2AXUA

Structure of prgx
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
305
structure length
303
Chain Sequence
MFKIGSVLKQIRQELNYHQIDLYSGIMSKSVYIKVEADSRPISVEELSKFSERLGVNFFEILNRAGMNSVNETGKEKLLISKIFTNPDLFDKNFQRIEPKRLTSLQYFSIYLGYISIAHHYNIEVPTFNKTITSDLKHLYDKRTTFFGIDYEIVSNLLNVLPYEEVSSIIKPMYPIVDSFGKDYDLTIQTVLKNALTISIMNRNLKEAQYYINQFEHLKTIKNISINGYYDLEINYLKQIYQFLTDKNIDSYLNAVNIINIFKIIGKEDIHRSLVEELTKISAKEKFTPPKEVTMYYENYVAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of peptide sex pheromone receptor PrgX and PrgX/pheromone complexes and regulation of conjugation in Enterococcus faecalis.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Transcription
molecule keywords PrgX
total genus 111
structure length 303
sequence length 305
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2005-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2axuA01
1.25.40.400 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2axuA02
3U3WA 3HZIB 4JCYA 3KZ3A 4F8DA 1POUA 1ZZBA 2HSGA 2CSFA 1E3OC 1HF0A 3KJXA 3F51A 1NERA 4Z5DA 2MEZA 1RPEL 2AXVA 2AWIA 2XJ3A 1X57A 4OB4A 3OQMA 1ZZCA 1LCDA 1ZZ9A 4Z58A 1EFAA 4Z5CA 3OQNA 3SCGA 2L49A 2OFYA 4Z5HA 1JH9A 2KEIA 1PRVA 3BD1A 3GN5A 4X4GA 1YSEA 1UXCA 1CQTA 2IVQA 3MLFA 1PERL 3EUSA 1ZAYA 3R1FA 2BNMA 2OR1L 2AXUA 3SCHA 2KEJA 2KZ8A 2PUDA 3QWGA 2LCVA 1UTXA 2IV1A 2WIUB 3CECA 4J1XA 3ZKCA 3F6WA 1LCCA 3DNVB 2IUOA 4X4DA 3QF3A 2LYQA 1OSLA 1ZZ6A 1JWLA 1QQAA 3PXPA 4PU4C 4X4FA 4Y42A 1B0NA 3O9XA 1PNRA 2IVBA 4YBAA 4GQMA 2D5VA 2LYKA 4FBIA 2EBYA 2IU7A 1QP7A 4I6TA 4YG1A 3SCFA 3BS3A 2O38A 4MCXA 2KPJA 4I6UA 1RZSA 3UFDA 1CJGA 1RIOA 3ZHIA 1NEQA 2PUFA 1WH6A 4PU3C 3F52A 1QPZA 3LFPA 1ZS4A 1WH8A 2ICPA 2LYRA 2BJCA 1RZRA 2PUAA 1QP0A 4IWRA 1L1MA 1LQCA 2HINA 3RZZA 2XI8A 4PU7A 2EF8A 4IA8A 4YARA 2A6CA 4X4IA 2JCGA 1RZRD 1O4XA 3LISA 2JVLA 1JFTA 3CLCA 3ZHMA 1AU7A 1ZPQA 3FYMA 3QYXA 1UXDA 2LYSA 1DWKA 3FYAA 3S8QA 3OQOA 3OMTA 2PE5A 1LMB3 1DW9A 2BNNA 2PUGA 1LLIA 1JFSA 1ZUGA 2PUEA 1ZZ7A 4GHJA 2KEKA 3D1NI 2CROA 2WUSR 1Y9QA 3VK0A 2H8RA 2XCJA 1QQBA 1S7EA 1BDIA 1XWRA 1WETA 3GBFA 2PPXA 1R69A 3H5TA 3TRBA 1R63A 1BDHA 4NDWA 3L1PA 2LYPA 1ZZ8A 4PU8A 2AUWA 3KXAA 2XIUA 1QP4A 4I8TA 2LYLA 4Z59A 2GRMA 2AW6A 2GRLA 1WIZA 4FN3A 2LYJA 4I6RA 4YG7B 1PRUA 2R63A 4X4HA 3JXCL 1ADRA 4IVZA 2AXZA 1X2LA 2IVGA 4J1WA 3BDNA 2PUCA 1PRAA 3B7HA 1Y7YA 2B5AA 2FJRA 2O49A 4X4BA 2PIJA 3CROL 2GZUA 3IVPA 1OCTC 3GN5B 2MQKA 5A7LA 3JXDL 3G5GA 3OP9A 1IC8A 4JQDA 2O4AA 2ICTA 2L8NA 3G7DA 4X4CA 3QQ6A 1ZVVA 2EWTA 1SQ8A 4JCXA 3JXBC 2R1JL 1GT0C 4MCTA 2XSDC 1VPWA 3FMYA 5K98B 4YG4A 2PUBA 4X4EA 2BNOA 4O8BA
chains in the Genus database with same CATH superfamily
2XCCA 5BW8C 3RKVA 3ZU7B 5ENSD 2AWIA 4QFVA 3SQVA 2XXPA 3OQMA 4K5BA 2VYIA 3SCGA 4Z5HA 3LEWA 4G24A 4LRZA 4JA9A 3TXMA 3ZFWA 1BD8A 3QWGA 3Q7AA 2B0OE 5M72A 3KAEA 5A6CA 4HRLA 2DBAA 3C3OA 1ZZ6A 4Y42A 2I9CA 2EBYA 4URKA 1QP7A 5AAOA 4I6TA 3KD7A 1Q2ZA 5ANLA 5AQAA 3EJNA 4HLEA 4GU5A 3D9LA 2LNMA 3RJVA 3L17A 2EF8A 2KBXA 3LDZA 1LD8A 2VSOE 3MKRA 3PUJA 4G8LA 1TNUA 2R05A 2DVWA 1OCRE 5KWDA 4QQIA 3MJWA 1UJKA 2R5SA 4BTAA 5AQBA 4EZJA 4WNGA 4CDRA 3B7SA 1B89A 1S63A 4AIFA 2DZOA 3MV3B 4XIFA 4U0UA 4U8HA 4DUIA 1TR4A 1H6PA 3G2SA 3NZLA 1OCCE 3RO2A 4AJWA 2GZUA 3SGHA 4DX5D 2OCCE 3G7DA 2RFMA 3EHMA 3PZ3A 3APCA 2L6BA 3NOGD 4AY5A 1LTXA 4APOA 2FULA 2HSGA 5JJTA 2LAHA 4E6HA 1DULA 3ISMC 3BG1B 4GA2A 3ZHEA 1X57A 1S64A 2L6JA 3UT4A 1YSEA 3FTUA 1JWFA 2X6HA 3GZSA 2OVFA 2XS8A 2XXQA 3F6WA 4X4DA 1X5BA 1Z5SC 1IKND 5EN5D 3E33A 2X6KA 4HS2A 4U0ZA 5AARA 2GRNB 3PZ1A 4YG1A 2VSYA 4MCXA 3Q7FA 3R7QA 3TWUA 1DNPA 4XKCA 4BEPA 3GZ1A 3CEQA 3LFPA 3Q47B 1E96B 3R9MA 5KBAA 4GTTA 2ETAA 1JFTA 3Q9NC 2NYJA 1UXDA 1E8XA 4N5CA 3FEYA 4HXIA 1NA3A 1LMB3 3U9WA 4CDNA 2J8SD 3IXEA 3CHMA 3CHRA 4KMOA 3FUJA 3SFXA 3NB2A 3CVXA 1R63A 3C3RA 5ITZF 3UWPA 3UXGA 2AUWA 3LXUX 3OWQA 2LYLA 3TWXA 4C0MA 5FQ6A 3HXFA 3ZHEB 1Z6TA 1K3ZD 4UQXA 2VGEA 4GZ6A 3HXEA 1U3CA 4KYOB 3W9GA 4LSZE 4FJZA 2MQKA 4JQDA 4AY6A 4JCXA 2R1JL 4JW1A 3DWLG 5CCMA 1RZRD 4N5QA 3TJPA 3PNTB 2YBDA 2H6HA 2F8XK 2CSFA 2YQ8A 4GB9A 5BV0A 1NERA 2WQHA 5T3RA 2BF0X 3VTYA 4HOQA 4Q2JA 4DJAA 4X4GA 4U0SA 1HQ1A 4GMLA 4GZCA 4JL0A 3KSLA 2IV1A 1OXJA 1MX4A 4FU3A 3ML8A 3ML9A 3B7BA 4H7XA 1SA4A 4GQMA 2XPYA 4L2LA 3ZNGA 1TNOA 3LVQE 4UUCA 4A55A 4O6FA 5CERB 3B7UX 3LCAA 5IY5E 4K5CA 2LXMA 2I6HA 2CHZA 3RZZA 4I17A 2Y1LE 3ZHMA 3CLCA 3EIJA 4GZ3A 1FT2A 2I2OA 3UKUG 4U8YD 2ODRD 3PZ4A 4WWNA 4BSZB 2PXVA 1LLIA 1HZ4A 2VSNA 2QY7A 2XS1A 1Y9QA 4EECA 4UQZA 3CK7A 2C0LA 3AU5A 2M4HA 3ZRHA 3TWRA 2L1PA 4X4HA 3JXCL 4DE8A 3CVYA 1UN8A 3EIQC 4YDYA 5EKQD 2WVIA 3PH0C 3Q49B 5A7LA 2VSXE 2DZNA 5K98B 1S70B 1HG5A 4LERA 2BNOA 4DRXE 5CEAA 3U3WA 2VTBB 3MEKA 3UM3A 1Y6IA 1OWOA 3Q9UC 3MKQA 3I4GA 4Z58A 4LUNU 2V8SE 3EUSA 1WM5A 1LD7A 1ZAYA 4WUYA 2DYRE 3R1FA 1PY1A 2X6JA 3HRAA 1TN7A 4HLLA 3V2OA 4HNAD 4J7WA 4EZKA 2MYOA 2FO7A 1WG0A 1OSLA 5CBOA 4KT6B 2D5VA 3FUNA 2FI7A 2IU7A 3G2WA 2PXUA 2ZU6B 1IHGA 1JCQA 2KPJA 2VQ2A 2WXIA 1QYMA 2PUFA 3SD5A 1WH6A 2FEZA 5DTQA 1QPZA 4KZ0A 3UT8A 2XGSA 1L1MA 2A5UA 3ZYKA 4TV3A 4DI3A 4I1OB 1ZPQA 1EDUA 3JUIA 3L54A 5ANRA 4GTOA 3L22A 4I9EA 4ANVA 4NIKA 3QC1A 1UN9A 2KEKA 1H6OA 1MYOA 2BKGA 4FHKA 1KPSB 3R7RA 3D9PA 1BDIA 3PUKA 4B93B 1WETA 2PPXA 1RW2A 5DRTA 3HXBA 2GRRB 3QOXA 2C2LA 3TL5A 2LYPA 3E30A 2EQXA 2NC9A 2L0TB 4ANXA 1E90A 3AG4E 1N4SA 2VTBA 4B8AA 1WIZA 5D0OD 3RRMB 3MKQB 2A4ZA 3VWSA 4J1WA 1MFQC 5AJDA 2WQ6A 4DI4A 1H2TC 3PRZA 3KS2A 2YINA 2PXDA 4UWGA 3FULA 2H6IA 4BFRA 3JQ0A 3FDHA 2XCBA 2DIWA 4PUCA 2GRPB 4AV7A 3FTXA 4N2QA 4BT9A 1O5MA 5EX3A 4CCAA 1EFAA 3FFLA 3OXLA 1AP7A 2PXPA 3FTYA 1IXVA 3T5VA 4J8DA 4FHJA 1UTXA 4C48B 4ATZD 4BSXA 3L08A 1KZPA 3D9MA 3QNKA 2C0MA 5JUWA 4ANUA 4ILGA 3CKCA 4MLPA 3P1UA 5KJMA 5FTPA 3UM0A 5ENQD 2LYRA 2BJCA 2LUHA 2EIJE 1N4QA 4OVUA 2P9UG 1AU7A 3QYXA 2LYSA 3FUFA 3Q15A 3UIPC 3CVQA 2XRZA 4U8VD 3D1NI 2BUGA 3QB2A 3Q79A 3ZW3A 2DWZA 1H6KA 4PU8A 3CVNA 2WM9A 1TNBA 4Z59A 4BETA 3FTVA 2OOEA 4XEIG 3ME5A 3EHQA 1PRUA 1ADRA 1QNFA 2ETCA 2WXOA 3DXMG 2LAIA 2XEHA 3ZKJA 1N4RA 2F0YA 3IHYA 3CROL 2JQEA 2OEVA 4RSYA 3FUEA 3JXDL 2XGMA 3E4BA 1SQ8A 4HOSA 2HE0A 1UOHA 4CT4A 5AYWD 3JQ1A 4U63A 2BEDA 2PUBA 3AAAC 3PS6A 1EYHA 4J8YA 4L1BA 4U96D 4OB4A 3OKZA 1ZZ9A 3ABKE 3T5XA 1WY6A 3V2XA 2XRYA 5KJKA 2OFYA 4Y6WA 3GN5A 5CBNA 4O1OA 2PUDA 4ER3A 2WXLA 2V0PA 4XX5A 3E34A 2ZIRA 3ZKCA 1JCSA 2IUOA 3CVWA 4BESA 2I1JA 3HG0D 2Y3AA 3AS5A 3A9ZA 2LYKA 4ANWA 5B1BE 3MV2B 5CEDB 2MXDA 3V79K 5EYPF 5CECB 5ENRD 4K03A 4EBAA 2ICPA 1RZRA 4Y6CA 1LQCA 