2AXUA

Structure of prgx
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
305
structure length
303
Chain Sequence
MFKIGSVLKQIRQELNYHQIDLYSGIMSKSVYIKVEADSRPISVEELSKFSERLGVNFFEILNRAGMNSVNETGKEKLLISKIFTNPDLFDKNFQRIEPKRLTSLQYFSIYLGYISIAHHYNIEVPTFNKTITSDLKHLYDKRTTFFGIDYEIVSNLLNVLPYEEVSSIIKPMYPIVDSFGKDYDLTIQTVLKNALTISIMNRNLKEAQYYINQFEHLKTIKNISINGYYDLEINYLKQIYQFLTDKNIDSYLNAVNIINIFKIIGKEDIHRSLVEELTKISAKEKFTPPKEVTMYYENYVAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of peptide sex pheromone receptor PrgX and PrgX/pheromone complexes and regulation of conjugation in Enterococcus faecalis.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Transcription
molecule keywords PrgX
total genus 111
structure length 303
sequence length 305
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2005-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2axuA01
1.25.40.400 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2axuA02
1EFAA 2PUGA 2KEKA 2PUAA 1QP4A 3HZIB 2IVBA 2IU7A 1ZZ9A 1GT0C 4X4FA 2GRMA 2LYPA 2KEIA 2OFYA 1LCCA 1SQ8A 4I6RA 1ZS4A 1RIOA 3F51A 1JH9A 1DW9A 3LFPA 3G5GA 3LISA 1R69A 4PU7A 2EF8A 3UFDA 2EWTA 3PXPA 1JFSA 1WETA 2PUCA 1QP0A 1QPZA 1DWKA 1ZVVA 2H8RA 1ZAYA 5A7LA 4Z58A 2JVLA 1XWRA 2MQKA 4X4CA 3ZHMA 1LMB3 3OQNA 3ZKCA 3SCFA 3FYMA 3R1FA 4PU3C 2ICPA 4JQDA 4I6TA 3BS3A 2L49A 1AU7A 1WH8A 2AXVA 3G7DA 4PU4C 3RZZA 3ZHIA 4Z5HA 3DNVB 2IVGA 1RZRA 3GBFA 4OB4A 3QQ6A 1QQAA 1ZZ8A 2IVQA 4X4BA 3OQMA 1CJGA 1PNRA 3QWGA 4FN3A 1B0NA 1Y9QA 2KPJA 1LCDA 3CLCA 1ADRA 1L1MA 2LCVA 2WUSR 1ZZ7A 2CSFA 3QYXA 3L1PA 1JWLA 1BDHA 2AUWA 4YARA 2XJ3A 1PRAA 2PIJA 3GN5B 4Z59A 3MLFA 1S7EA 2JCGA 2PUBA 2LYLA 3BDNA 1BDIA 2LYJA 1NEQA 4X4EA 1UTXA 4I6UA 4X4IA 5K98B 1POUA 3D1NI 1PRUA 1UXDA 2PUDA 3O9XA 2LYRA 2AXZA 1WH6A 1ZZCA 1OCTC 4I8TA 2IUOA 3JXDL 3EUSA 3JXCL 3SCGA 4FBIA 2O49A 4GQMA 1Y7YA 1UXCA 1PRVA 4MCTA 4F8DA 2FJRA 4GHJA 4JCXA 2BNOA 2XSDC 1RPEL 2CROA 4YBAA 2D5VA 3KJXA 1YSEA 3OMTA 4MCXA 2XIUA 4J1XA 3IVPA 2LYQA 4YG7B 3JXBC 2XCJA 3F52A 2B5AA 3F6WA 3U3WA 4JCYA 2AW6A 2KZ8A 1X2LA 2BNNA 3CROL 4IA8A 4X4DA 2O4AA 1NERA 4YG1A 2O38A 3B7HA 2PUFA 3OQOA 1OSLA 3BD1A 2BNMA 2GZUA 2GRLA 2R63A 2KEJA 1ZZBA 4J1WA 1ZZ6A 4IVZA 1ZUGA 1VPWA 2A6CA 1IC8A 1HF0A 1CQTA 2EBYA 4Y42A 3FMYA 2R1JL 3H5TA 3QF3A 4IWRA 4Z5DA 1QQBA 1RZRD 2LYKA 2HINA 2AXUA 1O4XA 4X4HA 1X57A 4NDWA 1RZSA 3GN5A 3VK0A 2BJCA 2OR1L 3SCHA 2MEZA 1LQCA 2ICTA 3KZ3A 2WIUB 3OP9A 2AWIA 4YG4A 2PUEA 2HSGA 2PE5A 2PPXA 1ZPQA 2LYSA 4O8BA 3S8QA 2L8NA 1JFTA 3TRBA 1R63A 3KXAA 1PERL 1WIZA 4X4GA 3CECA 4PU8A 2XI8A 2IV1A 4Z5CA 1E3OC 1LLIA 3FYAA 1QP7A
chains in the Genus database with same CATH superfamily
1WM5A 5BNWA 5ANLA 3RIBA 1N54A 2IU7A 3PZ4A 4U04A 3P2BA 2P9UG 2EILE 4G25A 1N11A 5DIZA 1OCOE 4UUCA 3LYAA 1HG2A 3HXEA 4LG6A 2J4BA 3D3MA 1QYMA 4I6TA 3OKZA 2XRZA 1UJJA 2XCBA 4ATZD 2H6HA 3EDTB 2M63A 4HS2A 1B0NA 3FP3A 1QQEA 5AARA 3S7BA 5CCLA 2R02A 3FUDA 3SFZA 4ER5A 2LYLA 3X2QE 4AV7A 2LYJA 1MX4A 4I6UA 1SW6A 3J5PA 5ARGA 2JABA 4HOTA 2QFCA 3KEZA 3U4TA 4F8DA 3D9NA 5GAHi 1MFQC 3D9PA 3OTNA 1EPUA 4RG6A 4WVLA 2B5AA 2IOSA 3SI5A 2YHCA 3ABKE 1OXJA 4UQXA 4F6RD 1OCCE 3CVXA 5KCMA 3B7HA 2MXDA 1ZBPA 3ZXSA 4C0EA 2HCSA 3FUFA 1EDUA 3LQXA 3FTZA 4HRNA 5D0OD 5E75A 3TJPA 3NBNB 2BJCA 1RZSA 4XKBA 2CG3A 1AP7A 2PUEA 1S63A 5CBOA 2XXPA 5JHAA 4O8BA 3F6QA 3Q7AA 1JCRA 5FJYA 3TRBA 4PU8A 4TUMA 2FFHA 4WNGA 1QP7A 3PS6A 3ASNE 3KSLA 5AQBA 3QB2A 3MKRA 1QP4A 5D0QD 1HU3A 1OY3D 2FO7A 2WXHA 3DRAA 3LFPA 4KMOA 1R69A 2VSNA 1ZAYA 2CHWA 1LF8A 5G05C 2MYOA 3GW4A 4PU3C 3ASDA 2L49A 3B7TA 3CHQA 3W9FA 2XPZA 1PNRA 4C9BB 1SZ9A 3U66A 3CSTA 5KNHD 1NZNA 3DSUA 4EZJA 2PXQA 1ZZ7A 2J07A 2GW1A 2HE0A 2AUWA 1E8YA 3PUJA 2BKGA 1W3BA 3ONLA 4DK5A 4KXKB 1ZZCA 3EUSA 2L6BA 3JXCL 4MKTA 4YVOA 3UT8A 4TXQA 3AS4A 5EYPF 5CEAA 2WM9A 3RRNB 2XSDC 1E8XA 4HLEA 2CROA 4CDMA 2WQ7A 3LY8A 1MJ0A 3CKCA 5GAGi 3DSWA 4HB5A 2PXTA 3CROL 4X4DA 2WXGA 1QZ2A 4OYSA 2MHKA 3CHPA 4J8YA 3ZU7B 5CBNA 3VLEA 2WXPA 1UW4B 2HYZA 5HQ8A 4BTBA 1VPWA 4U8VD 5FTPA 1JWGA 5ENNA 1A17A 4EZIA 2WMNA 4AY6A 4BX9A 4NDWA 4RG9A 4YG4A 5G55A 3EHNA 2LYSA 3ASHA 1R63A 4GTPA 2XS8A 2YHEA 2F8XK 1YYHA 5ENRD 2PXDA 2IO3C 2PUAA 2RFAA 3HZIB 5CHEE 1LTXA 3V31A 4N2SA 3F51A 4J8SA 4ANUA 2R59A 2EF8A 3TG5A 1KLXA 1N4RA 1ZVVA 2LO6A 4YDWA 2GRQB 5AJLA 1JWFA 3S2AA 2I2OA 1WH8A 4PU4C 3RZZA 4NRHB 3LVRE 3Q9NC 2PXUA 2DVWA 2PQRA 4G8KA 3QOXA 4N2QA 5HS0A 4ER7A 3L1PA 4CT0A 3CHOA 4K5AB 4QQIA 2J49A 2ONDA 3DXMG 4GA2A 1UTXA 4UWKA 4HRMB 5A7DB 4JEUA 1PRUA 1UXDA 3VLDA 2IU1A 1MYOA 3UM2A 2F37A 2V4HC 3OWQA 3JUEA 2XQ0A 3CV0A 3TEPA 5FQ4A 1TN6A 4OBMA 5FIOA 2XIUA 3HRAA 3ESLA 4DE9A 2YBDA 1JCSA 5DSXA 2KM4A 4I9EA 4PUCA 2O38A 5CERB 1DCQA 2VSYA 4GMLA 4UWFA 4A3TA 5KBAA 1LD8A 1Z5SC 1TNUA 5AENA 1S70B 2A4ZA 5AYWD 5AN8A 4FLHA 3PZ1A 4N3AA 4IYPA 2L0TB 2L8NA 4ILIA 2P2CP 3KXAA 4G8LA 2XI8A 5HI7A 4ZHBA 2PUGA 2KEKA 4NURA 4ABNA 3CVVA 3CVWA 1GT0C 2DWZA 2LYPA 4I17A 2CG2A 4PU7A 4ER0A 3U9WA 4HOUA 3SY2A 4MLPA 2VGYA 1IYGA 5ENPD 3DXKG 5EDSA 3FH7A 5ENQD 3C72A 4GCNA 4Z5HA 3EHRA 5DTQA 3DNVB 4EBAG 4OB4A 4CGVA 1L5JA 1LCDA 4PDXA 2WUSR 5JA4D 4EQFA 1OWNA 1HS6A 2DIWA 2XEHA 4Q2JA 4OAVB 5G2NA 2XXAA 4DI3A 1FPPA 2IUOA 3UI2A 1SZAA 4FBIA 3E32A 4JL0A 1HZ4A 1HQ1A 2IQCA 3JYSA 3HIZA 1Z6TA 1X81A 3E30A 5M72A 4JCYA 2HO1A 3F6WA 3E37A 5EX0A 3EUVA 2XZTG 3ML9A 4I2WA 4OAUC 1CQTA 3HDXA 2R1JL 3CK8A 2X6FA 3QF3A 3TWRA 1O4XA 1E7VA 4WAFA 3BU8A 1N0QA 1OWOA 2PE5A 1X5BA 4RVBA 1XGWA 5FZQA 3EHMA 3CVLA 1E3OC 3FUNA 3L82A 4E85A 3PEVB 4WWOA 4XX5A 4EHMA 2KEIA 4AIFA 1SQ8A 5EIBE 4ANVA 3UFDA 3FHEA 3E34A 4ILHB 1XWRA 3B7RL 3MV3B 2BEDA 3DM5A 4HRAA 2KZTB 4B94A 3PRZA 3UWPA 2X6JA 1SQMA 2V8SE 2ODRD 3AG4E 3V2OA 5HKPA 1NFIE 3PH0C 5JMND 1BI8B 1BDHA 1YA0A 3A9YA 2B6CA 3CVYA 3LKUA 2JCGA 3IBEA 2B0OE 5G04J 5E76A 4GB9A 2FI7A 3KS2A 3DBSA 2VEOA 5FZRA 3MX3A 2L9BA 4LUNU 3T5VA 3CK9A 2PXPA 3Q9UC 1OWLA 4X8QA 5G05J 3B95A 3CVPA 1ELWA 5AQ9A 4K5CA 2GRNB 4LNGA 1N52A 1ELKA 2J09A 4DX1A 4IA8A 2FF4A 3C98A 2OEVA 1YCSB 4F1SA 1ZZBA 4ER6A 5BXOA 5LOZA 4KZCA 1K1AA 4FU3A 4X4HA 3ZYKA 3KZ3A 3OP9A 3FEYA 3WG7E 2KCKA 4AOFA 3FU5A 2FEZA 3CKBA 1LD7A 3QDNA 3T8MA 2LNIA 3EU9A 3L13A 4I2ZA 1QB2A 1OWPA 3BUAA 3G2WA 2KBXA 5FINA 2A5EA 1DW9A 5DRTA 1JFSA 3IKOB 1WAO1 2H8RA 4O60A 2HM8A 3Q15A 4FC8A 1RZRA 4N3BA 4XEIG 4CZ2D 3B13A 3FWVA 5CMWA 5LP0A 1KZOA 3ZYLA 4LEUA 4U8HA 2P9SG 4NIKA 4L2LA 1N4PA 4U95D 3TELA 4UI9K 4U07A 4A1SA 4XZ4A 3PUKA 1E7UA 3T9KA 1VDYA 1DVPA 1IXVA 2J7WA 2WMOA 3LVQE 2QZAA 2VGEA 3ABLE 3JXDL 3CVQA 1BPOA 4EQZA 2L0IA 