2AXUA

Structure of prgx
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
305
structure length
303
Chain Sequence
MFKIGSVLKQIRQELNYHQIDLYSGIMSKSVYIKVEADSRPISVEELSKFSERLGVNFFEILNRAGMNSVNETGKEKLLISKIFTNPDLFDKNFQRIEPKRLTSLQYFSIYLGYISIAHHYNIEVPTFNKTITSDLKHLYDKRTTFFGIDYEIVSNLLNVLPYEEVSSIIKPMYPIVDSFGKDYDLTIQTVLKNALTISIMNRNLKEAQYYINQFEHLKTIKNISINGYYDLEINYLKQIYQFLTDKNIDSYLNAVNIINIFKIIGKEDIHRSLVEELTKISAKEKFTPPKEVTMYYENYVAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of peptide sex pheromone receptor PrgX and PrgX/pheromone complexes and regulation of conjugation in Enterococcus faecalis.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Transcription
molecule keywords PrgX
total genus 111
structure length 303
sequence length 305
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2005-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2axuA01
1.25.40.400 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2axuA02
4J1XA 2O49A 3JXCL 3OQOA 1QQBA 2ICTA 1GT0C 2O4AA 1Y9QA 3SCHA 4X4EA 2JVLA 3LFPA 4X4GA 2PUFA 3D1NI 4X4BA 1ADRA 2CSFA 2LYJA 4MCTA 3KXAA 4IVZA 2LYPA 3R1FA 1LLIA 1WH8A 2KEJA 1DWKA 1ZZBA 3GN5A 4I6RA 3F52A 1BDIA 3OQMA 1O4XA 5A7LA 4FBIA 2XCJA 1JWLA 4YARA 4YG1A 2FJRA 4PU7A 1PERL 2HSGA 2IVGA 1UXCA 1UXDA 3FYAA 1R69A 1QP7A 1NERA 2EF8A 3BD1A 1PRVA 2MQKA 2LCVA 3TRBA 1OCTC 2MEZA 1WH6A 2KEKA 2BNOA 2BJCA 1B0NA 1WIZA 1ZZ6A 3B7HA 3L1PA 4PU3C 1LQCA 1POUA 1PRUA 2AUWA 4FN3A 1LCCA 1ZPQA 4JCYA 1ZZ9A 1QQAA 2EWTA 2LYSA 1EFAA 1WETA 1LMB3 2AXUA 2OR1L 3QF3A 2CROA 4X4HA 3G5GA 2AXZA 2D5VA 3SCGA 2IVQA 4JQDA 4Z58A 2LYKA 1AU7A 3CECA 3GBFA 2ICPA 3HZIB 1X57A 2HINA 2WIUB 3S8QA 1ZZ7A 1Y7YA 3EUSA 2KPJA 1RIOA 4O8BA 1RPEL 3QWGA 1X2LA 4GQMA 1QP0A 3F51A 2PUDA 1PNRA 1ZZ8A 2L49A 4PU4C 2BNMA 3ZKCA 3FYMA 3FMYA 1SQ8A 4I6UA 2OFYA 4NDWA 2PIJA 1RZRD 4Z5HA 1CQTA 2PUBA 4I6TA 3O9XA 3QYXA 2PUGA 2O38A 4YG4A 1R63A 4F8DA 3U3WA 1QP4A 4YBAA 2PUCA 2R1JL 3KJXA 1JFSA 1CJGA 2IV1A 2H8RA 5K98B 2IVBA 1QPZA 1HF0A 1PRAA 2A6CA 2LYLA 4X4DA 2WUSR 2IUOA 3F6WA 2LYRA 1E3OC 3RZZA 3H5TA 1JFTA 3ZHMA 1VPWA 1RZRA 3IVPA 3BS3A 3BDNA 4Z5DA 2BNNA 3MLFA 2XJ3A 3OMTA 4MCXA 2KEIA 3DNVB 2AWIA 3CLCA 3LISA 2B5AA 2AXVA 1JH9A 4X4IA 1DW9A 2PPXA 4Y42A 3KZ3A 1IC8A 3OQNA 1OSLA 4IWRA 1L1MA 1XWRA 3ZHIA 1LCDA 2XIUA 2LYQA 2GRMA 1YSEA 1ZUGA 2PUAA 3QQ6A 4Z5CA 4X4FA 2IU7A 4JCXA 3G7DA 3UFDA 4Z59A 3CROL 4I8TA 1ZAYA 1S7EA 3GN5B 2JCGA 4IA8A 3VK0A 1BDHA 2PUEA 2R63A 3PXPA 4GHJA 2GRLA 3JXDL 2KZ8A 4J1WA 3JXBC 1NEQA 1ZVVA 2EBYA 4OB4A 2PE5A 1ZS4A 2GZUA 1UTXA 4YG7B 3OP9A 2XSDC 1RZSA 1ZZCA 2XI8A 2L8NA 2AW6A 4X4CA 3SCFA 4PU8A
chains in the Genus database with same CATH superfamily
5A7DB 4AVXA 3MV3B 2IO3C 3ZPJA 1ADRA 3A9YA 1NZNA 2X6HA 4BSZB 3MEKA 4RVBA 4N3BA 3F52A 1H2UA 3JCKC 4HI9A 2IEJA 1JWLA 3ABKE 4YG1A 4J8DA 4BFRA 2IOSA 5LX8A 3PNTB 1IHBA 4Z68A 3UKUG 2Y1LE 1A5EA 1DC2A 4Q94A 1PRUA 2BUGA 1ZPQA 3LQXA 3PZ2A 1U3DA 5DTRA 2OV8A 4AV7A 5BNWA 4U8HA 3CECA 3C72A 4BETA 4HBDA 4OBMA 4PU4C 4YNDA 3BQOA 4YBAA 4DX7D 5FINA 1N11A 3I4GA 2VQ2A 2R59A 3G2WA 3RAUA 3G0TA 5D0OD 4GTOA 1E8WA 4KXKB 4G26A 3ZYLA 3PNLB 4CGVA 3QDNA 5BXOA 2OEVA 2KEIA 4XI0A 2XGSA 5DSXA 5BV0A 1BD8A 2R05A 2B0OE 3C98A 4QQIA 2XQ0A 3FTXA 2EILE 4ACLA 5DTMA 2GRLA 3PRZA 2L0TB 5JHBA 1ZVVA 2OVFA 1E8YA 2M4HA 2YBDA 4MS6A 3I4RB 3IV0A 2O49A 5LP0A 5GAGi 2PUFA 1DNPA 1U2ZA 3DWLG 4UQXA 4EBAA 1QZ2A 1TJCA 4OVVA 3Q15A 1K1AA 2PXVA 2CHXA 4GA0A 4YDYA 3C3OA 3LS8A 2EF8A 3BD1A 4BERA 2KEKA 2BJCA 3DSXA 3ZHEB 3U66A 1N4PA 1N0RA 4I6JA 4JCYA 1SA5A 4DLOA 1OWLA 2EWTA 2LYSA 3D9HA 3MX3A 1IQRA 2VSNA 4X4HA 2GROB 2WXQA 2IVQA 3CKCA 2J4BA 4F6RD 2P2CP 4U7EB 5KJKA 1KT1A 4BT8A 4F7AA 4GZCA 2CHWA 4I17A 1SQ8A 2UWJG 2OFYA 2PIJA 2L6JA 5E76A 1OCOE 3ISMC 4GMRA 2WXHA 4GZ6A 5D0QD 3ZFWA 3LJ3A 2HO1A 3VLEA 2A6CA 2Y3AA 4OVUA 3QARA 5B1AE 4MRUA 4KVOA 1L5JA 3DSUA 5JJTA 2X6JA 3ZRHA 4CRWA 2ZGDA 1FPPA 1DW9A 5FWQA 2NC9A 3ZHIA 4XE0A 3MZLB 2XIUA 3APDA 3PEUB 4ILIA 4GTPA 4PDXA 3ZHEA 2YINA 3WG7E 3UWPA 4U63A 1S7EA 2JEKA 3PUJA 2LNMA 2R02A 3KL4A 4GYYA 3SI5A 3NZSA 3FWVA 3CQGB 2OVBA 3CVPA 3Q9UC 3EJNA 4MLPA 2JABA 4X4GA 2LYJA 4JPSA 4HLEA 1TEZA 2VJ8A 3SO8A 3GUUA 5CBOA 4GA2A 3PZ4A 4TXPA 2FEZA 1TN7A 3TGOA 1E7VA 4PS8A 3ASFA 2IU1A 2C0MA 3UT7A 2Y4TA 2VGXB 4KZCA 1ZZ9A 1TNZA 1EFAA 3C3QA 1WY6A 2CROA 4HLLA 2XEVA 1RPEL 3KSQA 4GQMA 3ML9A 3ZKCA 2PXPA 2FFHA 4U8YD 1Y6IA 5BUZA 1K3ZD 4K5AB 5T3RA 3RO3A 3R9AB 1UN8A 3RK6A 3KSLA 3NBNB 3U4TA 1AWCB 3AAAC 4HQDA 1MX4A 3GZDA 1JH9A 2KXPC 4EPZA 4IWRA 3FTYA 3ZKJA 4OYSA 3NROA 4JA7A 3VWSA 5EX3A 4Z59A 5JMND 5CEAA 2JCGA 3I5PA 5AQ9A 4GHJA 2KZ8A 5T8IA 2R17C 4G23A 3FUMA 2LLVA 2VSXE 4I1AA 3D9PA 3AU5A 2WXGA 3SBTB 4N3CA 2XXAA 3APFA 4KYOB 3ZUVB 3X2QE 3EHRA 3FFLA 4IVZA 2LYPA 3T9KA 4EQZA 4YDOA 4HOQA 4UQZA 4ZHBA 3ASDA 3FYAA 4B8CB 3GZCA 5ENRD 4E6HA 3HVEA 2FULA 1N4QA 2PM7A 4UI9C 2V3CC 3ESKA 4WNEA 5KWDA 2WXOA 2YHCA 4D10C 1DVPA 5LCWJ 3T5VA 2XZDG 5DRYA 4XI9A 3DSTA 1NP7A 2XS1A 4A63B 1VDYA 3V31A 1XNFA 3LYAA 3HZIB 1X57A 3PREA 4AP2A 3CVVA 4AY5A 4GZ3A 2KPJA 1TNOA 5EYPF 4BWRA 1PNRA 3HXEA 4UWHA 2PUBA 1IHGA 4I6TA 2LXLA 4GTTA 1UJJA 3MA5A 2DWZA 3UUXA 2DZNA 3UM0A 4DI4A 2GRPB 3J5PA 4PS3A 4B0ZA 4U07A 3V2OA 4U0ZA 1N9AA 4JXTA 3S7DA 3HVEB 5DRTA 3DPYA 4I2WA 3BDNA 3BS3A 1OT8A 3CVUA 1HG5A 3ZYKA 5FT9A 3D3MA 3TWTA 4Y42A 3PDNA 4HOUA 3HHMA 4HRAA 4FHKA 2LYQA 4FJYA 2GRMA 2WMNA 4J6IA 2IU7A 1O1TA 4APFA 1ZAYA 3JXBC 4U0SA 4FU3A 5EDSA 3LKUA 4MBGA 2J8SD 4AEZC 2KZTB 3ME5A 3JXCL 1H2VC 4UWFA 2WXNA 4EQFA 3KXAA 4HNAD 2WXFA 4RQIA 1HG2A 4YARA 2ILRA 5D2MC 4FP7A 4O60A 1QP7A 2FBNA 2MQKA 5B1BE 3KEAA 5KNGA 3RRMB 3FUDA 5AJDA 5D66A 5G05J 1DCQA 3FUKA 1N52A 2A5UA 4O1PA 1TNYA 5HI7A 3G2TA 3HXDA 1H6PA 2WVIA 3QJZA 2WQ6A 2PXLA 4I9EA 3BG1B 5H7PA 1QNFA 2Y0BG 4LEUA 3LVRE 1EYHA 3S7BA 1HO8A 3E34A 2RFMA 1H19A 4HXIA 3VLFA 4F1PA 4GZDA 4HI8A 2IY0C 2P9NG 4FJZA 1QYMA 2IV1A 1IKND 4Q96A 4KMOA 4UWLA 4G8KA 4CDMA 