2XPZA 1K1BA 3DXKG 4A1SA 2OVBA 3CK9A 4G8KA 3CLJA 3FTWA 5LFAA 1IQUA 4JHJA 1A5EA 3B95A 1ELKA 1TYQG 3LQXA 3AS8A 2Y4TA 2BNNA 3R09A 1JCRA 1AWCB 2IOSA 1BI8B 3IV0A 2VGYA 2ZGDA 5FZQA 3SHFA 3IEGA 4CGVA 3UKRG 4GZDA 1K1AA 4KZCA 1H2VC 2IJGX 2AW6A 1WDYA 2LYJA 2IF4A 3B13A 3UM1A 3S7JA 4X4BA 1OT8A 3KEZA 2O4AA 3GN5B 2KCLA 5DBKA 5D66A 3JXBC 3WG7E 3C5RA 2UWJG 1VPWA 4GA0A 5FQ7A 1KLXA 2E0IA 3HYMB 3MGBA 5J08A 3UM2A 4F8DA 4ILHB 2XQ0A 1DCQA 4G11A 1A17A 2V5FA 3ZXPA 1SA5A 5DTRA 1X81A 2XHEA 3CHQA 5CRVA 3LS8A 4Q94A 3G2UA 2J07A 3P2BA 4MKTA 4JB8P 4OAVB 3R9AB 2IFUA 4KBQA 4DLQA 3CECA 2IQCA 3LY9A 3RK6A 3TWWA 4RG9A 3O9XA 2LXLA 1KZOA 5A7DB 4OAUC 2XGOA 2A5EA 2CG3A 5T4YA 4FULA 2PQRA 4HB5A 3EU9A 1RZSA 3UFDA 2RD0A 4JPSA 5D0QD 2V4LA 2MHKA 3U64A 2IO2C 5DSXA 4X4IA 3QDNA 3MX3A 4U04A 4L2YA 4I2WA 4XZ4A 1HF8A 2ILRA 2PZIA 1IHBA 3QOWA 2WXMA 4UI9C 4YVQC 3DSSA 2KCVA 4M7CA 4NQ0A 3FUKA 2XEEA 1KT0A 3J5QB 1OWPA 2HYZA 3L9TA 5H7PA 3C98A 4I1MA 2FO1E 4BTBA 4IRUA 3FHEA 5J90A 1UG3A 5FQ4A 2KATA 4DLOA 2FJRA 2PIJA 3OP9A 1BLXB 1P5QA 1TJFA 3TELA 5AJLA 4MCTA 3MZLB 4MBGA 4GYOA 3ZYMA 4O8BA 2P9KG 3UMVA 3DSVA 3HDXA 4RLYA 4P29A 2XJ3A 1U3DA 1Y8MA 3ASFA 3SO8A 3GYZA 3HIZA 1MQSA 3IBEA 4I6GA 4Z5CA 2FF4A 2CFZA 2PUAA 3BD1A 1OCZE 3NBNB 3CK8A 3NOCD 2KEJA 2KZ8A 5ENOD 2ZXWE 2WXQA 3PZ2A 5BNWA 5EYLA 3UIOC 4A3TA 4CRWA 5GAGi 3Q73A 5JHBA 2Y0BG 1LCCA 3QF3A 2J49A 4R7LA 5T8IA 3DSUA 3G2VA 1PNRA 5B3SE 1W3BA 3E37A 3J5PA 3HXCA 1OUVA 2BKKB 3PZDA 4MRUA 2PM7A 3CHOA 4AOFA 4ACKA 1O4XA 3LISA 4FLHA 4XI9A 3AG3E 1JPLA 3APFA 3QWVA 3FYAA 3CR3A 3UPVA 3ONKA 2KXPC 3GW4A 4LCTA 3TWQA 3OAWA 2XCJA 5AQ7A 2PM6A 1PAQA 1NZNA 3O4ZA 2IU1A 1NI1A 1YA0A 3TXNA 3LY8A 4LNUD 1FPPA 1QP4A 1TNYA 1INZA 4TUUA 5FIOA 2R63A 4DX7D 4GMRA 3FTSA 2PUCA 4B89A 5BXOA 5JMND 3QAQA 2L9BA 2HCNA 1ZVVA 3UINC 4GCOA 1N52A 3JCKC 3JUEA 3PDNA 2XXAA 4LNBA 5ENNA 3BUAA 3ZGQA 3LJ3A 3MCXA 4NURA 1POUA 4WAFA 3Q5MA 2OEWA 3UT7A 4TXQA 4EKGA 3ZUVB 3OQNA 4YVOA 5AQ9A 1YYHA 2J4DA 4HFGA 5G04C 5JJ6A 1UXCA 2PQNA 2BNMA 5G55A 3FUMA 2LCVA 1LF8A 3QFIA 3FWVA 3DNVB 5BXUA 3TGOA 2EIKE 2IVBA 1MJ0A 2PXEA 3M9LA 2LLWA 1ZB1A 4ER5A 2IONA 2M63A 4JEHA 3UX4A 5JJ7A 4HVBA 5E75A 4YARA 4O1PA 2E2EA 4PDXA 4NRHB 4YDEA 2UY1B 4ZHBA 1E8ZA 1YMPA 2KZTB 3FH5A 3S2AA 4OBMA 4BX8A 2P9IG 2PUEA 4L23A 3RIBA 4Q96A 3CKBA 1QQBA 4G1TA 2IEJA 1ZBPA 3CHSA 4MS6A 3MEJA 3CSFA 3KXAA 4EHMA 4I8TA 2PL2A 2GRLA 4I6RA 2PXLA 4F53A 5CHEE 3S7BA 1HE8A 1PRAA 3V31A 4DK5A 3L6AA 4U07A 5EIBE 1TNZA 4X4CA 3E32A 1NP7A 2WXKA 2X3MA 2J7UA 4J8FA 3ULQA 1DCEA 3QK0A 3HZIB 4HRAA 3KJXA 5KNHD 3DPYA 3NROA 2R03A 4GPMA 2P9LG 2AVPA 3PE4A 2P2CP 2DCPA 1U2VG 3AJIA 3OTNA 2AXUA 3D3MA 4UI9K 1FT1A 4IULA 3ONLA 4ILIA 1QQEA 3UUXA 3ULYA 3FUDA 4G2VA 1NL4A 1N0RA 2UY1A 4X4FA 2R2LA 5DIZA 2KZTA 4FBIA 2NXPA 1SZAA 5CCLA 2XZTG 3ASHA 3KEAA 1YCSB 4GTPA 1N9AA 4RG6A 2WMOA 4W9RA 3SX0A 2XI8A 2JCGA 4WWPA 4JXTA 3LVRE 2HM8A 2GW1A 4B0ZA 3ESKA 4GTRA 5BUZA 4I6EA 3G2TA 2XENA 2I1KA 2P9NG 3S7DA 4BWRA 3UQ3A 4LNGA 4TXPA 3FU0A 4AEZC 5C1DA 3KL4A 2Q7FA 4ZFHA 3LY7A 4PS3A 4J8EA 1IYGA 4A63B 4OYSA 3DBSA 2EINE 2PXBA 3ZYLA 3T9KA 3QWPA 2ICTA 3ZPXA 4JD2G 5EDSA 1GT0C 3RSEG 2XSDC 1D8EA 4ER6A 4BERA 4OVVA 1MHQA 3URZA 3CVPA 1VDYA 1LCDA 5FQ8A 1H2UA 1JH9A 1BI7B 2GRQB 3MLFA 2VEOA 4GTMA 3SY2A 4EK9A 2WIUB 4F6RD 3SZ7A 4M3OA 2H6GA 3EUVA 3AU4A 5BPPA 4EZIA 5KJNA 5G04J 4ABNA 4YBAA 3W9FA 1SW6A 4ATGA 3F6QA 1TN8A 2P9PG 3C3QA 4WNFA 5LOZA 2WMNA 4RVBA 3ZN3A 2YHEA 5A23A 4WNEA 2LNIA 1NEQA 2H6FA 4CT0A 3D9NA 1WH8A 4IWRA 3B7TA 3HXDA 5G2NA 1K8KG 5EILA 1DWKA 5CMWA 2PE5A 5HQ8A 1DW9A 1ZZ7A 2BTDA 3T8KA 4EQZA 4BT8A 3I5PA 4U7EB 3NXHA 5AENA 1D9SA 4DPRA 1R69A 3H5TA 1O1RA 5ENPD 1BDHA 2ZGGA 4AP2A 2P9SG 4LEUA 2AJAA 3D9OA 2XIUA 4GYWA 3WXXA 2JEKA 3GZ2A 5KCMA 4HI9A 4N3BA 4I1AA 3UTMA 1BU9A 3O48A 2IVGA 4EZLA 2B5AA 3BG0B 3TWVA 2QFCA 4G23A 3K9IA 4UQYA 3IVPA 1OCTC 2L8NA 3QQ6A 2EWTA 1MX2A 1L5JA 4X4EA 4ER7A 1QQAA 4CEMA 1D8DA 4F1PA 5EIDA 3QKYA 4IYPA 4JCYA 4FJYA 3Q4AB 4Z5DA 3FH8A 1TJCA 1DC2A 4B8CB 2X38A 4GZ5A 3A9XA 4WNDA 2L49A 5D2MC 1TEZA 3ULEG 1Z3YA 1PRVA 4IN3B 1QB2A 4AM9A 3SCHA 3FUHA 1E7UA 3IHVA 3DPDA 3D9HA 3CIAA 4HQDA 4N3CA 5DT2A 2HR2A 4GYYA 1B0NA 2KC7A 3V30A 2WXFA 3QWWA 3KSQA 3SCFA 5HI7A 3GZCA 4I6UA 4YDOA 1RIOA 3F52A 4J6IA 1QP0A 3ASGA 3QARA 4PU7A 5FZSA 2B6CA 2KM4A 3NZSA 5G05J 2JVLA 3PEVB 4KXKB 2WXRA 3OQOA 3OMTA 5HKPA 2DYSE 3DSWA 4BY6A 4GHJA 2CROA 2YNQA 2H8RA 4A3VA 3FU6A 3EHRA 3GBFA 2J4BA 2L0IA 3MYVA 3L1PA 4XKBA 1UW4B 1NW3A 2CHXA 3DSXA 3QJZA 4G25A 2IOLA 3D9IA 3TEPA 4I43A 1JWGA 3RAUA 1XNFA 3EU5A 3JYSA 3PE5A 4JZYA 3L82A 4IVZA 2R02A 2WPVA 3B7HA 1Y7YA 2O49A 3VLEA 3VLDA 3SFYA 1HG2A 3EDTB 4PS7A 1O1TA 3SI5A 2IY0C 2LO6A 4KVMA 2LLVA 1N4PA 5DRYA 4AVXA 5LP0A 4CZ2D 2XEVA 1FVFA 4FC8A 5FZRA 1NA0A 3TWTA 5LCWJ 3VTXA 1CQTA 4I6JA 1PERL 2IVQA 1EPUA 4DX2A 4Z68A 1HO8A 3JXJA 2JABA 4GMJA 1N95A 2XPIA 4H7YA 3ENEA 3MA5A 3UI2A 1QZXA 2HO1A 2LYQA 2ZISA 4YDWA 2FFHA 4HI8A 4UI9J 4I9CA 2O38A 3I3NA 4C0EA 4F7AA 4HRNA 3VLFA 3ZHIA 1ZS4A 3CQGB 5LX8A 4F1SA 3FU3A 2WXNA 3BQOA 2YHCA 2PXQA 2LSVA 4V3IA 3TG4A 3SF4A 3CVUA 3T8MA 4I2ZA 2CG2A 3PEUB 4LG6A 3BU8A 1U2ZA 4F3VA 1RZ4A 3LKUA 1HU3A 2IO3C 3ABME 1S7EA 3CV0A 5DTMA 3PNLB 4JC8A 3CGHA 3JXIA 5GAHi 4PH4B 4UWKA 4D10C 2NSZA 1E7VA 5CRUA 4HRMB 2GRMA 1HXIA 1V55E 1HH8A 3LPZA 3HVEA 2V5QC 1OWMA 2VJ8A 4KVOA 2OV8A 2WXHA 1O1SA 3NF1A 2ETBA 3FU5A 3ESLA 3ZEFA 1N11A 1SQMA 3IKOB 4K0RA 4XE0A 3ASDA 3SBTB 3AG2E 1PC2A 3G0TA 3ZXSA 1N94A 4L7TA 2QYUA 4E85A 1SZ9A 2EIME 4FADA 2X6IA 4DX1A 1ZZCA 5HRYA 5FJYA 4EBAG 4ME2A 3FY4A 3LYAA 2OR1L 3QOUA 3X2QE 4Q69A 3CQCB 3ABLE 2X6FA 2HCSA 2V4HC 3RU0A 2QYJA 3BS3A 2J7WA 4ACLA 4K5AB 5FINA 2F37A 1MZCA 4C9BB 2RKKA 1CJGA 3PE3A 3NQPA 1OCOE 3NDBB 1FCHA 2HINA 2PNNA 5ARFA 2QC9A 1WAO1 2CFUA 1HFAA 4GTVA 1JFSA 1ZUGA 3HVEB 5CMYA 3RO3A 2WUSR 3TG5A 1Z3XA 2V3CC 4JHKA 3GZDC 3TRBA 3U4TA 5JHAA 2FBNA 1MX6A 5E76A 3SFZA 2ONDA 3S7FA 3FTZA 4YG7B 4J8SA 1SVXA 4UWFA 3SNXA 3L13A 3BDNA 4TRQA 4A1GA 3L16A 4GCNA 2EILE 3G5GA 1IC8A 1OY3D 2J08A 4FP7A 4APFA 4GAAA 1ELWA 4EKIA 4UWHA 1OWNA 2WXJA 3FMYA 1GW6A 3ZYQA 3DM5A 3KZ3A 1E3OC 4EQFA 3F51A 5LCWC 1RPEL 2MEZA 2PXFA 2AXVA 3DEOA 3DRAA 4FLBA 4HOUA 3A9YA 3AS4A 2WB2A 3I4RB 5AN8A 1ZU2A 3D9JA 4UWLA 1G3NB 2J09A 1N0QA 1TN6A 4J1XA 3FEXA 4DX6D 2Y4UA 4N2SA 2WQ7A 3AG1E 4FA6A 5KJLA 4PU4C 5EX0A 4ER0A 2P58C 4JA7A 1H0AA 1V54E 3RRUA 4HOTA 4DE9A 3CVVA 4BX9A 1NFIE 4PU3C 3EHNA 1OWLA 1KT1A 2J9QA 4IA8A 4YNDA 3ASNE 3FYMA 2MOWA 3S8QA 3CHPA 4WVLA 1E8WA 4GTQA 4HBDA 1QBQA 3CVLA 3RRNB 1DVPA 4NDWA 1UJJA 1ZZ8A 3ASOE 3C72A 4JVSA 5JA4D 3CSTA 4PS8A 2QZAA 2VGXB 4GTSA 4FN3A 4N3AA 3ZIMA 1BPOA 3TFLA 1X2LA 2GROB 4HORA 3NAWA 4L9PA 4CGWA 3OXGA 3APDA 1N54A 3B7RL 5FT9A 4X8QA 4YG4A 3GZDA 2CHWA 5C2YA 1HX8A 4TXRA 1ZZBA 1HF0A 3FUIA 2MRIA 2WXGA 3BEEA 2WXPA 1ELRA 3DSTA 1HS6A 2KEIA 2GGFA 4WWOA 2PXTA 3U66A 4XI0A 4CDMA 3PREA 4TUMA 3SBSA 3DEPA 3N71A 2KCKA 1JWLA 2PXKA 3PXPA 1FVHA 2Y69E 2JLBA 3OXFA 5ENTD 4G26A 4GA1A 2RFAA 1XGWA 3TAXA 5HS0A 4U95D 3D9KA 1QZ2A 5ARGA 3FP3A 4CYMD 2A6CA 4O60A 4RQIA 2R17C 4JHRA 2VGXA 3TWSA 2RG8A 3ZVVA 2PUGA 2F8YA 5KNGA 5AIJA 3VK0A 3ZPJA 1XWRA 2HFZA 5BV1A 3Q75A 4B94A 4N39A 1EF1C 4JEUA 5FWQA 5G05C 1S0PA 4AXHA 3Q78A 3SR4A 3NZUA 5B1AE 1IQRA 3FH7A 1H19A 4NACA 4EPZA 2R59A 1JUQA 2AXZA 3GUUA 2LSUA 2XZDG 3LJNA 3HHMA 4J0UA 1E8YA 5BT1A 3PVLA 4GPKA