3NZUA 2FJRA 4GHJA 3KJXA 3HVEA 4A3VA 5KJNA 5JJ7A 2P9KG 2XHEA 2YNQA 2AW6A 1X2LA 3TWQA 1H6PA 4GZ5A 4CDRA 2J8SD 3TXMA 2BNMA 2XPYA 3IXEA 2GROB 2XS1A 2IJGX 2M4HA 4J1WA 4WWPA 1ZZ6A 4JD2G 5AQAA 2A6CA 3D9LA 4F3VA 2VGXB 4Y6WA 3Q47B 3FDHA 3GZSA 4ILGA 3LJNA 4G26A 3DSSA 3R09A 1IQUA 4IN3B 3PE5A 3DEOA 3LPZA 2IVBA 2P9LG 5CRVA 4X4FA 1PY1A 3UT7A 1RIOA 4UI9J 3D9OA 4EKIA 2GGFA 3JQ0A 1QP0A 4BY6A 1DWKA 3EIJA 1SVXA 3CHRA 4UWLA 1RZ4A 3QWPA 5DRYA 1D8DA 2F0YA 3FYMA 4WWNA 3O4ZA 5KWDA 4ATGA 3IEGA 1CJGA 3ZFWA 4MRUA 4B8CB 4EK9A 3FU3A 4WUYA 1L1MA 4GYOA 4WNFA 3Q78A 2WXKA 5DTMA 3AS8A 3QFIA 1O5MA 4P29A 5BUZA 2V3CC 4YARA 3MLFA 5EN5D 2LYRA 5CEDB 1NA3A 1DNPA 1E96B 2L1PA 2CFUA 3RO3A 4GCOA 2RD0A 3PVLA 2X38A 1FT1A 2BNOA 4JA7A 3ZYQA 3LY7A 4JXTA 4OVVA 3TWTA 1S0PA 1TJCA 3U3WA 2ETAA 3EU5A 2V0PA 4I6JA 3OQOA 1OSLA 1SA5A 1E90A 2GZUA 2QC9A 2KEJA 3BQOA 2ZISA 3FUJA 3MV2B 4BEPA 4U0UA 3H5TA 2KC7A 5B3SE 2LLVA 4L1BA 1GW6A 1RZRD 1TN8A 1V54E 4I6EA 1X57A 3VK0A 2PNNA 2WIUB 2AWIA 1ZPQA 5FWQA 1E8WA 3OXGA 3NB2A 1WIZA 1EF1C 4YDYA 3FYAA 2PQNA 4I6GA 3NZLA 1HF8A 4C0MA 4FHKA 3ZEFA 2MOWA 3IHVA 3LISA 3AAAC 2GRRB 1QPZA 1WDYA 2CHZA 3R9AB 1MX6A 2WPVA 3G2UA 4X4CA 1LMB3 3R1FA 3BS3A 3A9ZA 4GPKA 1HXIA 4A1GA 4EZLA 3FH8A 1N4SA 4NQ0A 1BU9A 3ZKJA 5JJ6A 1Y9QA 4JA9A 2I1KA 3WXXA 4JC8A 5CECB 2LCVA 1KPSB 1N4QA 3C3QA 1JPLA 2XJ3A 1PRAA 4EKGA 1V55E 3ASGA 4GMRA 2WXOA 3PE4A 3ULEG 2VSOE 2XENA 2HR2A 1TN7A 1POUA 2PUDA 3RK6A 1WH6A 3ZVVA 3FEXA 5EILA 2JLBA 3R7RA 1UN8A 3MGBA 1NA0A 5KJMA 3CR3A 2C0MA 3UKRG 3DSXA 5LCWJ 4MCXA 3OMTA 2DBAA 4MS6A 2H6GA 2UY1B 4O1PA 3JXBC 2XCJA 3D9JA 3RRMB 2OV8A 1OWMA 2ETCA 2R63A 4IULA 1IC8A 3JXIA 4GAAA 1QQBA 3HYMB 4UWHA 4BSXA 4K03A 2HSGA 2XGOA 2ZGDA 1JFTA 3S7JA 1G3NB 2Y69E 1LLIA 5ENOD 3APFA 3ABME 4YDOA 3SQVA 3FUKA 4TUUA 3NAWA 4YNDA 4J8EA 2OFYA 3QAQA 5KJKA 4BFRA 3PEUB 3MKQA 1N9AA 4N39A 4YDEA 4DX2A 3TG4A 3ZHMA 3FU6A 3PNLB 3MYVA 4L9PA 4IRUA 2PXLA 3U64A 5B1BE 1QNFA 1HFAA 4B0ZA 4ME2A 4FN3A 2ZXWE 4JPSA 4FADA 3UINC 2Y3AA 4PS8A 3ZYMA 3UM3A 3KSQA 3RO2A 3NROA 3NOCD 4I8TA 1Q2ZA 2IF4A 4CDNA 3DWLG 2XXQA 4XI9A 4I9CA 3SCGA 2O49A 4HORA 3M9LA 5EYLA 1K3ZD 1ZB1A 1Y7YA 2QY7A 3RRUA 4HBDA 3TWUA 3ZGQA 3Q5MA 1TNBA 4GA0A 4RQIA 2R2LA 3CQGB 1HE8A 4XE0A 4GTQA 4U96D 2PXEA 4Y6CA 3DSVA 1NERA 3VLFA 2DYSE 4HOQA 4A63B 3R9MA 4ACLA 1FVFA 3FMYA 3ULYA 1H6KA 3QJZA 4TXPA 1JCQA 3ESKA 2MEZA 3GYZA 4DLQA 2PM7A 4X4GA 4Z5CA 2IV1A 5DTRA 2H6IA 3OXFA 3FUEA 1K8KG 1EYHA 4NACA 2OOEA 2NXPA 3CVNA 3G5GA 4CRWA 3QWVA 2EWTA 5CMYA 2PUCA 3L54A 3NOGD 4Q96A 2PM6A 2LXMA 1IHBA 3ZKCA 2YINA 3L16A 3CIAA 2WXMA 2QYUA 3ZHIA 2WXIA 2IVGA 4RLYA 4X4BA 1INZA 3AJIA 3L22A 3E4BA 4GPMA 2WQ6A 4JHJA 3K9IA 2HCNA 3QYXA 3QWWA 3DEPA 3TWVA 3L9TA 5FT9A 2PUBA 3L6AA 3URZA 3FULA 1NEQA 4I1AA 2P9PG 3D1NI 5H7PA 3VTXA 3GZCA 4GTMA 3Q49B 4URKA 1N94A 3ENEA 4XI0A 3SF4A 3DSTA 1AWCB 2OEWA 5T8IA 3ONKA 2LLWA 2NC9A 1MZCA 3C5RA 4JHKA 1O1SA 3I4GA 4KVOA 1QBQA 2OVFA 2V5QC 4HQDA 4YG7B 2KZ8A 3G2TA 3UKUG 2EIKE 3T8KA 4EZKA 3AU4A 1UG3A 3ZUVB 2Y4UA 3UPVA 2YQ8A 4G23A 4BSZB 2F8YA 4Y42A 3D9MA 1XNFA 3MEKA 3T5XA 3IV0A 1UOHA 1TYQG 3CHSA 4GMJA 3GN5A 2ICTA 3HXDA 3DPDA 3SR4A 2IONA 1H2VC 3KD7A 3UQ3A 4LCTA 1U2ZA 1EFAA 4W9RA 4M7CA 3UMVA 1A5EA 5ARFA 2CFZA 4RSYA 2R5SA 4HI9A 5EIDA 1ZS4A 3ZHEB 1P5QA 3ZXPA 5ITZF 5AJDA 5J90A 4GTOA 4HFGA 3OQNA 4DRXE 4Q69A 3NZSA 1MX2A 4DPRA 1Y6IA 3BG1B 5T4YA 2VJ8A 3CVUA 4HLLA 2CSFA 3I5PA 5T3RA 4G2VA 4D10C 4JB8P 3GUUA 4B89A 1BDIA 2IO2C 1ELRA 4KVMA 5BXUA 4U0ZA 1B89A 3HVEB 4DJAA 3EHQA 3Q75A 4HOSA 3DPYA 4MBGA 2KXPC 1YMPA 1HH8A 2OVBA 3HG0D 4J6IA 2BTDA 2V5FA 1BLXB 4J1XA 4M3OA 2XCCA 3IVPA 3F52A 5ENTD 5FQ6A 4U63A 5C2YA 1DCEA 1K1BA 4WNDA 4YG1A 2LAIA 4B8AA 3EJNA 5D2MC 2DCPA 5FQ7A 1H2UA 2LYKA 2HINA 3VWSA 4LNBA 2AXUA 5LX8A 4LNUD 2GRPB 3R7QA 2IEJA 4FULA 1OUVA 3BG0B 4EECA 2XEVA 3PZDA 5J08A 3UM1A 2VQ2A 4L7TA 3LJ3A 4BX8A 3OAWA 2R03A 3FY4A 4H7YA 1LCCA 2P9NG 3ZN3A 4BESA 3RAUA 5DBKA 2LSUA 3ZIMA 4YVQC 3SFXA 3FUIA 2WQHA 5EKQD 2XGMA 3UT4A 1BI7B 3G7DA 2J4DA 4LERA 1OT8A 5D66A 3GZDA 3D9KA 4JEHA 5KJLA 5LCWC 3B7BA 3D9HA 3SZ7A 3QNKA 4EBAA 3PNTB 2BF0X 4AXHA 4F1PA 1JWLA 3CEQA 4EPZA 4CCAA 1TEZA 2LUHA 4AJWA 4QFVA 3C3OA 3S7FA 2PZIA 3O9XA 4G24A 2PXVA 3TWXA 3KAEA 2J7UA 2EIME 1UXCA 3G2SA 2X6KA 3I3NA 1RPEL 3MZLB 2AVPA 3J5QB 4N3CA 2XGSA 5BV0A 1NP7A 4HVBA 3UIPC 4CT4A 3CSFA 3PZ3A 3ZPJA 2BNNA 4BETA 4KT6B 3IHYA 5LFAA 2FULA 4BT9A 4ACKA 4JHRA 1FCHA 3GZ2A 3ASOE 2WVIA 4BWRA 3KEAA 3UTMA 3FUMA 4AP2A 1Z3YA 1PAQA 4GZ3A 3S8QA 1H19A 2WXFA 3FTSA 4Q94A 4DX6D 2GRMA 4G1TA 4J7WA 3OXLA 1JH9A 3TWWA 4HXIA 5G04C 1HX8A 3NXHA 2PL2A 4UQZA 4N5QA 4Z58A 3V2XA 2MQKA 4DI4A 1IKND 3Q7FA 3A9XA 4CYMD 2ICPA 5C1DA 1AU7A 3FTWA 2P9IG 5B1AE 1QQAA 3RSEG 5BV1A 3AU5A 2KPJA 3V30A 2KCVA 4O1OA 1WY6A 2R05A 4I43A 4AM9A 2NSZA 4Z59A 3Q79A 3ML8A 4AVXA 3TFLA 4KZ0A 1FT2A 2LAHA 5JUWA 3BEEA 1U2VG 5BT1A 3ME5A 4FA6A 1Z3XA 2XEEA 4PS7A 4DUIA 3SD5A 4K0RA 3FTXA 4YBAA 3B7UX 4XIFA 4U7EB 5EX3A 1NI1A 4DLOA 4PS3A 1ZU2A 4U0SA 3KL4A 3CK7A 3ISMC 5A6CA 2E2EA 4BT8A 2O4AA 1SA4A 3Q73A 1MQSA 3SX0A 1ZUGA 1H2TC 1WG0A 3L17A 4J8DA 3SNXA 4GZ6A 2IOLA 2PPXA 1O1RA 3E33A 3APDA 1IHGA 4LSZE 3G0TA 3CLJA 1ZZ9A 1O1TA 2FO1E 4G11A 2WXLA 4DX5D 4I6RA 5IY5E 3RU0A 4FP7A 4J8FA 2RG8A 4DX7D 2NYJA 3QOWA 2JVLA 2XZDG 1PC2A 2UY1A 3SBTB 3P1UA 1S64A 2AXVA 1OCRE 5AIJA 2WB2A 3GBFA 1MHQA 1TNOA 2Y4TA 3PZ2A 3FU0A 4A55A 3HXCA 3QWGA 4KYOB 1ADRA 3VTYA 3LDZA 3N71A 2RKKA 2EQXA 4FJZA 4V3IA 4FLBA 5CRUA 2KCLA 2X3MA 2X6IA 4L2YA 1TR4A 2WXQA 3BDNA 3NDBB 2IY0C 1QZXA 4X4IA 3MA5A 1D9SA 2R17C 1H0AA 1HO8A 2VSXE 3AG1E 3MEJA 2LXLA 4JVSA 1Y8MA 4FJYA 1PRVA 5KNGA 4DE8A 4I1OB 1YSEA 4GTSA 4K5BA 3CHMA 4R7LA 2PXKA 4HRLA 2WXRA 4FHJA 3SO8A 2Y1LE 2GRLA 3UIOC 2PXFA 2J9QA 3SGHA 2VYIA 3ASFA 3FFLA 2EBYA 4IWRA 3HXBA 3JCKC 3LEWA 2PXBA 4U8YD 2OR1L 2ILRA 1H6OA 5AQ7A 2ETBA 2XPIA 2WXJA 3CECA 4JZYA 4CEMA 4HNAD 3UXGA 3TXNA 5JJTA 1N95A 3D9IA 5FZSA 1JUQA 3AS5A 2FBNA 4N5CA 3PXPA 5A23A 3ZHEA 3LY9A 3GZDC 3PDNA 4O6FA 2ZGGA 3PREA 4GTRA 3AG3E 3SCFA 4JQDA 2J08A 4BERA 4GTVA 3APCA 4E6HA 3SBSA 3QQ6A 3C3RA 1ZZ8A 2IVQA 3OQMA 3CQCB 2BUGA 4C48B 3QK0A 4TV3A 3NQPA 3Q4AB 3EIQC 4ER3A 4PH4B 3W9GA 1DULA 2C0LA 2PIJA 3SFYA 3GN5B 5AAOA 2I6HA 3QOUA 5CCMA 3FTYA 5K98B 2EIJE 3QKYA 2IFUA 2Y0BG 4F7AA 1OCTC 3LCAA 1UN9A 2V4LA 2X6HA 3TGOA 3ZW3A 4GQMA 3L08A 4MCTA 4JCXA 5FQ8A 2D5VA 4AEZC 4UI9C 3JUIA 3O48A 2UWJG 4ANWA 3LXUX 2XRYA 3LS8A 5JHBA 2E0IA 2VTBA 4I1MA 1UJKA 2VTBB 3JXJA 4OVUA 2EINE 2OCCE 3BD1A 3UUXA 4B93B 1U3CA 4IVZA 2BKKB 3PE3A 2ZU6B 1HG5A 4F53A 3ZPXA 2I1JA 3MKQB 1KT0A 3B7SA 2I9CA 4JW1A 1D8EA 2MRIA 5HRYA 1LQCA 4APFA 4CGWA 3MJWA 1NW3A 1PERL 4GTTA 4KBQA 4GZCA 3G2VA 1U3DA 4XKCA 2AJAA 3SHFA 4UQYA 2L6JA 2KZTA 3ULQA 4Z68A 1IQRA 3MCXA 5BW8C 3TL5A 4HI8A 2VGXA 2RFMA 1WETA 3RKVA 1N0RA 2HFZA 5A7LA 1TNYA 2LNMA 1RW2A 1TNZA 5ENSD 4H7XA 3HHMA 2WXNA 1TJFA 3FTVA 1FVHA 3RJVA 3CLCA 4TXRA 2DZNA 5ANRA 1KZPA 3CGHA 4ZFHA 3FUHA 1S7EA 3UM0A 4GU5A 4X4EA 3I4RB 3QC1A 3ZRHA 3UX4A 2LSVA 2KATA 2AXZA 3AG2E 1NL4A 3S7DA 4AY5A 1BD8A 2JEKA 3V79K 4J0UA 2DYRE 1DC2A 4GA1A 2QYJA 4GYYA 2P58C 4UWGA 4L23A 2LYQA 3GZ1A 2Q7FA 3HXFA 3TWSA 1E8ZA 2CHXA 2PUFA 3FTUA 4GYWA 2H6FA 4ANXA 3JQ1A 2DZOA 1HF0A 5BPPA 4TRQA 3TAXA 1OCZE 3NF1A 2JQEA 4Z5DA 3QARA 2C2LA 5DT2A 3ZNGA 1KT1A 4BTAA 3SCHA 4LRZA 4WNEA 2ZIRA 3FH5A 2A5UA 4APOA 4GZDA