3TFLA 4CDNA 4A1GA 4ER0A 3TEPA 3QWPA 3G2VA 4LNBA 2Y4UA 3P1UA 5AN8A 3ASHA 1SZ9A 1Z3YA 3UKRG 3LY8A 3FULA 5E75A 3FTWA 2VSOE 4W9RA 4YDEA 2XPIA 1YSEA 3QKYA 4TXRA 4DRXE 2KCLA 2IF4A 3UM2A 1V54E 3LEWA 3D9MA 2GGFA 2VYIA 3Q7AA 4EK9A 2XHEA 2PE5A 4A55A 4GZ5A 5C1DA 2WMOA 3OP9A 1LF8A 4X4CA 3EU9A 2LXMA 4DX5D 2AJAA 3SCFA 1BDIA 4G2VA 2ICTA 1LD7A 3CSFA 5BW8C 4WNDA 3IBEA 4Y6CA 5LFAA 1QBQA 3MCXA 4L7TA 2IVGA 3ONLA 2XCBA 1R69A 3FTSA 1BLXB 2X6FA 1B0NA 4RLYA 1SW6A 3TXMA 2HE0A 1WETA 5JHAA 3RIBA 3Q49B 4PH4B 3D9KA 3CVWA 3UI2A 2E2EA 4ANUA 3SCGA 3QOXA 4DLQA 2WXMA 3Q4AB 2VGEA 4GMLA 3RJVA 1YCSB 1ZB1A 4U96D 2B6CA 1O1RA 3AS8A 2L49A 3O9XA 5ENTD 3FDHA 3QOUA 4JB8P 5CECB 3AS5A 4GU5A 2DZOA 3JYSA 4WUYA 1IXVA 3PZ1A 1D8EA 2V5FA 2J07A 1OWOA 2R5SA 3L82A 4FLHA 1RZRA 3EHMA 2XJ3A 2DYSE 3KS2A 4FHJA 4GTMA 4HOTA 3CLCA 1TNUA 2PXFA 3EIQC 1MJ0A 3KZ3A 3QC1A 5IY5E 4APOA 1HFAA 2HYZA 4JEUA 5CRUA 4AOFA 2PUAA 4ANWA 3PEVB 5ENNA 3G7DA 3BU8A 3GN5B 2IOLA 4HS2A 3F6QA 4GTSA 2EBYA 3DSSA 1ZS4A 4XX5A 4GTQA 3Q78A 4HVBA 3ABME 2XSDC 3DSVA 4NIKA 3APCA 3TELA 2KATA 4HRNA 1ZZBA 1H6OA 5ENOD 2I1JA 2PZIA 1JCRA 3A9XA 3EHQA 3TRBA 1MQSA 1N4RA 3HXBA 4DX2A 4O1OA 1POUA 1N4SA 4YDWA 1N94A 2PXBA 1FT2A 4C9BB 3CHMA 2XGOA 3Q75A 4K5CA 4UWGA 1GW6A 3M9LA 2GRRB 1N54A 2IO2C 2WIUB 5FQ4A 1ZZ7A 1FT1A 4FADA 1X2LA 1UW4B 2CHZA 4H7YA 2PM6A 2LSUA 3EU5A 4NDWA 3L22A 1IQUA 3FH8A 3UX4A 3QWWA 4F8DA 3U3WA 4K03A 4KT6B 3CGHA 3DEOA 5HQ8A 3R09A 4R7LA 3GZ1A 1HH8A 5DBKA 4L2LA 4J8YA 4KZ0A 2NYJA 3H5TA 3FUNA 4J0UA 2J08A 2QYJA 4GAAA 3TWXA 3QOWA 3FUHA 4JC8A 3QK0A 4DUIA 1NFIE 4N2SA 4A3TA 3GZ2A 4NQ0A 3FH5A 4Z5CA 2EIJE 3R7QA 3C5RA 4I8TA 2CG3A 1N0QA 3TWRA 2QZAA 1E7UA 2YHEA 4I6GA 1D8DA 3AU4A 2XEHA 4CDRA 2Q7FA 5CCLA 2AW6A 3NB2A 4C48B 3OXLA 4IULA 2RG8A 1QQBA 2MHKA 3B7SA 3SBSA 5ENSD 3O48A 1QB2A 2J4DA 3GN5A 3ESLA 4BTBA 3GYZA 3FHEA 2HSGA 5LOZA 2WXKA 2LLWA 1FVHA 2ETAA 4ILHB 3W9FA 1HF8A 2PXUA 3FEYA 5G2NA 4EZLA 4DK5A 2PQNA 1E8XA 4WWPA 3VTYA 1LQCA 4FLBA 5CEDB 2FO1E 2BKKB 4WNGA 5AARA 3C3RA 2ETBA 3FU0A 4P29A 1ZU2A 5J08A 3DM5A 1UG3A 4U04A 4O8BA 3Q79A 2BNMA 3U64A 3QYXA 3PE4A 1R63A 3CK8A 2PUCA 3AS4A 4BT9A 5KJNA 3URZA 3RSEG 1PRAA 1P5QA 3FTZA 3CR3A 4Z5DA 3FU6A 4ZFHA 1OWNA 2DCPA 4WVLA 2BTDA 5BT1A 2L9BA 4UWKA 2XENA 4QFVA 2J49A 3FH7A 3VTXA 3CHSA 4UI9K 3ZGQA 5AENA 3JXDL 1NEQA 3JQ1A 3T5XA 1SA4A 4NRHB 1MX6A 1RZSA 2OCCE 3FEXA 3EHNA 1OXJA 1K1BA 4OAVB 3TAXA 5ITZF 1TJFA 1S63A 4G25A 1LLIA 2QFCA 2PQRA 2ONDA 3TWWA 4B89A 4N5CA 5A7LA 2XCJA 3V30A 4BEPA 1PERL 3LJNA 2P9SG 3R9MA 2LCVA 2H6GA 3Q7FA 3LDZA 3UT8A 3NF1A 2AUWA 3MEJA 1S64A 3E33A 3CSTA 4EKGA 3CVXA 1RZ4A 2DIWA 2DYRE 1SVXA 2CFUA 1TR4A 4DJAA 3Q47B 4Y6WA 1Y7YA 2LUHA 3D9NA 2H6IA 3CIAA 2VGXA 4EZKA 4EZIA 3UXGA 3TWSA 1Y8MA 2VTBA 5AQBA 5ENQD 5AYWD 3JUEA 3S7FA 2IVBA 3U9WA 4JZYA 3IXEA 3F6WA 5EX0A 2LYRA 2R03A 3RZZA 1ELWA 4GYWA 5EIDA 4A1SA 2AXVA 5G55A 3FUFA 3OQNA 2KM4A 4XKBA 2IONA 2PXKA 3ZU7B 2PXTA 3B7BA 3QQ6A 1E96B 4DE8A 4AM9A 4DE9A 2LNIA 3QFIA 5T4YA 4HRLA 5BXUA 4OB4A 4BX8A 3ASOE 3TG4A 3SFYA 2L8NA 3FUEA 4J1XA 3OQOA 1HU3A 1Y9QA 4X4EA 4PUCA 4G8LA 2RKKA 1E8ZA 1JPLA 1UXDA 1U2VG 3NQPA 3SX0A 1TN6A 4JEHA 4B8AA 2YNQA 1EPUA 5FIOA 4XKCA 1LCCA 1TN8A 4RG9A 1OWPA 2ZXWE 2IJGX 2WXLA 3DXMG 4F3VA 4Q69A 2NSZA 4J8FA 2WQ7A 2OR1L 4XEIG 4N39A 4LUNU 2ICPA 2ZIRA 1OY3D 3ENEA 3CVLA 3IKOB 1AP7A 4ER3A 4K0RA 2L6BA 4FULA 3MGBA 1CQTA 4TUUA 3NZLA 3ZW3A 3LVQE 4JW1A 1MX2A 2R1JL 3CV0A 2MOWA 5AQ7A 3B13A 5K98B 2JLBA 2EINE 2LYLA 3OWQA 2X6KA 2OOEA 2V4LA 3UM1A 3GZDC 2A5EA 1VPWA 3OMTA 3B95A 1S70B 4RG6A 1HZ4A 3BUAA 5EILA 2F37A 1ZBPA 1RW2A 1BDHA 2PUEA 1WAO1 1KLXA 2V0PA 4L9PA 3QNKA 3MYVA 3B7TA 3OAWA 5EYLA 3PZ3A 2XXQA 5FQ7A 3PZDA 3EUVA 4FBIA 2JQEA 4L23A 3ULEG 2PXDA 3SR4A 2WPVA 1ELRA 1OCTC 2I2OA 3B7HA 5HRYA 2J09A 5ARFA 3L54A 3N71A 3A9ZA 3QF3A 1EF1C 3AJIA 4G1TA 4N2QA 2AXZA 3ZPXA 3P2BA 4LSZE 3GBFA 3OXFA 4U95D 2V4HC 5AJLA 3S8QA 2H6HA 3RKVA 4U0UA 2XPZA 2QY7A 1QQEA 1BPOA 3KJXA 2XEEA 4LRZA 4AJWA 2KC7A 1LD8A 1ELKA 4X4DA 2GRQB 3DRAA 4GMJA 5AAOA 3IVPA 3G2UA 4XZ4A 4EHMA 3OKZA 3LISA 2B5AA 4M7CA 5ANRA 5FTPA 4AXHA 4KBQA 1L1MA 2KBXA 2CFZA 2VEOA 3PS6A 3ZN3A 1TYQG 2ETCA 4EZJA 3CROL 1G3NB 2A4ZA 3OTNA 5ARGA 5JA4D 4RSYA 2R63A 3PXPA 2V5QC 3NOGD 3UM3A 4HB5A 1PC2A 1HS6A 4ATZD 3UPVA 2I1KA 5C2YA 4J7WA 2VGYA 3RRUA 2WQHA 3SFZA 2P9KG 4B94A 2O4AA 2XCCA 3SCHA 3UIPC 3LFPA 4X4BA 2CSFA 4MCTA 2J7UA 1HXIA 1WH8A 2VTBB 4ABNA 4I6RA 3OQMA 2WXJA 2RFAA 1JWGA 3HXFA 5EN5D 3HRAA 1UXCA 3HDXA 2UY1B 4L2YA 5DIZA 1PRVA 4DPRA 3CLJA 1TNBA 3L1PA 5FJYA 1KZPA 1X5BA 2LAHA 4DI3A 5AIJA 4L1BA 2QYUA 1LMB3 2AXUA 2AVPA 3UINC 3CVQA 3CQCB 5JJ7A 4JQDA 3Q5MA 2LYKA 2QC9A 5FZSA 2R2LA 1WG0A 3LCAA 2PUDA 3D9IA 1FCHA 1S0PA 2O38A 2C2LA 4BX9A 4JD2G 4H7XA 3ZXSA 3SY2A 3WXXA 4MKTA 4CYMD 3FUJA 3JXJA 2IUOA 2XPYA 3FU3A 4ILGA 4CEMA 1E3OC 2F0YA 4HORA 3CKBA 2ZGGA 3ZHMA 4FA6A 4EKIA 3W9GA 3MKQB 1W3BA 1SQMA 3L08A 4HOSA 2PPXA 3HXCA 5HS0A 4WWNA 3MJWA 4WAFA 1ZUGA 1Q2ZA 3RU0A 2HCSA 3I3NA 3V2XA 4JCXA 2LO6A 3PUKA 4IRUA 4I9CA 1OUVA 3L16A 3ZVVA 4IYPA 3LY7A 1WM5A 2E0IA 3SZ7A 3ZYMA 3ASGA 1GT0C 4I6EA 4XIFA 4GA1A 1H2TC 2M63A 2PXQA 1OCRE 4GPMA 3ABLE 2FJRA 3UMVA 3DXKG 4A3VA 3ZIMA 4ANVA 2XS8A 1INZA 1WH6A 2P58C 1E90A 4WNFA 1WIZA 4C0EA 1YA0A 3L9TA 5HKPA 1JCSA 1QQAA 1U3CA 1IYGA 5ENPD 2DBAA 3AG2E 2RD0A 1KT0A 2D5VA 2P9IG 1AU7A 3TJPA 1KPSB 4BTAA 4V3IA 2MXDA 1RIOA 2BF0X 5LCWC 3S7JA 3LPZA 3ZXPA 1Z6TA 3D9OA 4JVSA 4Q2JA 3HIZA 3J5QB 1JCQA 3O4ZA 1QP4A 2KZTA 3L6AA 3FTVA 4FC8A 3D9JA 2OEWA 3NOCD 2X6IA 3AG4E 3D9LA 5G04C 5CMWA 4CCAA 2WUSR 4WWOA 2X3MA 2IQCA 2BNNA 1Z3XA 4UUCA 3DNVB 2AWIA 5GAHi 1HE8A 5CRVA 5CBNA 4N5QA 4K5BA 1UJKA 1O5MA 1JWFA 5A23A 3RRNB 1K8KG 5CERB 4X4FA 3SQVA 3UFDA 4GYOA 3VK0A 4HFGA 4BSXA 4J1WA 1PAQA 2XRYA 4TUMA 2XI8A 3GW4A 2LAIA 5DTQA 2BKGA 5G05C 3ASNE 3S2AA 3QB2A 5ANLA 2WM9A 2JVLA 3MKQA 4HRMB 3E32A 4JHRA 2F8YA 1DWKA 1OCCE 3DSWA 3R7RA 4F53A 3NDBB 4OAUC 3NXHA 3IEGA 1NA0A 3JQ0A 5KNHD 