBYA 2R5YA 3CCQI 5IPAA 2A6HF 1G8XA 3BG9A 3G71I 5GTIC 1FIPA 1VQ9I 1YRNA 1ZPQA 4K2EA 1Y6IA 3MFKA 3HL2A 1QNTA 2M4KA 3I58A 4A3BJ 2DXIA 1GXQA 2LRDA 5D6FA 5L3CA 3VWBA 5HLHA 2GRLA 1RPWA 4BY1J 4MCXA 3ZPLA 3CO7C 4XK4A 2HXOA 4OIPF 2BEOA 2JQEA 4P1WA 2CG4A 2JT1A 1HKTA 2VOOA 1VQOI 4E7SA 1MJBA 2VT3A 4MEXF 1YS7A 3JRCA 1ZGWA 4L9NA 4RAGA 4C2MJ 2LYPA 3BR3A 1H88C 1IRXA 4XLHA 4IZZA 1AKHA 2F48A 2ME0A 2FOWA 5LHHA 1QZEA 2GZWA 5K5OA 1P2FA 1SVMA 2FFHA 2LYJA 3JXCL 1YG2A 5CLSA 3K4NA 3V4GA 3IWFA 2PMUA 2DQRA 3BPXA 5GP9A 1S7EA 3DTKA 5EF6A 3J7AO 4PU3C 3OOPA 2FF4A 5F6FA 4U0VA 2QKMB 1D8JA 4G94A 1FSHA 3FXMA 3VB2A 5D5WB 3DKWA 3BZKA 1MMGA 4II2A 4ZZLA 1UMQA 1XN7A 5J1UA 3RZDJ 4CH7A 4XM3A 1R23A 2Y31A 1T2KA 2UV1A 1Z05A 3FK6A 2VE9A 4PGHA 3CP2A 2M7AA 1TWCJ 2IPQX 3C3WA 1T56A 1Y9QA 1G59A 4IHYA 1QVTA 2M5WA 1GVDA 2PUGA 2UXNA 2VB6A 1MSEC 2DO7A 2HOTA 1R6RA 2XAQA 3GX4X 2EF8A 4BEHB 2K3PA 3FXQA 2WC2A 3OYDA 2WIUB 3SFIA 1WH8A 2JVGA 3KYDB 2DLLA 1X2NA 4P5OA 4XONA 2X1CA 1OQYA 2R7FA 3A01B 4BHCA 4C9YA 1STZA 2L7KA 2FD5A 2XXAA 2XF5A 3L09A 2DMTA 3IKVA 5FKMA 1AOYA 2Z1DA 3OYJA 1RESA 3T8TA 3QOXA 2EJRA 3L2WA 2PXKA 5ICFA 4QPQA 2NS7A 3FXJA 2TDXA 3EUHC 1YHQI 4RDUA 3FXUA 1VQ8I 2V4JC 4JX4A 1SVOA 4XICA 3KZYA 2QQ9A 2G7UA 2M2EA 4HQMA 3RSNA 1T33A 3CMEI 2C6YA 3PNYA 4BQAA 3P9IA 3ESWB 1VI0A 3T0YA 3DLLF 3C2HA 1YJ9I 3V7CA 3HXLA 2G9WA 2FMYA 3RKYA 3TO9A 1ZUGA 2QF7A 2LFBA 2XV4S 2VQLA 2XSJC 3DTIA 5D5VB 4LIVA 1EH6A 3AAFA 1YIOA 4ZYDA 5DTRA 3C1DA 1FSEA 1XD7A 3W2VA 3FMYA 5BS6A 2W48A 4QWQA 3B6AA 4XOPA 1VFCA 4Z6YA 1DU0A 2NVUB 2Q2EB 3C2BA 1I50J 1BJZA 4A3KJ 3ZN1A 2PUDA 2KIQA 2X48A 4XMYA 3GCMA 1LPQA 4A3GJ 2IGMA 3HOUJ 4Q2JA 2HCSA 3O2PE 4LFUA 4LJZF 4UV8A 2IA2A 3F6VA 2ZMEB 5CVJA 4B8XA 1PNRA 1J7KA 2CV0A 5A2QK 2QBYA 1N25A 2HEOA 2HOEA 1U5TC 1TQMA 2K4BA 1QO0D 3O9XA 4A5NA 1NTCA 2K02A 3FYAA 3EETA 2PIJA 1R5ID 3OWQA 1VQPI 4LITA 4MHGA 4ZTFA 3D5SC 3NXHA 4RS8A 3F8NA 3OMTA 2R7OA 4BE2A 5L3FA 3H35A 3M1CA 4IVZA 4I99C 1LCDA 4QTRA 4E7KA 4IHVA 2E1CA 3ZHIA 1FIAA 3HRSA 4BJ5C 4EJUA 5DTMA 5DUKA 1D0ZA 3HRMA 4CCOA 1VQ6I 3MD2A 1FTTA 2RKHA 1GUUA 1VQ7I 1DP7P 4JOMA 2A07F 3OS0A 2BHYA 4WWCA 3D0SA 3IRRA 1Y0NA 1RKTA 1NK2P 2F4OB 2QSFX 3HTSB 3BJOA 1LVAA 1F5TA 2B9SA 4M3GA 1A6IA 1WH6A 5H6QA 2DQLA 2RN7A 4GO1A 4Z2YA 2HQNA 3K69A 3OOUA 2JSPA 4LMYA 3RDIA 1JUMA 3IRQA 2QSGX 1KQ0A 4CUGA 3K4MA 3QYFA 4MTEA 5K5QA 2XGXA 3CUOA 3H0GJ 1YTYA 5IYDJ 1R58A 5J8FA 3S1MJ 1XCBA 5KAFC 1KGSA 1U2WA 3HYIA 3EUKL 1U8BA 2R7QA 1G3TA 3RPQA 1ERDA 1UXCA 1JWLA 2XIGA 3PSFA 5JVGF 3KZIC 3PQJA 3KP7A 1ZQ3P 1QA6A 2WADA 3ZQQA 1BI1A 1UFMA 4EKGA 2LR8A 3GBGA 1MMSA 2ZKZA 3M7GA 1TNSA 1WJFA 1B0NA 4XLEA 2STTA 2VBXA 5JFRA 2HXIA 1SVLA 3ERMA 1VQNI 3R6SA 2MQKA 4Y4RA 3E97A 4UVCA 2EB7A 3LSJA 3JREA 3OQNA 3G0TA 4MNUA 4RB1A 3EUSA 1P7IA 2JVHA 3GMEA 1X2LA 4RB3C 2GA1A 4I09A 2HDCA 4MFDA 4XSXF 4HX7A 3SZTA 2HTSA 4XN0A 2KRFA 2VPRA 1WGXA 1ETOA 1DULA 1OFCX 3ZQLA 4E7JA 1LLIA 2WB1N 1OYIA 2KJBA 2GXGA 2QWWA 4NHJA 5F08A 3DBRB 3BROA 2CU7A 2HQRA 1Z67A 2HOAA 3W6KB 3S2HJ 1XGMA 3V7RA 3LMMA 4HX8A 4B3XA 1KU2A 4XORA 2DJNA 3SXYA 5FFXA 1P92A 2COBA 1K61A 2E60A 4X4EA 5CJ9A 2E7WA 3FF5A 2KISA 2ELKA 3QOPA 4U7DA 4OB4A 3IAS2 4WX9A 2KPJA 2VJIA 3HJEA 3A01A 4ENJA 3LFPA 2FA5A 2M45A 3QU3A 1TLHB 4XLAA 5D8KB 3A0BC 4IRGA 2MLGA 5DEQA 2MC4A 1PUFA 4ZDLA 5F64A 2Y48A 2DA7A 5K1YA 2R7XA 1DU6A 1A31A 3PQKA 3JCUC 2NVTJ 3ZMZA 4UB8C 4BEHA 5DDGA 3DF8A 1RUNA 2AXUA 1OSLA 2DFHA 2HYJA 3NARA 5D6EA 3S3OA 4PZJA 2KFDA 3J7YJ 4OOIA 4X4IA 4E7LA 2ZC2A 2A6TA 3DLAA 4Q47A 5DM6F 1TBXA 2YU9J 1QQBA 4DYRA 2VKVA 5EDNA 1VTNC 5GPAA 1ZLJA 2IXSA 3SDGA 5EZHA 1RI7A 1TWFJ 1D1AA 3SJMA 4N0BA 1Y0UA 2OA4A 2V1XA 1T0FA 2PMZA 5CVIA 4F93B 2L1PA 1WJCA 3ECOA 1IV8A 4ESBA 4OIQF 2FE3A 1D1BA 2CMPA 2L5QA 3S8PA 1Z21A 3JTGA 4Z59A 2KEJA 4Y13A 3CJNA 1XGNA 3WE3A 1NG7A 4AIHA 2AHQA 4XR6A 4YFXF 1YW7A 1FBSA 1D0YA 4BBRJ 2IA1A 5F1JA 1YLFA 5FROA 1EF4A 3PFIA 2LK2A 3I5UA 4HF0A 3TELA 2AQFA 3HUGB 2CW0F 2WAQN 3KEOA 2L9RA 1QB2A 5KVRA 3SZPA 3TP0A 1ZRCA 1FMVA 1G3SA 2FJ1A 4EM0B 3V8JA 3R4KA 3D5RC 3GWZA 1F4KA 2GM4A 1FTZA 3GTQJ 2PXTA 2IS2A 1F9NA 3IP4B 1JHFA 2OPTA 3ZCOA 3GZDC 4XKWA 2MBFA 1N78A 3DNVB 3ZGKA 2K9SA 3SDBA 2BJCA 1TT5B 3TO7A 2DK5A 1Q1HA 1V4RA 1YRNB 3TRBA 4A3DJ 3FKJA 3CUQA 1OYYA 4ZH4F 3DU5A 3KIOA 3LSHA 2PJRA 3LQQA 2GQQA 2VBYA 2A69F 2JA7J 1JFSA 2IJLA 3HBLA 3W2AA 5LLQA 5FRNA 2O3FA 2K5CA 3E5UA 2E34A 1C0WA 1HOMA 1MH4A 2WBMA 1VQMI 2LNBA 2LBFB 3S93A 4HLXA 3I59A 4A5MA 5EJCA 1U6GA 2A6EF 3IV5A 3QU6A 1YSEA 1SD5A 4G6TB 3S1RJ 2DPDA 2MEZA 1XWRA 4RGSA 2PG4A 1ZHFA 4YBAA 3FXKA 3NWTA 3JRAA 4QIWN 2JUCA 4RAZA 4KDPA 2PX9A 3FM3A 1YX3A 5EGOB 3QYBA 4D1QA 1QBJA 3ISPA 3I64A 2ODRD 2KRHA 2MH9A 4M3BA 2MXDA 4HYEA 1FYMA 5LFAA 3KXAA 1X2MA 4KA4A 2O0YA 2H8RA 2V9PA 4I6ZA 2JTVA 3CD6I 3VYRB 4GHJA 2BW3B 1RUOA 5C4XJ 3I4MJ 1TWAJ 3TMOA 3QPHA 2MLKA 5K5RA 3HOVJ 3QYXA 2QM3A 5DYMA 4A3MJ 3G1MA 5ERIA 2W85A 4XNFA 3R61A 4HNVA 3G7DA 1R7JA 1W36C 2CGPA 1YW8A 3OS2A 3F3XA 1KZHA 2MD0A 2OCEA 2XROA 2BY0A 2QYOA 3WTWC 4EATA 3EPZA 3OYLA 1BI2A 1SMTA 2O03A 3CECA 1PUEE 4BNCA 3GTJJ 2WUSR 5E3LA 4C3HJ 2IW5A 3RQIA 3JRGA 2XSDC 4AIJA 4F92B 2XAUA 2V9KA 1IW7F 3GN5B 4HNUA 4GRIA 1SFKA 2ISZA 2HPMA 5IOZA 1PERL 1HCRA 3P9KA 4G6DA 2W25A 2HKXA 3E7LA 1G3YA 4YRVA 3PIOF 3WGGA 2CV2A 5HS9A 4FE4A 5DUIA 1MMDA 1X1AA 2OR1L 2DPUA 1WJAA 4EGYA 2E1OA 2HGCA 2GXBA 1W7PD 5FKNA 2R3SA 3OYFA 1A36A 2M1BA 3FXOA 2F5CA 2GIVA 4GYGA 4OU0A 4PCQA 4DBRA 3ZMVA 1EJ9A 2X6OA 4RB2C 4S04A 1NHAA 1USSA 4WF2A 2W24A 3SQNA 4F3QA 4MCTA 2QA4I 3F72A 1HLVA 2O49A 1TWGJ 1ZG1A 4RAYA 2XAHA 4CO8A 2HZTA 2V3CC 1MNEA 4KT5C 1V5GA 2CQNA 1WJDA 2HOSA 3GTOJ 4EM2A 3CDHA 3WODF 2Z16A 4O3MA 3CLCA 3QQAA 1TZLA 5F0FA 4B4CA 1UTXA 2V1NA 2PXLA 3CCYA 4HOBA 3GXOA 2MD5A 4M3DA 2FSWA 4BXXJ 2FBIA 5KHDA 1J9IA 3GN5A 4HRAA 3TKYA 3L00A 2V6CA 5L3GA 1ZGAA 2HQ5A 3DU6A 3PNVA 1RRJA 2DA2A 2VODA 2YX4A 3ECHA 2IA0A 2CFXA 3WU2C 3M3YJ 3ELKA 1O4XA 1LE8A 4IL6C 2OAZA 3BS3A 3W6JB 3A9ZA 1JXSA 1O3QA 4L9VA 3LA2A 4OIOF 3O8GA 1MIJA 4YIIA 2LYRA 3H9GA 3JRDA 3G6EI 1QHHD 4IA8A 1XGSA 2CH0A 3Q0WA 3PL8A 4RAFA 3GBFA 1SEUA 2QQ8A 3IC7A 4MGRA 2DTZA 3FHNA 2OQGA 5EEHA 2Y75A 2LTPA 3LQRA 5L3BA 2K9NA 4B09A 4NDWA 1Z0XA 2EILH 2DFIA 2DMUA 2K86A 5K98B 1OCPA 2JPBA 3ZRGA 4BBSJ 2QUFA 3FZVA 5EG0B 3J7AY 3ONQA 1LFBA 5E1XA 1AHDP 1HBXG 2VKHA 2CS3A 4IF4A 4C2TA 1IV6A 2RVCA 4PJJA 1PRVA 3E6BA 1PJRA 2ZNZA 1LDDA 4KIGA 1XMKA 4RB0A 1XPXA 1S72I 1W1WE 2V6EA 5BOXA 3CUQB 2VXZA 4BDYA 4ESJA 2DFEA 3H0DA 1XMXA 1MDMB 1J59A 4IPAA 5J4VA 2WAQA 2RNJA 4M6XA 3CCLI 5F0HA 2EIJH 4IOAF 1MH3A 3J81Z 1HKSA 1MKMA 2M34A 2ZXJA 1FJLA 4NB5A 3F9KA 2W4SA 5EZGA 3R0AA 3ABTA 3O8HA 4P9FA 2XASA 1MJAA 5D8LB 4DNCA 5M5YJ 2P5LC 2EV6A 1ZTRA 2HVRA 3H3VK 3PO2J 2BY3A 2DODA 4YARA 1GHCA 4FBIA 1BDHA 3RJPA 1DP3A 1QRYA 1B8IB 5DCMA 3BWGA 2H6BA 4GQMA 2F4IA 3K6GA 1JGGA 3D5LA 2GXAA 3JRBA 3TW7A 3TFLA 3Q3SA 3U1KA 4Q4ZF 4I7HA 3CP8A 2EIKH 2VBZA 1Y56A 1FPQA 1CQTA 1V55H 1ON1A 4DIQA 1OISA 2ISYA 2Y0SA 5CQEA 3K70D 3ZR8X 1OR7C 2DDBA 5FD6A 1MBFA 2E19A 3ZXSA 1UXDA 2IS6A 2IVGA 4A0XA 1R9TJ 3K0LA 2J5PA 1IXCA 2R5ZB 1G4DA 4A69C 1FNNA 4G7ZF 3MZ8A 1MBEA 4FX0A 4PU4C 2HPIA 1L3LA 3BR1A 1VPWA 5FLXK 3MN2A 1BR4A 1ZRFA 2L54A 4EGZA 2XGCA 4O5VA 4E7ZA 2OUMA 3F23A 1K7AA 1TT0A 4D5CA 3E1SA 3CJQB 2DA3A 4CDGA 2LD5A 5TISC 2DOEA 2F5EA 4IRIA 5IP9J 1MJ9A 3OKZA 3RTRA 2MH2A 4NC8A 4W97A 2ELJA 4G9YA 3N4MA 2W1OA 1ZRDA 3L2RA 1KYWA 2HFHA 1D8KA 1YS6A 3CESA 4M9ZA 1NW3A 1X57A 1ZZBA 4RLFA 4KMUX 1B9NA 2L3DA 5A2QZ 1D5VA 5IOYA 4HV5A 3M4OJ 3K70C 2QZ8A 3N05A 2K4JA 2HS5A 3ABLH 2YPRA 4N4OB 3A9XA 1MZBA 4C2UA 1UG2A 2LG4A 1B1BA 3NZLA 4L0YB 2M3AA 4AVZA 4B1RA 5B3SH 3AG1H 3K7AJ 2W7NA 5LEJA 1LEBA 4ZDPA 3U9GA 4I6RA 4X4FA 5GAHi 1QP0A 2ICWG 4QSHA 3DBHB 2LOOA 4YIFA 5CYVA 4ENKA 3QPSA 4Y15A 4XLCA 2IVMA 1LVKA 2X4HA 3BCAA 1APLC 1BL0A 2PXQA 4G7OF 4WK8F 4BHPA 1S7OA 1JKPC 4A6EA 1X1DA 1V54H 2PXFA 1GDTA 1ETYA 4OMZA 4EJVA 4ESFA 3CC2I 2XI8A 4KIFA 2LLKA 5JUWA 2FMLA 1IF1A 3BTCA 3I0TA 4Z5DA 4FT8A 3SHFA 3BT9A 5HLTA 3LFUA 2LDUA 5EEGA 2ZMEA 5F0CA 5HDNA 1K78A 3DM5A 2KPMA 1ZK8A 2R7ZJ 1WH5A 2FNAA 3JSPA 1ZZ8A 4IHSA 4MTDA 4CZCA 2PUEA 2LY2A 3EDPA 3T8RA 1FYKA 3WTUC 1QPMA 4IXAA 1B59A 2G7HA 3FMQA 3CCSI 3S15J 2PI0A 1W5SA 2ZSHB 1HC8A 3M1EA 4FASD 3LAPA 1ETQA 2KL4A 2HR3A 1LFPA 2GRMA 3AL0C 1QZYA 4RM3A 3K4CA 3L2VA 1H9GA 2XAGA 2IUOA 2DCEA 1PRUA 1IN4A 3E0JB 3CC7I 3WU0A 1JJ8C 3GTKJ 1OCRH 2Y2ZA 1H89C 1G6NA 2HYGD 5GTHC 3ZQCA 4ABZA 2K9QA 3GUDA 3QQ6A 1ZVVA 1EA3A 5JLWA 2MC3A 4FHTA 3DQVC 5C4JJ 3RYPA 1EH8A 4ER0A 2LYCA 3SFZA 3S1NJ 2JRTA 1U9OA 2P8TA 3LA3A 2HDWA 4JQDA 1Z7UA 5LRRA 2CV1A 1UAAA 2LBFA 4HQEA 1WI9A 3ZPXA 3AL0B 1R5HA 1ZKGA 4IVNA 2LKSA 3FKIJ 1ZREA 3HGYA 1ULYA 2N8GA 2BYVE 3PIPF 2E7XA 3H5AA 3RPUA 4ER7A 1CF7B 2R7UA 2ZJ2A 2X1EA 5IP7J 4J19A 1LMB3 2D1VA 1WQ2A 1R4MB 2VASA 4LLGF 1LDKB 3WTZA 4HF1A 1RZRA 3I53A 3BJAA 5K7ZA 4X4BA 4WXDA 4N9IA 4ZYHA 3R60A 1XG1A 4WXCA 