chains in the Genus database with same CATH topology
2XCCA 4NURA 4PUCA 5BW8C 3RKVA 1POUA 4WAFA 3Q5MA 3UT7A 2XEVA 4AV7A 1FVFA 2AWIA 4QFVA 3FTXA 4FC8A 5FZRA 4N2QA 4BT9A 1NA0A 3OQMA 5EX3A 4CCAA 1EFAA 2VYIA 3FFLA 3OXLA 5LCWJ 3OQNA 3SCGA 3FTYA 4Z5HA 3LEWA 4G24A 4YVOA 2J4DA 4LRZA 4HFGA 4JA9A 5G04C 5JJ6A 1CQTA 3VTXA 3T5VA 1UXCA 1PERL 2IVQA 1EPUA 4I6JA 2PQNA 3TXMA 2BNMA 5G55A 1HO8A 4J8DA 3FUMA 3ZFWA 4FHJA 3QWGA 2LCVA 1LF8A 1UTXA 5M72A 3KAEA 5A6CA 4GMJA 2XPIA 3FWVA 3L08A 4BSXA 4H7YA 2DBAA 3ENEA 3MA5A 3DNVB 2HO1A 2LYQA 1ZZ6A 3TGOA 3D9MA 4Y42A 2IVBA 3QNKA 2I9CA 2EBYA 2C0MA 4URKA 1QP7A 4ANUA 4ILGA 4UI9J 4I6TA 3CKCA 3KD7A 3P1UA 4MLPA 5ANLA 2IONA 4I9CA 2O38A 3EJNA 3I3NA 4HLEA 4GU5A 2M63A 4JEHA 3D9LA 5FTPA 5KJMA 4C0EA 4F7AA 3VLFA 3ZHIA 3UX4A 5JJ7A 1ZS4A 2LYRA 2BJCA 3CQGB 4HVBA 5LX8A 3RJVA 4F1SA 5E75A 3L17A 3FU3A 4YARA 2EF8A 3LDZA 4OVUA 2WXNA 1AU7A 2YHCA 2E2EA 3QYXA 4PDXA 2LSVA 4NRHB 2LYSA 5G05C 4V3IA 2UY1B 3TG4A 1E8ZA 3FUFA 3SF4A 3CVUA 2KZTB 3FH5A 3S2AA 3Q15A 4I2ZA 2CG2A 3PEUB 3T8MA 2VSOE 3MKRA 4BX8A 2PUEA 3CVQA 4L23A 2XRZA 3PUJA 4F3VA 3LKUA 3RIBA 3D1NI 1HU3A 4Q96A 2BUGA 3CKBA 1QQBA 1S7EA 3CV0A 3PNLB 3QB2A 4G1TA 4JC8A 5T8IA 3MJWA 1UJKA 1ZBPA 2R5SA 3CHSA 4MS6A 3CGHA 4BTAA 4EZJA 4WNGA 3ZW3A 1H6KA 4CDRA 4PU8A 3B7SA 4PH4B 4UWKA 3CSFA 1B89A 2NSZA 3CVNA 3KXAA 4D10C 2WM9A 1E7VA 4I8TA 4Z59A 3FTVA 4AIFA 2OOEA 2GRMA 2PL2A 1HXIA 2GRLA 3MV3B 4I6RA 4XIFA 4F53A 1PRUA 1ADRA 4U0UA 1HH8A 1QNFA 4U8HA 2WXOA 3LPZA 5CHEE 2LAIA 3HVEA 3S7BA 1OWMA 2VJ8A 3IHYA 1HE8A 1PRAA 4KVOA 2OV8A 4DK5A 3G2SA 3CROL 2WXHA 3RO2A 4AJWA 3NF1A 2GZUA 3L6AA 4RSYA 3FUEA 4U07A 3SGHA 3JXDL 2XGMA 3E4BA 4X4CA 3G7DA 1NP7A 2WXKA 3EHMA 3FU5A 1SQ8A 2X3MA 3APCA 4HOSA 4AY5A 4CT4A 3ESLA 5AYWD 3JQ1A 3ZEFA 4U63A 2PUBA 4J8FA 1SQMA 3IKOB 4K0RA 4XE0A 3ULQA 4APOA 3PS6A 3ASDA 3SBTB 3QK0A 3HZIB 1EYHA 2FULA 2HSGA 1PC2A 3ZXSA 5JJTA 2LAHA 3KJXA 4L7TA 4E6HA 4L1BA 4E85A 1SZ9A 3BG1B 4GA2A 3ZHEA 1X57A 2X6IA 4FADA 4OB4A 1ZZCA 1ZZ9A 3T5XA 1WY6A 5FJYA 2L6JA 2XRYA 3UT4A 2OFYA 4EBAG 5KJKA 4ME2A 2AVPA 3PE4A 4Y6WA 3GN5A 1YSEA 2DCPA 3FTUA 3OTNA 3FY4A 3LYAA 2OR1L 2AXUA 1JWFA 3D3MA 2X6HA 2PUDA 3QOUA 4UI9K 2WXLA 2V0PA 4Q69A 3CQCB 4XX5A 3GZSA 4IULA 2OVFA 3ZKCA 3F6WA 3ONLA 4ILIA 2IUOA 4X4DA 1QQEA 1X5BA 3CVWA 3UUXA 2I1JA 2X6FA 3FUDA 4G2VA 2UY1A 2Y3AA 4X4FA 3AS5A 5DIZA 2KZTA 2LYKA 4FBIA 2NXPA 1SZAA 2X6KA 4HS2A 4U0ZA 4ANWA 3RU0A 4YG1A 3BS3A 2VSYA 5CCLA 4ACLA 4MCXA 3MV2B 3ASHA 3R7QA 4C9BB 3PE3A 1CJGA 1DNPA 3NQPA 4K03A 4XKCA 4EBAA 3GZ1A 3CEQA 3LFPA 3Q47B 2ICPA 1RZRA 2WMOA 4RG6A 1E96B 4W9RA 4Y6CA 1LQCA 1FCHA 2HINA 2XPZA 5ARFA 2XI8A 4A1SA 2JCGA 2OVBA 3CK9A 4WWPA 1JFTA 3CLJA 3FTWA 5LFAA 1IQUA 1UXDA 1E8XA 4JHJA 4N5CA 4JXTA 3FEYA 3LVRE 4HXIA 1ELKA 2HM8A 1NA3A 2GW1A 1WAO1 1LMB3 2CFUA 2Y4TA 2BNNA 1HFAA 3AS8A 3ESKA 3U9WA 4B0ZA 4CDNA 1JFSA 1ZUGA 3CHMA 3G2TA 3HVEB 4I6EA 5BUZA 2I1KA 5CMYA 2IOSA 3RO3A 3S7DA 3CHRA 2WUSR 3TG5A 1Z3XA 4KMOA 3UQ3A 4BWRA 3IV0A 2VGYA 3FU0A 3FUJA 4JHKA 4AEZC 5C1DA 5FZQA 3SHFA 3IEGA 4CGVA 3CVXA 3TRBA 1R63A 4GZDA 2Q7FA 3U4TA 2AUWA 5JHAA 3LXUX 2FBNA 3LY7A 4KZCA 1H2VC 5E76A 2LYLA 3SFZA 2ONDA 2IJGX 3S7FA 4C0MA 3FTZA 2AW6A 5FQ6A 4YG7B 2LYJA 4J8SA 4PS3A 4UWFA 4J8EA 3SNXA 3ZHEB 2IF4A 1IYGA 1Z6TA 3B13A 4UQXA 3L13A 4GZ6A 3BDNA 4OYSA 3DBSA 4TRQA 1U3CA 4A1GA 3S7JA 4X4BA 4KYOB 3ZYLA 3L16A 4GCNA 3KEZA 2O4AA 3GN5B 2MQKA 4FJZA 4JQDA 3G5GA 1IC8A 2J08A 2KCLA 4FP7A 4AY6A 3QWPA 2ICTA 4APFA 4JCXA 5DBKA 3JXBC 2R1JL 4GAAA 4JW1A 5EDSA 1ELWA 1GT0C 4UWHA 1OWNA 2XSDC 1VPWA 2UWJG 2WXJA 4GA0A 3FMYA 5FQ7A 1KLXA 1GW6A 2E0IA 3HYMB 3MGBA 1RZRD 5CCMA 5J08A 3TJPA 3PNTB 3ZYQA 3KZ3A 4F8DA 1E3OC 4ILHB 2CSFA 2YQ8A 4GB9A 4EQFA 2XQ0A 5BV0A 3F51A 1NERA 1RPEL 2MEZA 4OVVA 2AXVA 1MHQA 2WQHA 5LCWC 4G11A 4FLBA 5T3RA 3URZA 1A17A 2V5FA 3CVPA 4HOUA 1VDYA 1LCDA 2XHEA 5FQ8A 3CHQA 2BF0X 3LS8A 3AS4A 4Q94A 3VTYA 3G2UA 1H2UA 1JH9A 4HOQA 2J07A 4DJAA 4X4GA 3P2BA 4MKTA 4U0SA 2WB2A 3MLFA 3I4RB 3R9AB 1ZU2A 2IFUA 3D9JA 4GMLA 4GZCA 4JL0A 4KBQA 2IV1A 2WIUB 4DLQA 4UWLA 2J09A 3CECA 4FU3A 3FEXA 4J1XA 3ML8A 3SZ7A 2Y4UA 4M3OA 2IQCA 3ML9A 4N2SA 3LY9A 2WQ7A 3RK6A 4FA6A 5KJLA 3AU4A 4H7XA 5BPPA 4RG9A 4PU4C 5EX0A 3O9XA 5KJNA 5G04J 2P58C 4YBAA 4GQMA 4JA7A 5A7DB 4ABNA 2XGOA 2XPYA 1H0AA 3RRUA 2CG3A 4L2LA 5T4YA 4ATGA 4FULA 4HOTA 3CVVA 5LOZA 4BX9A 3LVQE 4WNFA 2WMNA 2PQRA 4A55A 4RVBA 4O6FA 3ZN3A 2YHEA 1RZSA 3UFDA 3B7UX 4WNEA 5A23A 2RD0A 2LNIA 3LCAA 1NEQA 4JPSA 4PU3C 3EHNA 4CT0A 3D9NA 1WH8A 5D0QD 4IWRA 3B7TA 1OWLA 2V4LA 2I6HA 1KT1A 2J9QA 2CHZA 2MHKA 3U64A 3RZZA 4I17A 5G2NA 4IA8A 4X4IA 3ZHMA 3CLCA 3EIJA 3QDNA 3MX3A 4YNDA 3FYMA 4GZ3A 4L2YA 4U04A 2I2OA 1DWKA 4I2WA 4XZ4A 2MOWA 1HF8A 3S8QA 5CMWA 2PE5A 5HQ8A 4WWNA 2ILRA 1DW9A 2PZIA 2WXMA 1LLIA 1HZ4A 4UI9C 3CHPA 1ZZ7A 2BTDA 2VSNA 2QY7A 4YVQC 1Y9QA 4BT8A 3I5PA 2KCVA 1E8WA 5AENA 4EECA 4UQZA 3CK7A 4NQ0A 4DPRA 3CVLA 3RRNB 1R69A 3H5TA 3FUKA 1DVPA 1BDHA 2C0LA 4NDWA 1UJJA 1ZZ8A 3AU5A 1KT0A 4AP2A 1OWPA 4LEUA 2HYZA 3D9OA 2XIUA 3C98A 4GYWA 4I1MA 4JVSA 4BTBA 3WXXA 3CSTA 4IRUA 4PS8A 3FHEA 2JEKA 3ZRHA 3GZ2A 5J90A 2VGXB 1UG3A 5FQ4A 2KATA 4FN3A 4X4HA 4N3AA 5KCMA 4N3BA 3JXCL 4I1AA 3ZIMA 3CVYA 1BPOA 1UN8A 3O48A 3EIQC 5EKQD 1X2LA 2IVGA 2WVIA 4DLOA 4EZLA 4HORA 2B5AA 2FJRA 3BG0B 2QFCA 2PIJA 3PH0C 3Q49B 3K9IA 4G23A 4UQYA 3IVPA 1OCTC 5A7LA 3OP9A 2L8NA 2VSXE 1P5QA 3QQ6A 1TJFA 2EWTA 5AJLA 3OXGA 3APDA 4CGWA 1N54A 3B7RL 5FT9A 4MCTA 3MZLB 5K98B 4YG4A 4GYOA 1L5JA 1HG5A 4LERA 3ZYMA 4X4EA 2CHWA 1QQAA 2BNOA 4CEMA 4O8BA 3U3WA 3QKYA 4IYPA 4JCYA 1HX8A 4FJYA 5C2YA 3UMVA 1ZZBA 2VTBB 3MEKA 3Q4AB 1HF0A 3HDXA 4Z5DA 3FH8A 1Y6IA 1TJCA 1OWOA 2MRIA 3FUIA 2XJ3A 1U3DA 1Y8MA 4P29A 3MKQA 4B8CB 2X38A 3ASFA 4GZ5A 4WNDA 2WXGA 3BEEA 3I4GA 3GYZA 2WXPA 4Z58A 1MQSA 