3L17A 1NERA 2IFUA 3SFXA 4C0MA 3KD7A 4LNUD 4BESA 2BNOA 5DT2A 4O6FA 3ULYA 3FP3A 3UT4A 5BPPA 5CCMA 3CHRA 5KBAA 3Q9NC 1BI7B 1D9SA 2HM8A 4LG6A 3DEPA 3SF4A 4AY6A 3K9IA 3FY4A 4GTRA 3PE3A 2HINA 2WXPA 4E85A 3JXIA 1QP0A 3CK9A 1ZZ8A 5A6CA 4Z5HA 4CZ2D 2C0LA 1NA3A 3EIJA 1UN9A 2P9LG 4YG4A 3LXUX 3TG5A 3HYMB 2WXIA 4GB9A 3DBSA 2PXEA 1NL4A 3VLDA 1JFTA 4I43A 4ER6A 3L13A 4MCXA 3G2SA 3KAEA 4X4IA 1IC8A 3NAWA 3ML8A 2PNNA 1YMPA 1LCDA 3ZEFA 5M72A 5B3SE 4ER5A 3MKRA 3ZNGA 3NZUA 5KCMA 4GCNA 2FI7A 3IHYA 3AG3E 1OWMA 3UIOC 5FQ6A 4NACA 2GW1A 2GZUA 4YG7B 3OXGA 2HCNA 4NURA 3CHQA 1DCEA 4Z58A 4PU8A 3SNXA 3UQ3A 3PE5A 5FZQA 2EIKE 2EIME 1KZOA 3R1FA 1A17A 1JUQA 2KCVA 4IN3B 3CK7A 3FUIA 3Q73A 2WXRA 1O4XA 4ATGA 2J9QA 2P9PG 2ZISA 3V79K 3CVNA 3AG1E 4I1MA 1LTXA 2MEZA 4ACKA 3TWVA 2V8SE 2F8XK 2GRNB 1MHQA 4PU3C 3ULQA 2L1PA 1UOHA 3FU5A 1QZXA 3GZSA 3JUIA 1DULA 3G5GA 4JL0A 4EBAG 3SGHA 3SHFA 1NI1A 4M3OA 1V55E 4DX6D 4CT4A 4LCTA 4LERA 4LNGA 2X38A 3QWGA 4CT0A 3F51A 4EECA 4I6UA 1Z5SC 2J7WA 2FO7A 5CMYA 2NXPA 1MZCA 4YVQC 2I9CA 2H8RA 1BU9A 4J8EA 4YVOA 4I2ZA 1H6KA 1HF0A 2P9UG 4GPKA 2BEDA 2WB2A 3B7RL 5JJ6A 1XWRA 4GTVA 3ONKA 4G24A 1HQ1A 3FTUA 4IA8A 5AQAA 4DX1A 2YQ8A 3E30A 4I1OB 1X81A 1OCZE 3CHPA 4JHJA 3IHVA 2CG2A 1UTXA 2I6HA 1FVFA 2XZTG 2VSYA 1EDUA 3DPDA 3RO2A 1NW3A 2EQXA 5KJMA 4ER7A 2LSVA 5EKQD 3D1NI 1HX8A 3TWQA 3E37A 4TV3A 2KEJA 3B7UX 3ZYQA 5J90A 4PU7A 2XGMA 2DVWA 3T8MA 3PVLA 5G04J 3UTMA 3T8KA 1BI8B 1ZZ6A 4BY6A 3TL5A 1YYHA 4FN3A 2XXPA 4CGWA 4N3AA 4UQYA 2L0IA 4F1SA 2FF4A 2Y69E 3SD5A 4ME2A 4X8QA 4AIFA 3HG0D 4JA9A 4TXQA 5KJLA 1SZAA 3EUSA 2KCKA 4B93B 3EDTB 4TRQA 2MYOA 4ANXA 1PY1A 3BEEA 3FYMA 3FMYA 1RZRD 3CEQA 1N95A 2PUGA 4UI9J 4PS7A 1JFSA 1CJGA 2UY1A 3KEZA 3LY9A 5CHEE 1QPZA 4J8SA 2H6FA 1B89A 3CHOA 2HFZA 3MV2B 1MYOA 1MFQC 3MLFA 1O1SA 1XGWA 5BV1A 4GCOA 5JUWA 1OSLA 4URKA 2ZU6B 3CVYA 4JHKA 3BG0B 2HR2A 3QWVA 1H0AA 5EIBE 3TXNA 2MRIA 4U8VD 4G11A 5FQ8A 2PL2A 1WDYA 3QAQA 2XRZA 1ZZCA 5FZRA 3E4BA 2ODRD 3PH0C 4KVMA 3TWUA
chains in the Genus database with same CATH topology
5A7DB 3JXCL 1H2VC 3ASGA 3TAXA 4AVXA 1GT0C 4UWFA 3MV3B 3ZPJA 4I6EA 4XIFA 2WXNA 1TJFA 4GA1A 1ADRA 1H2TC 4G25A 3KXAA 4EQFA 1NZNA 1LLIA 2X6HA 2QFCA 2WXFA 3MEKA 2M63A 2ONDA 2PQRA 4RVBA 4N3BA 3F52A 4B89A 1H2UA 3JCKC 4N5CA 1HG2A 5A7LA 2XCJA 1JWLA 4YARA 4YG1A 2FJRA 3UMVA 1PERL 2ILRA 4FP7A 4J8DA 4A3VA 3ZIMA 2IOSA 4BFRA 1QP7A 5LX8A 3PNTB 2FBNA 2MQKA 2LCVA 4ANVA 1INZA 3RRMB 1WH6A 3FUDA 2P58C 1E90A 4WNFA 1WIZA 3LDZA 5AJDA 3UT8A 4C0EA 1YA0A 3NF1A 5G05J 4Q94A 3FUKA 1PRUA 2AUWA 1N52A 2A5UA 2BUGA 1ZPQA 3CSTA 5HI7A 1QQAA 3CVXA 3G2TA 1U3CA 1IYGA 2DBAA 2DIWA 1U3DA 2WVIA 2RD0A 2CFUA 3QJZA 2OV8A 4AV7A 1KT0A 4DJAA 2WQ6A 2D5VA 4I9EA 4U8HA 5BNWA 1AU7A 3Q47B 3CECA 3TJPA 3BG1B 4BTAA 1QNFA 4LEUA 4V3IA 1RIOA 1Y7YA 3LVRE 3D9NA 2BF0X 4Y6WA 5LCWC 1EYHA 3S7JA 3LPZA 4PU4C 3S7BA 1HO8A 1Z6TA 3D9OA 4JVSA 4YNDA 3CIAA 1H19A 2VGXA 4EZKA 3HIZA 4HXIA 3VLFA 3O4ZA 1QP4A 4YBAA 1Y8MA 2KZTA 3L6AA 4GZDA 3FTVA 3I4GA 4FC8A 2VTBA 2VQ2A 2R59A 3D9JA 3G2WA 4FJZA 5AYWD 2IV1A 4Q96A 3S7FA 2X6IA 4KMOA 4UWLA 3D9LA 4CDMA 5G04C 5D0OD 5CMWA 2IVBA 4CCAA 3U9WA 4KXKB 1E8WA 4CDNA 2WUSR 4A1GA 4JZYA 4G26A 3ZYLA 3F6WA 3QWPA 3G2VA 4WWOA 5EX0A 2LYRA 2X3MA 2Y4UA 3P1UA 3RZZA 3ASHA 3PNLB 1ELWA 4GYWA 4CGVA 2IQCA 3QDNA 2BNNA 1SZ9A 1Z3YA 1Z3XA 2KEIA 4XI0A 4A1SA 3DNVB 2AWIA 3LY8A 1HE8A 2AXVA 3FULA 5E75A 5G55A 3FTWA 3FUFA 3OQNA 2KM4A 2VSOE 2XGSA 4XKBA 2IONA 5BV0A 4W9RA 1UJKA 2XPIA 1JWFA 1YSEA 3QKYA 5A23A 3C98A 3RRNB 3QQ6A 4X4FA 3UFDA 1E96B 2KCLA 2XQ0A 4AM9A 3FTXA 2IF4A 2LNIA 5T4YA 4GYOA 3VK0A 4HFGA 4ACLA 2GRLA 3LEWA 4BSXA 3PRZA 4J1WA 2L0TB 2GGFA 2VYIA 1PAQA 2XRYA 3D9MA 1ZVVA 5JHBA 2XHEA 2OVFA 1E8YA 4OB4A 2PE5A 4GZ5A 4A55A 3TG4A 4BX8A 5C1DA 2WMOA 3OP9A 1LF8A 2XI8A 4X4CA 2L8NA 3FUEA 4MS6A 3SCFA 1BDIA 4G2VA 3I4RB 4J1XA 2LAIA 3GW4A 3IV0A 2O49A 3OQOA 5LP0A 1HU3A 5G05C 2ICTA 3S2AA 1Y9QA 4X4EA 2PUFA 2JVLA 1DNPA 2WM9A 3CSFA 3MKQA 1QZ2A 3QB2A 4JHRA 1TJCA 4PUCA 4WNDA 5BW8C 4EBAA 3IBEA 1DWKA 4OVVA 3Q15A 3R7RA 4F53A 4Y6CA 1E8ZA 1JPLA 5LFAA 2CHXA 4GA0A 3MCXA 3IEGA 4L7TA 1NA0A 2IVGA 1UXDA 3JQ0A 3ONLA 2XCBA 3L17A 1R69A 3FTSA 1NERA 2EF8A 3BD1A 2IFUA 3LS8A 4C0MA 3KD7A 3NQPA 2KEKA 2BNOA 2BJCA 1B0NA 2X6FA 4JEHA 2YNQA 4O6FA 1EPUA 4B8AA 4XKCA 3ZHEB 3U66A 3FP3A 3UT4A 1LCCA 5BPPA 4RG9A 1OWPA 5CCMA 2IJGX 4I6JA 2WXLA 3CHRA 4JCYA 3TXMA 4DLOA 1OWLA 4F3VA 4Q69A 2NSZA 2EWTA 2LYSA 1WETA 4J8FA 5JHAA 3MX3A 2WQ7A 3RIBA 2OR1L 1IQRA 2HM8A 2VSNA 4X4HA 3Q49B 4PH4B 2WXQA 3D9KA 3CVWA 2E2EA 4ANUA 3SCGA 2IVQA 3CKCA 4N39A 3SF4A 4DLQA 2J4BA 4AY6A 3K9IA 3FY4A 4LUNU 2WXMA 2ICPA 3Q4AB 3ENEA 3CVLA 3IKOB 3PE3A 2HINA 2WXPA 5KJKA 4GMLA 4E85A 1KT1A 4K0RA 3RJVA 4BT8A 4F7AA 1QP0A 3CK9A 4GZCA 2CHWA 1ZZ8A 2L49A 3AS8A 4FULA 4I17A 3MGBA 1SQ8A 2UWJG 2OFYA 2PIJA 5A6CA 4Z5HA 1CQTA 2L6JA 3O9XA 2C0LA 1NA3A 3EIJA 3FDHA 1UN9A 3QOUA 4YG4A 3LVQE 3LXUX 4JW1A 4TUUA 5E76A 3ZW3A 3TG5A 3AS5A 2R1JL 4GU5A 3CV0A 3JYSA 2WXHA 4GZ6A 3HYMB 5D0QD 3ZFWA 3LJ3A 4WUYA 2MOWA 2WXIA 3B13A 4GB9A 2HO1A 5K98B 2JLBA 3VLEA 3DBSA 2A6CA 2LYLA 2V5FA 2Y3AA 2J07A 2X6KA 4OVUA 2OOEA 1OWOA 2R5SA 2V4LA 3QARA 3VLDA 4FLHA 1JFTA 4I43A 1VPWA 1RZRA 4MRUA 3EHMA 3L13A 4KVOA 1L5JA 5JJTA 3OMTA 2XJ3A 3KS2A 4FHJA 4MCXA 2X6JA 3G2SA 3KAEA 3CLCA 3ZRHA 4HOTA 4CRWA 4X4IA 1DW9A 3EIQC 5FWQA 3KZ3A 1IC8A 2NC9A 3QC1A 4RG6A 1HZ4A 3ML8A 3ZHIA 4XE0A 1LCDA 1HFAA 2HYZA 3MZLB 4JEUA 3ZEFA 4APOA 2XIUA 5M72A 4AOFA 3APDA 2PUAA 3PEUB 4ILIA 4ANWA 3PEVB 4PDXA 3MKRA 2YINA 5ENNA 3ZHEA 3G7DA 3NZUA 4U63A 5KCMA 4GCNA 1S7EA 3GN5B 1ZBPA 2FI7A 2IOLA 2JEKA 3IHYA 4HS2A 1BDHA 2PUEA 1WAO1 1OWMA 3PUJA 4B94A 1KLXA 2V0PA 5FQ6A 4NACA 4GYYA 2EBYA 3QNKA 2GW1A 1ZS4A 2GZUA 4XX5A 3MYVA 4YG7B 3NZSA 3OXGA 3B7TA 4NURA 2XSDC 3OAWA 3SI5A 3FWVA 3CHQA 4HVBA 3CQGB 4Z58A 4PU8A 3APCA 2OVBA 3CVPA 3SNXA 3EJNA 3UQ3A 4MLPA 5FZQA 5FQ7A 4X4GA 2LYJA 3R1FA 4JPSA 4HLEA 1A17A 1JUQA 