3CCMI 4PJMA 3JRFA 2A5WA 2E5ZA 4BUPA 3MQ0A 3F52A 3HSRA 1ZGJA 2LH9A 1U8RA 1V3FA 2LY9A 5DT2A 4S0HB 1FOYA 1POGA 3IH4A 3FM5A 5KK1A 5EYRA 3V42A 3GUUA 2HVQA 2ZFUA 3HHHA 3H36A 4RGUA 1QPIA 5FFZA 4AUXA 2Q1ZB 2JJ7A 1ETVA 4BJ6C 4GGGA 3SX0A 2DAOA 4XLNF 1WRJA 3A02A 1SAUA 2KLOA 1WI3A 4F52A 4BXFA 1YYVA 1I39A 3I55I 1JJ6C 2OTJI 2QENA 1DGWY 5M5WJ 3KYCB 1Z6TA 1FWZA 5DS9A 2NOGA 2O8XA 3BTJA 4L5EA 5J4YA 2VEOA 3S8QA 2EH3A 3KLOA 2M0MA 2HSGA 2KIUA 1JUSA 2F2EA 1OPCA 3E3VA 5HODA 3E6MA 1W5CC 1IJWC 1BA5A 1T6SA 4CCLA 1JH9A 3HG9A 2E1MB 4GYIA 4ZTJA 3NROA 3Q0VA 1PUFB 4PFPA 2YBDA 3G2BA 4Y42A 2A68F 2VL8A 2AXVA 1SQ8A 3BG3A 3CUQC 2KZGA 1TNTA 1E2XA 2PEXA 5ILVA 4NDLA 1XMAA 3IKTA 2PJRB 3HOWJ 4J01A 1J5YA 1R5GA 2BXZA 5B1AH 2KP6A 1Q1VA 1RZSA 1LNWA 2BY2A 1A5JA 3OYGA 3BR2A 1XSDA 1USTA 2FQ3A 4HBLA 2EBIA 2UXXA 3A0HC 4IX7A 4XQFA 3RKXA 3B7HA 2QGUA 3JAMZ 3M8JA 1HKQA 4BHBA 2DMNA 5EG0A 3EQLF 4D7MA 1UZCA 3M9AA 1HDDC 3LQXA 2A5YB 5DRTA 2JZYA 2B7EA 3BOQA 2PBIA 4AVPA 2ZBKA 2MW8A 4MQ9F 2BVMA 1TC3C 1SD4A 2IV1A 4A3IJ 3BTLA 3DEUA 2Y9ZA 1LDJA 4MQVA 2KIFA 1YJNI 2EFPA 1S7AA 5DTQA 3ZMDA 2QLZA 2XDVA 3J80Z 5DTDA 3IL2A 1FLIA 5H20A 2R7SA 1FYLA 2EFWA 5M5XJ 1WPKA 1AA7A 1X1PA 2JWTA 2WY7Q 2BNOA 2PPXA 2A05A 4HPQA 1QP4A 4IKFA 4UVAA 1LE8B 2Z2SB 1FOXA 2R7DA 4C3IJ 4PSXA 5B5EC 4W1UA 3GTPJ 3Q9SA 1JT0A 1CJGA 4ITVA 4FN3A 2NS0A 4BL0B 2L2OA 1REPC 2F5VA 3FISA 1E3OC 4ZYGA 2AS5F 2BBYA 3SEQA 3OWTA 4ENNA 2XIUA 3S3NA 2XXPA 1JTXA 3GO5A 4UXNA 2H6CA 4KN4X 5TGTA 3ROUA 2JCGA 2KEIA 4XKCA 2L9VA 5TRDA 1R1VA 2NRAC 2PLYA 1X3WB 3J7ZI 3WGHA 2AO9A 2CQ7A 1QQAA 4X4HA 2KEKA 2BXYA 3G4SI 5L3EA 3JW4A 1ZN2A 4PK4A 4E7HA 3UNGC 1XS9A 2PMHA 2ZB9A 2LLWA 2ZSIB 3VYSB 1R49A 2ECCA 3VK0A 1SFEA 2OBPA 3L2CA 4YEJA 1RETA 4HF2A 3SCGA 2NVQJ 2XAFA 1Z1DA 2LY1A 4HV6A 4QLCU 2Z33A 5M3MJ 2V26A 1TQIA 1E3PA 2D2WA 2WTEA 2XUBA 4A0ZA 5K7HA 3SEZA 2ACJA 5E3OA 1TWHJ 3H3UA 1POUA 4UUSA 2L7MP 4RBOA 1SFOJ 3JXDL 2EV5A 4HAMA 2CQXA 1HW5A 3KEYA 5LRSA 2DBBA 3E6CC 1VZ0A 2FXAA 1N75A 3D1NI 2OCCH 1KU3A 5CVUA 1UJ8A 1XSXA 2ZJPF 2VC0A 4F8DA 1M1EB 1ZAYA 1TQPA 2IGNA 2LNMA 5DSXA 2NOJB 3KPHA 2PE5A 2KDOA 2OJED 4ENMA 3DEEA 4E4HA 3BZ6A 3H92A 3LSPA 1T38A 4LB5A 2EZLA 2F6CA 2M30A 4L18B 3K1NA 1OR7A 1MMNA 2COMA 4M72A 4KFCA 3OR1C 5DD4A 4CZZA 4Q5SF 1Y7YA 4AD9A 1QGPA 1FP1D 3JAMK 1GV2A 1HA8A 4EJWA 2K3FA 2RC4A 5J3LA 4HLYA 2GIZA 3A03A 5FKKA 3S16J 3RZOJ 1I6HJ 4F91B 3MVPA 2PUBA 4HG2A 3KP6A 2Q0OA 2H27A 4JX5A 1IRZA 4P9UA 4BS9A 1G3WA 4YFNF 3OSFA 2HZDA 4HSTA 4YELA 5J40A 3LSTA 3ZMSA 2XC7A 3CCUI 1FEXA 3OYKA 3GEZA 5E79C 3IAM2 4U0WA 2KDZA 2GLOA 5DD8A 2NVXJ 1QPZA 1Y8QB 1BM9A 4XIDA 3VFZA 3F8FA 3QWLA 4NC6A 1S6LA 2PXPA 1R1TA 2L49A 1XDSA 2QCOA 1JKOC 4CSWA 4ZDOA 4BE0A 1IN6A 1QZXA 2ZXIA 5ILUA 3LAJA 1UHSA 1H0MA 1VQLI 4LB6B 4EEFG 2O7OA 3EUHA 3FXLA 3KX2A 4BACA 3GZ5A 4EJOA 3PSIA 3HKZN 4M74A 3RIRA 2IRFG 1DWKA 4I8TA 1WFXA 2XVCA 3G1LA 3OYHA 4IHWA 4ER3A 2GOMA 1WVRA 4XSZF 4X4DA 4BQQA 4II3A 2YR2A 3PUFA 5IP6A 2EBYA 4DBQA 1LJ9A 4BQNA 2E36A 3OQMA 4ASNA 2RNGA 4OMYA 3WU1B 3OIOA 1J75A 2RAEA 3BG5A 2VIXA 3KP5A 1XB4A 1RC9A 3WTVC 2Z5UA 3KP2A 2JA6J 4ZYEA 1BOBA 4OBMA 1FOKA 3GLLA 1K4SA 3CCJI 1ZZ6A 3HRTA 2BNNA 4UUVA 1BDIA 4A93J 1ZZ7A 2JQ7A 4H4KC 3QP6A 2JMWA 4NUBA 4CYCA 4CXFA 4ANJA 3AG4H 2XPWA 1GVJA 1O57A 1NK3P 3AG3H 2H1KA 2W84A 3ZN0A 2M7BA 4Y52J 3MZYA 3CF2A 3NRVA 2WA0A 2YUSA 3TP3A 4R79A 1IDZA 1UCRA 2DYRH 4M71A 4EKIA 3VPRA 2IP2A 2H94A 1ZG3A 5FD5A 2BNMA 2Q8KA 4F7ZA 2DT7B 2VXDA 2HFZA 2JRMA 4D0PA 3GVAA 3UWPA 5AIQA 5K7FA 4KIBA 2K40A 4DZPA 4RGXA 1B72A 4IRHA 2BZTA 4YFKF 1NH3A 5H2FC 2M0CA 4PGGA 2DYSH 3VSKA 3I71A 2LYSA 4ER5A 4A12A 5IY5H 3WHCA 1SANA 4BH9A 2Y69H 4O8BA 3ASOH 1ZG5A 2AXTC 3PJRA 1L1MA 3JRHA 3DPUA 2NS8A 3I59B 1P7JA 4NQWB 2FQ4A 2DT6A 3KEQA 4UB6C 4Y33A 2LYLA 2W82A 4BYYA 1X1CA 3DWLE 2ZJRF 5LD2C 3PXPA 2VE8A 2BHZA 3BY6A 1PP8F 4Y7NJ 4M9XA 2Z99A 4BE1A 2FRHA 2P81A 3I4PA 3OL4A 5CVRA 2AW6A 2FBKA 1RNLA 3OYAA 1O3TA 3OL3A 3OY9A 4HDVA 3S1QJ 2L7FP 4NQWA 3V7SA 3KYLA 4PSWA 1GT0C 4PU8A 2GBYA 2WY8Q 3K4LA 2XCJA 1XX5A 5LHGA 4HEA2 5C44J 1RIOH 1I6XA 4B3AA 2DMPA 1K6OA 4XOTA 1DQUA 3ZHMA 3CZ6A 3CO6C 4GFBA 2IT0A 3ML6A 3CCVI 4X4GA 4AYBN 1ITYA 3BQZA 2FU4A 5E8IA 3EUAA 2R92J 2V1DA 6PAXA 2IVBA 2A61A 3HSEA 4BDZA 4S05A 2E35A 5FLMJ 2L8NA 4RGRA 5IT9Z 1J2XA 2RGVA 3KL4A 3VDXA 3MEJA 3FK7A 2VT2A 1ORKA 3LOCA 1R22A 5KNLA 2J7UA 1DUXC 4A3FJ 4ETSA 3HOSA 2XGEA 5J6XA 4WCGA 1YO5C 1OCTC 3P7NA 2RV8A 2LSOA 1U78A 3GTMJ 3ZMUA 5HLGA 2D1HA 1IGNA 2CROA 1LB2A 2J7WA 3SCHA 4Z5CA 2MSYA 3HIFA 5GPCA 4JX6A 5DM7F 2P7CB 2KHMA 1KYZA 2MYSA 1JKRC 1KU7A 3GTGJ 1Y1WJ 3FIWA 1X3UA 3GZDA 3LNQA 3VYUB 4I02A 2EFOA 2PUFA 3OV8A 2L9NA 4A0YA 3UFDA 2VJ4A 4HSRA 3HOTA 3KZ3A 3Q0UA 1YFHA 3ZP5A 5LBQA 4LLNA 2R5ZA 3M9LA 1SAXA 2ZNYA 4HW0A 5ICGA 4TV7A 1Y8RB 4DYQA 3L1PA 1LEAA 3BP8A 3LSRA 1S29A 3CDIA 3H1CA 2GAUA 2D5VA 3PO3J 4AIDA 2V1UA 2EINH 5DRYA 5F04A 2EQRA 2PJPA 3HDDA 3IHUA 4P55A 4FQGA 4BGDA 1TW2A 1D5YA 4R8HA 3T5XA 3A2KA 1A04A 2DN0A 5FJ8J 1X1BA 4XN3A 1F1ZA 1HSJA 1LKXA 4XLPF 2JN6A 4IWRA 1ZR2A 1IN8A 2K27A 3QP5A 4I76A 2IU7A 3PUBA 1B6AA 3IH3A 3BDDA 3K4JA 4D9JA 4KNYA 1T95A 2X85A 4GCVA 1HSTA 3CMAI 1XC5A 3OIQA 4YG4A 3ABMH 3F8MA 5F1RA 2XKPA 3NAUA 2K85A 5JI6A 2XB0X 4KMFA 4AIKA 5E1WA 5GAGJ 4M6YA 2VLAA 3FMSA 1W4MA 4A2UA 1Z9CA 2VKEA 5DV5A 1BIBA 3CQZJ 1UHWA 2Y30A 5L3DA 1JUPA 1XGOA 3FHZA 3JTHA 2VUMJ 3LWFA 1FT9A 4KJZA 4B47A 5CVVA 3QOWA 3BQYA 2KZ8A 2VQCA 3TOBA 3DFGA 1KA8A 1N77A 2L01A 4CCNA 1V5EA 1BC8C 1I5ZA 3W6VA 4C30A 4YIRX 2PUAA 3S2DJ 5HS8A 2LYQA 3VWSA 1K79A 3S17J 4BKXA 2HNHA 3M07A 1K78B 5GADJ 3HEFA 5KCMA 3COAC 2VJJA 5DCMB 3H5NA 1OJLA 5J1YA 2LLVA 1RPEL 2TCTA 1P4XA 4Z5HA 1YQAA 3T1BA 4CCJA 1HDPA 3CF5F 3R0JA 1BI3A 1HXDA 4LGWA 3KFWX 1ADRA 1P6RA 3GFLA 2DOFA 3ZQFA 2R0QC 2PXDA 4KYWA 3E5QA 1LCCA 3E5XA 1WIZA 2IS4A 2RDPA 3CCRI 3HOXJ 1IXRC 5E1ZB 4JP0A 4N9HA 1T0FC 4RLQA 2ADUA 1QHGA 4P96A 2X6YA 3FMRA 3FYMA 1YI2I 4IOCF 2DW4A 3B73A 4V19K 1FC3A 5HVQC 1YOVB 3OMYA 4N4NB 2TRTA 5HDGA 5DCFA 2Y9YA 1FY7A 2ICPA 2KQRA 2XRLA 2DA5A 4DYCA 2E2HJ 2JSCA 2AWIA 3WTYC 3BR0A 2P4WA 1AWCA 5IYBJ 3SCFA 5M3FJ 2ESNA 1E17A 5IT9K 4JCYA 1GV5A 4PU7A 2IAIA 2KZVA 4XBFA 2BGCA 2CUEA 3WTSC 4GXOA 1WKMA 1RIOA 2JA2A 2PXUA 1ZLKA 5B1BH 1FP2A 3CDLA 3L7WA 3K1MA 3MKZA 2Y0MA 4E7IA 4UV9A 1H8AC 1AKHB 4UY8I 4ON0A 3F6WA 3H9JA 3BC8A 1XSVA 4BY7J 2V9VA 2R7VA 2ICTA 5ICCA 2P5KA 1DDNA 4OAYA 2A3SA 4FTHA 2R7TA 2XF6A 3TGNA 1T8IA
chains in the Genus database with same CATH topology
1W0TA 3HOVJ 3FISA 1E3OC 3MLFA 3OP9A 3QYXA 1LFUP 4A3MJ 1MBHA 5FKOA 2XIUA 4I6UA 1MSFC 2PUCA 3G1MA 4G12A 1Y1VJ 2EWTA 4HNVA 4C3JJ 2R93J 3G7DA 2L7ZA 1JTXA 4AC0A 1AU7A 2KEIA 2JCGA 1WETA 2E2JJ 3R1FA 4X4CA 3OQOA 1B8IA 2MGQA 3CECA 2NVYJ 2AO9A 4FISA 3GTJJ 2EZKA 1BW5A 4X4HA 2WUSR 1QQAA 1RKWA 5E3LA 4C3HJ 1W0UA 3RQIA 3JRGA 2I10A 2XSDC 2KEKA 3UKGA 2LCVA 2O4AA 1XS9A 2WV1A 2ZB9A 3GN5B 3VK0A 2ECCA 1U9NA 1PERL 5IOZA 1HCRA 3ZQGA 1RETA 3OSGA 3PM1A 3E7LA 3SCGA 2NVQJ 4FE4A 2JA5J 2OR1L 2E1OA 3QWGA 1RZRD 5FKNA 1R69A 4UUSB 4M6VA 5JLXA 5M3MJ 2OF7A 2X6OA 2KT0A 2JVLA 5K7HA 2G0EA 2R5YA 2ID6A 5E3OA 1TWHJ 5IPAA 4MCTA 1HLVA 3BG9A 1TWGJ 1POUA 2O49A 4UUSA 2L7MP 1FIPA 4RBOA 1YRNA 1SFOJ 1ZPQA 4X1EA 2CQXA 4A3BJ 2HOSA 3GTOJ 3CLCA 3QQAA 5F0FA 3D1NI 4B4CA 1UTXA 3IVPA 2GRLA 1RPWA 3CCYA 3GN5A 4M3DA 4BXXJ 4F8DA 4YG7B 4BY1J 1ZAYA 4XK4A 2HXOA 4XRMA 2PE5A 2HQ5A 1WCMJ 2E2IJ 2DA2A 1WH7A 3LSPA 3RKQA 2MG4A 3M3YJ 1O4XA 2EZLA 1LE8A 3BS3A 3KJXA 3JRCA 1ZGWA 3IH2A 4C2MJ 2LYPA 1VNDA 1MBGA 3BR3A 3O8GA 1H88C 1Y7YA 2LYRA 1AKHA 1GV2A 2ME0A 3JRDA 2LYJA 4IA8A 3JXCL 5FLVA 3S16J 5J3LA 3RZOJ 3Q0WA 3A03A 5FKKA 1DW9A 1I6HJ 4DW6A 3MVPA 2PUBA 3G1OA 3ZQHA 4JX5A 1IRZA 3GBFA 5GP9A 4UUTA 5EF6A 1S7EA 4PU3C 2DA6A 3OSFA 2DTZA 2PMZN 5E3MA 1IC8A 2LTPA 4MLOA 2K9NA 1FEXA 1UMQA 5J1UA 4NDWA 1Z0XA 3RZDJ 4CYCB 2DMUA 2KDZA 2GLOA 5K98B 2NVXJ 1OCPA 2Y31A 4BBSJ 1QPZA 5EG0B 3FK6A 4XIDA 2XPVA 3MKLA 1TWCJ 1AHDP 1LFBA 2L49A 1T56A 2QCOA 1JKOC 4MO7A 2AUWA 1Y9QA 1IV6A 4IHYA 1QVTA 1PRVA 1GVDA 2PUGA 1UHSA 2HOTA 4EEFG 2O7OA 3G5GA 1JFTA 1JKQC 2EF8A 2WIUB 3SFIA 3HKZN 1WH8A 2HINA 1DWKA 4I8TA 5F0HA 3G1LA 1X2NA 4IHWA 1MH3A 2M34A 1FJLA 5EZGA 1MSEC 3A01B 1R63A 4X4DA 3O8HA 3RZZA 2XPUA 5IP6A 2CRGA 5M5YJ 3H3VK 4M3FA 1ZTRA 2HDDA 2FD5A 3PO2J 2EBYA 2DMTA 3OQMA 4YARA 5FKMA 4FBIA 1BDHA 1RESA 2ID3A 3OIOA 1QRYA 2RAEA 1B8IB 2CJJA 3BG5A 2NS7A 4RDUA 4GQMA 4JX4A 2JA6J 4XICA 1JGGA 2X9DA 3JRBA 3TW7A 2M2EA 3Q3SA 2XB5A 1T33A 4LOCA 1CQTA 1VI0A 2JK3A 1NERA 1ZZ6A 1MBFA 2E19A 1UXDA 1ZUGA 2QF7A 2LFBA 2BNNA 2IVGA 1BDIA 4A93J 1R9TJ 1ZZ7A 2OFYA 4CYCA 2R5ZB 2JMWA 2O8KA 4A69C 2XPWA 1MBEA 5IYCJ 1NK3P 3FMYA 4PU4C 1VPWA 3BR1A 2H1KA 5F27A 3HOZJ 2W48A 3MN2A 3B6AA 4Y52J 1MBKA 1VFCA 2XGCA 1DU0A 3DCFA 2YUSA 4D5CA 3F51A 3TP3A 2DA3A 2LD5A 3C2BA 1I50J 3HM5A 1BJZA 4A3KJ 1IDZA 2YS9A 5IP9J 3VPRA 2PUDA 2X48A 3CROL 4A3GJ 3ZQIA 2BNMA 4W97A 3HOUJ 1G2HA 1F43A 1ZZ9A 