chains in the Genus database with same CATH topology
1WM5A 3FTSA 4E85A 5BNWA 3PEVB 5ANLA 3RIBA 1N54A 4Q94A 2IU7A 4WWOA 3FUKA 4TUUA 4XX5A 4YNDA 2GRMA 4G1TA 3OXLA 4J8EA 2KEIA 2OFYA 3QAQA 4U04A 1SQ8A 3P2BA 4AIFA 4BFRA 5KJKA 3PEUB 1JH9A 3MKQA 5A23A 4G25A 4ANVA 3UFDA 3FHEA 4N39A 4HXIA 5DIZA 5G04C 1HX8A 4ILHB 2PL2A 4UQZA 4Z58A 3TG4A 1XWRA 2MQKA 3ZHMA 3B7RL 3LYAA 1HG2A 4DI4A 3MV3B 2J4BA 2ICPA 3D3MA 4I6TA 5C1DA 1AU7A 4WWPA 3FTWA 2XRZA 3FU6A 3PNLB 3MYVA 1UJJA 2KZTB 4IRUA 3U64A 4B94A 2XCBA 3PRZA 1QNFA 1QQAA 1HFAA 2X6JA 4B0ZA 1SQMA 3EDTB 5BV1A 2V8SE 4ME2A 2M63A 4HS2A 4FN3A 3AU5A 1B0NA 2KPJA 3FP3A 4JPSA 1QQEA 2KCVA 3PH0C 3S7BA 4FADA 2Y3AA 4PS8A 3ZYMA 5CCLA 1BDHA 1WY6A 4I43A 4AM9A 1YA0A 2NSZA 3FUDA 3SFZA 4Z59A 3CVYA 3ML8A 3LKUA 2JCGA 2LYLA 4AV7A 4AVXA 2LYJA 4I6UA 3IBEA 4KZ0A 5ARGA 3RO2A 5G04J 4HOTA 5E76A 4I8TA 2LAHA 2IF4A 4CDNA 4GB9A 2FI7A 3KS2A 3DBSA 3BEEA 4XI9A 4I9CA 5FZRA 5BT1A 4FA6A 3SCGA 2O49A 1Z3XA 3MX3A 2QFCA 3KEZA 2L9BA 4HORA 4PS7A 1Y7YA 2QY7A 4LUNU 3U4TA 4F8DA 3T5VA 3D9NA 3RRUA 3CK9A 3SD5A 4K0RA 3FTXA 4YBAA 1OWLA 3B7UX 4XIFA 5G05J 3ZGQA 5EX3A 3Q5MA 3D9PA 4DLOA 3CVPA 1ELWA 3OTNA 4GA0A 1EPUA 4PS3A 4RG6A 3CQGB 1HE8A 4XE0A 1ZU2A 1N52A 2B5AA 2IOSA 4U0SA 3SI5A 3CK7A 2YHCA 5A6CA 1ELKA 2J09A 4IA8A 2E2EA 4BT8A 2O4AA 2FF4A 4UQXA 4Y6CA 3VLFA 1NERA 3CVXA 5KCMA 3C98A 3B7HA 1MQSA 1ZBPA 4HOQA 4F1SA 3ZXSA 4C0EA 1ZZBA 1EDUA 3FUFA 4ACLA 1ZUGA 1FVFA 1H2TC 3FMYA 3FTZA 5D0OD 1H6KA 5LOZA 5E75A 3QJZA 3L17A 4J8DA 4KZCA 3TJPA 4FU3A 3SNXA 4X4HA 2BJCA 1RZSA 4GZ6A 4XKBA 3ESKA 2CG3A 3ZYKA 2MEZA 3KZ3A 2IOLA 3OP9A 2PUEA 3GYZA 5JHAA 2PPXA 4O8BA 3FEYA 2PM7A 4DLQA 5FJYA 3TRBA 2KCKA 3APDA 4X4GA 4PU8A 1IHGA 4Z5CA 2IV1A 3FU5A 4AOFA 4WNGA 1QP7A 2FEZA 3PS6A 3CKBA 3QDNA 3T8MA 3CLJA 3QB2A 3MKRA 1QP4A 5D0QD 2LNIA 1ZZ9A 3L13A 1HU3A 3OXFA 3FUEA 4I2ZA 1OWPA 4G11A 3G2WA 2WXLA 1EYHA 4I6RA 2FO7A 2WXHA 2OOEA 2NXPA 4NACA 3CVNA 1DW9A 3LFPA 4KMOA 3G5GA 3RU0A 1R69A 4CRWA 3QWVA 2EWTA 1JFSA 3IKOB 2PUCA 1WAO1 4FP7A 4J8FA 5CMYA 2H8RA 2VSNA 2RG8A 1ZAYA 3L54A 4Q96A 2PM6A 2CHWA 2JVLA 1LF8A 5G05C 3ZN3A 1PC2A 2UY1A 3GW4A 3L16A 3ZKCA 2HM8A 2YINA 3SBTB 4PU3C 3CIAA 3P1UA 3ASDA 3Q15A 2L49A 2WXMA 2AXVA 3ZHIA 2WXIA 4FC8A 2IVGA 3B7TA 3CHQA 1RZRA 4N3BA 5AIJA 2WB2A 3GBFA 5CMWA 1MHQA 3B13A 3FWVA 2Y4TA 5LP0A 4X4BA 3FU0A 2XPZA 4A55A 1INZA 1PNRA 3ZYLA 3QWGA 4KYOB 4LEUA 3UPVA 3L22A 1ADRA 1SZ9A 3VTYA 3CSTA 3LDZA 3E4BA 3N71A 4C9BB 3U66A 1NZNA 4U8HA 2WQ6A 4EZJA 4L2LA 2EQXA 1ZZ7A 3K9IA 4FJZA 4JHJA 3QYXA 3QWWA 2J07A 4FLBA 4U07A 4UI9K 4V3IA 4A1SA 4XZ4A 2GW1A 3PUKA 2AUWA 1E8YA 2KCLA 2X3MA 2X6IA 4L2YA 5FT9A 2PUBA 3L6AA 1E7UA 2WXQA 3BDNA 3URZA 3FULA 1NEQA 3PUJA 1VDYA 4X4IA 1DVPA 4I1AA 1W3BA 3MA5A 3D1NI 3ONLA 4DK5A 2WMOA 3LVQE 4KXKB 1ZZCA 1H0AA 2R17C 1HO8A 2VSXE 3VTXA 3JXDL 3EUSA 3CVQA 1BPOA 3JXCL 4MKTA 4YVOA 3UT8A 3Q49B 2L0IA 4JVSA 3NZUA 3AS4A 1Y8MA 4URKA 2WM9A 4FJYA 3ENEA 3RRNB 4XI0A 1PRVA 3SF4A 2FJRA 5T8IA 4GHJA 3ONKA 2XSDC 1E8XA 4BTBA 2CROA 4CDMA 4HLEA 2WQ7A 4I1OB 3LY8A 3KJXA 2NC9A 1YSEA 3HVEA 3CHMA 3CKCA 4A3VA 5KJNA 4JHKA 3I4GA 4KVOA 5JJ7A 2OVFA 2XHEA 4R7LA 4YG7B 2YNQA 2AW6A 2KZ8A 1X2LA 3CROL 4GZ5A 4EECA 4X4DA 2WXGA 3G2TA 2WXRA 4CDRA 4EZKA 3AU4A 1QZ2A 4FHJA 4OYSA 3TXMA 2MHKA 3CHPA 1UG3A 2BNMA 2XPYA 3VLEA 2GRLA 2IJGX 2WXPA 1UW4B 2HYZA 4J1WA 2J9QA 2Y4UA 1ZZ6A 1VPWA 2VYIA 2YQ8A 2A6CA 3D9LA 3ASFA 3FFLA 4G23A 2EBYA 4Y42A 2VGXB 4Y6WA 5FTPA 4F3VA 1JWGA 3D9MA 5ENNA 1A17A 4IWRA 1XNFA 3Q47B 4AY6A 2WMNA 3MEKA 3T5XA 3JCKC 3IV0A 3FDHA 3CHSA 3LEWA 4NDWA 4GMJA 3GN5A 3GZSA 4RG9A 4BX9A 2OR1L 4YG4A 4ILGA 2ICTA 4G26A 5G55A 2ILRA 3EHNA 2LYSA 3DPDA 2IONA 1H2VC 1R63A 3ASHA 3KD7A 2XPIA 2WXJA 3CECA 4JZYA 1IQUA 2YHEA 3UQ3A 4LCTA 4IN3B 4CEMA 1EFAA 2PUAA 4W9RA 3HZIB 2IVBA 3LPZA 3UMVA 4X4FA 1PY1A 5CHEE 2CFZA 5ARFA 4RSYA 3TXNA 2R5SA 3UT7A 5JJTA 1RIOA 3D9IA 1ZS4A 4N2SA 4UI9J 3F51A 3D9OA 5FZSA 1JUQA 3AS5A 2FBNA 4J8SA 3ZHEB 2GGFA 4ANUA 2R59A 3JQ0A 1P5QA 2EF8A 4N5CA 3TG5A 3PXPA 1KLXA 1QP0A 4BY6A 1DWKA 3EIJA 1ZVVA 2LO6A 3LY9A 3PDNA 3CHRA 5AJDA 4UWLA 5AJLA 3ZHEA 5J90A 4O6FA 3QWPA 4HFGA 1JWFA 3S2AA 2I2OA 3PREA 3OQNA 3SCFA 3FYMA 4WWNA 4JQDA 2J08A 4Q69A 1WH8A 4PU4C 3RZZA 3O4ZA 3NZSA 4NRHB 3LVRE 4ATGA 3APCA 4E6HA 3SBSA 3QQ6A 2PQRA 1ZZ8A 3IEGA 2IVQA 3OQMA 3CQCB 1CJGA 4DPRA 3ZFWA 4MRUA 4N2QA 2BUGA 1Y6IA 4B8CB 3BG1B 3FU3A 2VJ8A 3QK0A 4TV3A 1L1MA 4WUYA 5T4YA 4GYOA 4WNFA 3CVUA 3NQPA 3Q4AB 2WXKA 3AS8A 2CSFA 3EIQC 3L1PA 3I5PA 4P29A 4PH4B 5BUZA 5HQ8A 5T3RA 4G2VA 4CT0A 2C0LA 4D10C 4YARA 2PIJA 4B89A 3CHOA 3GN5B 3MLFA 2I6HA 2J49A 1BDIA 2ONDA 3QOUA 1ELRA 4GA2A 4KVMA 5CCMA 1UTXA 4U0ZA 4UWKA 3FTYA 5A7DB 5K98B 3QKYA 2IFUA 4JEUA 1PRUA 1B89A 1UXDA 3HVEB 4F7AA 1OCTC 2LYRA 4DJAA 1NA3A 3VLDA 1DNPA 1E96B 3LCAA 1UN9A 2IU1A 4HOSA 2CFUA 2V4LA 2X6HA 3RO3A 3TGOA 1HH8A 3ZW3A 4GQMA 2OVBA 4GCOA 2RD0A 3L08A 3PVLA 4MCTA 4J6IA 2BTDA 2V5FA 2X38A 4JCXA 2BNOA 2XQ0A 3CV0A 4JA7A 5FQ8A 3ZYQA 3LY7A 5FQ4A 2D5VA 4AEZC 2XIUA 4J1XA 3JUIA 3O48A 2UWJG 3ESLA 3LXUX 4M3OA 4UI9C 2XRYA 4ANWA 3LS8A 2XCCA 3IVPA 4JXTA 4OVVA 5JHBA 2E0IA 2VTBA 1S0PA 1TJCA 3F52A 3U3WA 2KM4A 4I9EA 5FQ6A 4I1MA 4U63A 5C2YA 1UJKA 2V0PA 4PUCA 4WNDA 2VTBB 4YG1A 4I6JA 2LAIA 2O38A 4OVUA 4B8AA 3OQOA 1OSLA 3BD1A 3UUXA 1E90A 2VSYA 2GZUA 2KEJA 4GMLA 1U3CA 4IVZA 3PE3A 4UWFA 2ZU6B 1HG5A 3EJNA 4F53A 2I1JA 3FUJA 3MKQB 3MV2B 1KT0A 4A3TA 4U0UA 3H5TA 2KC7A 2DCPA 5FQ7A 1GW6A 1H2UA 4L1BA 1RZRD 2LYKA 5AENA 2HINA 4I6EA 2A4ZA 2I9CA 2AXUA 3B7SA 4JW1A 5AYWD 1X57A 5LX8A 3VK0A 2MRIA 4FLHA 1LQCA 4APFA 2WIUB 4N3AA 2AWIA 3R7QA 4IYPA 4CGWA 1ZPQA 3MJWA 1E8WA 5FWQA 2L0TB 3SGHA 2L8NA 3OXGA 4ILIA 3KXAA 1PERL 4FULA 1WIZA 1OUVA 2XI8A 1EF1C 3BG0B 4KBQA 4GZCA 3FYAA 5HI7A 2PQNA 2XEVA 3G2VA 3PZDA 5J08A 2PUGA 2KEKA 4NURA 