1ELRA 3HIZA 4Z5CA 3IBEA 4I6GA 2FF4A 2CFZA 4LUNU 2L49A 1HS6A 2V8SE 1TEZA 2KEIA 1Z3YA 1PRVA 3BD1A 2PUAA 4IN3B 3EUSA 1WM5A 1ZAYA 2GGFA 3R1FA 3CK8A 4WUYA 4AM9A 3SCHA 2KEJA 1PY1A 2KZ8A 2X6JA 3FUHA 4WWOA 3U66A 4XI0A 1E7UA 3IHVA 2WXQA 3DPDA 5BNWA 3CIAA 4N3CA 4A3TA 4CDMA 4CRWA 4EZKA 3PREA 3SBSA 5JHBA 1LCCA 2FO7A 3N71A 3QF3A 2HR2A 2KCKA 1OSLA 2J49A 1JWLA 3PXPA 1FVHA 4GYYA 4R7LA 4KT6B 3G2VA 1B0NA 1PNRA 2D5VA 2FI7A 2KC7A 2JLBA 3FUNA 3OXFA 2IU7A 2WXFA 3G2WA 3QWWA 4G26A 1W3BA 3SCFA 2ZU6B 1IHGA 5HI7A 4GA1A 2KPJA 4I6UA 1OUVA 2VQ2A 1XGWA 1RIOA 3TAXA 2WXIA 2PUFA 3PZDA 3SD5A 1WH6A 2FEZA 3F52A 1QPZA 2PM7A 4MRUA 3D9KA 1QZ2A 4J6IA 1QP0A 4KZ0A 5ARGA 3UT8A 2XGSA 1L1MA 2A5UA 3ASGA 3CHOA 3FP3A 3QARA 4TV3A 3ZYKA 4AOFA 4PU7A 5FZSA 4ACKA 2KM4A 2A6CA 1O4XA 3NZSA 5G05J 3LISA 2JVLA 4FLHA 4XI9A 4DI3A 2R17C 1ZPQA 4I1OB 4JHRA 1JPLA 3APFA 3QWVA 3PEVB 4KXKB 1EDUA 2WXRA 3FYAA 2VGXA 3CR3A 3JUIA 3L54A 5ANRA 2RG8A 3OQOA 3UPVA 3OMTA 3ZVVA 2PUGA 3L22A 3ONKA 4I9EA 4ANVA 3GW4A 3QC1A 4LCTA 4BY6A 4GHJA 3OAWA 1UN9A 2KEKA 5AIJA 2CROA 2YNQA 3VK0A 2H8RA 4FHKA 2XCJA 4A3VA 2PM6A 3R7RA 3ZPJA 3D9PA 3FU6A 1BDIA 3PUKA 1PAQA 1XWRA 1WETA 1NZNA 3GBFA 2PPXA 3O4ZA 2IU1A 5BV1A 4B94A 1YA0A 2J4BA 2L0IA 3TXNA 3MYVA 2C2LA 4N39A 3TL5A 3L1PA 1EF1C 2LYPA 4JEUA 5FWQA 3LY8A 1UW4B 2CHXA 3QJZA 1S0PA 2EQXA 4G25A 4XKBA 2IOLA 2NC9A 2L0TB 3MCXA 4AXHA 4ANXA 3D9IA 1E90A 1QP4A 3NZUA 4I43A 1JWGA 1INZA 1XNFA 4TUUA 2VTBA 4B8AA 3JYSA 1WIZA 2R63A 5D0OD 1IQRA 3FH7A 4JZYA 3RRMB 1H19A 3MKQB 2A4ZA 4NACA 4EPZA 2R59A 1JUQA 4IVZA 4B89A 2AXZA 4J1WA 2PUCA 2WPVA 3FTSA 2LSUA 3B7HA 5AJDA 1Y7YA 2O49A 4AVXA 2WQ6A 3VLEA 4DI4A 1H2TC 3PRZA 3KS2A 3VLDA 1HG2A 2YINA 3HHMA 4J0UA 3EDTB 3QAQA 2L9BA 4PS7A 1E8YA 1ZVVA 3SI5A 4GCOA 5BT1A 1N52A 4UWGA 3JCKC 3PDNA 2LO6A 3FULA 3PVLA 4KVMA 4BFRA 3JQ0A 5ENNA 4GPKA 3FDHA 2XCBA 3ZGQA 3LJ3A 2DIWA 5LP0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U3W A;  3HZI B;  4JCY A;  3KZ3 A;  4F8D A;  1POU A;  1ZZB A;  2HSG A;  2CSF A;  1E3O C;  1HF0 A;  3KJX A;  3F51 A;  1NER A;  4Z5D A;  2MEZ A;  1RPE L;  2AXV A;  2AWI A;  2XJ3 A;  1X57 A;  4OB4 A;  3OQM A;  1ZZC A;  1LCD A;  1ZZ9 A;  4Z58 A;  1EFA A;  4Z5C A;  3OQN A;  3SCG A;  2L49 A;  2OFY A;  4Z5H A;  1JH9 A;  2KEI A;  1PRV A;  3BD1 A;  3GN5 A;  4X4G A;  1YSE A;  1UXC A;  1CQT A;  2IVQ A;  3MLF A;  1PER L;  3EUS A;  1ZAY A;  3R1F A;  2BNM A;  2OR1 L;  2AXU A;  3SCH A;  2KEJ A;  2KZ8 A;  2PUD A;  3QWG A;  2LCV A;  1UTX A;  2IV1 A;  2WIU B;  3CEC A;  4J1X A;  3ZKC A;  3F6W A;  1LCC A;  3DNV B;  2IUO A;  4X4D A;  3QF3 A;  2LYQ A;  1OSL A;  1ZZ6 A;  1JWL A;  1QQA A;  3PXP A;  4PU4 C;  4X4F A;  4Y42 A;  1B0N A;  3O9X A;  1PNR A;  2IVB A;  4YBA A;  4GQM A;  2D5V A;  2LYK A;  4FBI A;  2EBY A;  2IU7 A;  1QP7 A;  4I6T A;  4YG1 A;  3SCF A;  3BS3 A;  2O38 A;  4MCX A;  2KPJ A;  4I6U A;  1RZS A;  3UFD A;  1CJG A;  1RIO A;  3ZHI A;  1NEQ A;  2PUF A;  1WH6 A;  4PU3 C;  3F52 A;  1QPZ A;  3LFP A;  1ZS4 A;  1WH8 A;  2ICP A;  2LYR A;  2BJC A;  1RZR A;  2PUA A;  1QP0 A;  4IWR A;  1L1M A;  1LQC A;  2HIN A;  3RZZ A;  2XI8 A;  4PU7 A;  2EF8 A;  4IA8 A;  4YAR A;  2A6C A;  4X4I A;  2JCG A;  1RZR D;  1O4X A;  3LIS A;  2JVL A;  1JFT A;  3CLC A;  3ZHM A;  1AU7 A;  1ZPQ A;  3FYM A;  3QYX A;  1UXD A;  2LYS A;  1DWK A;  3FYA A;  3S8Q A;  3OQO A;  3OMT A;  2PE5 A;  1LMB 3;  1DW9 A;  2BNN A;  2PUG A;  1LLI A;  1JFS A;  1ZUG A;  2PUE A;  1ZZ7 A;  4GHJ A;  2KEK A;  3D1N I;  2CRO A;  2WUS R;  1Y9Q A;  3VK0 A;  2H8R A;  2XCJ A;  1QQB A;  1S7E A;  1BDI A;  1XWR A;  1WET A;  3GBF A;  2PPX A;  1R69 A;  3H5T A;  3TRB A;  1R63 A;  1BDH A;  4NDW A;  3L1P A;  2LYP A;  1ZZ8 A;  4PU8 A;  2AUW A;  3KXA A;  2XIU A;  1QP4 A;  4I8T A;  2LYL A;  4Z59 A;  2GRM A;  2AW6 A;  2GRL A;  1WIZ A;  4FN3 A;  2LYJ A;  4I6R A;  4YG7 B;  1PRU A;  2R63 A;  4X4H A;  3JXC L;  1ADR A;  4IVZ A;  2AXZ A;  1X2L A;  2IVG A;  4J1W A;  3BDN A;  2PUC A;  1PRA A;  3B7H A;  1Y7Y A;  2B5A A;  2FJR A;  2O49 A;  4X4B A;  2PIJ A;  3CRO L;  2GZU A;  3IVP A;  1OCT C;  3GN5 B;  2MQK A;  5A7L A;  3JXD L;  3G5G A;  3OP9 A;  1IC8 A;  4JQD A;  2O4A A;  2ICT A;  2L8N A;  3G7D A;  4X4C A;  3QQ6 A;  1ZVV A;  2EWT A;  1SQ8 A;  4JCX A;  3JXB C;  2R1J L;  1GT0 C;  4MCT A;  2XSD C;  1VPW A;  3FMY A;  5K98 B;  4YG4 A;  2PUB A;  4X4E A;  2BNO A;  4O8B A; 
#chains in the Genus database with same CATH topology
 2XCC A;  5BW8 C;  3RKV A;  3ZU7 B;  5ENS D;  2AWI A;  4QFV A;  3SQV A;  2XXP A;  3OQM A;  4K5B A;  2VYI A;  3SCG A;  4Z5H A;  3LEW A;  4G24 A;  4LRZ A;  4JA9 A;  3TXM A;  3ZFW A;  1BD8 A;  3QWG A;  3Q7A A;  2B0O E;  5M72 A;  3KAE A;  5A6C A;  4HRL A;  2DBA A;  3C3O A;  1ZZ6 A;  4Y42 A;  2I9C A;  2EBY A;  4URK A;  1QP7 A;  5AAO A;  4I6T A;  3KD7 A;  1Q2Z A;  5ANL A;  5AQA A;  3EJN A;  4HLE A;  4GU5 A;  3D9L A;  2LNM A;  3RJV A;  3L17 A;  2EF8 A;  2KBX A;  3LDZ A;  1LD8 A;  2VSO E;  3MKR A;  3PUJ A;  4G8L A;  1TNU A;  2R05 A;  2DVW A;  1OCR E;  5KWD A;  4QQI A;  3MJW A;  1UJK A;  2R5S A;  4BTA A;  5AQB A;  4EZJ A;  4WNG A;  4CDR A;  3B7S A;  1B89 A;  1S63 A;  4AIF A;  2DZO A;  3MV3 B;  4XIF A;  4U0U A;  4U8H A;  4DUI A;  1TR4 A;  1H6P A;  3G2S A;  3NZL A;  1OCC E;  3RO2 A;  4AJW A;  2GZU A;  3SGH A;  4DX5 D;  2OCC E;  3G7D A;  2RFM A;  3EHM A;  3PZ3 A;  3APC A;  2L6B A;  3NOG D;  4AY5 A;  1LTX A;  4APO A;  2FUL A;  2HSG A;  5JJT A;  2LAH A;  4E6H A;  1DUL A;  3ISM C;  3BG1 B;  4GA2 A;  3ZHE A;  1X57 A;  1S64 A;  2L6J A;  3UT4 A;  1YSE A;  3FTU A;  1JWF A;  2X6H A;  3GZS A;  2OVF A;  2XS8 A;  2XXQ A;  3F6W A;  4X4D A;  1X5B A;  1Z5S C;  1IKN D;  5EN5 D;  3E33 A;  2X6K A;  4HS2 A;  4U0Z A;  5AAR A;  2GRN B;  3PZ1 A;  4YG1 A;  2VSY A;  4MCX A;  3Q7F A;  3R7Q A;  3TWU A;  1DNP A;  4XKC A;  4BEP A;  3GZ1 A;  3CEQ A;  3LFP A;  3Q47 B;  1E96 B;  3R9M A;  5KBA A;  4GTT A;  2ETA A;  1JFT A;  3Q9N C;  2NYJ A;  1UXD A;  1E8X A;  4N5C A;  3FEY A;  4HXI A;  1NA3 A;  1LMB 3;  3U9W A;  4CDN A;  2J8S D;  3IXE A;  3CHM A;  3CHR A;  4KMO A;  3FUJ A;  3SFX A;  3NB2 A;  3CVX A;  1R63 A;  3C3R A;  5ITZ F;  3UWP A;  3UXG A;  2AUW A;  3LXU X;  3OWQ A;  2LYL A;  3TWX A;  4C0M A;  5FQ6 A;  3HXF A;  3ZHE B;  1Z6T A;  1K3Z D;  4UQX A;  2VGE A;  4GZ6 A;  3HXE A;  1U3C A;  4KYO B;  3W9G A;  4LSZ E;  4FJZ A;  2MQK A;  4JQD A;  4AY6 A;  4JCX A;  2R1J L;  4JW1 A;  3DWL G;  5CCM A;  1RZR D;  4N5Q A;  3TJP A;  3PNT B;  2YBD A;  2H6H A;  