1ETKA 1PNRA 4XRSA 5K7FA 1B72A 2K40A 4DZPA 1X57A 1ZZBA 4I6TA 1ZR4A 2M0CA 5EGOA 4FCYA 2FX0A 2IEKA 5IOYA 5C3EJ 3DEWA 3M4OJ 3O9XA 2LYSA 1NTCA 3WHCA 1MBJA 1SANA 3FYAA 2PIJA 4O8BA 1UG2A 1MNMC 1L1MA 3JRHA 3OMTA 2NS8A 1P7JA 2FQ4A 4B1RA 3K7AJ 2LYLA 4I6RA 3PXPA 4IVZA 4X4FA 3K2AA 3TEDA 1QP0A 4QSHA 1LCDA 4Y7NJ 4A3JJ 2P81A 4QTRA 4IHVA 2AW6A 3QPSA 3ZHIA 1FIAA 3S1QJ 2L7FP 1APLC 1BL0A 1JKPC 1GT0C 4PU8A 2GBYA 3QPLA 2EZIA 1FTTA 1GUUA 2XCJA 1GDTA 1ETYA 3LISA 5C44J 2XI8A 1ETWA 3BDNA 4B3AA 2DMPA 2LLKA 4Z5DA 3BTCA 3ZHMA 3GTLJ 1RKTA 3BT9A 1NK2P 4GFBA 1B72B 4X4GA 4AYBN 1ITYA 4J1XA 3BQZA 5F0CA 1WH6A 4M3GA 1A6IA 1ZK8A 2CUFA 2R92J 2R7ZJ 4JCXA 3B6CA 1WH5A 4A3EJ 1ZZ8A 2IVBA 1EFAA 3OOUA 5FLMJ 1JUMA 2L8NA 2PUEA 3QF3A 3FK7A 4IHXA 3H0GJ 5IYDJ 1ORKA 1PRAA 3LOCA 3S1MJ 3S15J 4A3FJ 2XGEA 1OCTC 1ETQA 1U78A 1U8BA 2GRMA 3GTMJ 2GZUA 1I3QJ 3BD1A 1UXCA 1IGNA 2CROA 3SCHA 3JXBC 2IUOA 4Z5CA 2MSYA 1JWLA 1PRUA 5GPCA 3S14J 4JX6A 3BR5A 2O9LA 1ZQ3P 3CMYA 4MCXA 2EZHA 1JJ8C 3GTKJ 1JKRC 2Y2ZA 1H89C 3GTGJ 1X58A 1Z77A 1ZZCA 1Y1WJ 2LR8A 3GBGA 3FIWA 3ZQCA 4ABZA 3LNQA 2K9QA 2M9HA 3QQ6A 1ZVVA 3F0CA 3TW6A 1B0NA 3BTIA 2PUFA 5JLWA 5C4JJ 2HXIA 3UFDA 3S1NJ 2MQKA 3KZ3A 1U9OA 3Q0UA 4YG1A 3LSJA 3JREA 3U3WA 4MIMA 3OQNA 4JQDA 2R5ZA 3EUSA 1P7IA 1X2LA 3HOYJ 4MFDA 4DYQA 3L1PA 2VPRA 3LSRA 1WGXA 1ETOA 1ZKGA 2D5VA 1OFCX 3PO3J 3HZIB 2DA1A 3ZQLA 4J1WA 1LLIA 2WB1N 4D7NA 2R5YB 3FKIJ 2EQRA 1JT6A 5F08A 5F04A 3HGYA 3LSGA 2CU7A 1ETXA 2N8GA 2HOAA 3S2HJ 3HDDA 2IBDA 2R1JL 2DJNA 1D5YA 2JA8J 2COBA 2DN0A 1K61A 2B5AA 5FJ8J 4X4EA 2IVQA 5IP7J 2ELKA 4OB4A 4J19A 2AXZA 1LMB3 2KPJA 3A01A 3LFPA 4V2FA 2JN6A 3H5TA 4IWRA 2VI6A 1ZR2A 1RZRA 1PUFA 1DU6A 4I76A 2DA7A 4IEJA 3ZOBA 5K7ZA 2IU7A 4X4BA 3IH3A 2NVTJ 2AXUA 1OSLA 2HYJA 3ZKCA 1XG1A 3NARA 1XC5A 5FKLA 2DMQA 4X4IA 4YG4A 3JRIA 3JRFA 3NAUA 2XB0X 4X6AJ 4JYKA 5E3NA 1K83J 3F52A 2YU9J 2FJRA 1QQBA 2LY9A 4DYRA 2VKVA 4S0HB 5EDNA 1POGA 3IH4A 5GPAA 1JTYA 5EYRA 1HF0A 3SDGA 5EZHA 2Y0SN 2VKEA 1TWFJ 1QPIA 3SJMA 3CQZJ 3HB9A 4AUXA 4D5FA 2JJ7A 2Y30A 3BR6A 1JUPA 2LKXA 1QP7A 1ETVA 2VUMJ 4XRSG 3A02A 1WI3A 2HI3A 4FE7A 3BQYA 1IG7A 2KZ8A 4Z59A 2KEJA 4M3EA 2AHQA 1JJ6C 4BBRJ 5M5WJ 5DS9A 3W6VA 2NOGA 1IUFA 3BTJA 4L5EA 2PUAA 1ENHA 2EH3A 3S2DJ 2LYQA 2CQQA 5F1JA 3S8QA 4A3LJ 1EF4A 2HSGA 1JUSA 2LK2A 4BKXA 3S17J 3HEFA 5HODA 2WAQN 9ANTA 1OJLA 2L9RA 5J1YA 1RPEL 3TP0A 1IJWC 2TCTA 4A3CJ 1BA5A 2O38A 2FJ1A 1JH9A 2LP0A 4Z5HA 2XGDA 1HDPA 3Q0VA 4MFEA 1PUFB 1ZS4A 2GM4A 1FTZA 1BW6A 4Y42A 3GTQJ 1ADRA 5EEAA 2AXVA 1SQ8A 2R0QC 3ZQFA 2OPTA 1F36A 3BG3A 1LCCA 3DNVB 1WIZA 4NDLA 2K9SA 2LVSA 3HOWJ 3I4NJ 2BJCA 3HOXJ 4JP0A 1Q1VA 1RZSA 1YRNB 1RR7A 3TRBA 4A3DJ 1A5JA 5BNGA 3FYMA 3BR2A 2A6CA 1QVUA 2EBIA 2JA7J 4V2GA 2TRTA 1JFSA 3B7HA 2Y9YA 2ICPA 3HBLA 2XRLA 2DA5A 4DYCA 2DMNA 5EG0A 2E2HJ 4D7MA 2AWIA 2ME6A 1HDDC 1HOMA 2DA4A 3BR0A 1MH4A 1NEQA 5IYBJ 3JR9A 3SCFA 5M3FJ 3IV5A 1YSEA 2MEZA 3S1RJ 1GV5A 4JCYA 1XWRA 2ECBA 2MW8A 4PU7A 1TC3C 2IAIA 4YBAA 2IV1A 4A3IJ 3JRAA 3BTLA 4QIWN 1VF9A 2CUEA 5A7LA 2Y9ZA 1RIOA 3HGGA 4Z58A 2R63A 5EGOB 1LQCA 3CDLA 5J1RA 5DTDA 1H8AC 3F6WA 1AKHB 2LYKA 5M5XJ 4M3BA 1WPKA 2L0KA 2BNOA 2JWTA 2XJ3A 2M8GX 2PPXA 3KXAA 4BY7J 1X2MA 2CSFA 2H8RA 2ICTA 1QP4A 1IDYA 3WHBA 4I6ZA 1LE8B 2B63J 4GHJA 4C3IJ 4W1UA 5C4XJ 4FTHA 3GTPJ 1JT0A 3I4MJ 1TWAJ 4DZJA 4FN3A 1CJGA 3JXDL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W0T A;  3HOV J;  3FIS A;  1E3O C;  3MLF A;  3OP9 A;  3QYX A;  1LFU P;  4A3M J;  1MBH A;  5FKO A;  2XIU A;  4I6U A;  1MSF C;  2PUC A;  3G1M A;  4G12 A;  1Y1V J;  2EWT A;  4HNV A;  4C3J J;  2R93 J;  3G7D A;  2L7Z A;  1JTX A;  4AC0 A;  1AU7 A;  2KEI A;  2JCG A;  1WET A;  2E2J J;  3R1F A;  4X4C A;  3OQO A;  1B8I A;  2MGQ A;  3CEC A;  2NVY J;  2AO9 A;  4FIS A;  3GTJ J;  2EZK A;  1BW5 A;  4X4H A;  2WUS R;  1QQA A;  1RKW A;  5E3L A;  4C3H J;  1W0U A;  3RQI A;  3JRG A;  2I10 A;  2XSD C;  2KEK A;  3UKG A;  2LCV A;  2O4A A;  1XS9 A;  2WV1 A;  2ZB9 A;  3GN5 B;  3VK0 A;  2ECC A;  1U9N A;  1PER L;  5IOZ A;  1HCR A;  3ZQG A;  1RET A;  3OSG A;  3PM1 A;  3E7L A;  3SCG A;  2NVQ J;  4FE4 A;  2JA5 J;  2OR1 L;  2E1O A;  3QWG A;  1RZR D;  5FKN A;  1R69 A;  4UUS B;  4M6V A;  5JLX A;  5M3M J;  2OF7 A;  2X6O A;  2KT0 A;  2JVL A;  5K7H A;  2G0E A;  2R5Y A;  2ID6 A;  5E3O A;  1TWH J;  5IPA A;  4MCT A;  1HLV A;  3BG9 A;  1TWG J;  1POU A;  2O49 A;  4UUS A;  2L7M P;  1FIP A;  4RBO A;  1YRN A;  1SFO J;  1ZPQ A;  4X1E A;  2CQX A;  4A3B J;  2HOS A;  3GTO J;  3CLC A;  3QQA A;  5F0F A;  3D1N I;  4B4C A;  1UTX A;  3IVP A;  2GRL A;  1RPW A;  3CCY A;  3GN5 A;  4M3D A;  4BXX J;  4F8D A;  4YG7 B;  4BY1 J;  1ZAY A;  4XK4 A;  2HXO A;  4XRM A;  2PE5 A;  2HQ5 A;  1WCM J;  2E2I J;  2DA2 A;  1WH7 A;  3LSP A;  3RKQ A;  2MG4 A;  3M3Y J;  1O4X A;  2EZL A;  1LE8 A;  3BS3 A;  3KJX A;  3JRC A;  1ZGW A;  3IH2 A;  4C2M J;  2LYP A;  1VND A;  1MBG A;  3BR3 A;  3O8G A;  1H88 C;  1Y7Y A;  2LYR A;  1AKH A;  1GV2 A;  2ME0 A;  3JRD A;  2LYJ A;  4IA8 A;  3JXC L;  5FLV A;  3S16 J;  5J3L A;  3RZO J;  3Q0W A;  3A03 A;  5FKK A;  1DW9 A;  1I6H J;  4DW6 A;  3MVP A;  2PUB A;  3G1O A;  3ZQH A;  4JX5 A;  1IRZ A;  3GBF A;  5GP9 A;  4UUT A;  5EF6 A;  1S7E A;  4PU3 C;  2DA6 A;  3OSF A;  2DTZ A;  2PMZ N;  5E3M A;  1IC8 A;  2LTP A;  4MLO A;  2K9N A;  1FEX A;  1UMQ A;  5J1U A;  4NDW A;  1Z0X A;  3RZD J;  4CYC B;  2DMU A;  2KDZ A;  2GLO A;  5K98 B;  2NVX J;  1OCP A;  2Y31 A;  4BBS J;  1QPZ A;  5EG0 B;  3FK6 A;  4XID A;  2XPV A;  3MKL A;  1TWC J;  1AHD P;  1LFB A;  2L49 A;  1T56 A;  2QCO A;  1JKO C;  4MO7 A;  2AUW A;  1Y9Q A;  1IV6 A;  4IHY A;  1QVT A;  1PRV A;  1GVD A;  2PUG A;  1UHS A;  2HOT A;  4EEF G;  2O7O A;  3G5G A;  1JFT A;  1JKQ C;  2EF8 A;  2WIU B;  3SFI A;  3HKZ N;  1WH8 A;  2HIN A;  1DWK A;  4I8T A;  5F0H A;  3G1L A;  1X2N A;  4IHW A;  1MH3 A;  2M34 A;  1FJL A;  5EZG A;  1MSE C;  3A01 B;  1R63 A;  4X4D A;  3O8H A;  3RZZ A;  2XPU A;  5IP6 A;  2CRG A;  5M5Y J;  3H3V K;  4M3F A;  1ZTR A;  2HDD A;  2FD5 A;  3PO2 J;  2EBY A;  2DMT A;  3OQM A;  4YAR A;  5FKM A;  4FBI A;  1BDH A;  1RES A;  2ID3 A;  3OIO A;  1QRY A;  2RAE A;  1B8I B;  2CJJ A;  3BG5 A;  2NS7 A;  4RDU A;  4GQM A;  4JX4 A;  2JA6 J;  4XIC A;  1JGG A;  2X9D A;  3JRB A;  3TW7 A;  2M2E A;  3Q3S A;  2XB5 A;  1T33 A;  4LOC A;  1CQT A;  1VI0 A;  2JK3 A;  1NER A;  1ZZ6 A;  1MBF A;  2E19 A;  1UXD A;  1ZUG A;  2QF7 A;  2LFB A;  2BNN A;  2IVG A;  1BDI A;  4A93 J;  1R9T J;  1ZZ7 A;  2OFY A;  4CYC A;  2R5Z B;  2JMW A;  2O8K A;  4A69 C;  2XPW A;  1MBE A;  5IYC J;  1NK3 P;  3FMY A;  4PU4 C;  1VPW A;  3BR1 A;  2H1K A;  5F27 A;  3HOZ J;  2W48 A;  3MN2 A;  3B6A A;  4Y52 J;  1MBK A;  1VFC A;  2XGC A;  1DU0 A;  3DCF A;  2YUS A;  4D5C A;  3F51 A;  3TP3 A;  2DA3 A;  2LD5 A;  3C2B A;  1I50 J;  3HM5 A;  1BJZ A;  4A3K J;  1IDZ A;  2YS9 A;  5IP9 J;  3VPR A;  2PUD A;  2X48 A;  3CRO L;  4A3G J;  3ZQI A;  2BNM A;  4W97 A;  3HOU J;  1G2H A;  1F43 A;  1ZZ9 A;  1ETK A;  1PNR A;  4XRS A;  5K7F A;  1B72 A;  2K40 A;  4DZP A;  1X57 A;  1ZZB A;  4I6T A;  1ZR4 A;  2M0C A;  5EGO A;  4FCY A;  2FX0 A;  2IEK A;  5IOY A;  5C3E J;  3DEW A;  3M4O J;  3O9X A;  2LYS A;  1NTC A;  3WHC A;  1MBJ A;  1SAN A;  3FYA A;  2PIJ A;  4O8B A;  1UG2 A;  1MNM C;  1L1M A;  3JRH A;  3OMT A;  2NS8 A;  1P7J A;  2FQ4 A;  4B1R A;  3K7A J;  2LYL A;  4I6R A;  3PXP A;  4IVZ A;  4X4F A;  3K2A A;  3TED A;  1QP0 A;  4QSH A;  1LCD A;  4Y7N J;  4A3J J;  2P81 A;  4QTR A;  4IHV A;  2AW6 A;  3QPS A;  3ZHI A;  1FIA A;  3S1Q J;  2L7F P;  1APL C;  1BL0 A;  1JKP C;  1GT0 C;  4PU8 A;  2GBY A;  3QPL A;  2EZI A;  1FTT A;  1GUU A;  2XCJ A;  1GDT A;  1ETY A;  3LIS A;  5C44 J;  2XI8 A;  1ETW A;  3BDN A;  4B3A A;  2DMP A;  2LLK A;  4Z5D A;  3BTC A;  3ZHM A;  3GTL J;  1RKT A;  3BT9 A;  1NK2 P;  4GFB A;  1B72 B;  4X4G A;  4AYB N;  1ITY A;  4J1X A;  3BQZ A;  5F0C A;  1WH6 A;  4M3G A;  1A6I A;  1ZK8 A;  2CUF A;  2R92 J;  2R7Z J;  4JCX A;  3B6C A;  1WH5 A;  4A3E J;  1ZZ8 A;  2IVB A;  1EFA A;  3OOU A;  5FLM J;  1JUM A;  2L8N A;  2PUE A;  3QF3 A;  3FK7 A;  4IHX A;  3H0G J;  5IYD J;  1ORK A;  1PRA A;  3LOC A;  3S1M J;  3S15 J;  4A3F J;  2XGE A;  1OCT C;  1ETQ A;  1U78 A;  1U8B A;  2GRM A;  3GTM J;  2GZU A;  1I3Q J;  3BD1 A;  1UXC A;  1IGN A;  2CRO A;  3SCH A;  3JXB C;  2IUO A;  4Z5C A;  2MSY A;  1JWL A;  1PRU A;  5GPC A;  3S14 J;  4JX6 A;  3BR5 A;  2O9L A;  1ZQ3 P;  3CMY A;  4MCX A;  2EZH A;  1JJ8 C;  3GTK J;  1JKR C;  2Y2Z A;  1H89 C;  3GTG J;  1X58 A;  1Z77 A;  1ZZC A;  1Y1W J;  2LR8 A;  3GBG A;  3FIW A;  3ZQC A;  4ABZ A;  3LNQ A;  2K9Q A;  2M9H A;  3QQ6 A;  1ZVV A;  3F0C A;  3TW6 A;  1B0N A;  3BTI A;  2PUF A;  5JLW A;  5C4J J;  2HXI A;  3UFD A;  3S1N J;  2MQK A;  3KZ3 A;  1U9O A;  3Q0U A;  4YG1 A;  