2KATA 2KCVA 1ZZBA 3PZDA 4IN3B 1TEZA 2VJ8A 3CK7A 3FUIA 2WXRA 1O4XA 4FBIA 4ATGA 2J9QA 2I1JA 2PZIA 4L23A 2WPVA 3CVNA 1ELRA 4GA2A 3TRBA 1OCTC 4I1MA 2MEZA 2FEZA 1MQSA 4ACKA 2I2OA 1E7VA 2V8SE 3TGOA 3B7HA 4PS8A 3ASFA 2IU1A 1MHQA 4PU3C 2J09A 2C0MA 3ULQA 1POUA 5ARFA 3UT7A 2Y4TA 3L54A 3N71A 2VGXB 4KZCA 1ZZ9A 4C9BB 1EFAA 3FU5A 3GZSA 3QF3A 3JUIA 1WY6A 2CROA 1EF1C 3CHMA 4G1TA 3G5GA 2XGOA 4N2QA 2AXZA 2XEVA 3P2BA 4JL0A 4EBAG 3SGHA 3GBFA 3OXFA 4UWGA 3SHFA 1GW6A 4M3OA 4CT4A 4LCTA 1N54A 5AJLA 2WIUB 3S8QA 1ZZ7A 1RPEL 4LERA 5FQ4A 4FADA 2X38A 3QWGA 1X2LA 4GQMA 1UW4B 3F51A 2CHZA 3RKVA 4CT0A 4H7YA 4U0UA 3ML9A 4EECA 3ZKCA 2PM6A 2LSUA 4I6UA 4NDWA 2XPZA 3L22A 1IQUA 2QY7A 1QQEA 3FH8A 2FO7A 1BPOA 5CMYA 3UX4A 2NXPA 1Y6IA 3QWWA 5BUZA 4F8DA 3U3WA 5T3RA 3RO3A 4K03A 3KJXA 3R9AB 1UN8A 4KT6B 3CGHA 4LRZA 4YVQC 5ANLA 2I9CA 2H8RA 4AJWA 2KC7A 4J8EA 4R7LA 4YVOA 3GZ1A 1HH8A 4I2ZA 4L2LA 5DBKA 3RK6A 1H6KA 1HF0A 1ELKA 4GPKA 4X4DA 4KZ0A 3U4TA 3H5TA 3FUNA 4J0UA 4GMJA 3IVPA 2J08A 2WB2A 3G2UA 4XZ4A 4GAAA 3FUHA 3LISA 2B5AA 5ANRA 5FTPA 4JC8A 1JH9A 3QK0A 3B7RL 4AXHA 4EPZA 4IWRA 5JJ6A 4KBQA 1L1MA 1XWRA 3FTYA 4N2SA 4A3TA 3GZ2A 4OYSA 4NQ0A 2CFZA 3FH5A 3PS6A 4JA7A 3ZN3A 4EZJA 4Z5CA 5EX3A 3R7QA 3ONKA 4Z59A 3CROL 4I8TA 4G24A 2CG3A 2A4ZA 3FTUA 3OTNA 2JCGA 5ARGA 4IA8A 3I5PA 2R63A 3PXPA 4GHJA 2YQ8A 4RSYA 4I1OB 2KZ8A 3CHPA 5T8IA 1E7UA 2R17C 2YHEA 3IHVA 4G23A 4JHJA 3FUMA 2VSXE 1PC2A 1HS6A 4I6GA 2CG2A 4I1AA 1UTXA 2I1KA 3D9PA 3AU4A 3AU5A 5C2YA 3UPVA 2VGYA 4CDRA 2Q7FA 2WQHA 2I6HA 2AW6A 2WXGA 3RRUA 1FVFA 4N3CA 3SBTB 3SFZA 5CCLA 3OXLA 2VSYA 1EDUA 3DPDA 3APFA 2RG8A 4IULA 1QQBA 4KYOB 3RO2A 2MHKA 2EQXA 3B7SA 5KJMA 3SBSA 2O4AA 2LSVA 3SCHA 2XCCA 5EKQD 3LFPA 3O48A 3D1NI 4X4BA 1HX8A 2CSFA 4MCTA 4IVZA 3FFLA 2LYPA 4TV3A 1HXIA 1WH8A 2KEJA 2VTBB 2J4DA 4ABNA 3GN5A 4I6RA 3B7UX 3ESLA 3ZYQA 4BTBA 4HOQA 3OQMA 5J90A 2WXJA 1JWGA 3GYZA 4UQZA 3ASDA 3FHEA 4PU7A 2XGMA 2HSGA 5LOZA 1UXCA 3FYAA 2WXKA 3T8MA 3HDXA 4B8CB 2UY1B 4L2YA 1FVHA 5DIZA 1PRVA 4ILHB 4E6HA 1HF8A 3FEYA 3PVLA 3HVEA 3CLJA 2FULA 5G04J 5G2NA 4DPRA 4EZLA 5HQ8A 4DK5A 2PM7A 4UI9C 1ZZ6A 2PQNA 1E8XA 4WWPA 3VTYA 3L1PA 5FJYA 3TL5A 1LQCA 4BY6A 4FN3A 3ESKA 4WNEA 4CGWA 1X5BA 2WXOA 4N3AA 2LAHA 2YHCA 4FLBA 4DI3A 5AIJA 4L1BA 4UQYA 2L0IA 4F1SA 2FF4A 4D10C 1DVPA 5LCWJ 3T5VA 3SD5A 1LMB3 4ME2A 2AXUA 2AVPA 4XI9A 4WNGA 3CVQA 1NP7A 3CQCB 3FU0A 4AIFA 4P29A 1ZU2A 5J08A 5JJ7A 4JQDA 1VDYA 3Q5MA 2LYKA 1XNFA 4JA9A 3LYAA 3HZIB 1UG3A 4U04A 5KJLA 1X57A 3PREA 5FZSA 4AP2A 3CVVA 4AY5A 1SZAA 3EUSA 2KPJA 3LCAA 4O8BA 4GZ3A 2PUDA 2KCKA 4BWRA 3EDTB 4TRQA 1PNRA 4ANXA 1PY1A 3BEEA 2BNMA 3FYMA 3FMYA 1RZRD 2PUBA 1IHGA 3CEQA 4UWHA 3D9IA 4I6TA 3U64A 1FCHA 1S0PA 3QYXA 2PUGA 2O38A 1UJJA 3MA5A 3UUXA 4DI4A 3PE4A 4UI9J 1R63A 2C2LA 3CK8A 2PUCA 4PS7A 4BX9A 3AS4A 4PS3A 1JFSA 1CJGA 3URZA 4H7XA 3ZXSA 4BT9A 5KJNA 2UY1A 3WXXA 3KEZA 4MKTA 3LY9A 5CHEE 1QPZA 3FUJA 4J8SA 1PRAA 2IUOA 2XPYA 3FU3A 4U07A 4B0ZA 4ILGA 4CEMA 1P5QA 4U0ZA 1B89A 1E3OC 3CHOA 4HORA 3CKBA 3FTZA 4JXTA 3S7DA 3ZHMA 3HVEB 3MV2B 3CR3A 3BDNA 3BS3A 4I2WA 4Z5DA 4FA6A 3FU6A 3CVUA 1HG5A 1OWNA 2DCPA 3ZYKA 3MLFA 3MKQB 4UQXA 1XGWA 5FT9A 5BV1A 3D3MA 1W3BA 1SQMA 2BTDA 3L08A 4GCOA 4HOSA 2PPXA 4Y42A 3PDNA 2L9BA 5BT1A 1OSLA 3HHMA 4HOUA 4UWKA 4WWNA 4URKA 3MJWA 2ZU6B 4FHKA 2LYQA 4FJYA 2GRMA 4WAFA 3CVYA 1ZUGA 2WMNA 3BG0B 4JHKA 4J6IA 4QFVA 3RU0A 2HR2A 3I3NA 3QWVA 2IU7A 4JCXA 2LO6A 4APFA 1H0AA 1ZAYA 2J49A 3FH7A 3PUKA 3TXNA 3VTXA 2MRIA 3CHSA 4IRUA 4UI9K 4G11A 4I9CA 3JXDL 3ZGQA 5AENA 3JXBC 1NEQA 1OUVA 3L16A 4FU3A 3JQ1A 4U0SA 5FQ8A 3T5XA 3ZVVA 5EDSA 4IYPA 2PL2A 3LY7A 1WM5A 3LKUA 3QAQA 2XRZA 4NRHB 2E0IA 1RZSA 1ZZCA 5FZRA 3FEXA 3E4BA 2KZTB 4AEZC 3SZ7A 3EHNA 3PH0C 4KVMA 3ZYMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J1X A;  2O49 A;  3JXC L;  3OQO A;  1QQB A;  2ICT A;  1GT0 C;  2O4A A;  1Y9Q A;  3SCH A;  4X4E A;  2JVL A;  3LFP A;  4X4G A;  2PUF A;  3D1N I;  4X4B A;  1ADR A;  2CSF A;  2LYJ A;  4MCT A;  3KXA A;  4IVZ A;  2LYP A;  3R1F A;  1LLI A;  1WH8 A;  2KEJ A;  1DWK A;  1ZZB A;  3GN5 A;  4I6R A;  3F52 A;  1BDI A;  3OQM A;  1O4X A;  5A7L A;  4FBI A;  2XCJ A;  1JWL A;  4YAR A;  4YG1 A;  2FJR A;  4PU7 A;  1PER L;  2HSG A;  2IVG A;  1UXC A;  1UXD A;  3FYA A;  1R69 A;  1QP7 A;  1NER A;  2EF8 A;  3BD1 A;  1PRV A;  2MQK A;  2LCV A;  3TRB A;  1OCT C;  2MEZ A;  1WH6 A;  2KEK A;  2BNO A;  2BJC A;  1B0N A;  1WIZ A;  1ZZ6 A;  3B7H A;  3L1P A;  4PU3 C;  1LQC A;  1POU A;  1PRU A;  2AUW A;  4FN3 A;  1LCC A;  1ZPQ A;  4JCY A;  1ZZ9 A;  1QQA A;  2EWT A;  2LYS A;  1EFA A;  1WET A;  1LMB 3;  2AXU A;  2OR1 L;  3QF3 A;  2CRO A;  4X4H A;  3G5G A;  2AXZ A;  2D5V A;  3SCG A;  2IVQ A;  4JQD A;  4Z58 A;  2LYK A;  1AU7 A;  3CEC A;  3GBF A;  2ICP A;  3HZI B;  1X57 A;  2HIN A;  2WIU B;  3S8Q A;  1ZZ7 A;  1Y7Y A;  3EUS A;  2KPJ A;  1RIO A;  4O8B A;  1RPE L;  3QWG A;  1X2L A;  4GQM A;  1QP0 A;  3F51 A;  2PUD A;  1PNR A;  1ZZ8 A;  2L49 A;  4PU4 C;  2BNM A;  3ZKC A;  3FYM A;  3FMY A;  1SQ8 A;  4I6U A;  2OFY A;  4NDW A;  2PIJ A;  1RZR D;  4Z5H A;  1CQT A;  2PUB A;  4I6T A;  3O9X A;  3QYX A;  2PUG A;  2O38 A;  4YG4 A;  1R63 A;  4F8D A;  3U3W A;  1QP4 A;  4YBA A;  2PUC A;  2R1J L;  3KJX A;  1JFS A;  1CJG A;  2IV1 A;  2H8R A;  5K98 B;  2IVB A;  1QPZ A;  1HF0 A;  1PRA A;  2A6C A;  2LYL A;  4X4D A;  2WUS R;  2IUO A;  3F6W A;  2LYR A;  1E3O C;  3RZZ A;  3H5T A;  1JFT A;  3ZHM A;  1VPW A;  1RZR A;  3IVP A;  3BS3 A;  3BDN A;  4Z5D A;  2BNN A;  3MLF A;  2XJ3 A;  3OMT A;  4MCX A;  2KEI A;  3DNV B;  2AWI A;  3CLC A;  3LIS A;  2B5A A;  2AXV A;  1JH9 A;  4X4I A;  1DW9 A;  2PPX A;  4Y42 A;  3KZ3 A;  1IC8 A;  3OQN A;  1OSL A;  4IWR A;  1L1M A;  1XWR A;  3ZHI A;  1LCD A;  2XIU A;  2LYQ A;  2GRM A;  1YSE A;  1ZUG A;  2PUA A;  3QQ6 A;  4Z5C A;  4X4F A;  2IU7 A;  4JCX A;  3G7D A;  3UFD A;  4Z59 A;  3CRO L;  4I8T A;  1ZAY A;  1S7E A;  3GN5 B;  2JCG A;  4IA8 A;  3VK0 A;  1BDH A;  2PUE A;  2R63 A;  3PXP A;  4GHJ A;  2GRL A;  3JXD L;  2KZ8 A;  4J1W A;  3JXB C;  1NEQ A;  1ZVV A;  2EBY A;  4OB4 A;  2PE5 A;  1ZS4 A;  2GZU A;  1UTX A;  4YG7 B;  3OP9 A;  2XSD C;  1RZS A;  1ZZC A;  2XI8 A;  2L8N A;  2AW6 A;  4X4C A;  3SCF A;  4PU8 A; 