2F8X K;  2CSF A;  2YQ8 A;  4GB9 A;  5BV0 A;  1NER A;  2WQH A;  5T3R A;  2BF0 X;  3VTY A;  4HOQ A;  4Q2J A;  4DJA A;  4X4G A;  4U0S A;  1HQ1 A;  4GML A;  4GZC A;  4JL0 A;  3KSL A;  2IV1 A;  1OXJ A;  1MX4 A;  4FU3 A;  3ML8 A;  3ML9 A;  3B7B A;  4H7X A;  1SA4 A;  4GQM A;  2XPY A;  4L2L A;  3ZNG A;  1TNO A;  3LVQ E;  4UUC A;  4A55 A;  4O6F A;  5CER B;  3B7U X;  3LCA A;  5IY5 E;  4K5C A;  2LXM A;  2I6H A;  2CHZ A;  3RZZ A;  4I17 A;  2Y1L E;  3ZHM A;  3CLC A;  3EIJ A;  4GZ3 A;  1FT2 A;  2I2O A;  3UKU G;  4U8Y D;  2ODR D;  3PZ4 A;  4WWN A;  4BSZ B;  2PXV A;  1LLI A;  1HZ4 A;  2VSN A;  2QY7 A;  2XS1 A;  1Y9Q A;  4EEC A;  4UQZ A;  3CK7 A;  2C0L A;  3AU5 A;  2M4H A;  3ZRH A;  3TWR A;  2L1P A;  4X4H A;  3JXC L;  4DE8 A;  3CVY A;  1UN8 A;  3EIQ C;  4YDY A;  5EKQ D;  2WVI A;  3PH0 C;  3Q49 B;  5A7L A;  2VSX E;  2DZN A;  5K98 B;  1S70 B;  1HG5 A;  4LER A;  2BNO A;  4DRX E;  5CEA A;  3U3W A;  2VTB B;  3MEK A;  3UM3 A;  1Y6I A;  1OWO A;  3Q9U C;  3MKQ A;  3I4G A;  4Z58 A;  4LUN U;  2V8S E;  3EUS A;  1WM5 A;  1LD7 A;  1ZAY A;  4WUY A;  2DYR E;  3R1F A;  1PY1 A;  2X6J A;  3HRA A;  1TN7 A;  4HLL A;  3V2O A;  4HNA D;  4J7W A;  4EZK A;  2MYO A;  2FO7 A;  1WG0 A;  1OSL A;  5CBO A;  4KT6 B;  2D5V A;  3FUN A;  2FI7 A;  2IU7 A;  3G2W A;  2PXU A;  2ZU6 B;  1IHG A;  1JCQ A;  2KPJ A;  2VQ2 A;  2WXI A;  1QYM A;  2PUF A;  3SD5 A;  1WH6 A;  2FEZ A;  5DTQ A;  1QPZ A;  4KZ0 A;  3UT8 A;  2XGS A;  1L1M A;  2A5U A;  3ZYK A;  4TV3 A;  4DI3 A;  4I1O B;  1ZPQ A;  1EDU A;  3JUI A;  3L54 A;  5ANR A;  4GTO A;  3L22 A;  4I9E A;  4ANV A;  4NIK A;  3QC1 A;  1UN9 A;  2KEK A;  1H6O A;  1MYO A;  2BKG A;  4FHK A;  1KPS B;  3R7R A;  3D9P A;  1BDI A;  3PUK A;  4B93 B;  1WET A;  2PPX A;  1RW2 A;  5DRT A;  3HXB A;  2GRR B;  3QOX A;  2C2L A;  3TL5 A;  2LYP A;  3E30 A;  2EQX A;  2NC9 A;  2L0T B;  4ANX A;  1E90 A;  3AG4 E;  1N4S A;  2VTB A;  4B8A A;  1WIZ A;  5D0O D;  3RRM B;  3MKQ B;  2A4Z A;  3VWS A;  4J1W A;  1MFQ C;  5AJD A;  2WQ6 A;  4DI4 A;  1H2T C;  3PRZ A;  3KS2 A;  2YIN A;  2PXD A;  4UWG A;  3FUL A;  2H6I A;  4BFR A;  3JQ0 A;  3FDH A;  2XCB A;  2DIW A;  4PUC A;  2GRP B;  4AV7 A;  3FTX A;  4N2Q A;  4BT9 A;  1O5M A;  5EX3 A;  4CCA A;  1EFA A;  3FFL A;  3OXL A;  1AP7 A;  2PXP A;  3FTY A;  1IXV A;  3T5V A;  4J8D A;  4FHJ A;  1UTX A;  4C48 B;  4ATZ D;  4BSX A;  3L08 A;  1KZP A;  3D9M A;  3QNK A;  2C0M A;  5JUW A;  4ANU A;  4ILG A;  3CKC A;  4MLP A;  3P1U A;  5KJM A;  5FTP A;  3UM0 A;  5ENQ D;  2LYR A;  2BJC A;  2LUH A;  2EIJ E;  1N4Q A;  4OVU A;  2P9U G;  1AU7 A;  3QYX A;  2LYS A;  3FUF A;  3Q15 A;  3UIP C;  3CVQ A;  2XRZ A;  4U8V D;  3D1N I;  2BUG A;  3QB2 A;  3Q79 A;  3ZW3 A;  2DWZ A;  1H6K A;  4PU8 A;  3CVN A;  2WM9 A;  1TNB A;  4Z59 A;  4BET A;  3FTV A;  2OOE A;  4XEI G;  3ME5 A;  3EHQ A;  1PRU A;  1ADR A;  1QNF A;  2ETC A;  2WXO A;  3DXM G;  2LAI A;  2XEH A;  3ZKJ A;  1N4R A;  2F0Y A;  3IHY A;  3CRO L;  2JQE A;  2OEV A;  4RSY A;  3FUE A;  3JXD L;  2XGM A;  3E4B A;  1SQ8 A;  4HOS A;  2HE0 A;  1UOH A;  4CT4 A;  5AYW D;  3JQ1 A;  4U63 A;  2BED A;  2PUB A;  3AAA C;  3PS6 A;  1EYH A;  4J8Y A;  4L1B A;  4U96 D;  4OB4 A;  3OKZ A;  1ZZ9 A;  3ABK E;  3T5X A;  1WY6 A;  3V2X A;  2XRY A;  5KJK A;  2OFY A;  4Y6W A;  3GN5 A;  5CBN A;  4O1O A;  2PUD A;  4ER3 A;  2WXL A;  2V0P A;  4XX5 A;  3E34 A;  2ZIR A;  3ZKC A;  1JCS A;  2IUO A;  3CVW A;  4BES A;  2I1J A;  3HG0 D;  2Y3A A;  3AS5 A;  3A9Z A;  2LYK A;  4ANW A;  5B1B E;  3MV2 B;  5CED B;  2MXD A;  3V79 K;  5EYP F;  5CEC B;  5ENR D;  4K03 A;  4EBA A;  2ICP A;  1RZR A;  4Y6C A;  1LQC A;  2XPZ A;  1K1B A;  3DXK G;  4A1S A;  2OVB A;  3CK9 A;  4G8K A;  3CLJ A;  3FTW A;  5LFA A;  1IQU A;  4JHJ A;  1A5E A;  3B95 A;  1ELK A;  1TYQ G;  3LQX A;  3AS8 A;  2Y4T A;  2BNN A;  3R09 A;  1JCR A;  1AWC B;  2IOS A;  1BI8 B;  3IV0 A;  2VGY A;  2ZGD A;  5FZQ A;  3SHF A;  3IEG A;  4CGV A;  3UKR G;  4GZD A;  1K1A A;  4KZC A;  1H2V C;  2IJG X;  2AW6 A;  1WDY A;  2LYJ A;  2IF4 A;  3B13 A;  3UM1 A;  3S7J A;  4X4B A;  1OT8 A;  3KEZ A;  2O4A A;  3GN5 B;  2KCL A;  5DBK A;  5D66 A;  3JXB C;  3WG7 E;  3C5R A;  2UWJ G;  1VPW A;  4GA0 A;  5FQ7 A;  1KLX A;  2E0I A;  3HYM B;  3MGB A;  5J08 A;  3UM2 A;  4F8D A;  4ILH B;  2XQ0 A;  1DCQ A;  4G11 A;  1A17 A;  2V5F A;  3ZXP A;  1SA5 A;  5DTR A;  1X81 A;  2XHE A;  3CHQ A;  5CRV A;  3LS8 A;  4Q94 A;  3G2U A;  2J07 A;  3P2B A;  4MKT A;  4JB8 P;  4OAV B;  3R9A B;  2IFU A;  4KBQ A;  4DLQ A;  3CEC A;  2IQC A;  3LY9 A;  3RK6 A;  3TWW A;  4RG9 A;  3O9X A;  2LXL A;  1KZO A;  5A7D B;  4OAU C;  2XGO A;  2A5E A;  2CG3 A;  5T4Y A;  4FUL A;  2PQR A;  4HB5 A;  3EU9 A;  1RZS A;  3UFD A;  2RD0 A;  4JPS A;  5D0Q D;  2V4L A;  2MHK A;  3U64 A;  2IO2 C;  5DSX A;  4X4I A;  3QDN A;  3MX3 A;  4U04 A;  4L2Y A;  4I2W A;  4XZ4 A;  1HF8 A;  2ILR A;  2PZI A;  1IHB A;  3QOW A;  2WXM A;  4UI9 C;  4YVQ C;  3DSS A;  2KCV A;  4M7C A;  4NQ0 A;  3FUK A;  2XEE A;  1KT0 A;  3J5Q B;  1OWP A;  2HYZ A;  3L9T A;  5H7P A;  3C98 A;  4I1M A;  2FO1 E;  4BTB A;  4IRU A;  3FHE A;  5J90 A;  1UG3 A;  5FQ4 A;  2KAT A;  4DLO A;  2FJR A;  2PIJ A;  3OP9 A;  1BLX B;  1P5Q A;  1TJF A;  3TEL A;  5AJL A;  4MCT A;  3MZL B;  4MBG A;  4GYO A;  3ZYM A;  4O8B A;  2P9K G;  3UMV A;  3DSV A;  3HDX A;  4RLY A;  4P29 A;  2XJ3 A;  1U3D A;  1Y8M A;  3ASF A;  3SO8 A;  3GYZ A;  3HIZ A;  1MQS A;  3IBE A;  4I6G A;  4Z5C A;  2FF4 A;  2CFZ A;  2PUA A;  3BD1 A;  1OCZ E;  3NBN B;  3CK8 A;  3NOC D;  2KEJ A;  2KZ8 A;  5ENO D;  2ZXW E;  2WXQ A;  3PZ2 A;  5BNW A;  5EYL A;  3UIO C;  4A3T A;  4CRW A;  5GAG i;  3Q73 A;  5JHB A;  2Y0B G;  1LCC A;  3QF3 A;  2J49 A;  4R7L A;  5T8I A;  3DSU A;  3G2V A;  1PNR A;  5B3S E;  1W3B A;  3E37 A;  3J5P A;  3HXC A;  1OUV A;  2BKK B;  3PZD A;  4MRU A;  2PM7 A;  3CHO A;  4AOF A;  4ACK A;  1O4X A;  3LIS A;  4FLH A;  4XI9 A;  3AG3 E;  1JPL A;  3APF A;  3QWV A;  3FYA A;  3CR3 A;  3UPV A;  3ONK A;  2KXP C;  3GW4 A;  4LCT A;  3TWQ A;  3OAW A;  2XCJ A;  5AQ7 A;  2PM6 A;  1PAQ A;  1NZN A;  3O4Z A;  2IU1 A;  1NI1 A;  1YA0 A;  3TXN A;  3LY8 A;  4LNU D;  1FPP A;  1QP4 A;  1TNY A;  1INZ A;  4TUU A;  5FIO A;  2R63 A;  4DX7 D;  4GMR A;  3FTS A;  2PUC A;  4B89 A;  5BXO A;  5JMN D;  3QAQ A;  2L9B A;  2HCN A;  1ZVV A;  3UIN C;  4GCO A;  1N52 A;  3JCK C;  3JUE A;  3PDN A;  2XXA A;  4LNB A;  5ENN A;  3BUA A;  3ZGQ A;  3LJ3 A;  3MCX A;  4NUR A;  1POU A;  4WAF