3LSJ A;  3JRE A;  3U3W A;  4MIM A;  3OQN A;  4JQD A;  2R5Z A;  3EUS A;  1P7I A;  1X2L A;  3HOY J;  4MFD A;  4DYQ A;  3L1P A;  2VPR A;  3LSR A;  1WGX A;  1ETO A;  1ZKG A;  2D5V A;  1OFC X;  3PO3 J;  3HZI B;  2DA1 A;  3ZQL A;  4J1W A;  1LLI A;  2WB1 N;  4D7N A;  2R5Y B;  3FKI J;  2EQR A;  1JT6 A;  5F08 A;  5F04 A;  3HGY A;  3LSG A;  2CU7 A;  1ETX A;  2N8G A;  2HOA A;  3S2H J;  3HDD A;  2IBD A;  2R1J L;  2DJN A;  1D5Y A;  2JA8 J;  2COB A;  2DN0 A;  1K61 A;  2B5A A;  5FJ8 J;  4X4E A;  2IVQ A;  5IP7 J;  2ELK A;  4OB4 A;  4J19 A;  2AXZ A;  1LMB 3;  2KPJ A;  3A01 A;  3LFP A;  4V2F A;  2JN6 A;  3H5T A;  4IWR A;  2VI6 A;  1ZR2 A;  1RZR A;  1PUF A;  1DU6 A;  4I76 A;  2DA7 A;  4IEJ A;  3ZOB A;  5K7Z A;  2IU7 A;  4X4B A;  3IH3 A;  2NVT J;  2AXU A;  1OSL A;  2HYJ A;  3ZKC A;  1XG1 A;  3NAR A;  1XC5 A;  5FKL A;  2DMQ A;  4X4I A;  4YG4 A;  3JRI A;  3JRF A;  3NAU A;  2XB0 X;  4X6A J;  4JYK A;  5E3N A;  1K83 J;  3F52 A;  2YU9 J;  2FJR A;  1QQB A;  2LY9 A;  4DYR A;  2VKV A;  4S0H B;  5EDN A;  1POG A;  3IH4 A;  5GPA A;  1JTY A;  5EYR A;  1HF0 A;  3SDG A;  5EZH A;  2Y0S N;  2VKE A;  1TWF J;  1QPI A;  3SJM A;  3CQZ J;  3HB9 A;  4AUX A;  4D5F A;  2JJ7 A;  2Y30 A;  3BR6 A;  1JUP A;  2LKX A;  1QP7 A;  1ETV A;  2VUM J;  4XRS G;  3A02 A;  1WI3 A;  2HI3 A;  4FE7 A;  3BQY A;  1IG7 A;  2KZ8 A;  4Z59 A;  2KEJ A;  4M3E A;  2AHQ A;  1JJ6 C;  4BBR J;  5M5W J;  5DS9 A;  3W6V A;  2NOG A;  1IUF A;  3BTJ A;  4L5E A;  2PUA A;  1ENH A;  2EH3 A;  3S2D J;  2LYQ A;  2CQQ A;  5F1J A;  3S8Q A;  4A3L J;  1EF4 A;  2HSG A;  1JUS A;  2LK2 A;  4BKX A;  3S17 J;  3HEF A;  5HOD A;  2WAQ N;  9ANT A;  1OJL A;  2L9R A;  5J1Y A;  1RPE L;  3TP0 A;  1IJW C;  2TCT A;  4A3C J;  1BA5 A;  2O38 A;  2FJ1 A;  1JH9 A;  2LP0 A;  4Z5H A;  2XGD A;  1HDP A;  3Q0V A;  4MFE A;  1PUF B;  1ZS4 A;  2GM4 A;  1FTZ A;  1BW6 A;  4Y42 A;  3GTQ J;  1ADR A;  5EEA A;  2AXV A;  1SQ8 A;  2R0Q C;  3ZQF A;  2OPT A;  1F36 A;  3BG3 A;  1LCC A;  3DNV B;  1WIZ A;  4NDL A;  2K9S A;  2LVS A;  3HOW J;  3I4N J;  2BJC A;  3HOX J;  4JP0 A;  1Q1V A;  1RZS A;  1YRN B;  1RR7 A;  3TRB A;  4A3D J;  1A5J A;  5BNG A;  3FYM A;  3BR2 A;  2A6C A;  1QVU A;  2EBI A;  2JA7 J;  4V2G A;  2TRT A;  1JFS A;  3B7H A;  2Y9Y A;  2ICP A;  3HBL A;  2XRL A;  2DA5 A;  4DYC A;  2DMN A;  5EG0 A;  2E2H J;  4D7M A;  2AWI A;  2ME6 A;  1HDD C;  1HOM A;  2DA4 A;  3BR0 A;  1MH4 A;  1NEQ A;  5IYB J;  3JR9 A;  3SCF A;  5M3F J;  3IV5 A;  1YSE A;  2MEZ A;  3S1R J;  1GV5 A;  4JCY A;  1XWR A;  2ECB A;  2MW8 A;  4PU7 A;  1TC3 C;  2IAI A;  4YBA A;  2IV1 A;  4A3I J;  3JRA A;  3BTL A;  4QIW N;  1VF9 A;  2CUE A;  5A7L A;  2Y9Z A;  1RIO A;  3HGG A;  4Z58 A;  2R63 A;  5EGO B;  1LQC A;  3CDL A;  5J1R A;  5DTD A;  1H8A C;  3F6W A;  1AKH B;  2LYK A;  5M5X J;  4M3B A;  1WPK A;  2L0K A;  2BNO A;  2JWT A;  2XJ3 A;  2M8G X;  2PPX A;  3KXA A;  4BY7 J;  1X2M A;  2CSF A;  2H8R A;  2ICT A;  1QP4 A;  1IDY A;  3WHB A;  4I6Z A;  1LE8 B;  2B63 J;  4GHJ A;  4C3I J;  4W1U A;  5C4X J;  4FTH A;  3GTP J;  1JT0 A;  3I4M J;  1TWA J;  4DZJ A;  4FN3 A;  1CJG A;  3JXD L; 
#chains in the Genus database with same CATH topology
 2CWE A;  3OP9 A;  3MLF A;  4DGW B;  2X51 A;  3LSI A;  4EQZ A;  2XRN A;  3QOE A;  1MBH A;  3CLO A;  5FKO A;  3A4C A;  3U21 A;  1MSF C;  2CUJ A;  3G73 A;  4LD5 A;  2EWT A;  2OQR A;  1WJB A;  4C3J J;  2K9M A;  3ZQ7 A;  5FRM A;  2X1D A;  3O3K A;  4AC0 A;  2F5D A;  1WET A;  4ER6 A;  2E2J J;  3R1F A;  4U0Y A;  3RPU D;  3KET A;  2VJ5 A;  3OQO A;  1B8I A;  3IUO A;  3K1P A;  1BC7 C;  4FIS A;  1LUJ B;  1B4A A;  1BW5 A;  2F5F A;  2W00 A;  2I10 A;  2K9L A;  3UKG A;  1GXP A;  4CCK A;  1U5T A;  2LCV A;  3TBI A;  5JHF A;  4ZZD A;  1JE8 A;  2O4A A;  4DQ2 A;  1OLT A;  1U9N A;  2KKO A;  4UNO A;  3QAH A;  5CKT A;  3ZQG A;  2XKO A;  1KU9 A;  3OSG A;  3U1D A;  1UEL B;  2BE5 F;  1X3Z B;  1FMW A;  3FBN B;  3V8L A;  1MD0 A;  3BJ6 A;  2NYX A;  4R1H A;  3ABU A;  1R69 A;  5LGN A;  4UUS B;  4NC7 A;  4M6V A;  2HKO A;  4HX4 A;  4XKV A;  4DOZ A;  2NXN B;  2E1M C;  5GAH J;  2OF7 A;  1O3S A;  3TEP A;  2O61 A;  2JVL A;  2G0E A;  3WE2 A;  2ID6 A;  5FGM A;  1MW7 A;  3H3Z A;  4BU2 A;  5LGU A;  2XAJ A;  4XKB A;  5D4S A;  1TL8 A;  1ZAR A;  3VYT B;  4X1E A;  3S32 A;  3CC4 I;  4F55 A;  2NNN A;  2X6X A;  4NBQ A;  1Z3Y A;  1U5T B;  4LG3 A;  2P7V B;  3IVP A;  2QEX I;  4J00 A;  4YG7 B;  3J80 K;  3C18 A;  5D5X B;  4CIC A;  4QPO A;  4XRM A;  2WB1 A;  2P0W A;  5CPR B;  1WCM J;  2E2I J;  2CW8 A;  1JHH A;  3H5R A;  1WH7 A;  1U3E M;  2XF7 A;  3RKQ A;  2MG4 A;  1J0R A;  2WV0 A;  1IAW A;  4XRF A;  3EYI A;  2L02 A;  3KJX A;  3B02 A;  2IS1 A;  3IH2 A;  2EFQ A;  1VND A;  1MBG A;  2PFB A;  3TDZ C;  3LSM A;  3GFI A;  5JR3 A;  5E8G A;  1FZP B;  3TOA A;  1UB9 A;  1MGT A;  3HTU A;  2M87 A;  2VC1 A;  3QRF F;  1WWX A;  3BCB A;  5FLV A;  1IN5 A;  4EV0 A;  1DW9 A;  1W36 D;  1U2Z A;  4DW6 A;  4IJA A;  3G1O A;  3ZQH A;  1ONV A;  3J81 K;  4Y3O A;  3K4B A;  2HWV A;  4UUT A;  2DA6 A;  2X6W A;  3DPT A;  3OS1 A;  2PMZ N;  5E3M A;  1IC8 A;  2HCN A;  4L0Z B;  2ZXH A;  3LA7 A;  4MLO A;  2DTR A;  4CYC B;  3SZG A;  1RR8 C;  1R1U A;  1XDU A;  2XPV A;  3MKL A;  3MEX A;  2OD5 A;  4B44 A;  2BY1 A;  4XLF A;  4MO7 A;  2AUW A;  2OU2 A;  3W3C A;  2DOA A;  2P6T A;  3GZN B;  3F22 A;  2AXL A;  3FX3 A;  2L4M A;  2LC2 A;  1OMI A;  3HSF A;  4KUM A;  3G5G A;  1FBQ A;  2YX7 A;  1JFT A;  1JKQ C;  4KIC A;  2UZK A;  1D3Y A;  3A1Y A;  1CF7 A;  4JBA A;  2HIN A;  4EM1 A;  3TO6 A;  4I01 A;  5HOO A;  2XPU A;  2CRG A;  4M3F A;  2HDD A;  2ZJQ F;  1PYV A;  1R36 A;  3VSL A;  2ID3 A;  1Y39 A;  4ZJZ A;  1IRG A;  3WGI A;  2CJJ A;  3HUG A;  3KZZ A;  3WTX C;  4I0B A;  3PE5 A;  3OYM A;  2MA3 A;  4I2O A;  3I3L A;  1VQ4 I;  4U88 A;  5FB2 A;  2X9D A;  5B66 C;  2M4G A;  2JPC A;  2XB5 A;  1TP4 A;  3NWS A;  4LOC A;  2BV6 A;  5FLX Z;  3MWM A;  5HS7 A;  3F6O A;  2JK3 A;  4KT6 A;  1DGR M;  1NER A;  3GZC A;  2AQE A;  1SD7 A;  1HW1 A;  1E3H A;  3RCO A;  2OFY A;  2E5N A;  1O7F A;  3LFK A;  4BXU A;  2O8K A;  1IUY A;  5IYC J;  2Q2E A;  1QQI A;  3HOZ J;  5F27 A;  3CLQ A;  3K2Z A;  1IXS B;  3FWE A;  1L0O C;  4AM3 A;  1MBK A;  3LL7 A;  5IT3 A;  3DCF A;  4L9J A;  3F51 A;  4LG0 A;  3OIP A;  3HM5 A;  3GLX A;  1A35 A;  4UHT A;  3K10 A;  2B0L A;  3BLY A;  2NAZ A;  2YS9 A;  4AWX B;  4FX4 A;  1T08 B;  3CRO L;  3MZH A;  3BG7 A;  3KLN A;  3ZQI A;  1D0X A;  1G2H A;  3CTA A;  2EA2 A;  1F43 A;  1Z6R A;  4RM2 A;  3VEP A;  2WAE A;  1W7P A;  1ZZ9 A;  1ETK A;  1MMA A;  1OYW A;  2HU9 A;  4XRS A;  1YIJ I;  1ZEL A;  4KIT B;  4I6T A;  1QZZ A;  2EK5 A;  4RA2 A;  3PNT A;  1I27 A;  4B43 A;  1ZR4 A;  4CYD A;  5EGO A;  4FCY A;  1CGP A;  2FX0 A;  1LQ1 A;  2IEK A;  2WAF A;  4RMN A;  1OCZ H;  3DEW A;  5C3E J;  3G3Z A;  1MBJ A;  3DXJ F;  2Z9O A;  2ZCW A;  2OV7 A;  3OYE A;  5BPI A;  2FUG 2;  1R4N B;  1MNM C;  1KON A;  2Z3Y A;  3KP4 A;  1IN7 A;  4AYB A;  5BPD A;  2D45 A;  4LIU A;  1SMY F;  2HYF A;  2PXE A;  5J8C A;  3K2A A;  2DFF A;  4IQ4 A;  3TED A;  1BN5 A;  4A3J J;  4DE9 A;  2OZU A;  1WZ2 A;  2ZME C;  3DKY A;  1Z91 A;  3Q9V A;  2R7W A;  1P9Q C;  3BG6 A;  3DBL B;  5CQG A;  3H9Q A;  5ICE A;  4LK0 F;  4EMS A;  3QPL A;  2EZI A;  5E20 A;  3RI4 A;  3ULQ B;  1U0J A;  2W57 A;  2GWR A;  3LIS A;  5TJJ A;  1ETW A;  4HNT A;  3BDN A;  1S9H A;  1IO2 A;  5BMZ A;  4EK9 A;  2ZO4 A;  3CJT B;  2QQB A;  3OYN A;  4EJT A;  3GTL J;  3O6B B;  3F8C A;  1YJW I;  2H1L A;  2EPF A;  2QQA A;  2P6S A;  3F21 A;  1K4T A;  1IRF A;  4G7H F;  1B72 B;  4J1X A;  5HLI A;  5BQT A;  2WWY A;  3RKW A;  2CUF A;  2VON A;  1T98 A;  2QBY B;  3B6C A;  4OIR F;  4A3E J;  4JCX A;  2QVO A;  1EFA A;  4HZF A;  1ON2 A;  3WTT C;  1SFX A;  3S3M A;  1QU3 A;  3QF3 A;  4BQO A;  4M73 A;  2X0L A;  4IHX A;  1YE9 A;  1PRA A;  1J09 A;  3C2G A;  1VQK I;  4I0A A;  4CHU A;  1JI8 A;  3V8K A;  3OYC A;  3DKX A;  3TL4 X;  4OWR B;  4ZYA A;  2GZU A;  1I3Q J;  3BD1 A;  4LK1 F;  1OCO H;  4G8X A;  3JXB C;  3UR3 C;  3S14 J;  2VQG A;  3NEU A;  1MFQ C;  3BR5 A;  2O9L A;  3MCZ A;  2EWN A;  4U87 A;  3CMY A;  2EZH A;  2OZ6 A;  1PDN C;  4OIN F;  3QPT A;  4DE8 A;  3GFJ A;  3FDY A;  1X58 A;  1PP7 U;  1Z77 A;  1ZZC A;  2MFZ A;  5E18 F;  3OYI A;  1VQ5 I;  3ERE D;  1UG0 A;  2M9H A;  4IQJ A;  3F0C A;  3TW6 A;  3BTI A;  2VOP A;  2OTL I;  2CO5 A;  2O5R A;  1TTY A;  2ETH A;  4YG1 A;  3GF2 A;  3GZ6 A;  3M8E A;  1WSU A;  3U3W A;  3WG9 A;  2GOX B;  1WHU A;  2DU9 A;  2M8E A;  4MIM A;  4L9T A;  5HNH A;  2LF7 A;  1YW9 A;  2ELH A;  1I1S A;  3EYY A;  3HOY J;  3A9Y A;  5FO5 A;  1ZH5 A;  1FBU A;  3P9C A;  3C7J A;  1FX7 A;  1ZAO A;  2XXQ A;  3HZI B;  2DA1 A;  2H09 A;  2VN2 A;  4J1W A;  4D7N A;  2F4M B;  