4I6GA 1U3DA 2VQ2A 4L7TA 4XKCA 3LJ3A 4ABNA 4BX8A 1HF8A 3CVWA 1GT0C 3CVVA 4C0MA 3OAWA 2LYPA 3SHFA 3FY4A 2L6JA 1LCCA 2KZTA 4FHKA 4H7YA 4UQYA 1IQRA 3MCXA 5BW8C 3ULQA 3ZEFA 3TL5A 2MOWA 3IHVA 2CG2A 4I17A 5DBKA 2LSUA 3LISA 2VGXA 4PU7A 3ZIMA 4YVQC 3U9WA 1WETA 4HOUA 1QPZA 3R9AB 2CHZA 3RKVA 4MLPA 5A7LA 2VGYA 3FUIA 2WPVA 1IYGA 3G2UA 2WQHA 4X4CA 5EKQD 1LMB3 5EDSA 2XGMA 3FH7A 3R1FA 3UT4A 3BS3A 4GPKA 4GCNA 3G7DA 4Z5HA 2J4DA 1HXIA 4LERA 4A1GA 3DNVB 4EBAG 4EZLA 3FH8A 4OB4A 3HHMA 4H7XA 3D9KA 4JEHA 2WXNA 1TJFA 5KJLA 3FTVA 1FVHA 4NQ0A 5LCWC 5JJ6A 3SZ7A 4CGVA 1L5JA 3QNKA 1Y9QA 1LCDA 3CLCA 4JA9A 2I1KA 3RJVA 3WXXA 4EBAA 4PDXA 4JC8A 3PNTB 2LCVA 2WUSR 5ANRA 2BF0X 4AXHA 4EQFA 1OWNA 1JWLA 3CEQA 1JPLA 3CGHA 4EPZA 1HS6A 2DIWA 4CCAA 1TEZA 2XJ3A 3FUHA 1PRAA 4AJWA 3ASGA 1S7EA 4GU5A 2WXOA 3PE4A 4QFVA 4X4EA 2VSOE 3I4RB 2HR2A 3QC1A 3ZRHA 3UX4A 1POUA 5G2NA 2PZIA 2LSVA 3S7FA 2PUDA 3O9XA 2AXZA 1WH6A 2KATA 3RK6A 3FEXA 3ZVVA 4G24A 4DI3A 2IUOA 2JLBA 3R7RA 1UN8A 3KAEA 3S7DA 4AY5A 1SZAA 4FBIA 3MGBA 2JEKA 4JL0A 1HZ4A 1NA0A 5KJMA 4J0UA 2IQCA 3CR3A 1UXCA 2C0MA 3G2SA 3JYSA 2X6KA 3I3NA 3HIZA 1RPEL 1Z6TA 3MZLB 4GA1A 2AVPA 4GYYA 4N3CA 2P58C 2XGSA 4MCXA 3OMTA 2DBAA 4MS6A 4UWGA 5LCWJ 2UY1B 5BV0A 5M72A 1NP7A 4HVBA 4L23A 2LYQA 4CT4A 3JXBC 4JCYA 2XCJA 2HO1A 3CSFA 3F6WA 3GZ1A 3ZPJA 2Q7FA 2BNNA 3D9JA 3RRMB 4KT6B 5EX0A 3IHYA 1E8ZA 2CHXA 2OV8A 2FULA 5LFAA 2PUFA 1OWMA 3FTUA 4GYWA 4BT9A 4ACKA 4JHRA 4ANXA 3ML9A 3JQ1A 2R63A 4I2WA 4IULA 1FCHA 1IC8A 1HF0A 1CQTA 3GZ2A 3HDXA 2R1JL 5BPPA 4GAAA 3CK8A 4TRQA 3TAXA 2WVIA 3QF3A 2X6FA 3NF1A 4Z5DA 1QQBA 3QARA 4BWRA 2C2LA 1O4XA 3HYMB 4UWHA 1E7VA 1KT1A 3FUMA 3SCHA 4WAFA 4AP2A 4BTAA 1Z3YA 4LRZA 4BSXA 1PAQA 4K03A 1OWOA 2HSGA 2XGOA 4GZ3A 2PE5A 3S8QA 1X5BA 4RVBA 1H19A 2WXFA 1XGWA 1JFTA 4WNEA 5FZQA 3EHMA 3CVLA 3S7JA 3FH5A 1LLIA 1E3OC 2A5UA 3FUNA 4APOA 3APFA 4GZDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EFA A;  2PUG A;  2KEK A;  2PUA A;  1QP4 A;  3HZI B;  2IVB A;  2IU7 A;  1ZZ9 A;  1GT0 C;  4X4F A;  2GRM A;  2LYP A;  2KEI A;  2OFY A;  1LCC A;  1SQ8 A;  4I6R A;  1ZS4 A;  1RIO A;  3F51 A;  1JH9 A;  1DW9 A;  3LFP A;  3G5G A;  3LIS A;  1R69 A;  4PU7 A;  2EF8 A;  3UFD A;  2EWT A;  3PXP A;  1JFS A;  1WET A;  2PUC A;  1QP0 A;  1QPZ A;  1DWK A;  1ZVV A;  2H8R A;  1ZAY A;  5A7L A;  4Z58 A;  2JVL A;  1XWR A;  2MQK A;  4X4C A;  3ZHM A;  1LMB 3;  3OQN A;  3ZKC A;  3SCF A;  3FYM A;  3R1F A;  4PU3 C;  2ICP A;  4JQD A;  4I6T A;  3BS3 A;  2L49 A;  1AU7 A;  1WH8 A;  2AXV A;  3G7D A;  4PU4 C;  3RZZ A;  3ZHI A;  4Z5H A;  3DNV B;  2IVG A;  1RZR A;  3GBF A;  4OB4 A;  3QQ6 A;  1QQA A;  1ZZ8 A;  2IVQ A;  4X4B A;  3OQM A;  1CJG A;  1PNR A;  3QWG A;  4FN3 A;  1B0N A;  1Y9Q A;  2KPJ A;  1LCD A;  3CLC A;  1ADR A;  1L1M A;  2LCV A;  2WUS R;  1ZZ7 A;  2CSF A;  3QYX A;  3L1P A;  1JWL A;  1BDH A;  2AUW A;  4YAR A;  2XJ3 A;  1PRA A;  2PIJ A;  3GN5 B;  4Z59 A;  3MLF A;  1S7E A;  2JCG A;  2PUB A;  2LYL A;  3BDN A;  1BDI A;  2LYJ A;  1NEQ A;  4X4E A;  1UTX A;  4I6U A;  4X4I A;  5K98 B;  1POU A;  3D1N I;  1PRU A;  1UXD A;  2PUD A;  3O9X A;  2LYR A;  2AXZ A;  1WH6 A;  1ZZC A;  1OCT C;  4I8T A;  2IUO A;  3JXD L;  3EUS A;  3JXC L;  3SCG A;  4FBI A;  2O49 A;  4GQM A;  1Y7Y A;  1UXC A;  1PRV A;  4MCT A;  4F8D A;  2FJR A;  4GHJ A;  4JCX A;  2BNO A;  2XSD C;  1RPE L;  2CRO A;  4YBA A;  2D5V A;  3KJX A;  1YSE A;  3OMT A;  4MCX A;  2XIU A;  4J1X A;  3IVP A;  2LYQ A;  4YG7 B;  3JXB C;  2XCJ A;  3F52 A;  2B5A A;  3F6W A;  3U3W A;  4JCY A;  2AW6 A;  2KZ8 A;  1X2L A;  2BNN A;  3CRO L;  4IA8 A;  4X4D A;  2O4A A;  1NER A;  4YG1 A;  2O38 A;  3B7H A;  2PUF A;  3OQO A;  1OSL A;  3BD1 A;  2BNM A;  2GZU A;  2GRL A;  2R63 A;  2KEJ A;  1ZZB A;  4J1W A;  1ZZ6 A;  4IVZ A;  1ZUG A;  1VPW A;  2A6C A;  1IC8 A;  1HF0 A;  1CQT A;  2EBY A;  4Y42 A;  3FMY A;  2R1J L;  3H5T A;  3QF3 A;  4IWR A;  4Z5D A;  1QQB A;  1RZR D;  2LYK A;  2HIN A;  2AXU A;  1O4X A;  4X4H A;  1X57 A;  4NDW A;  1RZS A;  3GN5 A;  3VK0 A;  2BJC A;  2OR1 L;  3SCH A;  2MEZ A;  1LQC A;  2ICT A;  3KZ3 A;  2WIU B;  3OP9 A;  2AWI A;  4YG4 A;  2PUE A;  2HSG A;  2PE5 A;  2PPX A;  1ZPQ A;  2LYS A;  4O8B A;  3S8Q A;  2L8N A;  1JFT A;  3TRB A;  1R63 A;  3KXA A;  1PER L;  1WIZ A;  4X4G A;  3CEC A;  4PU8 A;  2XI8 A;  2IV1 A;  4Z5C A;  1E3O C;  1LLI A;  3FYA A;  1QP7 A; 
#chains in the Genus database with same CATH topology
 1WM5 A;  5BNW A;  5ANL A;  3RIB A;  1N54 A;  2IU7 A;  3PZ4 A;  4U04 A;  3P2B A;  2P9U G;  2EIL E;  4G25 A;  1N11 A;  5DIZ A;  1OCO E;  4UUC A;  3LYA A;  1HG2 A;  3HXE A;  4LG6 A;  2J4B A;  3D3M A;  1QYM A;  4I6T A;  3OKZ A;  2XRZ A;  1UJJ A;  2XCB A;  4ATZ D;  2H6H A;  3EDT B;  2M63 A;  4HS2 A;  1B0N A;  3FP3 A;  1QQE A;  5AAR A;  3S7B A;  5CCL A;  2R02 A;  3FUD A;  3SFZ A;  4ER5 A;  2LYL A;  3X2Q E;  4AV7 A;  2LYJ A;  1MX4 A;  4I6U A;  1SW6 A;  3J5P A;  5ARG A;  2JAB A;  4HOT A;  2QFC A;  3KEZ A;  3U4T A;  4F8D A;  3D9N A;  5GAH i;  1MFQ C;  3D9P A;  3OTN A;  1EPU A;  4RG6 A;  4WVL A;  2B5A A;  2IOS A;  3SI5 A;  2YHC A;  3ABK E;  1OXJ A;  4UQX A;  4F6R D;  1OCC E;  3CVX A;  5KCM A;  3B7H A;  2MXD A;  1ZBP A;  3ZXS A;  4C0E A;  2HCS A;  3FUF A;  1EDU A;  3LQX A;  3FTZ A;  4HRN A;  5D0O D;  5E75 A;  3TJP A;  3NBN B;  2BJC A;  1RZS A;  4XKB A;  2CG3 A;  1AP7 A;  2PUE A;  1S63 A;  5CBO A;  2XXP A;  5JHA A;  4O8B A;  3F6Q A;  3Q7A A;  1JCR A;  5FJY A;  3TRB A;  4PU8 A;  4TUM A;  2FFH A;  4WNG A;  1QP7 A;  3PS6 A;  3ASN E;  3KSL A;  5AQB A;  3QB2 A;  3MKR A;  1QP4 A;  5D0Q D;  1HU3 A;  1OY3 D;  2FO7 A;  2WXH A;  3DRA A;  3LFP A;  4KMO A;  1R69 A;  2VSN A;  1ZAY A;  2CHW A;  1LF8 A;  5G05 C;  2MYO A;  3GW4 A;  4PU3 C;  3ASD A;  2L49 A;  3B7T A;  3CHQ A;  3W9F A;  2XPZ A;  1PNR A;  4C9B B;  1SZ9 A;  3U66 A;  3CST A;  5KNH D;  1NZN A;  3DSU A;  4EZJ A;  2PXQ A;  1ZZ7 A;  2J07 A;  2GW1 A;  2HE0 A;  2AUW A;  1E8Y A;  3PUJ A;  2BKG A;  1W3B A;  3ONL A;  4DK5 A;  4KXK B;  1ZZC A;  3EUS A;  2L6B A;  3JXC L;  4MKT A;  4YVO A;  3UT8 A;  4TXQ A;  3AS4 A;  5EYP F;  5CEA A;  2WM9 A;  3RRN B;  2XSD C;  1E8X A;  4HLE A;  2CRO A;  4CDM A;  2WQ7 A;  3LY8 A;  1MJ0 A;  3CKC A;  5GAG i;  3DSW A;  4HB5 A;  2PXT A;  3CRO L;  4X4D A;  2WXG A;  1QZ2 A;  4OYS A;  2MHK A;  3CHP A;  4J8Y A;  3ZU7 B;  5CBN A;  3VLE A;  2WXP A;  1UW4 B;  2HYZ A;  5HQ8 A;  4BTB A;  1VPW A;  4U8V D;  5FTP A;  1JWG A;  5ENN A;  1A17 A;  4EZI A;  2WMN A;  