#chains in the Genus database with same CATH topology
 5A7D B;  4AVX A;  3MV3 B;  2IO3 C;  3ZPJ A;  1ADR A;  3A9Y A;  1NZN A;  2X6H A;  4BSZ B;  3MEK A;  4RVB A;  4N3B A;  3F52 A;  1H2U A;  3JCK C;  4HI9 A;  2IEJ A;  1JWL A;  3ABK E;  4YG1 A;  4J8D A;  4BFR A;  2IOS A;  5LX8 A;  3PNT B;  1IHB A;  4Z68 A;  3UKU G;  2Y1L E;  1A5E A;  1DC2 A;  4Q94 A;  1PRU A;  2BUG A;  1ZPQ A;  3LQX A;  3PZ2 A;  1U3D A;  5DTR A;  2OV8 A;  4AV7 A;  5BNW A;  4U8H A;  3CEC A;  3C72 A;  4BET A;  4HBD A;  4OBM A;  4PU4 C;  4YND A;  3BQO A;  4YBA A;  4DX7 D;  5FIN A;  1N11 A;  3I4G A;  2VQ2 A;  2R59 A;  3G2W A;  3RAU A;  3G0T A;  5D0O D;  4GTO A;  1E8W A;  4KXK B;  4G26 A;  3ZYL A;  3PNL B;  4CGV A;  3QDN A;  5BXO A;  2OEV A;  2KEI A;  4XI0 A;  2XGS A;  5DSX A;  5BV0 A;  1BD8 A;  2R05 A;  2B0O E;  3C98 A;  4QQI A;  2XQ0 A;  3FTX A;  2EIL E;  4ACL A;  5DTM A;  2GRL A;  3PRZ A;  2L0T B;  5JHB A;  1ZVV A;  2OVF A;  1E8Y A;  2M4H A;  2YBD A;  4MS6 A;  3I4R B;  3IV0 A;  2O49 A;  5LP0 A;  5GAG i;  2PUF A;  1DNP A;  1U2Z A;  3DWL G;  4UQX A;  4EBA A;  1QZ2 A;  1TJC A;  4OVV A;  3Q15 A;  1K1A A;  2PXV A;  2CHX A;  4GA0 A;  4YDY A;  3C3O A;  3LS8 A;  2EF8 A;  3BD1 A;  4BER A;  2KEK A;  2BJC A;  3DSX A;  3ZHE B;  3U66 A;  1N4P A;  1N0R A;  4I6J A;  4JCY A;  1SA5 A;  4DLO A;  1OWL A;  2EWT A;  2LYS A;  3D9H A;  3MX3 A;  1IQR A;  2VSN A;  4X4H A;  2GRO B;  2WXQ A;  2IVQ A;  3CKC A;  2J4B A;  4F6R D;  2P2C P;  4U7E B;  5KJK A;  1KT1 A;  4BT8 A;  4F7A A;  4GZC A;  2CHW A;  4I17 A;  1SQ8 A;  2UWJ G;  2OFY A;  2PIJ A;  2L6J A;  5E76 A;  1OCO E;  3ISM C;  4GMR A;  2WXH A;  4GZ6 A;  5D0Q D;  3ZFW A;  3LJ3 A;  2HO1 A;  3VLE A;  2A6C A;  2Y3A A;  4OVU A;  3QAR A;  5B1A E;  4MRU A;  4KVO A;  1L5J A;  3DSU A;  5JJT A;  2X6J A;  3ZRH A;  4CRW A;  2ZGD A;  1FPP A;  1DW9 A;  5FWQ A;  2NC9 A;  3ZHI A;  4XE0 A;  3MZL B;  2XIU A;  3APD A;  3PEU B;  4ILI A;  4GTP A;  4PDX A;  3ZHE A;  2YIN A;  3WG7 E;  3UWP A;  4U63 A;  1S7E A;  2JEK A;  3PUJ A;  2LNM A;  2R02 A;  3KL4 A;  4GYY A;  3SI5 A;  3NZS A;  3FWV A;  3CQG B;  2OVB A;  3CVP A;  3Q9U C;  3EJN A;  4MLP A;  2JAB A;  4X4G A;  2LYJ A;  4JPS A;  4HLE A;  1TEZ A;  2VJ8 A;  3SO8 A;  3GUU A;  5CBO A;  4GA2 A;  3PZ4 A;  4TXP A;  2FEZ A;  1TN7 A;  3TGO A;  1E7V A;  4PS8 A;  3ASF A;  2IU1 A;  2C0M A;  3UT7 A;  2Y4T A;  2VGX B;  4KZC A;  1ZZ9 A;  1TNZ A;  1EFA A;  3C3Q A;  1WY6 A;  2CRO A;  4HLL A;  2XEV A;  1RPE L;  3KSQ A;  4GQM A;  3ML9 A;  3ZKC A;  2PXP A;  2FFH A;  4U8Y D;  1Y6I A;  5BUZ A;  1K3Z D;  4K5A B;  5T3R A;  3RO3 A;  3R9A B;  1UN8 A;  3RK6 A;  3KSL A;  3NBN B;  3U4T A;  1AWC B;  3AAA C;  4HQD A;  1MX4 A;  3GZD A;  1JH9 A;  2KXP C;  4EPZ A;  4IWR A;  3FTY A;  3ZKJ A;  4OYS A;  3NRO A;  4JA7 A;  3VWS A;  5EX3 A;  4Z59 A;  5JMN D;  5CEA A;  2JCG A;  3I5P A;  5AQ9 A;  4GHJ A;  2KZ8 A;  5T8I A;  2R17 C;  4G23 A;  3FUM A;  2LLV A;  2VSX E;  4I1A A;  3D9P A;  3AU5 A;  2WXG A;  3SBT B;  4N3C A;  2XXA A;  3APF A;  4KYO B;  3ZUV B;  3X2Q E;  3EHR A;  3FFL A;  4IVZ A;  2LYP A;  3T9K A;  4EQZ A;  4YDO A;  4HOQ A;  4UQZ A;  4ZHB A;  3ASD A;  3FYA A;  4B8C B;  3GZC A;  5ENR D;  4E6H A;  3HVE A;  2FUL A;  1N4Q A;  2PM7 A;  4UI9 C;  2V3C C;  3ESK A;  4WNE A;  5KWD A;  2WXO A;  2YHC A;  4D10 C;  1DVP A;  5LCW J;  3T5V A;  2XZD G;  5DRY A;  4XI9 A;  3DST A;  1NP7 A;  2XS1 A;  4A63 B;  1VDY A;  3V31 A;  1XNF A;  3LYA A;  3HZI B;  1X57 A;  3PRE A;  4AP2 A;  3CVV A;  4AY5 A;  4GZ3 A;  2KPJ A;  1TNO A;  5EYP F;  4BWR A;  1PNR A;  3HXE A;  4UWH A;  2PUB A;  1IHG A;  4I6T A;  2LXL A;  4GTT A;  1UJJ A;  3MA5 A;  2DWZ A;  3UUX A;  2DZN A;  3UM0 A;  4DI4 A;  2GRP B;  3J5P A;  4PS3 A;  4B0Z A;  4U07 A;  3V2O A;  4U0Z A;  1N9A A;  4JXT A;  3S7D A;  3HVE B;  5DRT A;  3DPY A;  4I2W A;  3BDN A;  3BS3 A;  1OT8 A;  3CVU A;  1HG5 A;  3ZYK A;  5FT9 A;  3D3M A;  3TWT A;  4Y42 A;  3PDN A;  4HOU A;  3HHM A;  4HRA A;  4FHK A;  2LYQ A;  4FJY A;  2GRM A;  2WMN A;  4J6I A;  2IU7 A;  1O1T A;  4APF A;  1ZAY A;  3JXB C;  4U0S A;  4FU3 A;  5EDS A;  3LKU A;  4MBG A;  2J8S D;  4AEZ C;  2KZT B;  3ME5 A;  3JXC L;  1H2V C;  4UWF A;  2WXN A;  4EQF A;  3KXA A;  4HNA D;  2WXF A;  4RQI A;  1HG2 A;  4YAR A;  2ILR A;  5D2M C;  4FP7 A;  4O60 A;  1QP7 A;  2FBN A;  2MQK A;  5B1B E;  3KEA A;  5KNG A;  3RRM B;  3FUD A;  5AJD A;  5D66 A;  5G05 J;  1DCQ A;  3FUK A;  1N52 A;  2A5U A;  4O1P A;  1TNY A;  5HI7 A;  3G2T A;  3HXD A;  1H6P A;  2WVI A;  3QJZ A;  2WQ6 A;  2PXL A;  4I9E A;  3BG1 B;  5H7P A;  1QNF A;  2Y0B G;  4LEU A;  3LVR E;  1EYH A;  3S7B A;  1HO8 A;  3E34 A;  2RFM A;  1H19 A;  4HXI A;  3VLF A;  4F1P A;  4GZD A;  4HI8 A;  2IY0 C;  2P9N G;  4FJZ A;  1QYM A;  2IV1 A;  1IKN D;  4Q96 A;  4KMO A;  4UWL A;  4G8K A;  4CDM A;  3TFL A;  4CDN A;  4A1G A;  4ER0 A;  3TEP A;  3QWP A;  3G2V A;  4LNB A;  2Y4U A;  3P1U A;  5AN8 A;  3ASH A;  1SZ9 A;  1Z3Y A;  3UKR G;  3LY8 A;  3FUL A;  5E75 A;  3FTW A;  2VSO E;  4W9R A;  4YDE A;  2XPI A;  1YSE A;  3QKY A;  4TXR A;  4DRX E;  2KCL A;  2IF4 A;  3UM2 A;  1V54 E;  3LEW A;  3D9M A;  2GGF A;  2VYI A;  3Q7A A;  4EK9 A;  2XHE A;  2PE5 A;  4A55 A;  4GZ5 A;  5C1D A;  2WMO A;  3OP9 A;  1LF8 A;  4X4C A;  3EU9 A;  2LXM A;  4DX5 D;  2AJA A;  3SCF A;  1BDI A;  4G2V A;  2ICT A;  1LD7 A;  3CSF A;  5BW8 C;  4WND A;  3IBE A;  4Y6C A;  5LFA A;  1QBQ A;  3MCX A;  4L7T A;  2IVG A;  3ONL A;  2XCB A;  1R69 A;  3FTS A;  1BLX B;  2X6F A;  1B0N A;  4RLY A;  