2KMU A;  2R5Y B;  1JT6 A;  4ZC3 A;  3LSG A;  1A6Q A;  2QKL B;  1ETX A;  1MND A;  1DPR A;  4NNJ A;  3GW2 A;  4H0E A;  2IBD A;  2E71 A;  2R1J L;  3L2U A;  2DT5 A;  2JA8 J;  1I1G A;  4KN7 X;  2DDA A;  3CMM A;  5AIP A;  1KQ9 A;  4U7B A;  1BOA A;  2B5A A;  1MDM A;  2GA2 A;  2IVQ A;  2QSH X;  2R7R A;  3CJR B;  1KQ8 A;  2AXZ A;  3RYR A;  3OR2 C;  3KE2 A;  4V2F A;  3H5T A;  1HQ1 A;  2VI6 A;  2K7L A;  1HQC A;  3LSK A;  2DK8 A;  3MAJ A;  4FET A;  5AON A;  2CW7 A;  2P5V A;  2YU3 A;  5HDK A;  1ODD A;  4IEJ A;  3ZOB A;  1S8N A;  5J47 A;  3I9V 2;  2ESH A;  3SR4 A;  3R09 A;  2VKD A;  3ZKC A;  4IHT A;  1RZ4 A;  2L4A A;  4EQQ A;  2FNP A;  3I54 A;  5FKL A;  2DMQ A;  5GAG i;  3BPV A;  1W7P B;  3JRI A;  3S2W A;  1UHM A;  4X6A J;  4JYK A;  5E3N A;  1K83 J;  3KCC A;  1B9M A;  1S3J A;  2R4G A;  4I98 B;  3TQN A;  3QOD A;  3P5J A;  4L5I A;  3CCE I;  1R63 A;  2FJR A;  1BJA A;  3HKZ A;  5KAI C;  5JVT A;  4LG0 B;  1JTY A;  1HF0 A;  3KP3 A;  1SC7 A;  1TW3 A;  2Y0S N;  3RZZ A;  2LKP A;  4GDF A;  2PXV A;  3HB9 A;  3BZC A;  4D5F A;  2LKX A;  3AG2 H;  3BR6 A;  5E17 F;  1QP7 A;  3JSO A;  1R00 A;  1S5L C;  1GLN A;  3K4K A;  4XRS G;  1DPU A;  3MKY B;  4AU7 A;  4FE7 A;  2HI3 A;  3ZMT A;  2I8D A;  1V5F A;  1IG7 A;  4XL9 A;  5ED4 A;  4PFO A;  4M3E A;  2BVL A;  3FBI B;  4BAY A;  2J5O A;  1JGS A;  2I5U A;  2HTJ A;  1IUF A;  2RQQ A;  3L2Q A;  1ENH A;  2CFO A;  4EVI A;  3AKZ A;  2CQQ A;  3I56 I;  1FOW A;  2CUZ A;  4IO9 F;  4A3L J;  2OC6 A;  1W5T A;  3SYT A;  2EFN A;  1OCC H;  3W2W A;  9ANT A;  1P4A A;  2YSR A;  4X0G A;  3TDU C;  2DI3 A;  2EA4 A;  4A3C J;  2O38 A;  3AFH A;  2LP0 A;  2CYY A;  2ZFW A;  1EV7 A;  1EKE A;  1WJ5 A;  2XGD A;  3E6D A;  4MFE A;  1ZS4 A;  4E6K G;  1IZ1 A;  2VQH A;  2ZXW H;  3HC7 A;  1BW6 A;  1BR2 A;  5EEA A;  3OYB A;  2VPL A;  5HNF A;  2VBW A;  2CQK A;  1F36 A;  5LGT A;  1BI0 A;  4MEY F;  4PUS A;  5GAE J;  1OKR A;  2LVS A;  3VOE A;  3I4N J;  4L5J A;  2KRC A;  1PVE A;  5D4R A;  3VOD A;  1RR7 A;  3HRU A;  5BNG A;  5JHU A;  5LHI A;  1E0E A;  3FXR A;  2A6C A;  1QVU A;  3M8F A;  2V79 A;  4V2G A;  4JQF A;  4CCM A;  3QYE A;  4CA0 A;  2FOK A;  2PN6 A;  2STW A;  4Q48 A;  2ME6 A;  2DA4 A;  2UUZ A;  2HQA A;  1NEQ A;  3HPG A;  3JR9 A;  2L9S A;  4JK1 X;  4O6J A;  4PJL A;  2EIM H;  2NNY A;  1ZYR F;  1T39 A;  1Z7L A;  2ECB A;  1I3A A;  2MAB A;  1O3R A;  1WJE A;  1VF9 A;  3REO A;  5D5U B;  5A7L A;  3HGG A;  4Z58 A;  1R71 A;  2R63 A;  1D1C A;  4G6Q A;  1LQC A;  1BR1 A;  5J1R A;  3X2Q H;  3L9F A;  3MKW B;  2E1N A;  1ACI A;  2LYK A;  2L0K A;  3HPH A;  2XJ3 A;  2M8G X;  4PDK A;  3GFM A;  2CSF A;  4OAZ A;  3IWZ A;  2XHK A;  2UWM A;  1BIA A;  1IDY A;  2DJI A;  3WHB A;  2B63 J;  4DJA A;  2LRE A;  3QFI A;  3NDB B;  4PJ0 C;  2FEZ A;  2KJC A;  4DZJ A;  2FBH A;  4B48 A;  3DPL C;  3DTE A;  3ASN H;  4HA8 A;  4CGZ A;  1W0T A;  2IGK A;  4LLL A;  5LEK A;  1LFU P;  3RQ4 A;  2BW3 A;  2V7F A;  4HDU A;  1EH7 A;  4WXH A;  3ABK H;  4I6U A;  2PUC A;  1XTA A;  2PQ8 A;  2RRE A;  4G12 A;  1Y1V J;  1O7L A;  2R93 J;  2L7Z A;  4EZI A;  1YX5 A;  1AU7 A;  3GYH X;  3ME5 A;  1YIT I;  3Q5F A;  4UVB A;  2LMD A;  4KIS A;  2PXB A;  4X4C A;  2BOL A;  4HRI A;  1SD6 A;  2MGQ A;  3K9T A;  2NVY J;  2EZK A;  1P4W A;  1SFU A;  4M9S A;  1RKW A;  3HHG A;  3HZJ A;  5ILS A;  1W0U A;  1H9T A;  3PFY A;  2O6G E;  4WVL A;  5H6R A;  3F8B A;  2IGO A;  2WV1 A;  3MMY B;  2EV0 A;  2LF8 A;  2RQP A;  1X19 A;  2JUG A;  3WG7 H;  1HW2 A;  4PJN A;  3PM1 A;  2HVS A;  2M4H A;  4E70 A;  2KIM A;  1K6Y A;  1X4P A;  2JA5 J;  3DP7 A;  1RZR D;  1NG6 A;  3DV8 A;  3QWG A;  4YG2 F;  3NQO A;  5JLX A;  3U2R A;  1X4O A;  1Z3X A;  3N97 A;  4A6D A;  2KT0 A;  1XCV A;  2CSO A;  4Y17 A;  2H8W A;  4BJT A;  1BBY A;  2R5Y A;  3CCQ I;  5IPA A;  2A6H F;  1G8X A;  3BG9 A;  3G71 I;  5GTI C;  1FIP A;  1VQ9 I;  1YRN A;  1ZPQ A;  4K2E A;  1Y6I A;  3MFK A;  3HL2 A;  1QNT A;  2M4K A;  3I58 A;  4A3B J;  2DXI A;  1GXQ A;  2LRD A;  5D6F A;  5L3C A;  3VWB A;  5HLH A;  2GRL A;  1RPW A;  4BY1 J;  4MCX A;  3ZPL A;  3CO7 C;  4XK4 A;  2HXO A;  4OIP F;  2BEO A;  2JQE A;  4P1W A;  2CG4 A;  2JT1 A;  1HKT A;  2VOO A;  1VQO I;  4E7S A;  1MJB A;  2VT3 A;  4MEX F;  1YS7 A;  3JRC A;  1ZGW A;  4L9N A;  4RAG A;  4C2M J;  2LYP A;  3BR3 A;  1H88 C;  1IRX A;  4XLH A;  4IZZ A;  1AKH A;  2F48 A;  2ME0 A;  2FOW A;  5LHH A;  1QZE A;  2GZW A;  5K5O A;  1P2F A;  1SVM A;  2FFH A;  2LYJ A;  3JXC L;  1YG2 A;  5CLS A;  3K4N A;  3V4G A;  3IWF A;  2PMU A;  2DQR A;  3BPX A;  5GP9 A;  1S7E A;  3DTK A;  5EF6 A;  3J7A O;  4PU3 C;  3OOP A;  2FF4 A;  5F6F A;  4U0V A;  2QKM B;  1D8J A;  4G94 A;  1FSH A;  3FXM A;  3VB2 A;  5D5W B;  3DKW A;  3BZK A;  1MMG A;  4II2 A;  4ZZL A;  1UMQ A;  1XN7 A;  5J1U A;  3RZD J;  4CH7 A;  4XM3 A;  1R23 A;  2Y31 A;  1T2K A;  2UV1 A;  1Z05 A;  3FK6 A;  2VE9 A;  4PGH A;  3CP2 A;  2M7A A;  1TWC J;  2IPQ X;  3C3W A;  1T56 A;  1Y9Q A;  1G59 A;  4IHY A;  1QVT A;  2M5W A;  1GVD A;  2PUG A;  2UXN A;  2VB6 A;  1MSE C;  2DO7 A;  2HOT A;  1R6R A;  2XAQ A;  3GX4 X;  2EF8 A;  4BEH B;  2K3P A;  3FXQ A;  2WC2 A;  3OYD A;  2WIU B;  3SFI A;  1WH8 A;  2JVG A;  3KYD B;  2DLL A;  1X2N A;  4P5O A;  4XON A;  2X1C A;  1OQY A;  2R7F A;  3A01 B;  4BHC A;  4C9Y A;  1STZ A;  2L7K A;  2FD5 A;  2XXA A;  2XF5 A;  3L09 A;  2DMT A;  3IKV A;  5FKM A;  1AOY A;  2Z1D A;  3OYJ A;  1RES A;  3T8T A;  3QOX A;  2EJR A;  3L2W A;  2PXK A;  5ICF A;  4QPQ A;  2NS7 A;  3FXJ A;  2TDX A;  3EUH C;  1YHQ I;  4RDU A;  3FXU A;  1VQ8 I;  2V4J C;  4JX4 A;  1SVO A;  4XIC A;  3KZY A;  2QQ9 A;  2G7U A;  2M2E A;  4HQM A;  3RSN A;  1T33 A;  3CME I;  2C6Y A;  3PNY A;  4BQA A;  3P9I A;  3ESW B;  1VI0 A;  3T0Y A;  3DLL F;  3C2H A;  1YJ9 I;  3V7C A;  3HXL A;  2G9W A;  2FMY A;  3RKY A;  3TO9 A;  1ZUG A;  2QF7 A;  2LFB A;  2XV4 S;  2VQL A;  2XSJ C;  3DTI A;  5D5V B;  4LIV A;  1EH6 A;  3AAF A;  1YIO A;  4ZYD A;  5DTR A;  3C1D A;  1FSE A;  1XD7 A;  3W2V A;  3FMY A;  5BS6 A;  2W48 A;  4QWQ A;  3B6A A;  4XOP A;  1VFC A;  4Z6Y A;  1DU0 A;  2NVU B;  2Q2E B;  3C2B A;  1I50 J;  1BJZ A;  4A3K J;  3ZN1 A;  2PUD A;  2KIQ A;  2X48 A;  4XMY A;  3GCM A;  1LPQ A;  4A3G J;  2IGM A;  3HOU J;  4Q2J A;  2HCS A;  3O2P E;  4LFU A;  4LJZ F;  4UV8 A;  2IA2 A;  3F6V A;  2ZME B;  5CVJ A;  4B8X A;  1PNR A;  1J7K A;  2CV0 A;  5A2Q K;  2QBY A;  1N25 A;  2HEO A;  2HOE A;  1U5T C;  1TQM A;  2K4B A;  1QO0 D;  3O9X A;  4A5N A;  1NTC A;  2K02 A;  3FYA A;  3EET A;  2PIJ A;  1R5I D;  3OWQ A;  1VQP I;  4LIT A;  4MHG A;  4ZTF A;  3D5S C;  3NXH A;  4RS8 A;  3F8N A;  3OMT A;  2R7O A;  4BE2 A;  5L3F A;  3H35 A;  3M1C A;  4IVZ A;  4I99 C;  1LCD A;  4QTR A;  4E7K A;  4IHV A;  2E1C A;  3ZHI A;  1FIA A;  3HRS A;  4BJ5 C;  4EJU A;  5DTM A;  5DUK A;  1D0Z A;  3HRM A;  4CCO A;  1VQ6 I;  3MD2 A;  1FTT A;  2RKH A;  1GUU A;  1VQ7 I;  1DP7 P;  4JOM A;  2A07 F;  3OS0 A;  2BHY A;  4WWC A;  3D0S A;  3IRR A;  1Y0N A;  1RKT A;  1NK2 P;  2F4O B;  2QSF X;  3HTS B;  3BJO A;  1LVA A;  1F5T A;  2B9S A;  4M3G A;  1A6I A;  1WH6 A;  5H6Q A;  2DQL A;  2RN7 A;  4GO1 A;  4Z2Y A;  2HQN A;  3K69 A;  3OOU A;  2JSP A;  4LMY A;  3RDI A;  1JUM A;  3IRQ A;  2QSG X;  1KQ0 A;  4CUG A;  3K4M A;  3QYF A;  4MTE A;  5K5Q A;  2XGX A;  3CUO A;  3H0G J;  1YTY A;  5IYD J;  1R58 A;  5J8F A;  3S1M J;  1XCB A;  5KAF C;  1KGS A;  1U2W A;  3HYI A;  3EUK L;  1U8B A;  2R7Q A;  1G3T A;  3RPQ A;  1ERD A;  1UXC A;  1JWL A;  2XIG A;  3PSF A;  5JVG F;  3KZI C;  3PQJ A;  3KP7 A;  1ZQ3 P;  1QA6 A;  2WAD A;  3ZQQ A;  1BI1 A;  1UFM A;  4EKG A;  2LR8 A;  3GBG A;  1MMS A;  2ZKZ A;  3M7G A;  1TNS A;  1WJF A;  1B0N A;  4XLE A;  2STT A;  2VBX A;  5JFR A;  2HXI A;  1SVL A;  3ERM A;  1VQN I;  3R6S A;  2MQK A;  4Y4R A;  3E97 A;  4UVC A;  2EB7 A;  3LSJ A;  3JRE A;  3OQN A;  3G0T A;  4MNU A;  4RB1 A;  3EUS A;  1P7I A;  2JVH A;  3GME A;  1X2L A;  4RB3 C;  2GA1 A;  4I09 A;  2HDC A;  4MFD A;  4XSX F;  4HX7 A;  3SZT A;  2HTS A;  4XN0 A;  2KRF A;  2VPR A;  1WGX A;  1ETO A;  1DUL A;  1OFC X;  3ZQL A;  4E7J A;  1LLI A;  2WB1 N;  1OYI A;  2KJB A;  2GXG A;  2QWW A;  4NHJ A;  5F08 A;  3DBR B;  3BRO A;  2CU7 A;  2HQR A;  1Z67 A;  2HOA A;  3W6K B;  3S2H J;  1XGM A;  3V7R A;  3LMM A;  4HX8 A;  4B3X A;  1KU2 A;  4XOR A;  2DJN A;  3SXY A;  5FFX A;  1P92 A;  2COB A;  1K61 A;  2E60 A;  4X4E A;  5CJ9 A;  2E7W A;  3FF5 A;  2KIS A;  2ELK A;  3QOP A;  4U7D A;  4OB4 A;  3IAS 2;  4WX9 A;  2KPJ A;  2VJI A;  3HJE A;  3A01 A;  4ENJ A;  3LFP A;  2FA5 A;  2M45 A;  3QU3 A;  1TLH B;  4XLA A;  5D8K B;  3A0B C;  4IRG A;  2MLG A;  5DEQ A;  2MC4 A;  1PUF A;  4ZDL A;  5F64 A;  2Y48 A;  2DA7 A;  5K1Y A;  2R7X A;  1DU6 A;  1A31 A;  3PQK A;  3JCU C;  