4AY6 A;  4BX9 A;  4NDW A;  4RG9 A;  4YG4 A;  5G55 A;  3EHN A;  2LYS A;  3ASH A;  1R63 A;  4GTP A;  2XS8 A;  2YHE A;  2F8X K;  1YYH A;  5ENR D;  2PXD A;  2IO3 C;  2PUA A;  2RFA A;  3HZI B;  5CHE E;  1LTX A;  3V31 A;  4N2S A;  3F51 A;  4J8S A;  4ANU A;  2R59 A;  2EF8 A;  3TG5 A;  1KLX A;  1N4R A;  1ZVV A;  2LO6 A;  4YDW A;  2GRQ B;  5AJL A;  1JWF A;  3S2A A;  2I2O A;  1WH8 A;  4PU4 C;  3RZZ A;  4NRH B;  3LVR E;  3Q9N C;  2PXU A;  2DVW A;  2PQR A;  4G8K A;  3QOX A;  4N2Q A;  5HS0 A;  4ER7 A;  3L1P A;  4CT0 A;  3CHO A;  4K5A B;  4QQI A;  2J49 A;  2OND A;  3DXM G;  4GA2 A;  1UTX A;  4UWK A;  4HRM B;  5A7D B;  4JEU A;  1PRU A;  1UXD A;  3VLD A;  2IU1 A;  1MYO A;  3UM2 A;  2F37 A;  2V4H C;  3OWQ A;  3JUE A;  2XQ0 A;  3CV0 A;  3TEP A;  5FQ4 A;  1TN6 A;  4OBM A;  5FIO A;  2XIU A;  3HRA A;  3ESL A;  4DE9 A;  2YBD A;  1JCS A;  5DSX A;  2KM4 A;  4I9E A;  4PUC A;  2O38 A;  5CER B;  1DCQ A;  2VSY A;  4GML A;  4UWF A;  4A3T A;  5KBA A;  1LD8 A;  1Z5S C;  1TNU A;  5AEN A;  1S70 B;  2A4Z A;  5AYW D;  5AN8 A;  4FLH A;  3PZ1 A;  4N3A A;  4IYP A;  2L0T B;  2L8N A;  4ILI A;  2P2C P;  3KXA A;  4G8L A;  2XI8 A;  5HI7 A;  4ZHB A;  2PUG A;  2KEK A;  4NUR A;  4ABN A;  3CVV A;  3CVW A;  1GT0 C;  2DWZ A;  2LYP A;  4I17 A;  2CG2 A;  4PU7 A;  4ER0 A;  3U9W A;  4HOU A;  3SY2 A;  4MLP A;  2VGY A;  1IYG A;  5ENP D;  3DXK G;  5EDS A;  3FH7 A;  5ENQ D;  3C72 A;  4GCN A;  4Z5H A;  3EHR A;  5DTQ A;  3DNV B;  4EBA G;  4OB4 A;  4CGV A;  1L5J A;  1LCD A;  4PDX A;  2WUS R;  5JA4 D;  4EQF A;  1OWN A;  1HS6 A;  2DIW A;  2XEH A;  4Q2J A;  4OAV B;  5G2N A;  2XXA A;  4DI3 A;  1FPP A;  2IUO A;  3UI2 A;  1SZA A;  4FBI A;  3E32 A;  4JL0 A;  1HZ4 A;  1HQ1 A;  2IQC A;  3JYS A;  3HIZ A;  1Z6T A;  1X81 A;  3E30 A;  5M72 A;  4JCY A;  2HO1 A;  3F6W A;  3E37 A;  5EX0 A;  3EUV A;  2XZT G;  3ML9 A;  4I2W A;  4OAU C;  1CQT A;  3HDX A;  2R1J L;  3CK8 A;  2X6F A;  3QF3 A;  3TWR A;  1O4X A;  1E7V A;  4WAF A;  3BU8 A;  1N0Q A;  1OWO A;  2PE5 A;  1X5B A;  4RVB A;  1XGW A;  5FZQ A;  3EHM A;  3CVL A;  1E3O C;  3FUN A;  3L82 A;  4E85 A;  3PEV B;  4WWO A;  4XX5 A;  4EHM A;  2KEI A;  4AIF A;  1SQ8 A;  5EIB E;  4ANV A;  3UFD A;  3FHE A;  3E34 A;  4ILH B;  1XWR A;  3B7R L;  3MV3 B;  2BED A;  3DM5 A;  4HRA A;  2KZT B;  4B94 A;  3PRZ A;  3UWP A;  2X6J A;  1SQM A;  2V8S E;  2ODR D;  3AG4 E;  3V2O A;  5HKP A;  1NFI E;  3PH0 C;  5JMN D;  1BI8 B;  1BDH A;  1YA0 A;  3A9Y A;  2B6C A;  3CVY A;  3LKU A;  2JCG A;  3IBE A;  2B0O E;  5G04 J;  5E76 A;  4GB9 A;  2FI7 A;  3KS2 A;  3DBS A;  2VEO A;  5FZR A;  3MX3 A;  2L9B A;  4LUN U;  3T5V A;  3CK9 A;  2PXP A;  3Q9U C;  1OWL A;  4X8Q A;  5G05 J;  3B95 A;  3CVP A;  1ELW A;  5AQ9 A;  4K5C A;  2GRN B;  4LNG A;  1N52 A;  1ELK A;  2J09 A;  4DX1 A;  4IA8 A;  2FF4 A;  3C98 A;  2OEV A;  1YCS B;  4F1S A;  1ZZB A;  4ER6 A;  5BXO A;  5LOZ A;  4KZC A;  1K1A A;  4FU3 A;  4X4H A;  3ZYK A;  3KZ3 A;  3OP9 A;  3FEY A;  3WG7 E;  2KCK A;  4AOF A;  3FU5 A;  2FEZ A;  3CKB A;  1LD7 A;  3QDN A;  3T8M A;  2LNI A;  3EU9 A;  3L13 A;  4I2Z A;  1QB2 A;  1OWP A;  3BUA A;  3G2W A;  2KBX A;  5FIN A;  2A5E A;  1DW9 A;  5DRT A;  1JFS A;  3IKO B;  1WAO 1;  2H8R A;  4O60 A;  2HM8 A;  3Q15 A;  4FC8 A;  1RZR A;  4N3B A;  4XEI G;  4CZ2 D;  3B13 A;  3FWV A;  5CMW A;  5LP0 A;  1KZO A;  3ZYL A;  4LEU A;  4U8H A;  2P9S G;  4NIK A;  4L2L A;  1N4P A;  4U95 D;  3TEL A;  4UI9 K;  4U07 A;  4A1S A;  4XZ4 A;  3PUK A;  1E7U A;  3T9K A;  1VDY A;  1DVP A;  1IXV A;  2J7W A;  2WMO A;  3LVQ E;  2QZA A;  2VGE A;  3ABL E;  3JXD L;  3CVQ A;  1BPO A;  4EQZ A;  2L0I A;  3NZU A;  2FJR A;  4GHJ A;  3KJX A;  3HVE A;  4A3V A;  5KJN A;  5JJ7 A;  2P9K G;  2XHE A;  2YNQ A;  2AW6 A;  1X2L A;  3TWQ A;  1H6P A;  4GZ5 A;  4CDR A;  2J8S D;  3TXM A;  2BNM A;  2XPY A;  3IXE A;  2GRO B;  2XS1 A;  2IJG X;  2M4H A;  4J1W A;  4WWP A;  1ZZ6 A;  4JD2 G;  5AQA A;  2A6C A;  3D9L A;  4F3V A;  2VGX B;  4Y6W A;  3Q47 B;  3FDH A;  3GZS A;  4ILG A;  3LJN A;  4G26 A;  3DSS A;  3R09 A;  1IQU A;  4IN3 B;  3PE5 A;  3DEO A;  3LPZ A;  2IVB A;  2P9L G;  5CRV A;  4X4F A;  1PY1 A;  3UT7 A;  1RIO A;  4UI9 J;  3D9O A;  4EKI A;  2GGF A;  3JQ0 A;  1QP0 A;  4BY6 A;  1DWK A;  3EIJ A;  1SVX A;  3CHR A;  4UWL A;  1RZ4 A;  3QWP A;  5DRY A;  1D8D A;  2F0Y A;  3FYM A;  4WWN A;  3O4Z A;  5KWD A;  4ATG A;  3IEG A;  1CJG A;  3ZFW A;  4MRU A;  4B8C B;  4EK9 A;  3FU3 A;  4WUY A;  1L1M A;  4GYO A;  4WNF A;  3Q78 A;  2WXK A;  5DTM A;  3AS8 A;  3QFI A;  1O5M A;  4P29 A;  5BUZ A;  2V3C C;  4YAR A;  3MLF A;  5EN5 D;  2LYR A;  5CED B;  1NA3 A;  1DNP A;  1E96 B;  2L1P A;  2CFU A;  3RO3 A;  4GCO A;  2RD0 A;  3PVL A;  2X38 A;  1FT1 A;  2BNO A;  4JA7 A;  3ZYQ A;  3LY7 A;  4JXT A;  4OVV A;  3TWT A;  1S0P A;  1TJC A;  3U3W A;  2ETA A;  3EU5 A;  2V0P A;  4I6J A;  3OQO A;  1OSL A;  1SA5 A;  1E90 A;  2GZU A;  2QC9 A;  2KEJ A;  3BQO A;  2ZIS A;  3FUJ A;  3MV2 B;  4BEP A;  4U0U A;  3H5T A;  2KC7 A;  5B3S E;  2LLV A;  4L1B A;  1GW6 A;  1RZR D;  1TN8 A;  1V54 E;  4I6E A;  1X57 A;  3VK0 A;  2PNN A;  2WIU B;  2AWI A;  1ZPQ A;  5FWQ A;  1E8W A;  3OXG A;  3NB2 A;  1WIZ A;  1EF1 C;  4YDY A;  3FYA A;  2PQN A;  4I6G A;  3NZL A;  1HF8 A;  4C0M A;  4FHK A;  3ZEF A;  2MOW A;  3IHV A;  3LIS A;  3AAA C;  2GRR B;  1QPZ A;  1WDY A;  2CHZ A;  3R9A B;  1MX6 A;  2WPV A;  3G2U A;  4X4C A;  1LMB 3;  3R1F A;  3BS3 A;  3A9Z A;  4GPK A;  1HXI A;  4A1G A;  4EZL A;  3FH8 A;  1N4S A;  4NQ0 A;  1BU9 A;  3ZKJ A;  5JJ6 A;  1Y9Q A;  4JA9 A;  2I1K A;  3WXX A;  4JC8 A;  5CEC B;  2LCV A;  1KPS B;  1N4Q A;  3C3Q A;  1JPL A;  2XJ3 A;  1PRA A;  4EKG A;  1V55 E;  3ASG A;  4GMR A;  2WXO A;  3PE4 A;  3ULE G;  2VSO E;  2XEN A;  2HR2 A;  1TN7 A;  1POU A;  2PUD A;  3RK6 A;  1WH6 A;  3ZVV A;  3FEX A;  5EIL A;  2JLB A;  3R7R A;  1UN8 A;  3MGB A;  1NA0 A;  5KJM A;  3CR3 A;  2C0M A;  3UKR G;  3DSX A;  5LCW J;  4MCX A;  3OMT A;  2DBA A;  4MS6 A;  2H6G A;  2UY1 B;  4O1P A;  3JXB C;  2XCJ A;  3D9J A;  3RRM B;  2OV8 A;  1OWM A;  2ETC A;  2R63 A;  4IUL A;  1IC8 A;  3JXI A;  4GAA A;  1QQB A;  3HYM B;  4UWH A;  4BSX A;  4K03 A;  2HSG A;  2XGO A;  2ZGD A;  1JFT A;  3S7J A;  1G3N B;  2Y69 E;  1LLI A;  5ENO D;  3APF A;  3ABM E;  4YDO A;  3SQV A;  3FUK A;  4TUU A;  3NAW A;  4YND A;  4J8E A;  2OFY A;  3QAQ A;  5KJK A;  4BFR A;  3PEU B;  3MKQ A;  1N9A A;  4N39 A;  4YDE A;  4DX2 A;  3TG4 A;  3ZHM A;  3FU6 A;  3PNL