A;  3Q5M A;  2OEW A;  3UT7 A;  4TXQ A;  4EKG A;  3ZUV B;  3OQN A;  4YVO A;  5AQ9 A;  1YYH A;  2J4D A;  4HFG A;  5G04 C;  5JJ6 A;  1UXC A;  2PQN A;  2BNM A;  5G55 A;  3FUM A;  2LCV A;  1LF8 A;  3QFI A;  3FWV A;  3DNV B;  5BXU A;  3TGO A;  2EIK E;  2IVB A;  1MJ0 A;  2PXE A;  3M9L A;  2LLW A;  1ZB1 A;  4ER5 A;  2ION A;  2M63 A;  4JEH A;  3UX4 A;  5JJ7 A;  4HVB A;  5E75 A;  4YAR A;  4O1P A;  2E2E A;  4PDX A;  4NRH B;  4YDE A;  2UY1 B;  4ZHB A;  1E8Z A;  1YMP A;  2KZT B;  3FH5 A;  3S2A A;  4OBM A;  4BX8 A;  2P9I G;  2PUE A;  4L23 A;  3RIB A;  4Q96 A;  3CKB A;  1QQB A;  4G1T A;  2IEJ A;  1ZBP A;  3CHS A;  4MS6 A;  3MEJ A;  3CSF A;  3KXA A;  4EHM A;  4I8T A;  2PL2 A;  2GRL A;  4I6R A;  2PXL A;  4F53 A;  5CHE E;  3S7B A;  1HE8 A;  1PRA A;  3V31 A;  4DK5 A;  3L6A A;  4U07 A;  5EIB E;  1TNZ A;  4X4C A;  3E32 A;  1NP7 A;  2WXK A;  2X3M A;  2J7U A;  4J8F A;  3ULQ A;  1DCE A;  3QK0 A;  3HZI B;  4HRA A;  3KJX A;  5KNH D;  3DPY A;  3NRO A;  2R03 A;  4GPM A;  2P9L G;  2AVP A;  3PE4 A;  2P2C P;  2DCP A;  1U2V G;  3AJI A;  3OTN A;  2AXU A;  3D3M A;  4UI9 K;  1FT1 A;  4IUL A;  3ONL A;  4ILI A;  1QQE A;  3UUX A;  3ULY A;  3FUD A;  4G2V A;  1NL4 A;  1N0R A;  2UY1 A;  4X4F A;  2R2L A;  5DIZ A;  2KZT A;  4FBI A;  2NXP A;  1SZA A;  5CCL A;  2XZT G;  3ASH A;  3KEA A;  1YCS B;  4GTP A;  1N9A A;  4RG6 A;  2WMO A;  4W9R A;  3SX0 A;  2XI8 A;  2JCG A;  4WWP A;  4JXT A;  3LVR E;  2HM8 A;  2GW1 A;  4B0Z A;  3ESK A;  4GTR A;  5BUZ A;  4I6E A;  3G2T A;  2XEN A;  2I1K A;  2P9N G;  3S7D A;  4BWR A;  3UQ3 A;  4LNG A;  4TXP A;  3FU0 A;  4AEZ C;  5C1D A;  3KL4 A;  2Q7F A;  4ZFH A;  3LY7 A;  4PS3 A;  4J8E A;  1IYG A;  4A63 B;  4OYS A;  3DBS A;  2EIN E;  2PXB A;  3ZYL A;  3T9K A;  3QWP A;  2ICT A;  3ZPX A;  4JD2 G;  5EDS A;  1GT0 C;  3RSE G;  2XSD C;  1D8E A;  4ER6 A;  4BER A;  4OVV A;  1MHQ A;  3URZ A;  3CVP A;  1VDY A;  1LCD A;  5FQ8 A;  1H2U A;  1JH9 A;  1BI7 B;  2GRQ B;  3MLF A;  2VEO A;  4GTM A;  3SY2 A;  4EK9 A;  2WIU B;  4F6R D;  3SZ7 A;  4M3O A;  2H6G A;  3EUV A;  3AU4 A;  5BPP A;  4EZI A;  5KJN A;  5G04 J;  4ABN A;  4YBA A;  3W9F A;  1SW6 A;  4ATG A;  3F6Q A;  1TN8 A;  2P9P G;  3C3Q A;  4WNF A;  5LOZ A;  2WMN A;  4RVB A;  3ZN3 A;  2YHE A;  5A23 A;  4WNE A;  2LNI A;  1NEQ A;  2H6F A;  4CT0 A;  3D9N A;  1WH8 A;  4IWR A;  3B7T A;  3HXD A;  5G2N A;  1K8K G;  5EIL A;  1DWK A;  5CMW A;  2PE5 A;  5HQ8 A;  1DW9 A;  1ZZ7 A;  2BTD A;  3T8K A;  4EQZ A;  4BT8 A;  3I5P A;  4U7E B;  3NXH A;  5AEN A;  1D9S A;  4DPR A;  1R69 A;  3H5T A;  1O1R A;  5ENP D;  1BDH A;  2ZGG A;  4AP2 A;  2P9S G;  4LEU A;  2AJA A;  3D9O A;  2XIU A;  4GYW A;  3WXX A;  2JEK A;  3GZ2 A;  5KCM A;  4HI9 A;  4N3B A;  4I1A A;  3UTM A;  1BU9 A;  3O48 A;  2IVG A;  4EZL A;  2B5A A;  3BG0 B;  3TWV A;  2QFC A;  4G23 A;  3K9I A;  4UQY A;  3IVP A;  1OCT C;  2L8N A;  3QQ6 A;  2EWT A;  1MX2 A;  1L5J A;  4X4E A;  4ER7 A;  1QQA A;  4CEM A;  1D8D A;  4F1P A;  5EID A;  3QKY A;  4IYP A;  4JCY A;  4FJY A;  3Q4A B;  4Z5D A;  3FH8 A;  1TJC A;  1DC2 A;  4B8C B;  2X38 A;  4GZ5 A;  3A9X A;  4WND A;  2L49 A;  5D2M C;  1TEZ A;  3ULE G;  1Z3Y A;  1PRV A;  4IN3 B;  1QB2 A;  4AM9 A;  3SCH A;  3FUH A;  1E7U A;  3IHV A;  3DPD A;  3D9H A;  3CIA A;  4HQD A;  4N3C A;  5DT2 A;  2HR2 A;  4GYY A;  1B0N A;  2KC7 A;  3V30 A;  2WXF A;  3QWW A;  3KSQ A;  3SCF A;  5HI7 A;  3GZC A;  4I6U A;  4YDO A;  1RIO A;  3F52 A;  4J6I A;  1QP0 A;  3ASG A;  3QAR A;  4PU7 A;  5FZS A;  2B6C A;  2KM4 A;  3NZS A;  5G05 J;  2JVL A;  3PEV B;  4KXK B;  2WXR A;  3OQO A;  3OMT A;  5HKP A;  2DYS E;  3DSW A;  4BY6 A;  4GHJ A;  2CRO A;  2YNQ A;  2H8R A;  4A3V A;  3FU6 A;  3EHR A;  3GBF A;  2J4B A;  2L0I A;  3MYV A;  3L1P A;  4XKB A;  1UW4 B;  1NW3 A;  2CHX A;  3DSX A;  3QJZ A;  4G25 A;  2IOL A;  3D9I A;  3TEP A;  4I43 A;  1JWG A;  3RAU A;  1XNF A;  3EU5 A;  3JYS A;  3PE5 A;  4JZY A;  3L82 A;  4IVZ A;  2R02 A;  2WPV A;  3B7H A;  1Y7Y A;  2O49 A;  3VLE A;  3VLD A;  3SFY A;  1HG2 A;  3EDT B;  4PS7 A;  1O1T A;  3SI5 A;  2IY0 C;  2LO6 A;  4KVM A;  2LLV A;  1N4P A;  5DRY A;  4AVX A;  5LP0 A;  4CZ2 D;  2XEV A;  1FVF A;  4FC8 A;  5FZR A;  1NA0 A;  3TWT A;  5LCW J;  3VTX A;  1CQT A;  4I6J A;  1PER L;  2IVQ A;  1EPU A;  4DX2 A;  4Z68 A;  1HO8 A;  3JXJ A;  2JAB A;  4GMJ A;  1N95 A;  2XPI A;  4H7Y A;  3ENE A;  3MA5 A;  3UI2 A;  1QZX A;  2HO1 A;  2LYQ A;  2ZIS A;  4YDW A;  2FFH A;  4HI8 A;  4UI9 J;  4I9C A;  2O38 A;  3I3N A;  4C0E A;  4F7A A;  4HRN A;  3VLF A;  3ZHI A;  1ZS4 A;  3CQG B;  5LX8 A;  4F1S A;  3FU3 A;  2WXN A;  3BQO A;  2YHC A;  2PXQ A;  2LSV A;  4V3I A;  3TG4 A;  3SF4 A;  3CVU A;  3T8M A;  4I2Z A;  2CG2 A;  3PEU B;  4LG6 A;  3BU8 A;  1U2Z A;  4F3V A;  1RZ4 A;  3LKU A;  1HU3 A;  2IO3 C;  3ABM E;  1S7E A;  3CV0 A;  5DTM A;  3PNL B;  4JC8 A;  3CGH A;  3JXI A;  5GAH i;  4PH4 B;  4UWK A;  4D10 C;  2NSZ A;  1E7V A;  5CRU A;  4HRM B;  2GRM A;  1HXI A;  1V55 E;  1HH8 A;  3LPZ A;  3HVE A;  2V5Q C;  1OWM A;  2VJ8 A;  4KVO A;  2OV8 A;  2WXH A;  1O1S A;  3NF1 A;  2ETB A;  3FU5 A;  3ESL A;  3ZEF A;  1N11 A;  1SQM A;  3IKO B;  4K0R A;  4XE0 A;  3ASD A;  3SBT B;  3AG2 E;  1PC2 A;  3G0T A;  3ZXS A;  1N94 A;  4L7T A;  2QYU A;  4E85 A;  1SZ9 A;  2EIM E;  4FAD A;  2X6I A;  4DX1 A;  1ZZC A;  5HRY A;  5FJY A;  4EBA G;  4ME2 A;  3FY4 A;  3LYA A;  2OR1 L;  3QOU A;  3X2Q E;  4Q69 A;  3CQC B;  3ABL E;  2X6F A;  2HCS A;  2V4H C;  3RU0 A;  2QYJ A;  3BS3 A;  2J7W A;  4ACL A;  4K5A B;  5FIN A;  2F37 A;  1MZC A;  4C9B B;  2RKK A;  1CJG A;  3PE3 A;  3NQP A;  1OCO E;  3NDB B;  1FCH A;  2HIN A;  2PNN A;  5ARF A;  2QC9 A;  1WAO 1;  2CFU A;  1HFA A;  4GTV A;  1JFS A;  1ZUG A;  3HVE B;  5CMY A;  3RO3 A;  2WUS R;  3TG5 A;  1Z3X A;  2V3C C;  4JHK A;  3GZD C;  3TRB A;  3U4T A;  5JHA A;  2FBN A;  1MX6 A;  5E76 A;  3SFZ A;  2OND A;  3S7F A;  3FTZ A;  4YG7 B;  4J8S A;  1SVX A;  4UWF A;  3SNX A;  3L13 A;  3BDN A;  4TRQ A;  4A1G A;  3L16 A;  4GCN A;  2EIL E;  3G5G A;  1IC8 A;  1OY3 D;  2J08 A;  4FP7 A;  4APF A;  4GAA A;  1ELW A;  4EKI A;  4UWH A;  1OWN A;  2WXJ A;  3FMY A;  1GW6 A;  3ZYQ A;  3DM5 A;  3KZ3 A;  1E3O C;  4EQF A;  3F51 A;  5LCW C;  1RPE L;  2MEZ A;  2PXF A;  2AXV A;  3DEO A;  3DRA A;  4FLB A;  4HOU A;  3A9Y A;  3AS4 A;  2WB2 A;  3I4R B;  5AN8 A;  1ZU2 A;  3D9J A;  4UWL A;  1G3N B;  2J09 A;  1N0Q A;  1TN6 A;  4J1X A;  3FEX A;  4DX6 D;  2Y4U A;  4N2S A;  2WQ7 A;  3AG1 