2NVT J;  3ZMZ A;  4UB8 C;  4BEH A;  5DDG A;  3DF8 A;  1RUN A;  2AXU A;  1OSL A;  2DFH A;  2HYJ A;  3NAR A;  5D6E A;  3S3O A;  4PZJ A;  2KFD A;  3J7Y J;  4OOI A;  4X4I A;  4E7L A;  2ZC2 A;  2A6T A;  3DLA A;  4Q47 A;  5DM6 F;  1TBX A;  2YU9 J;  1QQB A;  4DYR A;  2VKV A;  5EDN A;  1VTN C;  5GPA A;  1ZLJ A;  2IXS A;  3SDG A;  5EZH A;  1RI7 A;  1TWF J;  1D1A A;  3SJM A;  4N0B A;  1Y0U A;  2OA4 A;  2V1X A;  1T0F A;  2PMZ A;  5CVI A;  4F93 B;  2L1P A;  1WJC A;  3ECO A;  1IV8 A;  4ESB A;  4OIQ F;  2FE3 A;  1D1B A;  2CMP A;  2L5Q A;  3S8P A;  1Z21 A;  3JTG A;  4Z59 A;  2KEJ A;  4Y13 A;  3CJN A;  1XGN A;  3WE3 A;  1NG7 A;  4AIH A;  2AHQ A;  4XR6 A;  4YFX F;  1YW7 A;  1FBS A;  1D0Y A;  4BBR J;  2IA1 A;  5F1J A;  1YLF A;  5FRO A;  1EF4 A;  3PFI A;  2LK2 A;  3I5U A;  4HF0 A;  3TEL A;  2AQF A;  3HUG B;  2CW0 F;  2WAQ N;  3KEO A;  2L9R A;  1QB2 A;  5KVR A;  3SZP A;  3TP0 A;  1ZRC A;  1FMV A;  1G3S A;  2FJ1 A;  4EM0 B;  3V8J A;  3R4K A;  3D5R C;  3GWZ A;  1F4K A;  2GM4 A;  1FTZ A;  3GTQ J;  2PXT A;  2IS2 A;  1F9N A;  3IP4 B;  1JHF A;  2OPT A;  3ZCO A;  3GZD C;  4XKW A;  2MBF A;  1N78 A;  3DNV B;  3ZGK A;  2K9S A;  3SDB A;  2BJC A;  1TT5 B;  3TO7 A;  2DK5 A;  1Q1H A;  1V4R A;  1YRN B;  3TRB A;  4A3D J;  3FKJ A;  3CUQ A;  1OYY A;  4ZH4 F;  3DU5 A;  3KIO A;  3LSH A;  2PJR A;  3LQQ A;  2GQQ A;  2VBY A;  2A69 F;  2JA7 J;  1JFS A;  2IJL A;  3HBL A;  3W2A A;  5LLQ A;  5FRN A;  2O3F A;  2K5C A;  3E5U A;  2E34 A;  1C0W A;  1HOM A;  1MH4 A;  2WBM A;  1VQM I;  2LNB A;  2LBF B;  3S93 A;  4HLX A;  3I59 A;  4A5M A;  5EJC A;  1U6G A;  2A6E F;  3IV5 A;  3QU6 A;  1YSE A;  1SD5 A;  4G6T B;  3S1R J;  2DPD A;  2MEZ A;  1XWR A;  4RGS A;  2PG4 A;  1ZHF A;  4YBA A;  3FXK A;  3NWT A;  3JRA A;  4QIW N;  2JUC A;  4RAZ A;  4KDP A;  2PX9 A;  3FM3 A;  1YX3 A;  5EGO B;  3QYB A;  4D1Q A;  1QBJ A;  3ISP A;  3I64 A;  2ODR D;  2KRH A;  2MH9 A;  4M3B A;  2MXD A;  4HYE A;  1FYM A;  5LFA A;  3KXA A;  1X2M A;  4KA4 A;  2O0Y A;  2H8R A;  2V9P A;  4I6Z A;  2JTV A;  3CD6 I;  3VYR B;  4GHJ A;  2BW3 B;  1RUO A;  5C4X J;  3I4M J;  1TWA J;  3TMO A;  3QPH A;  2MLK A;  5K5R A;  3HOV J;  3QYX A;  2QM3 A;  5DYM A;  4A3M J;  3G1M A;  5ERI A;  2W85 A;  4XNF A;  3R61 A;  4HNV A;  3G7D A;  1R7J A;  1W36 C;  2CGP A;  1YW8 A;  3OS2 A;  3F3X A;  1KZH A;  2MD0 A;  2OCE A;  2XRO A;  2BY0 A;  2QYO A;  3WTW C;  4EAT A;  3EPZ A;  3OYL A;  1BI2 A;  1SMT A;  2O03 A;  3CEC A;  1PUE E;  4BNC A;  3GTJ J;  2WUS R;  5E3L A;  4C3H J;  2IW5 A;  3RQI A;  3JRG A;  2XSD C;  4AIJ A;  4F92 B;  2XAU A;  2V9K A;  1IW7 F;  3GN5 B;  4HNU A;  4GRI A;  1SFK A;  2ISZ A;  2HPM A;  5IOZ A;  1PER L;  1HCR A;  3P9K A;  4G6D A;  2W25 A;  2HKX A;  3E7L A;  1G3Y A;  4YRV A;  3PIO F;  3WGG A;  2CV2 A;  5HS9 A;  4FE4 A;  5DUI A;  1MMD A;  1X1A A;  2OR1 L;  2DPU A;  1WJA A;  4EGY A;  2E1O A;  2HGC A;  2GXB A;  1W7P D;  5FKN A;  2R3S A;  3OYF A;  1A36 A;  2M1B A;  3FXO A;  2F5C A;  2GIV A;  4GYG A;  4OU0 A;  4PCQ A;  4DBR A;  3ZMV A;  1EJ9 A;  2X6O A;  4RB2 C;  4S04 A;  1NHA A;  1USS A;  4WF2 A;  2W24 A;  3SQN A;  4F3Q A;  4MCT A;  2QA4 I;  3F72 A;  1HLV A;  2O49 A;  1TWG J;  1ZG1 A;  4RAY A;  2XAH A;  4CO8 A;  2HZT A;  2V3C C;  1MNE A;  4KT5 C;  1V5G A;  2CQN A;  1WJD A;  2HOS A;  3GTO J;  4EM2 A;  3CDH A;  3WOD F;  2Z16 A;  4O3M A;  3CLC A;  3QQA A;  1TZL A;  5F0F A;  4B4C A;  1UTX A;  2V1N A;  2PXL A;  3CCY A;  4HOB A;  3GXO A;  2MD5 A;  4M3D A;  2FSW A;  4BXX J;  2FBI A;  5KHD A;  1J9I A;  3GN5 A;  4HRA A;  3TKY A;  3L00 A;  2V6C A;  5L3G A;  1ZGA A;  2HQ5 A;  3DU6 A;  3PNV A;  1RRJ A;  2DA2 A;  2VOD A;  2YX4 A;  3ECH A;  2IA0 A;  2CFX A;  3WU2 C;  3M3Y J;  3ELK A;  1O4X A;  1LE8 A;  4IL6 C;  2OAZ A;  3BS3 A;  3W6J B;  3A9Z A;  1JXS A;  1O3Q A;  4L9V A;  3LA2 A;  4OIO F;  3O8G A;  1MIJ A;  4YII A;  2LYR A;  3H9G A;  3JRD A;  3G6E I;  1QHH D;  4IA8 A;  1XGS A;  2CH0 A;  3Q0W A;  3PL8 A;  4RAF A;  3GBF A;  1SEU A;  2QQ8 A;  3IC7 A;  4MGR A;  2DTZ A;  3FHN A;  2OQG A;  5EEH A;  2Y75 A;  2LTP A;  3LQR A;  5L3B A;  2K9N A;  4B09 A;  4NDW A;  1Z0X A;  2EIL H;  2DFI A;  2DMU A;  2K86 A;  5K98 B;  1OCP A;  2JPB A;  3ZRG A;  4BBS J;  2QUF A;  3FZV A;  5EG0 B;  3J7A Y;  3ONQ A;  1LFB A;  5E1X A;  1AHD P;  1HBX G;  2VKH A;  2CS3 A;  4IF4 A;  4C2T A;  1IV6 A;  2RVC A;  4PJJ A;  1PRV A;  3E6B A;  1PJR A;  2ZNZ A;  1LDD A;  4KIG A;  1XMK A;  4RB0 A;  1XPX A;  1S72 I;  1W1W E;  2V6E A;  5BOX A;  3CUQ B;  2VXZ A;  4BDY A;  4ESJ A;  2DFE A;  3H0D A;  1XMX A;  1MDM B;  1J59 A;  4IPA A;  5J4V A;  2WAQ A;  2RNJ A;  4M6X A;  3CCL I;  5F0H A;  2EIJ H;  4IOA F;  1MH3 A;  3J81 Z;  1HKS A;  1MKM A;  2M34 A;  2ZXJ A;  1FJL A;  4NB5 A;  3F9K A;  2W4S A;  5EZG A;  3R0A A;  3ABT A;  3O8H A;  4P9F A;  2XAS A;  1MJA A;  5D8L B;  4DNC A;  5M5Y J;  2P5L C;  2EV6 A;  1ZTR A;  2HVR A;  3H3V K;  3PO2 J;  2BY3 A;  2DOD A;  4YAR A;  1GHC A;  4FBI A;  1BDH A;  3RJP A;  1DP3 A;  1QRY A;  1B8I B;  5DCM A;  3BWG A;  2H6B A;  4GQM A;  2F4I A;  3K6G A;  1JGG A;  3D5L A;  2GXA A;  3JRB A;  3TW7 A;  3TFL A;  3Q3S A;  3U1K A;  4Q4Z F;  4I7H A;  3CP8 A;  2EIK H;  2VBZ A;  1Y56 A;  1FPQ A;  1CQT A;  1V55 H;  1ON1 A;  4DIQ A;  1OIS A;  2ISY A;  2Y0S A;  5CQE A;  3K70 D;  3ZR8 X;  1OR7 C;  2DDB A;  5FD6 A;  1MBF A;  2E19 A;  3ZXS A;  1UXD A;  2IS6 A;  2IVG A;  4A0X A;  1R9T J;  3K0L A;  2J5P A;  1IXC A;  2R5Z B;  1G4D A;  4A69 C;  1FNN A;  4G7Z F;  3MZ8 A;  1MBE A;  4FX0 A;  4PU4 C;  2HPI A;  1L3L A;  3BR1 A;  1VPW A;  5FLX K;  3MN2 A;  1BR4 A;  1ZRF A;  2L54 A;  4EGZ A;  2XGC A;  4O5V A;  4E7Z A;  2OUM A;  3F23 A;  1K7A A;  1TT0 A;  4D5C A;  3E1S A;  3CJQ B;  2DA3 A;  4CDG A;  2LD5 A;  5TIS C;  2DOE A;  2F5E A;  4IRI A;  5IP9 J;  1MJ9 A;  3OKZ A;  3RTR A;  2MH2 A;  4NC8 A;  4W97 A;  2ELJ A;  4G9Y A;  3N4M A;  2W1O A;  1ZRD A;  3L2R A;  1KYW A;  2HFH A;  1D8K A;  1YS6 A;  3CES A;  4M9Z A;  1NW3 A;  1X57 A;  1ZZB A;  4RLF A;  4KMU X;  1B9N A;  2L3D A;  5A2Q Z;  1D5V A;  5IOY A;  4HV5 A;  3M4O J;  3K70 C;  2QZ8 A;  3N05 A;  2K4J A;  2HS5 A;  3ABL H;  2YPR A;  4N4O B;  3A9X A;  1MZB A;  4C2U A;  1UG2 A;  2LG4 A;  1B1B A;  3NZL A;  4L0Y B;  2M3A A;  4AVZ A;  4B1R A;  5B3S H;  3AG1 H;  3K7A J;  2W7N A;  5LEJ A;  1LEB A;  4ZDP A;  3U9G A;  4I6R A;  4X4F A;  5GAH i;  1QP0 A;  2ICW G;  4QSH A;  3DBH B;  2LOO A;  4YIF A;  5CYV A;  4ENK A;  3QPS A;  4Y15 A;  4XLC A;  2IVM A;  1LVK A;  2X4H A;  3BCA A;  1APL C;  1BL0 A;  2PXQ A;  4G7O F;  4WK8 F;  4BHP A;  1S7O A;  1JKP C;  4A6E A;  1X1D A;  1V54 H;  2PXF A;  1GDT A;  1ETY A;  4OMZ A;  4EJV A;  4ESF A;  3CC2 I;  2XI8 A;  4KIF A;  2LLK A;  5JUW A;  2FML A;  1IF1 A;  3BTC A;  3I0T A;  4Z5D A;  4FT8 A;  3SHF A;  3BT9 A;  5HLT A;  3LFU A;  2LDU A;  5EEG A;  2ZME A;  5F0C A;  5HDN A;  1K78 A;  3DM5 A;  2KPM A;  1ZK8 A;  2R7Z J;  1WH5 A;  2FNA A;  3JSP A;  1ZZ8 A;  4IHS A;  4MTD A;  4CZC A;  2PUE A;  2LY2 A;  3EDP A;  3T8R A;  1FYK A;  3WTU C;  1QPM A;  4IXA A;  1B59 A;  2G7H A;  3FMQ A;  3CCS I;  3S15 J;  2PI0 A;  1W5S A;  2ZSH B;  1HC8 A;  3M1E A;  4FAS D;  3LAP A;  1ETQ A;  2KL4 A;  2HR3 A;  1LFP A;  2GRM A;  3AL0 C;  1QZY A;  4RM3 A;  3K4C A;  3L2V A;  1H9G A;  2XAG A;  2IUO A;  2DCE A;  1PRU A;  1IN4 A;  3E0J B;  3CC7 I;  3WU0 A;  1JJ8 C;  3GTK J;  1OCR H;  2Y2Z A;  1H89 C;  1G6N A;  2HYG D;  5GTH C;  3ZQC A;  4ABZ A;  2K9Q A;  3GUD A;  3QQ6 A;  1ZVV A;  1EA3 A;  5JLW A;  2MC3 A;  4FHT A;  3DQV C;  5C4J J;  3RYP A;  1EH8 A;  4ER0 A;  2LYC A;  3SFZ A;  3S1N J;  2JRT A;  1U9O A;  2P8T A;  3LA3 A;  2HDW A;  4JQD A;  1Z7U A;  5LRR A;  2CV1 A;  1UAA A;  2LBF A;  4HQE A;  1WI9 A;  3ZPX A;  3AL0 B;  1R5H A;  1ZKG A;  4IVN A;  2LKS A;  3FKI J;  1ZRE A;  3HGY A;  1ULY A;  2N8G A;  2BYV E;  3PIP F;  2E7X A;  3H5A A;  3RPU A;  4ER7 A;  1CF7 B;  2R7U A;  2ZJ2 A;  2X1E A;  5IP7 J;  4J19 A;  1LMB 3;  2D1V A;  1WQ2 A;  1R4M B;  2VAS A;  4LLG F;  1LDK B;  3WTZ A;  4HF1 A;  1RZR A;  3I53 A;  3BJA A;  5K7Z A;  4X4B A;  4WXD A;  4N9I A;  4ZYH A;  3R60 A;  1XG1 A;  4WXC A;  3CCM I;  4PJM A;  3JRF A;  2A5W A;  2E5Z A;  4BUP A;  3MQ0 A;  3F52 A;  3HSR A;  1ZGJ A;  2LH9 A;  1U8R A;  1V3F A;  2LY9 A;  5DT2 A;  4S0H B;  1FOY A;  1POG A;  3IH4 A;  3FM5 A;  5KK1 A;  5EYR A;  3V42 A;  3GUU A;  2HVQ A;  2ZFU A;  3HHH A;  3H36 A;  4RGU A;  1QPI A;  5FFZ A;  4AUX A;  2Q1Z B;  2JJ7 A;  1ETV A;  4BJ6 C;  4GGG A;  3SX0 A;  2DAO A;  4XLN F;  1WRJ A;  3A02 A;  1SAU A;  2KLO A;  1WI3 A;  4F52 A;  4BXF A;  1YYV A;  1I39 A;  3I55 I;  1JJ6 C;  2OTJ I;  2QEN A;  1DGW Y;  5M5W J;  3KYC B;  1Z6T A;  1FWZ A;  5DS9 A;  2NOG A;  2O8X A;  3BTJ A;  4L5E A;  5J4Y A;  2VEO A;  3S8Q A;  2EH3 A;  3KLO A;  2M0M A;  2HSG A;  2KIU A;  1JUS A;  2F2E A;  1OPC A;  3E3V A;  5HOD A;  3E6M A;  1W5C C;  1IJW C;  1BA5 A;  1T6S A;  4CCL A;  1JH9 A;  3HG9 A;  2E1M B;  4GYI A;  4ZTJ A;  3NRO A;  3Q0V A;  1PUF B;  4PFP A;  2YBD A;  3G2B A;  4Y42 A;  2A68 F;  2VL8 A;  2AXV A;  1SQ8 A;  3BG3 A;  3CUQ C;  2KZG A;  1TNT A;  1E2X A;  2PEX A;  5ILV A;  4NDL A;  1XMA A;  3IKT A;  2PJR B;  3HOW J;  4J01 A;  1J5Y A;  1R5G A;  2BXZ A;  5B1A H;  2KP6 A;  1Q1V A;  1RZS A;  1LNW A;  2BY2 A;  1A5J A;  3OYG A;  3BR2 A;  1XSD A;  1UST A;  2FQ3 A;  4HBL A;  2EBI A;  2UXX A;  3A0H C;  4IX7 A;  4XQF A;  3RKX A;  3B7H A;  2QGU A;  3JAM Z;  3M8J A;  1HKQ A;  4BHB A;  2DMN A;  5EG0 A;  3EQL F;  4D7M A;  1UZC A;  3M9A A;  1HDD C;  3LQX A;  2A5Y B;  5DRT A;  2JZY A;  2B7E A;  3BOQ A;  2PBI A;  4AVP A;  2ZBK A;  2MW8 A;  4MQ9 F;  2BVM A;  1TC3 C;  1SD4 A;  2IV1 A;  4A3I J;  3BTL A;  3DEU A;  2Y9Z A;  1LDJ A;  4MQV A;  2KIF A;  1YJN I;  2EFP A;  1S7A A;  5DTQ A;  3ZMD A;  2QLZ A;  2XDV A;  3J80 Z;  5DTD A;  3IL2 A;  1FLI A;  5H20 A;  2R7S A;  1FYL A;  2EFW A;  5M5X J;  1WPK A;  1AA7 A;  1X1P A;  2JWT A;  2WY7 Q;  2BNO A;  2PPX A;  2A05 A;  4HPQ A;  1QP4 A;  4IKF A;  4UVA A;  1LE8 B;  2Z2S B;  1FOX A;  2R7D A;  4C3I J;  4PSX A;  5B5E C;  4W1U A;  3GTP J;  3Q9S A;  1JT0 A;  1CJG A;  4ITV A;  4FN3 A;  2NS0 A;  4BL0 B;  2L2O A;  1REP C;  2F5V A;  3FIS A;  1E3O C;  4ZYG A;  2AS5 F;  2BBY A;  3SEQ A;  3OWT A;  4ENN A;  2XIU A;  3S3N A;  2XXP A;  1JTX A;  3GO5 A;  4UXN A;  2H6C A;  4KN4 X;  5TGT A;  3ROU A;  2JCG A;  2KEI A;  4XKC A;  2L9V A;  5TRD A;  1R1V A;  2NRA C;  2PLY A;  1X3W B;  3J7Z I;  3WGH A;  2AO9 A;  2CQ7 A;  1QQA A;  4X4H A;  2KEK A;  2BXY A;  3G4S I;  5L3E A;  3JW4 A;  1ZN2 A;  4PK4 A;  4E7H A;  3UNG C;  1XS9 A;  2PMH A;  2ZB9 A;  2LLW A;  2ZSI B;  3VYS B;  1R49 A;  2ECC A;  3VK0 A;  1SFE A;  2OBP A;  3L2C A;  4YEJ A;  1RET A;  4HF2 A;  3SCG A;  2NVQ J;  2XAF A;  1Z1D A;  2LY1 A;  4HV6 A;  4QLC U;  2Z33 A;  5M3M J;  2V26 A;  1TQI A;  1E3P A;  2D2W A;  2WTE A;  2XUB A;  4A0Z A;  5K7H A;  3SEZ A;  2ACJ A;  5E3O A;  1TWH J;  3H3U A;  1POU A;  4UUS A;  2L7M P;  4RBO A;  1SFO J;  3JXD L;  2EV5 A;  4HAM A;  2CQX A;  1HW5 A;  3KEY A;  5LRS A;  2DBB A;  3E6C C;  1VZ0 A;  2FXA A;  1N75 A;  3D1N I;  2OCC H;  1KU3 A;  5CVU A;  1UJ8 A;  1XSX A;  2ZJP F;  2VC0 A;  4F8D A;  1M1E B;  1ZAY A;  1TQP A;  2IGN A;  2LNM A;  5DSX A;  2NOJ B;  3KPH A;  2PE5 A;  2KDO A;  2OJE D;  4ENM A;  3DEE A;  4E4H A;  3BZ6 A;  3H92 A;  3LSP A;  1T38 A;  4LB5 A;  2EZL A;  2F6C A;  2M30 A;  4L18 B;  3K1N A;  1OR7 A;  1MMN A;  2COM A;  4M72 A;  4KFC A;  3OR1 C;  5DD4 A;  4CZZ A;  4Q5S F;  1Y7Y A;  4AD9 A;  1QGP A;  1FP1 D;  3JAM K;  1GV2 A;  1HA8 A;  4EJW A;  2K3F A;  2RC4 A;  5J3L A;  4HLY A;  2GIZ A;  3A03 A;  5FKK A;  3S16 J;  3RZO J;  1I6H J;  4F91 B;  3MVP A;  2PUB A;  4HG2 A;  3KP6 A;  2Q0O A;  2H27 A;  4JX5 A;  1IRZ A;  4P9U A;  4BS9 A;  1G3W A;  4YFN F;  3OSF A;  2HZD A;  4HST A;  4YEL A;  5J40 A;  3LST A;  3ZMS A;  2XC7 A;  3CCU I;  1FEX A;  3OYK A;  3GEZ A;  5E79 C;  3IAM 2;  4U0W A;  2KDZ A;  2GLO A;  5DD8 A;  2NVX J;  1QPZ A;  1Y8Q B;  1BM9 A;  4XID A;  3VFZ A;  3F8F A;  3QWL A;  4NC6 A;  1S6L A;  2PXP A;  1R1T A;  2L49 A;  1XDS A;  2QCO A;  1JKO C;  4CSW A;  4ZDO A;  4BE0 A;  1IN6 A;  1QZX A;  2ZXI A;  5ILU A;  3LAJ A;  1UHS A;  1H0M A;  1VQL I;  4LB6 B;  4EEF G;  2O7O A;  3EUH A;  3FXL A;  3KX2 A;  4BAC A;  3GZ5 A;  4EJO A;  3PSI A;  3HKZ N;  4M74 A;  3RIR A;  2IRF G;  1DWK A;  4I8T A;  1WFX A;  2XVC A;  3G1L A;  3OYH A;  4IHW A;  4ER3 A;  2GOM A;  1WVR A;  4XSZ F;  4X4D A;  4BQQ A;  4II3 A;  2YR2 A;  3PUF A;  5IP6 A;  2EBY A;  4DBQ A;  1LJ9 A;  4BQN A;  2E36 A;  3OQM A;  4ASN A;  2RNG A;  4OMY A;  3WU1 B;  3OIO A;  1J75 A;  2RAE A;  3BG5 A;  2VIX A;  3KP5 A;  1XB4 A;  1RC9 A;  3WTV C;  2Z5U A;  3KP2 A;  2JA6 J;  4ZYE A;  1BOB A;  4OBM A;  1FOK A;  3GLL A;  1K4S A;  3CCJ I;  1ZZ6 A;  3HRT A;  2BNN A;  4UUV A;  1BDI A;  4A93 J;  1ZZ7 A;  2JQ7 A;  4H4K C;  3QP6 A;  2JMW A;  4NUB A;  4CYC A;  4CXF A;  4ANJ A;  3AG4 H;  2XPW A;  1GVJ A;  1O57 A;  1NK3 P;  3AG3 H;  2H1K A;  2W84 A;  3ZN0 A;  2M7B A;  4Y52 J;  3MZY A;  3CF2 A;  3NRV A;  2WA0 A;  2YUS A;  3TP3 A;  4R79 A;  1IDZ A;  1UCR A;  2DYR H;  4M71 A;  4EKI A;  3VPR A;  2IP2 A;  2H94 A;  1ZG3 A;  5FD5 A;  2BNM A;  2Q8K A;  4F7Z A;  2DT7 B;  2VXD A;  2HFZ A;  2JRM A;  4D0P A;  3GVA A;  3UWP A;  5AIQ A;  5K7F A;  4KIB A;  2K40 A;  4DZP A;  4RGX A;  1B72 A;  4IRH A;  2BZT A;  4YFK F;  1NH3 A;  5H2F C;  2M0C A;  4PGG A;  2DYS H;  3VSK A;  3I71 A;  2LYS A;  4ER5 A;  4A12 A;  5IY5 H;  3WHC A;  1SAN A;  4BH9 A;  2Y69 H;  4O8B A;  3ASO H;  1ZG5 A;  2AXT C;  3PJR A;  1L1M A;  3JRH A;  3DPU A;  2NS8 A;  3I59 B;  1P7J A;  4NQW B;  2FQ4 A;  2DT6 A;  3KEQ A;  4UB6 C;  4Y33 A;  2LYL A;  2W82 A;  4BYY A;  1X1C A;  3DWL E;  2ZJR F;  5LD2 C;  3PXP A;  2VE8 A;  2BHZ A;  3BY6 A;  1PP8 F;  4Y7N J;  4M9X A;  2Z99 A;  4BE1 A;  2FRH A;  2P81 A;  3I4P A;  3OL4 A;  5CVR A;  2AW6 A;  2FBK A;  1RNL A;  3OYA A;  1O3T A;  3OL3 A;  3OY9 A;  4HDV A;  3S1Q J;  2L7F P;  4NQW A;  3V7S A;  3KYL A;  4PSW A;  1GT0 C;  4PU8 A;  2GBY A;  2WY8 Q;  3K4L A;  2XCJ A;  1XX5 A;  5LHG A;  4HEA 2;  5C44 J;  1RIO H;  1I6X A;  4B3A A;  2DMP A;  1K6O A;  4XOT A;  1DQU A;  3ZHM A;  3CZ6 A;  3CO6 C;  4GFB A;  2IT0 A;  3ML6 A;  3CCV I;  4X4G A;  4AYB N;  1ITY A;  3BQZ A;  2FU4 A;  5E8I A;  3EUA A;  2R92 J;  2V1D A;  6PAX A;  2IVB A;  2A61 A;  3HSE A;  4BDZ A;  4S05 A;  2E35 A;  5FLM J;  2L8N A;  4RGR A;  5IT9 Z;  1J2X A;  2RGV A;  3KL4 A;  3VDX A;  3MEJ A;  3FK7 A;  2VT2 A;  1ORK A;  3LOC A;  1R22 A;  5KNL A;  2J7U A;  1DUX C;  4A3F J;  4ETS A;  3HOS A;  2XGE A;  5J6X A;  4WCG A;  1YO5 C;  1OCT C;  3P7N A;  2RV8 A;  2LSO A;  1U78 A;  3GTM J;  3ZMU A;  5HLG A;  2D1H A;  1IGN A;  2CRO A;  1LB2 A;  2J7W A;  3SCH A;  4Z5C A;  2MSY A;  3HIF A;  5GPC A;  4JX6 A;  5DM7 F;  2P7C B;  2KHM A;  1KYZ A;  2MYS A;  1JKR C;  1KU7 A;  3GTG J;  1Y1W J;  3FIW A;  1X3U A;  3GZD A;  3LNQ A;  3VYU B;  4I02 A;  2EFO A;  2PUF A;  3OV8 A;  2L9N A;  4A0Y A;  3UFD A;  2VJ4 A;  4HSR A;  3HOT A;  3KZ3 A;  3Q0U A;  1YFH A;  3ZP5 A;  5LBQ A;  4LLN A;  2R5Z A;  3M9L A;  1SAX A;  2ZNY A;  4HW0 A;  5ICG A;  4TV7 A;  1Y8R B;  4DYQ A;  3L1P A;  1LEA A;  3BP8 A;  3LSR A;  1S29 A;  3CDI A;  3H1C A;  2GAU A;  2D5V A;  3PO3 J;  4AID A;  2V1U A;  2EIN H;  5DRY A;  5F04 A;  2EQR A;  2PJP A;  3HDD A;  3IHU A;  4P55 A;  4FQG A;  4BGD A;  1TW2 A;  1D5Y A;  4R8H A;  3T5X A;  3A2K A;  1A04 A;  2DN0 A;  5FJ8 J;  1X1B A;  4XN3 A;  1F1Z A;  1HSJ A;  1LKX A;  4XLP F;  2JN6 A;  4IWR A;  1ZR2 A;  1IN8 A;  2K27 A;  3QP5 A;  4I76 A;  2IU7 A;  3PUB A;  1B6A A;  3IH3 A;  3BDD A;  3K4J A;  4D9J A;  4KNY A;  1T95 A;  2X85 A;  4GCV A;  1HST A;  3CMA I;  1XC5 A;  3OIQ A;  4YG4 A;  3ABM H;  3F8M A;  5F1R A;  2XKP A;  3NAU A;  2K85 A;  5JI6 A;  2XB0 X;  4KMF A;  4AIK A;  5E1W A;  5GAG J;  4M6Y A;  2VLA A;  3FMS A;  1W4M A;  4A2U A;  1Z9C A;  2VKE A;  5DV5 A;  1BIB A;  3CQZ J;  1UHW A;  2Y30 A;  5L3D A;  1JUP A;  1XGO A;  3FHZ A;  3JTH A;  2VUM J;  3LWF A;  1FT9 A;  4KJZ A;  4B47 A;  5CVV A;  3QOW A;  3BQY A;  2KZ8 A;  2VQC A;  3TOB A;  3DFG A;  1KA8 A;  1N77 A;  2L01 A;  4CCN A;  1V5E A;  1BC8 C;  1I5Z A;  3W6V A;  4C30 A;  4YIR X;  2PUA A;  3S2D J;  5HS8 A;  2LYQ A;  3VWS A;  1K79 A;  3S17 J;  4BKX A;  2HNH A;  3M07 A;  1K78 B;  5GAD J;  3HEF A;  5KCM A;  3COA C;  2VJJ A;  5DCM B;  3H5N A;  1OJL A;  5J1Y A;  2LLV A;  1RPE L;  2TCT A;  1P4X A;  4Z5H A;  1YQA A;  3T1B A;  4CCJ A;  1HDP A;  3CF5 F;  3R0J A;  1BI3 A;  1HXD A;  4LGW A;  3KFW X;  1ADR A;  1P6R A;  3GFL A;  2DOF A;  3ZQF A;  2R0Q C;  2PXD A;  4KYW A;  3E5Q A;  1LCC A;  3E5X A;  1WIZ A;  2IS4 A;  2RDP A;  3CCR I;  3HOX J;  1IXR C;  5E1Z B;  4JP0 A;  4N9H A;  1T0F C;  4RLQ A;  2ADU A;  1QHG A;  4P96 A;  2X6Y A;  3FMR A;  3FYM A;  1YI2 I;  4IOC F;  2DW4 A;  3B73 A;  4V19 K;  1FC3 A;  5HVQ C;  1YOV B;  3OMY A;  4N4N B;  2TRT A;  5HDG A;  5DCF A;  2Y9Y A;  1FY7 A;  2ICP A;  2KQR A;  2XRL A;  2DA5 A;  4DYC A;  2E2H J;  2JSC A;  2AWI A;  3WTY C;  3BR0 A;  2P4W A;  1AWC A;  5IYB J;  3SCF A;  5M3F J;  2ESN A;  1E17 A;  5IT9 K;  4JCY A;  1GV5 A;  4PU7 A;  2IAI A;  2KZV A;  4XBF A;  2BGC A;  2CUE A;  3WTS C;  4GXO A;  1WKM A;  1RIO A;  2JA2 A;  2PXU A;  1ZLK A;  5B1B H;  1FP2 A;  3CDL A;  3L7W A;  3K1M A;  3MKZ A;  2Y0M A;  4E7I A;  4UV9 A;  1H8A C;  1AKH B;  4UY8 I;  4ON0 A;  3F6W A;  3H9J A;  3BC8 A;  1XSV A;  4BY7 J;  2V9V A;  2R7V A;  2ICT A;  5ICC A;  2P5K A;  1DDN A;  4OAY A;  2A3S A;  4FTH A;  2R7T A;  2XF6 A;  3TGN A;  1T8I A; 