1SW6 A;  3TXM A;  2HE0 A;  1WET A;  5JHA A;  3RIB A;  3Q49 B;  4PH4 B;  3D9K A;  3CVW A;  3UI2 A;  2E2E A;  4ANU A;  3SCG A;  3QOX A;  4DLQ A;  2WXM A;  3Q4A B;  2VGE A;  4GML A;  3RJV A;  1YCS B;  1ZB1 A;  4U96 D;  2B6C A;  1O1R A;  3AS8 A;  2L49 A;  3O9X A;  5ENT D;  3FDH A;  3QOU A;  4JB8 P;  5CEC B;  3AS5 A;  4GU5 A;  2DZO A;  3JYS A;  4WUY A;  1IXV A;  3PZ1 A;  1D8E A;  2V5F A;  2J07 A;  1OWO A;  2R5S A;  3L82 A;  4FLH A;  1RZR A;  3EHM A;  2XJ3 A;  2DYS E;  3KS2 A;  4FHJ A;  4GTM A;  4HOT A;  3CLC A;  1TNU A;  2PXF A;  3EIQ C;  1MJ0 A;  3KZ3 A;  3QC1 A;  5IY5 E;  4APO A;  1HFA A;  2HYZ A;  4JEU A;  5CRU A;  4AOF A;  2PUA A;  4ANW A;  3PEV B;  5ENN A;  3G7D A;  3BU8 A;  3GN5 B;  2IOL A;  4HS2 A;  3F6Q A;  4GTS A;  2EBY A;  3DSS A;  1ZS4 A;  4XX5 A;  4GTQ A;  3Q78 A;  4HVB A;  3ABM E;  2XSD C;  3DSV A;  4NIK A;  3APC A;  3TEL A;  2KAT A;  4HRN A;  1ZZB A;  1H6O A;  5ENO D;  2I1J A;  2PZI A;  1JCR A;  3A9X A;  3EHQ A;  3TRB A;  1MQS A;  1N4R A;  3HXB A;  4DX2 A;  4O1O A;  1POU A;  1N4S A;  4YDW A;  1N94 A;  2PXB A;  1FT2 A;  4C9B B;  3CHM A;  2XGO A;  3Q75 A;  4K5C A;  4UWG A;  1GW6 A;  3M9L A;  2GRR B;  1N54 A;  2IO2 C;  2WIU B;  5FQ4 A;  1ZZ7 A;  1FT1 A;  4FAD A;  1X2L A;  1UW4 B;  2CHZ A;  4H7Y A;  2PM6 A;  2LSU A;  3EU5 A;  4NDW A;  3L22 A;  1IQU A;  3FH8 A;  3UX4 A;  3QWW A;  4F8D A;  3U3W A;  4K03 A;  4KT6 B;  3CGH A;  3DEO A;  5HQ8 A;  3R09 A;  4R7L A;  3GZ1 A;  1HH8 A;  5DBK A;  4L2L A;  4J8Y A;  4KZ0 A;  2NYJ A;  3H5T A;  3FUN A;  4J0U A;  2J08 A;  2QYJ A;  4GAA A;  3TWX A;  3QOW A;  3FUH A;  4JC8 A;  3QK0 A;  4DUI A;  1NFI E;  4N2S A;  4A3T A;  3GZ2 A;  4NQ0 A;  3FH5 A;  4Z5C A;  2EIJ E;  3R7Q A;  3C5R A;  4I8T A;  2CG3 A;  1N0Q A;  3TWR A;  2QZA A;  1E7U A;  2YHE A;  4I6G A;  1D8D A;  3AU4 A;  2XEH A;  4CDR A;  2Q7F A;  5CCL A;  2AW6 A;  3NB2 A;  4C48 B;  3OXL A;  4IUL A;  2RG8 A;  1QQB A;  2MHK A;  3B7S A;  3SBS A;  5ENS D;  3O48 A;  1QB2 A;  2J4D A;  3GN5 A;  3ESL A;  4BTB A;  3GYZ A;  3FHE A;  2HSG A;  5LOZ A;  2WXK A;  2LLW A;  1FVH A;  2ETA A;  4ILH B;  3W9F A;  1HF8 A;  2PXU A;  3FEY A;  5G2N A;  4EZL A;  4DK5 A;  2PQN A;  1E8X A;  4WWP A;  3VTY A;  1LQC A;  4FLB A;  5CED B;  2FO1 E;  2BKK B;  4WNG A;  5AAR A;  3C3R A;  2ETB A;  3FU0 A;  4P29 A;  1ZU2 A;  5J08 A;  3DM5 A;  1UG3 A;  4U04 A;  4O8B A;  3Q79 A;  2BNM A;  3U64 A;  3QYX A;  3PE4 A;  1R63 A;  3CK8 A;  2PUC A;  3AS4 A;  4BT9 A;  5KJN A;  3URZ A;  3RSE G;  1PRA A;  1P5Q A;  3FTZ A;  3CR3 A;  4Z5D A;  3FU6 A;  4ZFH A;  1OWN A;  2DCP A;  4WVL A;  2BTD A;  5BT1 A;  2L9B A;  4UWK A;  2XEN A;  4QFV A;  2J49 A;  3FH7 A;  3VTX A;  3CHS A;  4UI9 K;  3ZGQ A;  5AEN A;  3JXD L;  1NEQ A;  3JQ1 A;  3T5X A;  1SA4 A;  4NRH B;  1MX6 A;  1RZS A;  2OCC E;  3FEX A;  3EHN A;  1OXJ A;  1K1B A;  4OAV B;  3TAX A;  5ITZ F;  1TJF A;  1S63 A;  4G25 A;  1LLI A;  2QFC A;  2PQR A;  2OND A;  3TWW A;  4B89 A;  4N5C A;  5A7L A;  2XCJ A;  3V30 A;  4BEP A;  1PER L;  3LJN A;  2P9S G;  3R9M A;  2LCV A;  2H6G A;  3Q7F A;  3LDZ A;  3UT8 A;  3NF1 A;  2AUW A;  3MEJ A;  1S64 A;  3E33 A;  3CST A;  4EKG A;  3CVX A;  1RZ4 A;  2DIW A;  2DYR E;  1SVX A;  2CFU A;  1TR4 A;  4DJA A;  3Q47 B;  4Y6W A;  1Y7Y A;  2LUH A;  3D9N A;  2H6I A;  3CIA A;  2VGX A;  4EZK A;  4EZI A;  3UXG A;  3TWS A;  1Y8M A;  2VTB A;  5AQB A;  5ENQ D;  5AYW D;  3JUE A;  3S7F A;  2IVB A;  3U9W A;  4JZY A;  3IXE A;  3F6W A;  5EX0 A;  2LYR A;  2R03 A;  3RZZ A;  1ELW A;  4GYW A;  5EID A;  4A1S A;  2AXV A;  5G55 A;  3FUF A;  3OQN A;  2KM4 A;  4XKB A;  2ION A;  2PXK A;  3ZU7 B;  2PXT A;  3B7B A;  3QQ6 A;  1E96 B;  4DE8 A;  4AM9 A;  4DE9 A;  2LNI A;  3QFI A;  5T4Y A;  4HRL A;  5BXU A;  4OB4 A;  4BX8 A;  3ASO E;  3TG4 A;  3SFY A;  2L8N A;  3FUE A;  4J1X A;  3OQO A;  1HU3 A;  1Y9Q A;  4X4E A;  4PUC A;  4G8L A;  2RKK A;  1E8Z A;  1JPL A;  1UXD A;  1U2V G;  3NQP A;  3SX0 A;  1TN6 A;  4JEH A;  4B8A A;  2YNQ A;  1EPU A;  5FIO A;  4XKC A;  1LCC A;  1TN8 A;  4RG9 A;  1OWP A;  2ZXW E;  2IJG X;  2WXL A;  3DXM G;  4F3V A;  4Q69 A;  2NSZ A;  4J8F A;  2WQ7 A;  2OR1 L;  4XEI G;  4N39 A;  4LUN U;  2ICP A;  2ZIR A;  1OY3 D;  3ENE A;  3CVL A;  3IKO B;  1AP7 A;  4ER3 A;  4K0R A;  2L6B A;  4FUL A;  3MGB A;  1CQT A;  4TUU A;  3NZL A;  3ZW3 A;  3LVQ E;  4JW1 A;  1MX2 A;  2R1J L;  3CV0 A;  2MOW A;  5AQ7 A;  3B13 A;  5K98 B;  2JLB A;  2EIN E;  2LYL A;  3OWQ A;  2X6K A;  2OOE A;  2V4L A;  3UM1 A;  3GZD C;  2A5E A;  1VPW A;  3OMT A;  3B95 A;  1S70 B;  4RG6 A;  1HZ4 A;  3BUA A;  5EIL A;  2F37 A;  1ZBP A;  1RW2 A;  1BDH A;  2PUE A;  1WAO 1;  1KLX A;  2V0P A;  4L9P A;  3QNK A;  3MYV A;  3B7T A;  3OAW A;  5EYL A;  3PZ3 A;  2XXQ A;  5FQ7 A;  3PZD A;  3EUV A;  4FBI A;  2JQE A;  4L23 A;  3ULE G;  2PXD A;  3SR4 A;  2WPV A;  1ELR A;  1OCT C;  2I2O A;  3B7H A;  5HRY A;  2J09 A;  5ARF A;  3L54 A;  3N71 A;  3A9Z A;  3QF3 A;  1EF1 C;  3AJI A;  4G1T A;  4N2Q A;  2AXZ A;  3ZPX A;  3P2B A;  4LSZ E;  3GBF A;  3OXF A;  4U95 D;  2V4H C;  5AJL A;  3S8Q A;  2H6H A;  3RKV A;  4U0U A;  2XPZ A;  2QY7 A;  1QQE A;  1BPO A;  3KJX A;  2XEE A;  4LRZ A;  4AJW A;  2KC7 A;  1LD8 A;  1ELK A;  4X4D A;  2GRQ B;  3DRA A;  4GMJ A;  5AAO A;  3IVP A;  3G2U A;  4XZ4 A;  4EHM A;  3OKZ A;  3LIS A;  2B5A A;  4M7C A;  5ANR A;  5FTP A;  4AXH A;  4KBQ A;  1L1M A;  2KBX A;  2CFZ A;  2VEO A;  3PS6 A;  3ZN3 A;  1TYQ G;  2ETC A;  4EZJ A;  3CRO L;  1G3N B;  2A4Z A;  3OTN A;  5ARG A;  5JA4 D;  4RSY A;  2R63 A;  3PXP A;  2V5Q C;  3NOG D;  3UM3 A;  4HB5 A;  1PC2 A;  1HS6 A;  4ATZ D;  3UPV A;  2I1K A;  5C2Y A;  4J7W A;  2VGY A;  3RRU A;  2WQH A;  3SFZ A;  2P9K G;  4B94 A;  2O4A A;  2XCC A;  3SCH A;  3UIP C;  3LFP A;  4X4B A;  2CSF A;  4MCT A;  2J7U A;  1HXI A;  1WH8 A;  2VTB B;  4ABN A;  4I6R A;  3OQM A;  2WXJ A;  2RFA A;  1JWG A;  3HXF A;  5EN5 D;  3HRA A;  1UXC A;  3HDX A;  2UY1 B;  4L2Y A;  5DIZ A;  1PRV A;  4DPR A;  3CLJ A;  1TNB A;  3L1P A;  5FJY A;  1KZP A;  1X5B A;  2LAH A;  4DI3 A;  5AIJ A;  4L1B A;  2QYU A;  1LMB 3;  2AXU A;  2AVP A;  3UIN C;  3CVQ A;  3CQC B;  5JJ7 A;  4JQD A;  3Q5M A;  2LYK A;  2QC9 A;  5FZS A;  2R2L A;  1WG0 A;  3LCA A;  2PUD A;  3D9I A;  1FCH A;  1S0P A;  2O38 A;  2C2L A;  4BX9 A;  4JD2 G;  4H7X A;  3ZXS A;  3SY2 A;  3WXX A;  4MKT A;  4CYM D;  3FUJ A;  3JXJ A;  2IUO A;  2XPY A;  3FU3 A;  4ILG A;  4CEM A;  1E3O C;  2F0Y A;  4HOR A;  3CKB A;  2ZGG A;  3ZHM A;  4FA6 A;  4EKI A;  3W9G A;  3MKQ B;  1W3B A;  1SQM A;  3L08 A;  4HOS A;  2PPX A;  3HXC A;  5HS0 A;  4WWN A;  3MJW A;  4WAF A;  1ZUG A;  1Q2Z A;  3RU0 A;  2HCS A;  3I3N A;  3V2X A;  4JCX A;  2LO6 A;  3PUK A;  4IRU A;  4I9C A;  1OUV A;  3L16 A;  3ZVV A;  4IYP A;  3LY7 A;  1WM5 A;  2E0I A;  3SZ7 A;  3ZYM A;  3ASG A;  1GT0 C;  4I6E A;  4XIF A;  4GA1 A;  1H2T C;  2M63 A;  2PXQ A;  1OCR E;  4GPM A;  3ABL E;  2FJR A;  3UMV A;  3DXK G;  4A3V A;  3ZIM A;  4ANV A;  2XS8 A;  1INZ A;  1WH6 A;  2P58 C;  1E90 A;  4WNF A;  1WIZ A;  4C0E A;  1YA0 A;  3L9T A;  5HKP A;  1JCS A;  1QQA A;  1U3C A;  1IYG A;  5ENP D;  2DBA A;  3AG2 E;  2RD0 A;  1KT0 A;  2D5V A;  2P9I G;  1AU7 A;  3TJP A;  1KPS B;  4BTA A;  4V3I A;  2MXD A;  1RIO A;  2BF0 X;  5LCW C;  3S7J A;  3LPZ A;  3ZXP A;  1Z6T A;  3D9O A;  4JVS A;  4Q2J A;  3HIZ A;  3J5Q B;  1JCQ A;  3O4Z A;  1QP4 A;  2KZT A;  3L6A A;  3FTV A;  4FC8 A;  3D9J A;  2OEW A;  3NOC D;  2X6I A;  3AG4 E;  3D9L A;  5G04 C;  5CMW A;  4CCA A;  2WUS R;  4WWO A;  2X3M A;  2IQC A;  2BNN A;  1Z3X A;  4UUC A;  3DNV B;  2AWI A;  5GAH i;  1HE8 A;  5CRV A;  5CBN A;  4N5Q A;  4K5B A;  1UJK A;  1O5M A;  1JWF A;  5A23 A;  3RRN B;  1K8K G;  5CER B;  4X4F A;  3SQV A;  3UFD A;  4GYO A;  3VK0 A;  4HFG A;  4BSX A;  4J1W A;  1PAQ A;  2XRY A;  4TUM A;  2XI8 A;  3GW4 A;  2LAI A;  5DTQ A;  2BKG A;  5G05 C;  3ASN E;  3S2A A;  3QB2 A;  5ANL A;  2WM9 A;  2JVL A;  3MKQ A;  4HRM B;  3E32 A;  4JHR A;  2F8Y A;  1DWK A;  1OCC E;  3DSW A;  3R7R A;  4F53 A;  3NDB B;  4OAU C;  3NXH A;  3IEG A;  1NA0 A;  3JQ0 A;  5KNH D;  3L17 A;  1NER A;  2IFU A;  3SFX A;  4C0M A;  3KD7 A;  4LNU D;  4BES A;  2BNO A;  5DT2 A;  4O6F A;  3ULY A;  3FP3 A;  3UT4 A;  5BPP A;  5CCM A;  3CHR A;  5KBA A;  3Q9N C;  1BI7 B;  1D9S A;  2HM8 A;  4LG6 A;  3DEP A;  3SF4 A;  4AY6 A;  3K9I A;  3FY4 A;  4GTR A;  3PE3 A;  2HIN A;  2WXP A;  4E85 A;  3JXI A;  1QP0 A;  3CK9 A;  1ZZ8 A;  5A6C A;  4Z5H A;  4CZ2 D;  2C0L A;  1NA3 A;  3EIJ A;  1UN9 A;  2P9L G;  4YG4 A;  3LXU X;  3TG5 A;  3HYM B;  2WXI A;  4GB9 A;  3DBS A;  2PXE A;  1NL4 A;  3VLD A;  1JFT A;  4I43 A;  4ER6 A;  3L13 A;  4MCX A;  3G2S A;  3KAE A;  4X4I A;  1IC8 A;  3NAW A;  3ML8 A;  2PNN A;  1YMP A;  1LCD A;  3ZEF A;  5M72 A;  5B3S E;  4ER5 A;  3MKR A;  3ZNG A;  3NZU A;  5KCM A;  4GCN A;  2FI7 A;  3IHY A;  3AG3 E;  1OWM A;  3UIO C;  5FQ6 A;  4NAC A;  2GW1 A;  2GZU A;  4YG7 B;  3OXG A;  2HCN A;  4NUR A;  3CHQ A;  1DCE A;  4Z58 A;  4PU8 A;  3SNX A;  3UQ3 A;  3PE5 A;  5FZQ A;  2EIK E;  2EIM E;  1KZO A;  3R1F A;  1A17 A;  1JUQ A;  2KCV A;  4IN3 B;  3CK7 A;  3FUI A;  3Q73 A;  2WXR A;  1O4X A;  4ATG A;  2J9Q A;  2P9P G;  2ZIS A;  3V79 K;  3CVN A;  3AG1 E;  4I1M A;  1LTX A;  2MEZ A;  4ACK A;  3TWV A;  2V8S E;  2F8X K;  2GRN B;  1MHQ A;  4PU3 C;  3ULQ A;  2L1P A;  1UOH A;  3FU5 A;  1QZX A;  3GZS A;  3JUI A;  1DUL A;  3G5G A;  4JL0 A;  4EBA G;  3SGH A;  3SHF A;  1NI1 A;  4M3O A;  1V55 E;  4DX6 D;  4CT4 A;  4LCT A;  4LER A;  4LNG A;  2X38 A;  3QWG A;  4CT0 A;  3F51 A;  4EEC A;  4I6U A;  1Z5S C;  2J7W A;  2FO7 A;  5CMY A;  2NXP A;  1MZC A;  4YVQ C;  2I9C A;  2H8R A;  1BU9 A;  4J8E A;  4YVO A;  4I2Z A;  1H6K A;  1HF0 A;  2P9U G;  4GPK A;  2BED A;  2WB2 A;  3B7R L;  5JJ6 A;  1XWR A;  4GTV A;  3ONK A;  4G24 A;  1HQ1 A;  3FTU A;  4IA8 A;  5AQA A;  4DX1 A;  2YQ8 A;  3E30 A;  4I1O B;  1X81 A;  1OCZ E;  3CHP A;  4JHJ A;  3IHV A;  2CG2 A;  1UTX A;  2I6H A;  1FVF A;  2XZT G;  2VSY A;  1EDU A;  3DPD A;  3RO2 A;  1NW3 A;  2EQX A;  5KJM A;  4ER7 A;  2LSV A;  5EKQ D;  3D1N I;  1HX8 A;  3TWQ A;  3E37 A;  4TV3 A;  2KEJ A;  3B7U X;  3ZYQ A;  5J90 A;  4PU7 A;  2XGM A;  2DVW A;  3T8M A;  3PVL A;  5G04 J;  3UTM A;  3T8K A;  1BI8 B;  1ZZ6 A;  4BY6 A;  3TL5 A;  1YYH A;  4FN3 A;  2XXP A;  4CGW A;  4N3A A;  4UQY A;  2L0I A;  4F1S A;  2FF4 A;  2Y69 E;  3SD5 A;  4ME2 A;  4X8Q A;  4AIF A;  3HG0 D;  4JA9 A;  4TXQ A;  5KJL A;  1SZA A;  3EUS A;  2KCK A;  4B93 B;  3EDT B;  4TRQ A;  2MYO A;  4ANX A;  1PY1 A;  3BEE A;  3FYM A;  3FMY A;  1RZR D;  3CEQ A;  1N95 A;  2PUG A;  4UI9 J;  4PS7 A;  1JFS A;  1CJG A;  2UY1 A;  3KEZ A;  3LY9 A;  5CHE E;  1QPZ A;  4J8S A;  2H6F A;  1B89 A;  3CHO A;  2HFZ A;  3MV2 B;  1MYO A;  1MFQ C;  3MLF A;  1O1S A;  1XGW A;  5BV1 A;  4GCO A;  5JUW A;  1OSL A;  4URK A;  2ZU6 B;  3CVY A;  4JHK A;  3BG0 B;  2HR2 A;  3QWV A;  1H0A A;  5EIB E;  3TXN A;  2MRI A;  4U8V D;  4G11 A;  5FQ8 A;  2PL2 A;  1WDY A;  3QAQ A;  2XRZ A;  1ZZC A;  5FZR A;  3E4B A;  2ODR D;  3PH0 C;  4KVM A;  3TWU A; 
#chains in the Genus database with same CATH homology