B;  3MYV A;  4L9P A;  4IRU A;  2PXL A;  3U64 A;  5B1B E;  1QNF A;  1HFA A;  4B0Z A;  4ME2 A;  4FN3 A;  2ZXW E;  4JPS A;  4FAD A;  3UIN C;  2Y3A A;  4PS8 A;  3ZYM A;  3UM3 A;  3KSQ A;  3RO2 A;  3NRO A;  3NOC D;  4I8T A;  1Q2Z A;  2IF4 A;  4CDN A;  3DWL G;  2XXQ A;  4XI9 A;  4I9C A;  3SCG A;  2O49 A;  4HOR A;  3M9L A;  5EYL A;  1K3Z D;  1ZB1 A;  1Y7Y A;  2QY7 A;  3RRU A;  4HBD A;  3TWU A;  3ZGQ A;  3Q5M A;  1TNB A;  4GA0 A;  4RQI A;  2R2L A;  3CQG B;  1HE8 A;  4XE0 A;  4GTQ A;  4U96 D;  2PXE A;  4Y6C A;  3DSV A;  1NER A;  3VLF A;  2DYS E;  4HOQ A;  4A63 B;  3R9M A;  4ACL A;  1FVF A;  3FMY A;  3ULY A;  1H6K A;  3QJZ A;  4TXP A;  1JCQ A;  3ESK A;  2MEZ A;  3GYZ A;  4DLQ A;  2PM7 A;  4X4G A;  4Z5C A;  2IV1 A;  5DTR A;  2H6I A;  3OXF A;  3FUE A;  1K8K G;  1EYH A;  4NAC A;  2OOE A;  2NXP A;  3CVN A;  3G5G A;  4CRW A;  3QWV A;  2EWT A;  5CMY A;  2PUC A;  3L54 A;  3NOG D;  4Q96 A;  2PM6 A;  2LXM A;  1IHB A;  3ZKC A;  2YIN A;  3L16 A;  3CIA A;  2WXM A;  2QYU A;  3ZHI A;  2WXI A;  2IVG A;  4RLY A;  4X4B A;  1INZ A;  3AJI A;  3L22 A;  3E4B A;  4GPM A;  2WQ6 A;  4JHJ A;  3K9I A;  2HCN A;  3QYX A;  3QWW A;  3DEP A;  3TWV A;  3L9T A;  5FT9 A;  2PUB A;  3L6A A;  3URZ A;  3FUL A;  1NEQ A;  4I1A A;  2P9P G;  3D1N I;  5H7P A;  3VTX A;  3GZC A;  4GTM A;  3Q49 B;  4URK A;  1N94 A;  3ENE A;  4XI0 A;  3SF4 A;  3DST A;  1AWC B;  2OEW A;  5T8I A;  3ONK A;  2LLW A;  2NC9 A;  1MZC A;  3C5R A;  4JHK A;  1O1S A;  3I4G A;  4KVO A;  1QBQ A;  2OVF A;  2V5Q C;  4HQD A;  4YG7 B;  2KZ8 A;  3G2T A;  3UKU G;  2EIK E;  3T8K A;  4EZK A;  3AU4 A;  1UG3 A;  3ZUV B;  2Y4U A;  3UPV A;  2YQ8 A;  4G23 A;  4BSZ B;  2F8Y A;  4Y42 A;  3D9M A;  1XNF A;  3MEK A;  3T5X A;  3IV0 A;  1UOH A;  1TYQ G;  3CHS A;  4GMJ A;  3GN5 A;  2ICT A;  3HXD A;  3DPD A;  3SR4 A;  2ION A;  1H2V C;  3KD7 A;  3UQ3 A;  4LCT A;  1U2Z A;  1EFA A;  4W9R A;  4M7C A;  3UMV A;  1A5E A;  5ARF A;  2CFZ A;  4RSY A;  2R5S A;  4HI9 A;  5EID A;  1ZS4 A;  3ZHE B;  1P5Q A;  3ZXP A;  5ITZ F;  5AJD A;  5J90 A;  4GTO A;  4HFG A;  3OQN A;  4DRX E;  4Q69 A;  3NZS A;  1MX2 A;  4DPR A;  1Y6I A;  3BG1 B;  5T4Y A;  2VJ8 A;  3CVU A;  4HLL A;  2CSF A;  3I5P A;  5T3R A;  4G2V A;  4D10 C;  4JB8 P;  3GUU A;  4B89 A;  1BDI A;  2IO2 C;  1ELR A;  4KVM A;  5BXU A;  4U0Z A;  1B89 A;  3HVE B;  4DJA A;  3EHQ A;  3Q75 A;  4HOS A;  3DPY A;  4MBG A;  2KXP C;  1YMP A;  1HH8 A;  2OVB A;  3HG0 D;  4J6I A;  2BTD A;  2V5F A;  1BLX B;  4J1X A;  4M3O A;  2XCC A;  3IVP A;  3F52 A;  5ENT D;  5FQ6 A;  4U63 A;  5C2Y A;  1DCE A;  1K1B A;  4WND A;  4YG1 A;  2LAI A;  4B8A A;  3EJN A;  5D2M C;  2DCP A;  5FQ7 A;  1H2U A;  2LYK A;  2HIN A;  3VWS A;  4LNB A;  2AXU A;  5LX8 A;  4LNU D;  2GRP B;  3R7Q A;  2IEJ A;  4FUL A;  1OUV A;  3BG0 B;  4EEC A;  2XEV A;  3PZD A;  5J08 A;  3UM1 A;  2VQ2 A;  4L7T A;  3LJ3 A;  4BX8 A;  3OAW A;  2R03 A;  3FY4 A;  4H7Y A;  1LCC A;  2P9N G;  3ZN3 A;  4BES A;  3RAU A;  5DBK A;  2LSU A;  3ZIM A;  4YVQ C;  3SFX A;  3FUI A;  2WQH A;  5EKQ D;  2XGM A;  3UT4 A;  1BI7 B;  3G7D A;  2J4D A;  4LER A;  1OT8 A;  5D66 A;  3GZD A;  3D9K A;  4JEH A;  5KJL A;  5LCW C;  3B7B A;  3D9H A;  3SZ7 A;  3QNK A;  4EBA A;  3PNT B;  2BF0 X;  4AXH A;  4F1P A;  1JWL A;  3CEQ A;  4EPZ A;  4CCA A;  1TEZ A;  2LUH A;  4AJW A;  4QFV A;  3C3O A;  3S7F A;  2PZI A;  3O9X A;  4G24 A;  2PXV A;  3TWX A;  3KAE A;  2J7U A;  2EIM E;  1UXC A;  3G2S A;  2X6K A;  3I3N A;  1RPE L;  3MZL B;  2AVP A;  3J5Q B;  4N3C A;  2XGS A;  5BV0 A;  1NP7 A;  4HVB A;  3UIP C;  4CT4 A;  3CSF A;  3PZ3 A;  3ZPJ A;  2BNN A;  4BET A;  4KT6 B;  3IHY A;  5LFA A;  2FUL A;  4BT9 A;  4ACK A;  4JHR A;  1FCH A;  3GZ2 A;  3ASO E;  2WVI A;  4BWR A;  3KEA A;  3UTM A;  3FUM A;  4AP2 A;  1Z3Y A;  1PAQ A;  4GZ3 A;  3S8Q A;  1H19 A;  2WXF A;  3FTS A;  4Q94 A;  4DX6 D;  2GRM A;  4G1T A;  4J7W A;  3OXL A;  1JH9 A;  3TWW A;  4HXI A;  5G04 C;  1HX8 A;  3NXH A;  2PL2 A;  4UQZ A;  4N5Q A;  4Z58 A;  3V2X A;  2MQK A;  4DI4 A;  1IKN D;  3Q7F A;  3A9X A;  4CYM D;  2ICP A;  5C1D A;  1AU7 A;  3FTW A;  2P9I G;  5B1A E;  1QQA A;  3RSE G;  5BV1 A;  3AU5 A;  2KPJ A;  3V30 A;  2KCV A;  4O1O A;  1WY6 A;  2R05 A;  4I43 A;  4AM9 A;  2NSZ A;  4Z59 A;  3Q79 A;  3ML8 A;  4AVX A;  3TFL A;  4KZ0 A;  1FT2 A;  2LAH A;  5JUW A;  3BEE A;  1U2V G;  5BT1 A;  3ME5 A;  4FA6 A;  1Z3X A;  2XEE A;  4PS7 A;  4DUI A;  3SD5 A;  4K0R A;  3FTX A;  4YBA A;  3B7U X;  4XIF A;  4U7E B;  5EX3 A;  1NI1 A;  4DLO A;  4PS3 A;  1ZU2 A;  4U0S A;  3KL4 A;  3CK7 A;  3ISM C;  5A6C A;  2E2E A;  4BT8 A;  2O4A A;  1SA4 A;  3Q73 A;  1MQS A;  3SX0 A;  1ZUG A;  1H2T C;  1WG0 A;  3L17 A;  4J8D A;  3SNX A;  4GZ6 A;  2IOL A;  2PPX A;  1O1R A;  3E33 A;  3APD A;  1IHG A;  4LSZ E;  3G0T A;  3CLJ A;  1ZZ9 A;  1O1T A;  2FO1 E;  4G11 A;  2WXL A;  4DX5 D;  4I6R A;  5IY5 E;  3RU0 A;  4FP7 A;  4J8F A;  2RG8 A;  4DX7 D;  2NYJ A;  3QOW A;  2JVL A;  2XZD G;  1PC2 A;  2UY1 A;  3SBT B;  3P1U A;  1S64 A;  2AXV A;  1OCR E;  5AIJ A;  2WB2 A;  3GBF A;  1MHQ A;  1TNO A;  2Y4T A;  3PZ2 A;  3FU0 A;  4A55 A;  3HXC A;  3QWG A;  4KYO B;  1ADR A;  3VTY A;  3LDZ A;  3N71 A;  2RKK A;  2EQX A;  4FJZ A;  4V3I A;  4FLB A;  5CRU A;  2KCL A;  2X3M A;  2X6I A;  4L2Y A;  1TR4 A;  2WXQ A;  3BDN A;  3NDB B;  2IY0 C;  1QZX A;  4X4I A;  3MA5 A;  1D9S A;  2R17 C;  1H0A A;  1HO8 A;  2VSX E;  3AG1 E;  3MEJ A;  2LXL A;  4JVS A;  1Y8M A;  4FJY A;  1PRV A;  5KNG A;  4DE8 A;  4I1O B;  1YSE A;  4GTS A;  4K5B A;  3CHM A;  4R7L A;  2PXK A;  4HRL A;  2WXR A;  4FHJ A;  3SO8 A;  2Y1L E;  2GRL A;  3UIO C;  2PXF A;  2J9Q A;  3SGH A;  2VYI A;  3ASF A;  3FFL A;  2EBY A;  4IWR A;  3HXB A;  3JCK C;  3LEW A;  2PXB A;  4U8Y D;  2OR1 L;  2ILR A;  1H6O A;  5AQ7 A;  2ETB A;  2XPI A;  2WXJ A;  3CEC A;  4JZY A;  4CEM A;  4HNA D;  3UXG A;  3TXN A;  5JJT A;  1N95 A;  3D9I A;  5FZS A;  1JUQ A;  3AS5 A;  2FBN A;  4N5C A;  3PXP A;  5A23 A;  3ZHE A;  3LY9 A;  3GZD C;  3PDN A;  4O6F A;  2ZGG A;  3PRE A;  4GTR A;  3AG3 E;  3SCF A;  4JQD A;  2J08 A;  4BER A;  4GTV A;  3APC A;  4E6H A;  3SBS A;  3QQ6 A;  3C3R A;  1ZZ8 A;  2IVQ A;  3OQM A;  3CQC B;  2BUG A;  4C48 B;  3QK0 A;  4TV3 A;  3NQP A;  3Q4A B;  3EIQ C;  4ER3 A;  4PH4 B;  3W9G A;  1DUL A;  2C0L A;  2PIJ A;  3SFY A;  3GN5 B;  5AAO A;  2I6H A;  3QOU A;  5CCM A;  3FTY A;  5K98 B;  2EIJ E;  3QKY A;  2IFU A;  2Y0B G;  4F7A A;  1OCT C;  3LCA A;  1UN9 A;  2V4L