#chains in the Genus database with same CATH homology
 1W0T A;  3HOV J;  3FIS A;  1E3O C;  3MLF A;  3OP9 A;  3QYX A;  1LFU P;  4A3M J;  1MBH A;  5FKO A;  2XIU A;  4I6U A;  1MSF C;  2PUC A;  3G1M A;  4G12 A;  1Y1V J;  2EWT A;  4HNV A;  4C3J J;  2R93 J;  3G7D A;  2L7Z A;  1JTX A;  4AC0 A;  1AU7 A;  2KEI A;  2JCG A;  1WET A;  2E2J J;  3R1F A;  4X4C A;  3OQO A;  1B8I A;  2MGQ A;  3CEC A;  2NVY J;  2AO9 A;  4FIS A;  3GTJ J;  2EZK A;  1BW5 A;  4X4H A;  2WUS R;  1QQA A;  1RKW A;  5E3L A;  4C3H J;  1W0U A;  3RQI A;  3JRG A;  2I10 A;  2XSD C;  2KEK A;  3UKG A;  2LCV A;  2O4A A;  1XS9 A;  2WV1 A;  2ZB9 A;  3GN5 B;  3VK0 A;  2ECC A;  1U9N A;  1PER L;  5IOZ A;  1HCR A;  3ZQG A;  1RET A;  3OSG A;  3PM1 A;  3E7L A;  3SCG A;  2NVQ J;  4FE4 A;  2JA5 J;  2OR1 L;  2E1O A;  3QWG A;  1RZR D;  5FKN A;  1R69 A;  4UUS B;  4M6V A;  5JLX A;  5M3M J;  2OF7 A;  2X6O A;  2KT0 A;  2JVL A;  5K7H A;  2G0E A;  2R5Y A;  2ID6 A;  5E3O A;  1TWH J;  5IPA A;  4MCT A;  1HLV A;  3BG9 A;  1TWG J;  1POU A;  2O49 A;  4UUS A;  2L7M P;  1FIP A;  4RBO A;  1YRN A;  1SFO J;  1ZPQ A;  4X1E A;  2CQX A;  4A3B J;  2HOS A;  3GTO J;  3CLC A;  3QQA A;  5F0F A;  3D1N I;  4B4C A;  1UTX A;  3IVP A;  2GRL A;  1RPW A;  3CCY A;  3GN5 A;  4M3D A;  4BXX J;  4F8D A;  4YG7 B;  4BY1 J;  1ZAY A;  4XK4 A;  2HXO A;  4XRM A;  2PE5 A;  2HQ5 A;  1WCM J;  2E2I J;  2DA2 A;  1WH7 A;  3LSP A;  3RKQ A;  2MG4 A;  3M3Y J;  1O4X A;  2EZL A;  1LE8 A;  3BS3 A;  3KJX A;  3JRC A;  1ZGW A;  3IH2 A;  4C2M J;  2LYP A;  1VND A;  1MBG A;  3BR3 A;  3O8G A;  1H88 C;  1Y7Y A;  2LYR A;  1AKH A;  1GV2 A;  2ME0 A;  3JRD A;  2LYJ A;  4IA8 A;  3JXC L;  5FLV A;  3S16 J;  5J3L A;  3RZO J;  3Q0W A;  3A03 A;  5FKK A;  1DW9 A;  1I6H J;  4DW6 A;  3MVP A;  2PUB A;  3G1O A;  3ZQH A;  4JX5 A;  1IRZ A;  3GBF A;  5GP9 A;  4UUT A;  5EF6 A;  1S7E A;  4PU3 C;  2DA6 A;  3OSF A;  2DTZ A;  2PMZ N;  5E3M A;  1IC8 A;  2LTP A;  4MLO A;  2K9N A;  1FEX A;  1UMQ A;  5J1U A;  4NDW A;  1Z0X A;  3RZD J;  4CYC B;  2DMU A;  2KDZ A;  2GLO A;  5K98 B;  2NVX J;  1OCP A;  2Y31 A;  4BBS J;  1QPZ A;  5EG0 B;  3FK6 A;  4XID A;  2XPV A;  3MKL A;  1TWC J;  1AHD P;  1LFB A;  2L49 A;  1T56 A;  2QCO A;  1JKO C;  4MO7 A;  2AUW A;  1Y9Q A;  1IV6 A;  4IHY A;  1QVT A;  1PRV A;  1GVD A;  2PUG A;  1UHS A;  2HOT A;  4EEF G;  2O7O A;  3G5G A;  1JFT A;  1JKQ C;  2EF8 A;  2WIU B;  3SFI A;  3HKZ N;  1WH8 A;  2HIN A;  1DWK A;  4I8T A;  5F0H A;  3G1L A;  1X2N A;  4IHW A;  1MH3 A;  2M34 A;  1FJL A;  5EZG A;  1MSE C;  3A01 B;  1R63 A;  4X4D A;  3O8H A;  3RZZ A;  2XPU A;  5IP6 A;  2CRG A;  5M5Y J;  3H3V K;  4M3F A;  1ZTR A;  2HDD A;  2FD5 A;  3PO2 J;  2EBY A;  2DMT A;  3OQM A;  4YAR A;  5FKM A;  4FBI A;  1BDH A;  1RES A;  2ID3 A;  3OIO A;  1QRY A;  2RAE A;  1B8I B;  2CJJ A;  3BG5 A;  2NS7 A;  4RDU A;  4GQM A;  4JX4 A;  2JA6 J;  4XIC A;  1JGG A;  2X9D A;  3JRB A;  3TW7 A;  2M2E A;  3Q3S A;  2XB5 A;  1T33 A;  4LOC A;  1CQT A;  1VI0 A;  2JK3 A;  1NER A;  1ZZ6 A;  1MBF A;  2E19 A;  1UXD A;  1ZUG A;  2QF7 A;  2LFB A;  2BNN A;  2IVG A;  1BDI A;  4A93 J;  1R9T J;  1ZZ7 A;  2OFY A;  4CYC A;  2R5Z B;  2JMW A;  2O8K A;  4A69 C;  2XPW A;  1MBE A;  5IYC J;  1NK3 P;  3FMY A;  4PU4 C;  1VPW A;  3BR1 A;  2H1K A;  5F27 A;  3HOZ J;  2W48 A;  3MN2 A;  3B6A A;  4Y52 J;  1MBK A;  1VFC A;  2XGC A;  1DU0 A;  3DCF A;  2YUS A;  4D5C A;  3F51 A;  3TP3 A;  2DA3 A;  2LD5 A;  3C2B A;  1I50 J;  3HM5 A;  1BJZ A;  4A3K J;  1IDZ A;  2YS9 A;  5IP9 J;  3VPR A;  2PUD A;  2X48 A;  3CRO L;  4A3G J;  3ZQI A;  2BNM A;  4W97 A;  3HOU J;  1G2H A;  1F43 A;  1ZZ9 A;  1ETK A;  1PNR A;  4XRS A;  5K7F A;  1B72 A;  2K40 A;  4DZP A;  1X57 A;  1ZZB A;  4I6T A;  1ZR4 A;  2M0C A;  5EGO A;  4FCY A;  2FX0 A;  2IEK A;  5IOY A;  5C3E J;  3DEW A;  3M4O J;  3O9X A;  2LYS A;  1NTC A;  3WHC A;  1MBJ A;  1SAN A;  3FYA A;  2PIJ A;  4O8B A;  1UG2 A;  1MNM C;  1L1M A;  3JRH A;  3OMT A;  2NS8 A;  1P7J A;  2FQ4 A;  4B1R A;  3K7A J;  2LYL A;  4I6R A;  3PXP A;  4IVZ A;  4X4F A;  3K2A A;  3TED A;  1QP0 A;  4QSH A;  1LCD A;  4Y7N J;  4A3J J;  2P81 A;  4QTR A;  4IHV A;  2AW6 A;  3QPS A;  3ZHI A;  1FIA A;  3S1Q J;  2L7F P;  1APL C;  1BL0 A;  1JKP C;  1GT0 C;  4PU8 A;  2GBY A;  3QPL A;  2EZI A;  1FTT A;  1GUU A;  2XCJ A;  1GDT A;  1ETY A;  3LIS A;  5C44 J;  2XI8 A;  1ETW A;  3BDN A;  4B3A A;  2DMP A;  2LLK A;  4Z5D A;  3BTC A;  3ZHM A;  3GTL J;  1RKT A;  3BT9 A;  1NK2 P;  4GFB A;  1B72 B;  4X4G A;  4AYB N;  1ITY A;  4J1X A;  3BQZ A;  5F0C A;  1WH6 A;  4M3G A;  1A6I A;  1ZK8 A;  2CUF A;  2R92 J;  2R7Z J;  4JCX A;  3B6C A;  1WH5 A;  4A3E J;  1ZZ8 A;  2IVB A;  1EFA A;  3OOU A;  5FLM J;  1JUM A;  2L8N A;  2PUE A;  3QF3 A;  3FK7 A;  4IHX A;  3H0G J;  5IYD J;  1ORK A;  1PRA A;  3LOC A;  3S1M J;  3S15 J;  4A3F J;  2XGE A;  1OCT C;  1ETQ A;  1U78 A;  1U8B A;  2GRM A;  3GTM J;  2GZU A;  1I3Q J;  3BD1 A;  1UXC A;  1IGN A;  2CRO A;  3SCH A;  3JXB C;  2IUO A;  4Z5C A;  2MSY A;  1JWL A;  1PRU A;  5GPC A;  3S14 J;  4JX6 A;  3BR5 A;  2O9L A;  1ZQ3 P;  3CMY A;  4MCX A;  2EZH A;  1JJ8 C;  3GTK J;  1JKR C;  2Y2Z A;  1H89 C;  3GTG J;  1X58 A;  1Z77 A;  1ZZC A;  1Y1W J;  2LR8 A;  3GBG A;  3FIW A;  3ZQC A;  4ABZ A;  3LNQ A;  2K9Q A;  2M9H A;  3QQ6 A;  1ZVV A;  3F0C A;  3TW6 A;  1B0N A;  3BTI A;  2PUF A;  5JLW A;  5C4J J;  2HXI A;  3UFD A;  3S1N J;  2MQK A;  3KZ3 A;  1U9O A;  3Q0U A;  4YG1 A;  3LSJ A;  3JRE A;  3U3W A;  4MIM A;  3OQN A;  4JQD A;  2R5Z A;  3EUS A;  1P7I A;  1X2L A;  3HOY J;  4MFD A;  4DYQ A;  3L1P A;  2VPR A;  3LSR A;  1WGX A;  1ETO A;  1ZKG A;  2D5V A;  1OFC X;  3PO3 J;  3HZI B;  2DA1 A;  3ZQL A;  4J1W A;  1LLI A;  2WB1 N;  4D7N A;  2R5Y B;  3FKI J;  2EQR A;  1JT6 A;  5F08 A;  5F04 A;  3HGY A;  3LSG A;  2CU7 A;  1ETX A;  2N8G A;  2HOA A;  3S2H J;  3HDD A;  2IBD A;  2R1J L;  2DJN A;  1D5Y A;  2JA8 J;  2COB A;  2DN0 A;  1K61 A;  2B5A A;  5FJ8 J;  4X4E A;  2IVQ A;  5IP7 J;  2ELK A;  4OB4 A;  4J19 A;  2AXZ A;  1LMB 3;  2KPJ A;  3A01 A;  3LFP A;  4V2F A;  2JN6 A;  3H5T A;  4IWR A;  2VI6 A;  1ZR2 A;  1RZR A;  1PUF A;  1DU6 A;  4I76 A;  2DA7 A;  4IEJ A;  3ZOB A;  5K7Z A;  2IU7 A;  4X4B A;  3IH3 A;  2NVT J;  2AXU A;  1OSL A;  2HYJ A;  3ZKC A;  1XG1 A;  3NAR A;  1XC5 A;  5FKL A;  2DMQ A;  4X4I A;  4YG4 A;  3JRI A;  3JRF A;  3NAU A;  2XB0 X;  4X6A J;  4JYK A;  5E3N A;  1K83 J;  3F52 A;  2YU9 J;  2FJR A;  1QQB A;  2LY9 A;  4DYR A;  2VKV A;  4S0H B;  5EDN A;  1POG A;  3IH4 A;  5GPA A;  1JTY A;  5EYR A;  1HF0 A;  3SDG A;  5EZH A;  2Y0S N;  2VKE A;  1TWF J;  1QPI A;  3SJM A;  3CQZ J;  3HB9 A;  4AUX A;  4D5F A;  2JJ7 A;  2Y30 A;  3BR6 A;  1JUP A;  2LKX A;  1QP7 A;  1ETV A;  2VUM J;  4XRS G;  3A02 A;  1WI3 A;  2HI3 A;  4FE7 A;  3BQY A;  1IG7 A;  2KZ8 A;  4Z59 A;  2KEJ A;  4M3E A;  2AHQ A;  1JJ6 C;  4BBR J;  5M5W J;  5DS9 A;  3W6V A;  2NOG A;  1IUF A;  3BTJ A;  4L5E A;  2PUA A;  1ENH A;  2EH3 A;  3S2D J;  2LYQ A;  2CQQ A;  5F1J A;  3S8Q A;  4A3L J;  1EF4 A;  2HSG A;  1JUS A;  2LK2 A;  4BKX A;  3S17 J;  3HEF A;  5HOD A;  2WAQ N;  9ANT A;  1OJL A;  2L9R A;  5J1Y A;  1RPE L;  3TP0 A;  1IJW C;  2TCT A;  4A3C J;  1BA5 A;  2O38 A;  2FJ1 A;  1JH9 A;  2LP0 A;  4Z5H A;  2XGD A;  1HDP A;  3Q0V A;  4MFE A;  1PUF B;  1ZS4 A;  2GM4 A;  1FTZ A;  1BW6 A;  4Y42 A;  3GTQ J;  1ADR A;  5EEA A;  2AXV A;  1SQ8 A;  2R0Q C;  3ZQF A;  2OPT A;  1F36 A;  3BG3 A;  1LCC A;  3DNV B;  1WIZ A;  4NDL A;  2K9S A;  2LVS A;  3HOW J;  3I4N J;  2BJC A;  3HOX J;  4JP0 A;  1Q1V A;  1RZS A;  1YRN B;  1RR7 A;  3TRB A;  4A3D J;  1A5J A;  5BNG A;  3FYM A;  3BR2 A;  2A6C A;  1QVU A;  2EBI A;  2JA7 J;  4V2G A;  2TRT A;  1JFS A;  3B7H A;  2Y9Y A;  2ICP A;  3HBL A;  2XRL A;  2DA5 A;  4DYC A;  2DMN A;  5EG0 A;  2E2H J;  4D7M A;  2AWI A;  2ME6 A;  1HDD C;  1HOM A;  2DA4 A;  3BR0 A;  1MH4 A;  1NEQ A;  5IYB J;  3JR9 A;  3SCF A;  5M3F J;  3IV5 A;  1YSE A;  2MEZ A;  3S1R J;  1GV5 A;  4JCY A;  1XWR A;  2ECB A;  2MW8 A;  4PU7 A;  1TC3 C;  2IAI A;  4YBA A;  2IV1 A;  4A3I J;  3JRA A;  3BTL A;  4QIW N;  1VF9 A;  2CUE A;  5A7L A;  2Y9Z A;  1RIO A;  3HGG A;  4Z58 A;  2R63 A;  5EGO B;  1LQC A;  3CDL A;  5J1R A;  5DTD A;  1H8A C;  3F6W A;  1AKH B;  2LYK A;  5M5X J;  4M3B A;  1WPK A;  2L0K A;  2BNO A;  2JWT A;  2XJ3 A;  2M8G X;  2PPX A;  3KXA A;  4BY7 J;  1X2M A;  2CSF A;  2H8R A;  2ICT A;  1QP4 A;  1IDY A;  3WHB A;  4I6Z A;  1LE8 B;  2B63 J;  4GHJ A;  4C3I J;  4W1U A;  5C4X J;  4FTH A;  3GTP J;  1JT0 A;  3I4M J;  1TWA J;  4DZJ A;  4FN3 A;  1CJG A;  3JXD L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...