E;  4FA6 A;  5KJL A;  4PU4 C;  5EX0 A;  4ER0 A;  2P58 C;  4JA7 A;  1H0A A;  1V54 E;  3RRU A;  4HOT A;  4DE9 A;  3CVV A;  4BX9 A;  1NFI E;  4PU3 C;  3EHN A;  1OWL A;  1KT1 A;  2J9Q A;  4IA8 A;  4YND A;  3ASN E;  3FYM A;  2MOW A;  3S8Q A;  3CHP A;  4WVL A;  1E8W A;  4GTQ A;  4HBD A;  1QBQ A;  3CVL A;  3RRN B;  1DVP A;  4NDW A;  1UJJ A;  1ZZ8 A;  3ASO E;  3C72 A;  4JVS A;  5JA4 D;  3CST A;  4PS8 A;  2QZA A;  2VGX B;  4GTS A;  4FN3 A;  4N3A A;  3ZIM A;  1BPO A;  3TFL A;  1X2L A;  2GRO B;  4HOR A;  3NAW A;  4L9P A;  4CGW A;  3OXG A;  3APD A;  1N54 A;  3B7R L;  5FT9 A;  4X8Q A;  4YG4 A;  3GZD A;  2CHW A;  5C2Y A;  1HX8 A;  4TXR A;  1ZZB A;  1HF0 A;  3FUI A;  2MRI A;  2WXG A;  3BEE A;  2WXP A;  1ELR A;  3DST A;  1HS6 A;  2KEI A;  2GGF A;  4WWO A;  2PXT A;  3U66 A;  4XI0 A;  4CDM A;  3PRE A;  4TUM A;  3SBS A;  3DEP A;  3N71 A;  2KCK A;  1JWL A;  2PXK A;  3PXP A;  1FVH A;  2Y69 E;  2JLB A;  3OXF A;  5ENT D;  4G26 A;  4GA1 A;  2RFA A;  1XGW A;  3TAX A;  5HS0 A;  4U95 D;  3D9K A;  1QZ2 A;  5ARG A;  3FP3 A;  4CYM D;  2A6C A;  4O60 A;  4RQI A;  2R17 C;  4JHR A;  2VGX A;  3TWS A;  2RG8 A;  3ZVV A;  2PUG A;  2F8Y A;  5KNG A;  5AIJ A;  3VK0 A;  3ZPJ A;  1XWR A;  2HFZ A;  5BV1 A;  3Q75 A;  4B94 A;  4N39 A;  1EF1 C;  4JEU A;  5FWQ A;  5G05 C;  1S0P A;  4AXH A;  3Q78 A;  3SR4 A;  3NZU A;  5B1A E;  1IQR A;  3FH7 A;  1H19 A;  4NAC A;  4EPZ A;  2R59 A;  1JUQ A;  2AXZ A;  3GUU A;  2LSU A;  2XZD G;  3LJN A;  3HHM A;  4J0U A;  1E8Y A;  5BT1 A;  3PVL A;  4GPK A; 
#chains in the Genus database with same CATH homology
 2XCC A;  4NUR A;  4PUC A;  5BW8 C;  3RKV A;  1POU A;  4WAF A;  3Q5M A;  3UT7 A;  2XEV A;  4AV7 A;  1FVF A;  2AWI A;  4QFV A;  3FTX A;  4FC8 A;  5FZR A;  4N2Q A;  4BT9 A;  1NA0 A;  3OQM A;  5EX3 A;  4CCA A;  1EFA A;  2VYI A;  3FFL A;  3OXL A;  5LCW J;  3OQN A;  3SCG A;  3FTY A;  4Z5H A;  3LEW A;  4G24 A;  4YVO A;  2J4D A;  4LRZ A;  4HFG A;  4JA9 A;  5G04 C;  5JJ6 A;  1CQT A;  3VTX A;  3T5V A;  1UXC A;  1PER L;  2IVQ A;  1EPU A;  4I6J A;  2PQN A;  3TXM A;  2BNM A;  5G55 A;  1HO8 A;  4J8D A;  3FUM A;  3ZFW A;  4FHJ A;  3QWG A;  2LCV A;  1LF8 A;  1UTX A;  5M72 A;  3KAE A;  5A6C A;  4GMJ A;  2XPI A;  3FWV A;  3L08 A;  4BSX A;  4H7Y A;  2DBA A;  3ENE A;  3MA5 A;  3DNV B;  2HO1 A;  2LYQ A;  1ZZ6 A;  3TGO A;  3D9M A;  4Y42 A;  2IVB A;  3QNK A;  2I9C A;  2EBY A;  2C0M A;  4URK A;  1QP7 A;  4ANU A;  4ILG A;  4UI9 J;  4I6T A;  3CKC A;  3KD7 A;  3P1U A;  4MLP A;  5ANL A;  2ION A;  4I9C A;  2O38 A;  3EJN A;  3I3N A;  4HLE A;  4GU5 A;  2M63 A;  4JEH A;  3D9L A;  5FTP A;  5KJM A;  4C0E A;  4F7A A;  3VLF A;  3ZHI A;  3UX4 A;  5JJ7 A;  1ZS4 A;  2LYR A;  2BJC A;  3CQG B;  4HVB A;  5LX8 A;  3RJV A;  4F1S A;  5E75 A;  3L17 A;  3FU3 A;  4YAR A;  2EF8 A;  3LDZ A;  4OVU A;  2WXN A;  1AU7 A;  2YHC A;  2E2E A;  3QYX A;  4PDX A;  2LSV A;  4NRH B;  2LYS A;  5G05 C;  4V3I A;  2UY1 B;  3TG4 A;  1E8Z A;  3FUF A;  3SF4 A;  3CVU A;  2KZT B;  3FH5 A;  3S2A A;  3Q15 A;  4I2Z A;  2CG2 A;  3PEU B;  3T8M A;  2VSO E;  3MKR A;  4BX8 A;  2PUE A;  3CVQ A;  4L23 A;  2XRZ A;  3PUJ A;  4F3V A;  3LKU A;  3RIB A;  3D1N I;  1HU3 A;  4Q96 A;  2BUG A;  3CKB A;  1QQB A;  1S7E A;  3CV0 A;  3PNL B;  3QB2 A;  4G1T A;  4JC8 A;  5T8I A;  3MJW A;  1UJK A;  1ZBP A;  2R5S A;  3CHS A;  4MS6 A;  3CGH A;  4BTA A;  4EZJ A;  4WNG A;  3ZW3 A;  1H6K A;  4CDR A;  4PU8 A;  3B7S A;  4PH4 B;  4UWK A;  3CSF A;  1B89 A;  2NSZ A;  3CVN A;  3KXA A;  4D10 C;  2WM9 A;  1E7V A;  4I8T A;  4Z59 A;  3FTV A;  4AIF A;  2OOE A;  2GRM A;  2PL2 A;  1HXI A;  2GRL A;  3MV3 B;  4I6R A;  4XIF A;  4F53 A;  1PRU A;  1ADR A;  4U0U A;  1HH8 A;  1QNF A;  4U8H A;  2WXO A;  3LPZ A;  5CHE E;  2LAI A;  3HVE A;  3S7B A;  1OWM A;  2VJ8 A;  3IHY A;  1HE8 A;  1PRA A;  4KVO A;  2OV8 A;  4DK5 A;  3G2S A;  3CRO L;  2WXH A;  3RO2 A;  4AJW A;  3NF1 A;  2GZU A;  3L6A A;  4RSY A;  3FUE A;  4U07 A;  3SGH A;  3JXD L;  2XGM A;  3E4B A;  4X4C A;  3G7D A;  1NP7 A;  2WXK A;  3EHM A;  3FU5 A;  1SQ8 A;  2X3M A;  3APC A;  4HOS A;  4AY5 A;  4CT4 A;  3ESL A;  5AYW D;  3JQ1 A;  3ZEF A;  4U63 A;  2PUB A;  4J8F A;  1SQM A;  3IKO B;  4K0R A;  4XE0 A;  3ULQ A;  4APO A;  3PS6 A;  3ASD A;  3SBT B;  3QK0 A;  3HZI B;  1EYH A;  2FUL A;  2HSG A;  1PC2 A;  3ZXS A;  5JJT A;  2LAH A;  3KJX A;  4L7T A;  4E6H A;  4L1B A;  4E85 A;  1SZ9 A;  3BG1 B;  4GA2 A;  3ZHE A;  1X57 A;  2X6I A;  4FAD A;  4OB4 A;  1ZZC A;  1ZZ9 A;  3T5X A;  1WY6 A;  5FJY A;  2L6J A;  2XRY A;  3UT4 A;  2OFY A;  4EBA G;  5KJK A;  4ME2 A;  2AVP A;  3PE4 A;  4Y6W A;  3GN5 A;  1YSE A;  2DCP A;  3FTU A;  3OTN A;  3FY4 A;  3LYA A;  2OR1 L;  2AXU A;  1JWF A;  3D3M A;  2X6H A;  2PUD A;  3QOU A;  4UI9 K;  2WXL A;  2V0P A;  4Q69 A;  3CQC B;  4XX5 A;  3GZS A;  4IUL A;  2OVF A;  3ZKC A;  3F6W A;  3ONL A;  4ILI A;  2IUO A;  4X4D A;  1QQE A;  1X5B A;  3CVW A;  3UUX A;  2I1J A;  2X6F A;  3FUD A;  4G2V A;  2UY1 A;  2Y3A A;  4X4F A;  3AS5 A;  5DIZ A;  2KZT A;  2LYK A;  4FBI A;  2NXP A;  1SZA A;  2X6K A;  4HS2 A;  4U0Z A;  4ANW A;  3RU0 A;  4YG1 A;  3BS3 A;  2VSY A;  5CCL A;  4ACL A;  4MCX A;  3MV2 B;  3ASH A;  3R7Q A;  4C9B B;  3PE3 A;  1CJG A;  1DNP A;  3NQP A;  4K03 A;  4XKC A;  4EBA A;  3GZ1 A;  3CEQ A;  3LFP A;  3Q47 B;  2ICP A;  1RZR A;  2WMO A;  4RG6 A;  1E96 B;  4W9R A;  4Y6C A;  1LQC A;  1FCH A;  2HIN A;  2XPZ A;  5ARF A;  2XI8 A;  4A1S A;  2JCG A;  2OVB A;  3CK9 A;  4WWP A;  1JFT A;  3CLJ A;  3FTW A;  5LFA A;  1IQU A;  1UXD A;  1E8X A;  4JHJ A;  4N5C A;  4JXT A;  3FEY A;  3LVR E;  4HXI A;  1ELK A;  2HM8 A;  1NA3 A;  2GW1 A;  1WAO 1;  1LMB 3;  2CFU A;  2Y4T A;  2BNN A;  1HFA A;  3AS8 A;  3ESK A;  3U9W A;  4B0Z A;  4CDN A;  1JFS A;  1ZUG A;  3CHM A;  3G2T A;  3HVE B;  4I6E A;  5BUZ A;  2I1K A;  5CMY A;  2IOS A;  3RO3 A;  3S7D A;  3CHR A;  2WUS R;  3TG5 A;  1Z3X A;  4KMO A;  3UQ3 A;  4BWR A;  3IV0 A;  2VGY A;  3FU0 A;  3FUJ A;  4JHK A;  4AEZ C;  5C1D A;  5FZQ A;  3SHF A;  3IEG A;  4CGV A;  3CVX A;  3TRB A;  1R63 A;  4GZD A;  2Q7F A;  3U4T A;  2AUW A;  5JHA A;  3LXU X;  2FBN A;  3LY7 A;  4KZC A;  1H2V C;  5E76 A;  2LYL A;  3SFZ A;  2OND A;  2IJG X;  3S7F A;  4C0M A;  3FTZ A;  2AW6 A;  5FQ6 A;  4YG7 B;  2LYJ A;  4J8S A;  4PS3 A;  4UWF A;  4J8E A;  3SNX A;  3ZHE B;  2IF4 A;  1IYG A;  1Z6T A;  3B13 A;  4UQX A;  3L13 A;  4GZ6 A;  3BDN A;  4OYS A;  3DBS A;  4TRQ A;  1U3C A;  4A1G A;  