A;  2X6H A;  3TGO A;  3ZW3 A;  4GQM A;  3L08 A;  4MCT A;  4JCX A;  5FQ8 A;  2D5V A;  4AEZ C;  4UI9 C;  3JUI A;  3O48 A;  2UWJ G;  4ANW A;  3LXU X;  2XRY A;  3LS8 A;  5JHB A;  2E0I A;  2VTB A;  4I1M A;  1UJK A;  2VTB B;  3JXJ A;  4OVU A;  2EIN E;  2OCC E;  3BD1 A;  3UUX A;  4B93 B;  1U3C A;  4IVZ A;  2BKK B;  3PE3 A;  2ZU6 B;  1HG5 A;  4F53 A;  3ZPX A;  2I1J A;  3MKQ B;  1KT0 A;  3B7S A;  2I9C A;  4JW1 A;  1D8E A;  2MRI A;  5HRY A;  1LQC A;  4APF A;  4CGW A;  3MJW A;  1NW3 A;  1PER L;  4GTT A;  4KBQ A;  4GZC A;  3G2V A;  1U3D A;  4XKC A;  2AJA A;  3SHF A;  4UQY A;  2L6J A;  2KZT A;  3ULQ A;  4Z68 A;  1IQR A;  3MCX A;  5BW8 C;  3TL5 A;  4HI8 A;  2VGX A;  2RFM A;  1WET A;  3RKV A;  1N0R A;  2HFZ A;  5A7L A;  1TNY A;  2LNM A;  1RW2 A;  1TNZ A;  5ENS D;  4H7X A;  3HHM A;  2WXN A;  1TJF A;  3FTV A;  1FVH A;  3RJV A;  3CLC A;  4TXR A;  2DZN A;  5ANR A;  1KZP A;  3CGH A;  4ZFH A;  3FUH A;  1S7E A;  3UM0 A;  4GU5 A;  4X4E A;  3I4R B;  3QC1 A;  3ZRH A;  3UX4 A;  2LSV A;  2KAT A;  2AXZ A;  3AG2 E;  1NL4 A;  3S7D A;  4AY5 A;  1BD8 A;  2JEK A;  3V79 K;  4J0U A;  2DYR E;  1DC2 A;  4GA1 A;  2QYJ A;  4GYY A;  2P58 C;  4UWG A;  4L23 A;  2LYQ A;  3GZ1 A;  2Q7F A;  3HXF A;  3TWS A;  1E8Z A;  2CHX A;  2PUF A;  3FTU A;  4GYW A;  2H6F A;  4ANX A;  3JQ1 A;  2DZO A;  1HF0 A;  5BPP A;  4TRQ A;  3TAX A;  1OCZ E;  3NF1 A;  2JQE A;  4Z5D A;  3QAR A;  2C2L A;  5DT2 A;  3ZNG A;  1KT1 A;  4BTA A;  3SCH A;  4LRZ A;  4WNE A;  2ZIR A;  3FH5 A;  2A5U A;  4APO A;  4GZD A; 
#chains in the Genus database with same CATH homology
 1WM5 A;  3FTS A;  4E85 A;  5BNW A;  3PEV B;  5ANL A;  3RIB A;  1N54 A;  4Q94 A;  2IU7 A;  4WWO A;  3FUK A;  4TUU A;  4XX5 A;  4YND A;  2GRM A;  4G1T A;  3OXL A;  4J8E A;  2KEI A;  2OFY A;  3QAQ A;  4U04 A;  1SQ8 A;  3P2B A;  4AIF A;  4BFR A;  5KJK A;  3PEU B;  1JH9 A;  3MKQ A;  5A23 A;  4G25 A;  4ANV A;  3UFD A;  3FHE A;  4N39 A;  4HXI A;  5DIZ A;  5G04 C;  1HX8 A;  4ILH B;  2PL2 A;  4UQZ A;  4Z58 A;  3TG4 A;  1XWR A;  2MQK A;  3ZHM A;  3B7R L;  3LYA A;  1HG2 A;  4DI4 A;  3MV3 B;  2J4B A;  2ICP A;  3D3M A;  4I6T A;  5C1D A;  1AU7 A;  4WWP A;  3FTW A;  2XRZ A;  3FU6 A;  3PNL B;  3MYV A;  1UJJ A;  2KZT B;  4IRU A;  3U64 A;  4B94 A;  2XCB A;  3PRZ A;  1QNF A;  1QQA A;  1HFA A;  2X6J A;  4B0Z A;  1SQM A;  3EDT B;  5BV1 A;  2V8S E;  4ME2 A;  2M63 A;  4HS2 A;  4FN3 A;  3AU5 A;  1B0N A;  2KPJ A;  3FP3 A;  4JPS A;  1QQE A;  2KCV A;  3PH0 C;  3S7B A;  4FAD A;  2Y3A A;  4PS8 A;  3ZYM A;  5CCL A;  1BDH A;  1WY6 A;  4I43 A;  4AM9 A;  1YA0 A;  2NSZ A;  3FUD A;  3SFZ A;  4Z59 A;  3CVY A;  3ML8 A;  3LKU A;  2JCG A;  2LYL A;  4AV7 A;  4AVX A;  2LYJ A;  4I6U A;  3IBE A;  4KZ0 A;  5ARG A;  3RO2 A;  5G04 J;  4HOT A;  5E76 A;  4I8T A;  2LAH A;  2IF4 A;  4CDN A;  4GB9 A;  2FI7 A;  3KS2 A;  3DBS A;  3BEE A;  4XI9 A;  4I9C A;  5FZR A;  5BT1 A;  4FA6 A;  3SCG A;  2O49 A;  1Z3X A;  3MX3 A;  2QFC A;  3KEZ A;  2L9B A;  4HOR A;  4PS7 A;  1Y7Y A;  2QY7 A;  4LUN U;  3U4T A;  4F8D A;  3T5V A;  3D9N A;  3RRU A;  3CK9 A;  3SD5 A;  4K0R A;  3FTX A;  4YBA A;  1OWL A;  3B7U X;  4XIF A;  5G05 J;  3ZGQ A;  5EX3 A;  3Q5M A;  3D9P A;  4DLO A;  3CVP A;  1ELW A;  3OTN A;  4GA0 A;  1EPU A;  4PS3 A;  4RG6 A;  3CQG B;  1HE8 A;  4XE0 A;  1ZU2 A;  1N52 A;  2B5A A;  2IOS A;  4U0S A;  3SI5 A;  3CK7 A;  2YHC A;  5A6C A;  1ELK A;  2J09 A;  4IA8 A;  2E2E A;  4BT8 A;  2O4A A;  2FF4 A;  4UQX A;  4Y6C A;  3VLF A;  1NER A;  3CVX A;  5KCM A;  3C98 A;  3B7H A;  1MQS A;  1ZBP A;  4HOQ A;  4F1S A;  3ZXS A;  4C0E A;  1ZZB A;  1EDU A;  3FUF A;  4ACL A;  1ZUG A;  1FVF A;  1H2T C;  3FMY A;  3FTZ A;  5D0O D;  1H6K A;  5LOZ A;  5E75 A;  3QJZ A;  3L17 A;  4J8D A;  4KZC A;  3TJP A;  4FU3 A;  3SNX A;  4X4H A;  2BJC A;  1RZS A;  4GZ6 A;  4XKB A;  3ESK A;  2CG3 A;  3ZYK A;  2MEZ A;  3KZ3 A;  2IOL A;  3OP9 A;  2PUE A;  3GYZ A;  5JHA A;  2PPX A;  4O8B A;  3FEY A;  2PM7 A;  4DLQ A;  5FJY A;  3TRB A;  2KCK A;  3APD A;  4X4G A;  4PU8 A;  1IHG A;  4Z5C A;  2IV1 A;  3FU5 A;  4AOF A;  4WNG A;  1QP7 A;  2FEZ A;  3PS6 A;  3CKB A;  3QDN A;  3T8M A;  3CLJ A;  3QB2 A;  3MKR A;  1QP4 A;  5D0Q D;  2LNI A;  1ZZ9 A;  3L13 A;  1HU3 A;  3OXF A;  3FUE A;  4I2Z A;  1OWP A;  4G11 A;  3G2W A;  2WXL A;  1EYH A;  4I6R A;  2FO7 A;  2WXH A;  2OOE A;  2NXP A;  4NAC A;  3CVN A;  1DW9 A;  3LFP A;  4KMO A;  3G5G A;  3RU0 A;  1R69 A;  4CRW A;  3QWV A;  2EWT A;  1JFS A;  3IKO B;  2PUC A;  1WAO 1;  4FP7 A;  4J8F A;  5CMY A;  2H8R A;  2VSN A;  2RG8 A;  1ZAY A;  3L54 A;  4Q96 A;  2PM6 A;  2CHW A;  2JVL A;  1LF8 A;  5G05 C;  3ZN3 A;  1PC2 A;  2UY1 A;  3GW4 A;  3L16 A;  3ZKC A;  2HM8 A;  2YIN A;  3SBT B;  4PU3 C;  3CIA A;  3P1U A;  3ASD A;  3Q15 A;  2L49 A;  2WXM A;  2AXV A;  3ZHI A;  2WXI A;  4FC8 A;  2IVG A;  3B7T A;  3CHQ A;  1RZR A;  4N3B A;  5AIJ A;  2WB2 A;  3GBF A;  5CMW A;  1MHQ A;  3B13 A;  3FWV A;  2Y4T A;  5LP0 A;  4X4B A;  3FU0 A;  2XPZ A;  4A55 A;  1INZ A;  1PNR A;  3ZYL A;  3QWG A;  4KYO B;  4LEU A;  3UPV A;  3L22 A;  1ADR A;  1SZ9 A;  3VTY A;  3CST A;  3LDZ A;  3E4B A;  3N71 A;  4C9B B;  3U66 A;  1NZN A;  4U8H A;  2WQ6 A;  4EZJ A;  4L2L A;  2EQX A;  1ZZ7 A;  3K9I A;  4FJZ A;  4JHJ A;  3QYX A;  3QWW A;  2J07 A;  4FLB A;  4U07 A;  4UI9 K;  4V3I A;  4A1S A;  4XZ4 A;  2GW1 A;  3PUK A;  2AUW A;  1E8Y A;  2KCL A;  2X3M A;  2X6I A;  4L2Y A;  5FT9 A;  2PUB A;  3L6A A;  1E7U A;  2WXQ A;  3BDN A;  3URZ A;  3FUL A;  1NEQ A;  3PUJ A;  1VDY A;  4X4I A;  1DVP A;  4I1A A;  1W3B A;  3MA5 A;  3D1N I;  3ONL A;  4DK5 A;  2WMO A;  3LVQ E;  4KXK B;  1ZZC A;  1H0A A;  2R17 C;  1HO8 A;  2VSX E;  3VTX A;  3JXD L;  3EUS A;  3CVQ A;  1BPO A;  3JXC L;  4MKT A;  4YVO A;  3UT8 A;  3Q49 B;  2L0I A;  4JVS A;  3NZU A;  3AS4 A;  1Y8M A;  4URK A;  2WM9 A;  4FJY A;  3ENE A;  3RRN B;  4XI0 A;  1PRV A;  3SF4 A;  2FJR A;  5T8I A;  4GHJ A;  3ONK A;  2XSD C;  1E8X A;  4BTB A;  2CRO A;  4CDM A;  4HLE A;  2WQ7 A;  4I1O B;  3LY8 A;  3KJX A;  2NC9 A;  1YSE A;  3HVE A;  3CHM A;  3CKC A;  4A3V A;  5KJN A;  4JHK A;  3I4G A;  4KVO A;  5JJ7 A;  2OVF A;  2XHE A;  4R7L A;  4YG7 B;  2YNQ A;  2AW6 A;  2KZ8 A;  1X2L A;  3CRO L;  4GZ5 A;  4EEC A;  4X4D A;  2WXG A;  3G2T A;  2WXR A;  4CDR A;  4EZK A;  3AU4 A;  1QZ2 A;  4FHJ A;  4OYS A;  3TXM A;  2MHK A;  3CHP A;  1UG3 A;  2BNM A;  2XPY A;  3VLE A;  2GRL A;  2IJG X;  2WXP A;  1UW4 B;  2HYZ A;  4J1W A;  