3S7J A;  4X4B A;  4KYO B;  3ZYL A;  3L16 A;  4GCN A;  3KEZ A;  2O4A A;  3GN5 B;  2MQK A;  4FJZ A;  4JQD A;  3G5G A;  1IC8 A;  2J08 A;  2KCL A;  4FP7 A;  4AY6 A;  3QWP A;  2ICT A;  4APF A;  4JCX A;  5DBK A;  3JXB C;  2R1J L;  4GAA A;  4JW1 A;  5EDS A;  1ELW A;  1GT0 C;  4UWH A;  1OWN A;  2XSD C;  1VPW A;  2UWJ G;  2WXJ A;  4GA0 A;  3FMY A;  5FQ7 A;  1KLX A;  1GW6 A;  2E0I A;  3HYM B;  3MGB A;  1RZR D;  5CCM A;  5J08 A;  3TJP A;  3PNT B;  3ZYQ A;  3KZ3 A;  4F8D A;  1E3O C;  4ILH B;  2CSF A;  2YQ8 A;  4GB9 A;  4EQF A;  2XQ0 A;  5BV0 A;  3F51 A;  1NER A;  1RPE L;  2MEZ A;  4OVV A;  2AXV A;  1MHQ A;  2WQH A;  5LCW C;  4G11 A;  4FLB A;  5T3R A;  3URZ A;  1A17 A;  2V5F A;  3CVP A;  4HOU A;  1VDY A;  1LCD A;  2XHE A;  5FQ8 A;  3CHQ A;  2BF0 X;  3LS8 A;  3AS4 A;  4Q94 A;  3VTY A;  3G2U A;  1H2U A;  1JH9 A;  4HOQ A;  2J07 A;  4DJA A;  4X4G A;  3P2B A;  4MKT A;  4U0S A;  2WB2 A;  3MLF A;  3I4R B;  3R9A B;  1ZU2 A;  2IFU A;  3D9J A;  4GML A;  4GZC A;  4JL0 A;  4KBQ A;  2IV1 A;  2WIU B;  4DLQ A;  4UWL A;  2J09 A;  3CEC A;  4FU3 A;  3FEX A;  4J1X A;  3ML8 A;  3SZ7 A;  2Y4U A;  4M3O A;  2IQC A;  3ML9 A;  4N2S A;  3LY9 A;  2WQ7 A;  3RK6 A;  4FA6 A;  5KJL A;  3AU4 A;  4H7X A;  5BPP A;  4RG9 A;  4PU4 C;  5EX0 A;  3O9X A;  5KJN A;  5G04 J;  2P58 C;  4YBA A;  4GQM A;  4JA7 A;  5A7D B;  4ABN A;  2XGO A;  2XPY A;  1H0A A;  3RRU A;  2CG3 A;  4L2L A;  5T4Y A;  4ATG A;  4FUL A;  4HOT A;  3CVV A;  5LOZ A;  4BX9 A;  3LVQ E;  4WNF A;  2WMN A;  2PQR A;  4A55 A;  4RVB A;  4O6F A;  3ZN3 A;  2YHE A;  1RZS A;  3UFD A;  3B7U X;  4WNE A;  5A23 A;  2RD0 A;  2LNI A;  3LCA A;  1NEQ A;  4JPS A;  4PU3 C;  3EHN A;  4CT0 A;  3D9N A;  1WH8 A;  5D0Q D;  4IWR A;  3B7T A;  1OWL A;  2V4L A;  2I6H A;  1KT1 A;  2J9Q A;  2CHZ A;  2MHK A;  3U64 A;  3RZZ A;  4I17 A;  5G2N A;  4IA8 A;  4X4I A;  3ZHM A;  3CLC A;  3EIJ A;  3QDN A;  3MX3 A;  4YND A;  3FYM A;  4GZ3 A;  4L2Y A;  4U04 A;  2I2O A;  1DWK A;  4I2W A;  4XZ4 A;  2MOW A;  1HF8 A;  3S8Q A;  5CMW A;  2PE5 A;  5HQ8 A;  4WWN A;  2ILR A;  1DW9 A;  2PZI A;  2WXM A;  1LLI A;  1HZ4 A;  4UI9 C;  3CHP A;  1ZZ7 A;  2BTD A;  2VSN A;  2QY7 A;  4YVQ C;  1Y9Q A;  4BT8 A;  3I5P A;  2KCV A;  1E8W A;  5AEN A;  4EEC A;  4UQZ A;  3CK7 A;  4NQ0 A;  4DPR A;  3CVL A;  3RRN B;  1R69 A;  3H5T A;  3FUK A;  1DVP A;  1BDH A;  2C0L A;  4NDW A;  1UJJ A;  1ZZ8 A;  3AU5 A;  1KT0 A;  4AP2 A;  1OWP A;  4LEU A;  2HYZ A;  3D9O A;  2XIU A;  3C98 A;  4GYW A;  4I1M A;  4JVS A;  4BTB A;  3WXX A;  3CST A;  4IRU A;  4PS8 A;  3FHE A;  2JEK A;  3ZRH A;  3GZ2 A;  5J90 A;  2VGX B;  1UG3 A;  5FQ4 A;  2KAT A;  4FN3 A;  4X4H A;  4N3A A;  5KCM A;  4N3B A;  3JXC L;  4I1A A;  3ZIM A;  3CVY A;  1BPO A;  1UN8 A;  3O48 A;  3EIQ C;  5EKQ D;  1X2L A;  2IVG A;  2WVI A;  4DLO A;  4EZL A;  4HOR A;  2B5A A;  2FJR A;  3BG0 B;  2QFC A;  2PIJ A;  3PH0 C;  3Q49 B;  3K9I A;  4G23 A;  4UQY A;  3IVP A;  1OCT C;  5A7L A;  3OP9 A;  2L8N A;  2VSX E;  1P5Q A;  3QQ6 A;  1TJF A;  2EWT A;  5AJL A;  3OXG A;  3APD A;  4CGW A;  1N54 A;  3B7R L;  5FT9 A;  4MCT A;  3MZL B;  5K98 B;  4YG4 A;  4GYO A;  1L5J A;  1HG5 A;  4LER A;  3ZYM A;  4X4E A;  2CHW A;  1QQA A;  2BNO A;  4CEM A;  4O8B A;  3U3W A;  3QKY A;  4IYP A;  4JCY A;  1HX8 A;  4FJY A;  5C2Y A;  3UMV A;  1ZZB A;  2VTB B;  3MEK A;  3Q4A B;  1HF0 A;  3HDX A;  4Z5D A;  3FH8 A;  1Y6I A;  1TJC A;  1OWO A;  2MRI A;  3FUI A;  2XJ3 A;  1U3D A;  1Y8M A;  4P29 A;  3MKQ A;  4B8C B;  2X38 A;  3ASF A;  4GZ5 A;  4WND A;  2WXG A;  3BEE A;  3I4G A;  3GYZ A;  2WXP A;  4Z58 A;  1MQS A;  1ELR A;  3HIZ A;  4Z5C A;  3IBE A;  4I6G A;  2FF4 A;  2CFZ A;  4LUN U;  2L49 A;  1HS6 A;  2V8S E;  1TEZ A;  2KEI A;  1Z3Y A;  1PRV A;  3BD1 A;  2PUA A;  4IN3 B;  3EUS A;  1WM5 A;  1ZAY A;  2GGF A;  3R1F A;  3CK8 A;  4WUY A;  4AM9 A;  3SCH A;  2KEJ A;  1PY1 A;  2KZ8 A;  2X6J A;  3FUH A;  4WWO A;  3U66 A;  4XI0 A;  1E7U A;  3IHV A;  2WXQ A;  3DPD A;  5BNW A;  3CIA A;  4N3C A;  4A3T A;  4CDM A;  4CRW A;  4EZK A;  3PRE A;  3SBS A;  5JHB A;  1LCC A;  2FO7 A;  3N71 A;  3QF3 A;  2HR2 A;  2KCK A;  1OSL A;  2J49 A;  1JWL A;  3PXP A;  1FVH A;  4GYY A;  4R7L A;  4KT6 B;  3G2V A;  1B0N A;  1PNR A;  2D5V A;  2FI7 A;  2KC7 A;  2JLB A;  3FUN A;  3OXF A;  2IU7 A;  2WXF A;  3G2W A;  3QWW A;  4G26 A;  1W3B A;  3SCF A;  2ZU6 B;  1IHG A;  5HI7 A;  4GA1 A;  2KPJ A;  4I6U A;  1OUV A;  2VQ2 A;  1XGW A;  1RIO A;  3TAX A;  2WXI A;  2PUF A;  3PZD A;  3SD5 A;  1WH6 A;  2FEZ A;  3F52 A;  1QPZ A;  2PM7 A;  4MRU A;  3D9K A;  1QZ2 A;  4J6I A;  1QP0 A;  4KZ0 A;  5ARG A;  3UT8 A;  2XGS A;  1L1M A;  2A5U A;  3ASG A;  3CHO A;  3FP3 A;  3QAR A;  4TV3 A;  3ZYK A;  4AOF A;  4PU7 A;  5FZS A;  4ACK A;  2KM4 A;  2A6C A;  1O4X A;  3NZS A;  5G05 J;  3LIS A;  2JVL A;  4FLH A;  4XI9 A;  4DI3 A;  2R17 C;  1ZPQ A;  4I1O B;  4JHR A;  1JPL A;  3APF A;  3QWV A;  3PEV B;  4KXK B;  1EDU A;  2WXR A;  3FYA A;  2VGX A;  3CR3 A;  3JUI A;  3L54 A;  5ANR A;  2RG8 A;  3OQO A;  3UPV A;  3OMT A;  3ZVV A;  2PUG A;  3L22 A;  3ONK A;  4I9E A;  4ANV A;  3GW4 A;  3QC1 A;  4LCT A;  4BY6 A;  4GHJ A;  3OAW A;  1UN9 A;  2KEK A;  5AIJ A;  2CRO A;  2YNQ A;  3VK0 A;  2H8R A;  4FHK A;  2XCJ A;  4A3V A;  2PM6 A;  3R7R A;  3ZPJ A;  3D9P A;  3FU6 A;  1BDI A;  3PUK A;  1PAQ A;  1XWR A;  1WET A;  1NZN A;  3GBF A;  2PPX A;  3O4Z A;  2IU1 A;  5BV1 A;  4B94 A;  1YA0 A;  2J4B A;  2L0I A;  3TXN A;  3MYV A;  2C2L A;  4N39 A;  3TL5 A;  3L1P A;  1EF1 C;  2LYP A;  4JEU A;  5FWQ A;  3LY8 A;  1UW4 B;  2CHX A;  3QJZ A;  1S0P A;  2EQX A;  4G25 A;  4XKB A;  2IOL A;  2NC9 A;  2L0T B;  3MCX A;  4AXH A;  4ANX A;  3D9I A;  1E90 A;  1QP4 A;  3NZU A;  4I43 A;  1JWG A;  1INZ A;  1XNF A;  4TUU A;  2VTB A;  4B8A A;  3JYS A;  1WIZ A;  2R63 A;  5D0O D;  1IQR A;  3FH7 A;  4JZY A;  3RRM B;  1H19 A;  3MKQ B;  2A4Z A;  4NAC A;  4EPZ A;  2R59 A;  1JUQ A;  4IVZ A;  4B89 A;  2AXZ A;  4J1W A;  2PUC A;  2WPV A;  3FTS A;  2LSU A;  3B7H A;  5AJD A;  1Y7Y A;  2O49 A;  4AVX A;  2WQ6 A;  3VLE A;  4DI4 A;  1H2T C;  3PRZ A;  3KS2 A;  3VLD A;  1HG2 A;  2YIN A;  3HHM A;  4J0U A;  3EDT B;  3QAQ A;  2L9B A;  4PS7 A;  1E8Y A;  1ZVV A;  3SI5 A;  4GCO A;  5BT1 A;  1N52 A;  4UWG A;  3JCK C;  3PDN A;  2LO6 A;  3FUL A;  3PVL A;  4KVM A;  4BFR A;  3JQ0 A;  5ENN A;  4GPK A;  3FDH A;  2XCB A;  3ZGQ A;  3LJ3 A;  2DIW A;  5LP0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...