2J9Q A;  2Y4U A;  1ZZ6 A;  1VPW A;  2VYI A;  2YQ8 A;  2A6C A;  3D9L A;  3ASF A;  3FFL A;  4G23 A;  2EBY A;  4Y42 A;  2VGX B;  4Y6W A;  5FTP A;  4F3V A;  1JWG A;  3D9M A;  5ENN A;  1A17 A;  4IWR A;  1XNF A;  3Q47 B;  4AY6 A;  2WMN A;  3MEK A;  3T5X A;  3JCK C;  3IV0 A;  3FDH A;  3CHS A;  3LEW A;  4NDW A;  4GMJ A;  3GN5 A;  3GZS A;  4RG9 A;  4BX9 A;  2OR1 L;  4YG4 A;  4ILG A;  2ICT A;  4G26 A;  5G55 A;  2ILR A;  3EHN A;  2LYS A;  3DPD A;  2ION A;  1H2V C;  1R63 A;  3ASH A;  3KD7 A;  2XPI A;  2WXJ A;  3CEC A;  4JZY A;  1IQU A;  2YHE A;  3UQ3 A;  4LCT A;  4IN3 B;  4CEM A;  1EFA A;  2PUA A;  4W9R A;  3HZI B;  2IVB A;  3LPZ A;  3UMV A;  4X4F A;  1PY1 A;  5CHE E;  2CFZ A;  5ARF A;  4RSY A;  3TXN A;  2R5S A;  3UT7 A;  5JJT A;  1RIO A;  3D9I A;  1ZS4 A;  4N2S A;  4UI9 J;  3F51 A;  3D9O A;  5FZS A;  1JUQ A;  3AS5 A;  2FBN A;  4J8S A;  3ZHE B;  2GGF A;  4ANU A;  2R59 A;  3JQ0 A;  1P5Q A;  2EF8 A;  4N5C A;  3TG5 A;  3PXP A;  1KLX A;  1QP0 A;  4BY6 A;  1DWK A;  3EIJ A;  1ZVV A;  2LO6 A;  3LY9 A;  3PDN A;  3CHR A;  5AJD A;  4UWL A;  5AJL A;  3ZHE A;  5J90 A;  4O6F A;  3QWP A;  4HFG A;  1JWF A;  3S2A A;  2I2O A;  3PRE A;  3OQN A;  3SCF A;  3FYM A;  4WWN A;  4JQD A;  2J08 A;  4Q69 A;  1WH8 A;  4PU4 C;  3RZZ A;  3O4Z A;  3NZS A;  4NRH B;  3LVR E;  4ATG A;  3APC A;  4E6H A;  3SBS A;  3QQ6 A;  2PQR A;  1ZZ8 A;  3IEG A;  2IVQ A;  3OQM A;  3CQC B;  1CJG A;  4DPR A;  3ZFW A;  4MRU A;  4N2Q A;  2BUG A;  1Y6I A;  4B8C B;  3BG1 B;  3FU3 A;  2VJ8 A;  3QK0 A;  4TV3 A;  1L1M A;  4WUY A;  5T4Y A;  4GYO A;  4WNF A;  3CVU A;  3NQP A;  3Q4A B;  2WXK A;  3AS8 A;  2CSF A;  3EIQ C;  3L1P A;  3I5P A;  4P29 A;  4PH4 B;  5BUZ A;  5HQ8 A;  5T3R A;  4G2V A;  4CT0 A;  2C0L A;  4D10 C;  4YAR A;  2PIJ A;  4B89 A;  3CHO A;  3GN5 B;  3MLF A;  2I6H A;  2J49 A;  1BDI A;  2OND A;  3QOU A;  1ELR A;  4GA2 A;  4KVM A;  5CCM A;  1UTX A;  4U0Z A;  4UWK A;  3FTY A;  5A7D B;  5K98 B;  3QKY A;  2IFU A;  4JEU A;  1PRU A;  1B89 A;  1UXD A;  3HVE B;  4F7A A;  1OCT C;  2LYR A;  4DJA A;  1NA3 A;  3VLD A;  1DNP A;  1E96 B;  3LCA A;  1UN9 A;  2IU1 A;  4HOS A;  2CFU A;  2V4L A;  2X6H A;  3RO3 A;  3TGO A;  1HH8 A;  3ZW3 A;  4GQM A;  2OVB A;  4GCO A;  2RD0 A;  3L08 A;  3PVL A;  4MCT A;  4J6I A;  2BTD A;  2V5F A;  2X38 A;  4JCX A;  2BNO A;  2XQ0 A;  3CV0 A;  4JA7 A;  5FQ8 A;  3ZYQ A;  3LY7 A;  5FQ4 A;  2D5V A;  4AEZ C;  2XIU A;  4J1X A;  3JUI A;  3O48 A;  2UWJ G;  3ESL A;  3LXU X;  4M3O A;  4UI9 C;  2XRY A;  4ANW A;  3LS8 A;  2XCC A;  3IVP A;  4JXT A;  4OVV A;  5JHB A;  2E0I A;  2VTB A;  1S0P A;  1TJC A;  3F52 A;  3U3W A;  2KM4 A;  4I9E A;  5FQ6 A;  4I1M A;  4U63 A;  5C2Y A;  1UJK A;  2V0P A;  4PUC A;  4WND A;  2VTB B;  4YG1 A;  4I6J A;  2LAI A;  2O38 A;  4OVU A;  4B8A A;  3OQO A;  1OSL A;  3BD1 A;  3UUX A;  1E90 A;  2VSY A;  2GZU A;  2KEJ A;  4GML A;  1U3C A;  4IVZ A;  3PE3 A;  4UWF A;  2ZU6 B;  1HG5 A;  3EJN A;  4F53 A;  2I1J A;  3FUJ A;  3MKQ B;  3MV2 B;  1KT0 A;  4A3T A;  4U0U A;  3H5T A;  2KC7 A;  2DCP A;  5FQ7 A;  1GW6 A;  1H2U A;  4L1B A;  1RZR D;  2LYK A;  5AEN A;  2HIN A;  4I6E A;  2A4Z A;  2I9C A;  2AXU A;  3B7S A;  4JW1 A;  5AYW D;  1X57 A;  5LX8 A;  3VK0 A;  2MRI A;  4FLH A;  1LQC A;  4APF A;  2WIU B;  4N3A A;  2AWI A;  3R7Q A;  4IYP A;  4CGW A;  1ZPQ A;  3MJW A;  1E8W A;  5FWQ A;  2L0T B;  3SGH A;  2L8N A;  3OXG A;  4ILI A;  3KXA A;  1PER L;  4FUL A;  1WIZ A;  1OUV A;  2XI8 A;  1EF1 C;  3BG0 B;  4KBQ A;  4GZC A;  3FYA A;  5HI7 A;  2PQN A;  2XEV A;  3G2V A;  3PZD A;  5J08 A;  2PUG A;  2KEK A;  4NUR A;  4I6G A;  1U3D A;  2VQ2 A;  4L7T A;  4XKC A;  3LJ3 A;  4ABN A;  4BX8 A;  1HF8 A;  3CVW A;  1GT0 C;  3CVV A;  4C0M A;  3OAW A;  2LYP A;  3SHF A;  3FY4 A;  2L6J A;  1LCC A;  2KZT A;  4FHK A;  4H7Y A;  4UQY A;  1IQR A;  3MCX A;  5BW8 C;  3ULQ A;  3ZEF A;  3TL5 A;  2MOW A;  3IHV A;  2CG2 A;  4I17 A;  5DBK A;  2LSU A;  3LIS A;  2VGX A;  4PU7 A;  3ZIM A;  4YVQ C;  3U9W A;  1WET A;  4HOU A;  1QPZ A;  3R9A B;  2CHZ A;  3RKV A;  4MLP A;  5A7L A;  2VGY A;  3FUI A;  2WPV A;  1IYG A;  3G2U A;  2WQH A;  4X4C A;  5EKQ D;  1LMB 3;  5EDS A;  2XGM A;  3FH7 A;  3R1F A;  3UT4 A;  3BS3 A;  4GPK A;  4GCN A;  3G7D A;  4Z5H A;  2J4D A;  1HXI A;  4LER A;  4A1G A;  3DNV B;  4EBA G;  4EZL A;  3FH8 A;  4OB4 A;  3HHM A;  4H7X A;  3D9K A;  4JEH A;  2WXN A;  1TJF A;  5KJL A;  3FTV A;  1FVH A;  4NQ0 A;  5LCW C;  5JJ6 A;  3SZ7 A;  4CGV A;  1L5J A;  3QNK A;  1Y9Q A;  1LCD A;  3CLC A;  4JA9 A;  2I1K A;  3RJV A;  3WXX A;  4EBA A;  4PDX A;  4JC8 A;  3PNT B;  2LCV A;  2WUS R;  5ANR A;  2BF0 X;  4AXH A;  4EQF A;  1OWN A;  1JWL A;  3CEQ A;  1JPL A;  3CGH A;  4EPZ A;  1HS6 A;  2DIW A;  4CCA A;  1TEZ A;  2XJ3 A;  3FUH A;  1PRA A;  4AJW A;  3ASG A;  1S7E A;  4GU5 A;  2WXO A;  3PE4 A;  4QFV A;  4X4E A;  2VSO E;  3I4R B;  2HR2 A;  3QC1 A;  3ZRH A;  3UX4 A;  1POU A;  5G2N A;  2PZI A;  2LSV A;  3S7F A;  2PUD A;  3O9X A;  2AXZ A;  1WH6 A;  2KAT A;  3RK6 A;  3FEX A;  3ZVV A;  4G24 A;  4DI3 A;  2IUO A;  2JLB A;  3R7R A;  1UN8 A;  3KAE A;  3S7D A;  4AY5 A;  1SZA A;  4FBI A;  3MGB A;  2JEK A;  4JL0 A;  1HZ4 A;  1NA0 A;  5KJM A;  4J0U A;  2IQC A;  3CR3 A;  1UXC A;  2C0M A;  3G2S A;  3JYS A;  2X6K A;  3I3N A;  3HIZ A;  1RPE L;  1Z6T A;  3MZL B;  4GA1 A;  2AVP A;  4GYY A;  4N3C A;  2P58 C;  2XGS A;  4MCX A;  3OMT A;  2DBA A;  4MS6 A;  4UWG A;  5LCW J;  2UY1 B;  5BV0 A;  5M72 A;  1NP7 A;  4HVB A;  4L23 A;  2LYQ A;  4CT4 A;  3JXB C;  4JCY A;  2XCJ A;  2HO1 A;  3CSF A;  3F6W A;  3GZ1 A;  3ZPJ A;  2Q7F A;  2BNN A;  3D9J A;  3RRM B;  4KT6 B;  5EX0 A;  3IHY A;  1E8Z A;  2CHX A;  2OV8 A;  2FUL A;  5LFA A;  2PUF A;  1OWM A;  3FTU A;  4GYW A;  4BT9 A;  4ACK A;  4JHR A;  4ANX A;  3ML9 A;  3JQ1 A;  2R63 A;  4I2W A;  4IUL A;  1FCH A;  1IC8 A;  1HF0 A;  1CQT A;  3GZ2 A;  3HDX A;  2R1J L;  5BPP A;  4GAA A;  3CK8 A;  4TRQ A;  3TAX A;  2WVI A;  3QF3 A;  2X6F A;  3NF1 A;  4Z5D A;  1QQB A;  3QAR A;  4BWR A;  2C2L A;  1O4X A;  3HYM B;  4UWH A;  1E7V A;  1KT1 A;  3FUM A;  3SCH A;  4WAF A;  4AP2 A;  4BTA A;  1Z3Y A;  4LRZ A;  4BSX A;  1PAQ A;  4K03 A;  1OWO A;  2HSG A;  2XGO A;  4GZ3 A;  2PE5 A;  3S8Q A;  1X5B A;  4RVB A;  1H19 A;  2WXF A;  1XGW A;  1JFT A;  4WNE A;  5FZQ A;  3EHM A;  3CVL A;  3S7J A;  3FH5 A;  1LLI A;  1E3O C;  2A5U A;  3FUN A;  4APO A;  3APF A;  4GZD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...