 5A7D B;  3JXC L;  1H2V C;  3ASG A;  3TAX A;  4AVX A;  1GT0 C;  4UWF A;  3MV3 B;  3ZPJ A;  4I6E A;  4XIF A;  2WXN A;  1TJF A;  4GA1 A;  1ADR A;  1H2T C;  4G25 A;  3KXA A;  4EQF A;  1NZN A;  1LLI A;  2X6H A;  2QFC A;  2WXF A;  3MEK A;  2M63 A;  2OND A;  2PQR A;  4RVB A;  4N3B A;  3F52 A;  4B89 A;  1H2U A;  3JCK C;  4N5C A;  1HG2 A;  5A7L A;  2XCJ A;  1JWL A;  4YAR A;  4YG1 A;  2FJR A;  3UMV A;  1PER L;  2ILR A;  4FP7 A;  4J8D A;  4A3V A;  3ZIM A;  2IOS A;  4BFR A;  1QP7 A;  5LX8 A;  3PNT B;  2FBN A;  2MQK A;  2LCV A;  4ANV A;  1INZ A;  3RRM B;  1WH6 A;  3FUD A;  2P58 C;  1E90 A;  4WNF A;  1WIZ A;  3LDZ A;  5AJD A;  3UT8 A;  4C0E A;  1YA0 A;  3NF1 A;  5G05 J;  4Q94 A;  3FUK A;  1PRU A;  2AUW A;  1N52 A;  2A5U A;  2BUG A;  1ZPQ A;  3CST A;  5HI7 A;  1QQA A;  3CVX A;  3G2T A;  1U3C A;  1IYG A;  2DBA A;  2DIW A;  1U3D A;  2WVI A;  2RD0 A;  2CFU A;  3QJZ A;  2OV8 A;  4AV7 A;  1KT0 A;  4DJA A;  2WQ6 A;  2D5V A;  4I9E A;  4U8H A;  5BNW A;  1AU7 A;  3Q47 B;  3CEC A;  3TJP A;  3BG1 B;  4BTA A;  1QNF A;  4LEU A;  4V3I A;  1RIO A;  1Y7Y A;  3LVR E;  3D9N A;  2BF0 X;  4Y6W A;  5LCW C;  1EYH A;  3S7J A;  3LPZ A;  4PU4 C;  3S7B A;  1HO8 A;  1Z6T A;  3D9O A;  4JVS A;  4YND A;  3CIA A;  1H19 A;  2VGX A;  4EZK A;  3HIZ A;  4HXI A;  3VLF A;  3O4Z A;  1QP4 A;  4YBA A;  1Y8M A;  2KZT A;  3L6A A;  4GZD A;  3FTV A;  3I4G A;  4FC8 A;  2VTB A;  2VQ2 A;  2R59 A;  3D9J A;  3G2W A;  4FJZ A;  5AYW D;  2IV1 A;  4Q96 A;  3S7F A;  2X6I A;  4KMO A;  4UWL A;  3D9L A;  4CDM A;  5G04 C;  5D0O D;  5CMW A;  2IVB A;  4CCA A;  3U9W A;  4KXK B;  1E8W A;  4CDN A;  2WUS R;  4A1G A;  4JZY A;  4G26 A;  3ZYL A;  3F6W A;  3QWP A;  3G2V A;  4WWO A;  5EX0 A;  2LYR A;  2X3M A;  2Y4U A;  3P1U A;  3RZZ A;  3ASH A;  3PNL B;  1ELW A;  4GYW A;  4CGV A;  2IQC A;  3QDN A;  2BNN A;  1SZ9 A;  1Z3Y A;  1Z3X A;  2KEI A;  4XI0 A;  4A1S A;  3DNV B;  2AWI A;  3LY8 A;  1HE8 A;  2AXV A;  3FUL A;  5E75 A;  5G55 A;  3FTW A;  3FUF A;  3OQN A;  2KM4 A;  2VSO E;  2XGS A;  4XKB A;  2ION A;  5BV0 A;  4W9R A;  1UJK A;  2XPI A;  1JWF A;  1YSE A;  3QKY A;  5A23 A;  3C98 A;  3RRN B;  3QQ6 A;  4X4F A;  3UFD A;  1E96 B;  2KCL A;  2XQ0 A;  4AM9 A;  3FTX A;  2IF4 A;  2LNI A;  5T4Y A;  4GYO A;  3VK0 A;  4HFG A;  4ACL A;  2GRL A;  3LEW A;  4BSX A;  3PRZ A;  4J1W A;  2L0T B;  2GGF A;  2VYI A;  1PAQ A;  2XRY A;  3D9M A;  1ZVV A;  5JHB A;  2XHE A;  2OVF A;  1E8Y A;  4OB4 A;  2PE5 A;  4GZ5 A;  4A55 A;  3TG4 A;  4BX8 A;  5C1D A;  2WMO A;  3OP9 A;  1LF8 A;  2XI8 A;  4X4C A;  2L8N A;  3FUE A;  4MS6 A;  3SCF A;  1BDI A;  4G2V A;  3I4R B;  4J1X A;  2LAI A;  3GW4 A;  3IV0 A;  2O49 A;  3OQO A;  5LP0 A;  1HU3 A;  5G05 C;  2ICT A;  3S2A A;  1Y9Q A;  4X4E A;  2PUF A;  2JVL A;  1DNP A;  2WM9 A;  3CSF A;  3MKQ A;  1QZ2 A;  3QB2 A;  4JHR A;  1TJC A;  4PUC A;  4WND A;  5BW8 C;  4EBA A;  3IBE A;  1DWK A;  4OVV A;  3Q15 A;  3R7R A;  4F53 A;  4Y6C A;  1E8Z A;  1JPL A;  5LFA A;  2CHX A;  4GA0 A;  3MCX A;  3IEG A;  4L7T A;  1NA0 A;  2IVG A;  1UXD A;  3JQ0 A;  3ONL A;  2XCB A;  3L17 A;  1R69 A;  3FTS A;  1NER A;  2EF8 A;  3BD1 A;  2IFU A;  3LS8 A;  4C0M A;  3KD7 A;  3NQP A;  2KEK A;  2BNO A;  2BJC A;  1B0N A;  2X6F A;  4JEH A;  2YNQ A;  4O6F A;  1EPU A;  4B8A A;  4XKC A;  3ZHE B;  3U66 A;  3FP3 A;  3UT4 A;  1LCC A;  5BPP A;  4RG9 A;  1OWP A;  5CCM A;  2IJG X;  4I6J A;  2WXL A;  3CHR A;  4JCY A;  3TXM A;  4DLO A;  1OWL A;  4F3V A;  4Q69 A;  2NSZ A;  2EWT A;  2LYS A;  1WET A;  4J8F A;  5JHA A;  3MX3 A;  2WQ7 A;  3RIB A;  2OR1 L;  1IQR A;  2HM8 A;  2VSN A;  4X4H A;  3Q49 B;  4PH4 B;  2WXQ A;  3D9K A;  3CVW A;  2E2E A;  4ANU A;  3SCG A;  2IVQ A;  3CKC A;  4N39 A;  3SF4 A;  4DLQ A;  2J4B A;  4AY6 A;  3K9I A;  3FY4 A;  4LUN U;  2WXM A;  2ICP A;  3Q4A B;  3ENE A;  3CVL A;  3IKO B;  3PE3 A;  2HIN A;  2WXP A;  5KJK A;  4GML A;  4E85 A;  1KT1 A;  4K0R A;  3RJV A;  4BT8 A;  4F7A A;  1QP0 A;  3CK9 A;  4GZC A;  2CHW A;  1ZZ8 A;  2L49 A;  3AS8 A;  4FUL A;  4I17 A;  3MGB A;  1SQ8 A;  2UWJ G;  2OFY A;  2PIJ A;  5A6C A;  4Z5H A;  1CQT A;  2L6J A;  3O9X A;  2C0L A;  1NA3 A;  3EIJ A;  3FDH A;  1UN9 A;  3QOU A;  4YG4 A;  3LVQ E;  3LXU X;  4JW1 A;  4TUU A;  5E76 A;  3ZW3 A;  3TG5 A;  3AS5 A;  2R1J L;  4GU5 A;  3CV0 A;  3JYS A;  2WXH A;  4GZ6 A;  3HYM B;  5D0Q D;  3ZFW A;  3LJ3 A;  4WUY A;  2MOW A;  2WXI A;  3B13 A;  4GB9 A;  2HO1 A;  5K98 B;  2JLB A;  3VLE A;  3DBS A;  2A6C A;  2LYL A;  2V5F A;  2Y3A A;  2J07 A;  2X6K A;  4OVU A;  2OOE A;  1OWO A;  2R5S A;  2V4L A;  3QAR A;  3VLD A;  4FLH A;  1JFT A;  4I43 A;  1VPW A;  1RZR A;  4MRU A;  3EHM A;  3L13 A;  4KVO A;  1L5J A;  5JJT A;  3OMT A;  2XJ3 A;  3KS2 A;  4FHJ A;  4MCX A;  2X6J A;  3G2S A;  3KAE A;  3CLC A;  3ZRH A;  4HOT A;  4CRW A;  4X4I A;  1DW9 A;  3EIQ C;  5FWQ A;  3KZ3 A;  1IC8 A;  2NC9 A;  3QC1 A;  4RG6 A;  1HZ4 A;  3ML8 A;  3ZHI A;  4XE0 A;  1LCD A;  1HFA A;  2HYZ A;  3MZL B;  4JEU A;  3ZEF A;  4APO A;  2XIU A;  5M72 A;  4AOF A;  3APD A;  2PUA A;  3PEU B;  4ILI A;  4ANW A;  3PEV B;  4PDX A;  3MKR A;  2YIN A;  5ENN A;  3ZHE A;  3G7D A;  3NZU A;  4U63 A;  5KCM A;  4GCN A;  1S7E A;  3GN5 B;  1ZBP A;  2FI7 A;  2IOL A;  2JEK A;  3IHY A;  4HS2 A;  1BDH A;  2PUE A;  1WAO 1;  1OWM A;  3PUJ A;  4B94 A;  1KLX A;  2V0P A;  5FQ6 A;  4NAC A;  4GYY A;  2EBY A;  3QNK A;  2GW1 A;  1ZS4 A;  2GZU A;  4XX5 A;  3MYV A;  4YG7 B;  3NZS A;  3OXG A;  3B7T A;  4NUR A;  2XSD C;  3OAW A;  3SI5 A;  3FWV A;  3CHQ A;  4HVB A;  3CQG B;  4Z58 A;  4PU8 A;  3APC A;  2OVB A;  3CVP A;  3SNX A;  3EJN A;  3UQ3 A;  4MLP A;  5FZQ A;  5FQ7 A;  4X4G A;  2LYJ A;  3R1F A;  4JPS A;  4HLE A;  1A17 A;  1JUQ A;  2KAT A;  2KCV A;  1ZZB A;  3PZD A;  4IN3 B;  1TEZ A;  2VJ8 A;  3CK7 A;  3FUI A;  2WXR A;  1O4X A;  4FBI A;  4ATG A;  2J9Q A;  2I1J A;  2PZI A;  4L23 A;  2WPV A;  3CVN A;  1ELR A;  4GA2 A;  3TRB A;  1OCT C;  4I1M A;  2MEZ A;  2FEZ A;  1MQS A;  4ACK A;  2I2O A;  1E7V A;  2V8S E;  3TGO A;  3B7H A;  4PS8 A;  3ASF A;  2IU1 A;  1MHQ A;  4PU3 C;  2J09 A;  2C0M A;  3ULQ A;  1POU A;  5ARF A;  3UT7 A;  2Y4T A;  3L54 A;  3N71 A;  2VGX B;  4KZC A;  1ZZ9 A;  4C9B B;  1EFA A;  3FU5 A;  3GZS A;  3QF3 A;  3JUI A;  1WY6 A;  2CRO A;  1EF1 C;  3CHM A;  4G1T A;  3G5G A;  2XGO A;  4N2Q A;  2AXZ A;  2XEV A;  3P2B A;  4JL0 A;  4EBA G;  3SGH A;  3GBF A;  3OXF A;  4UWG A;  3SHF A;  1GW6 A;  4M3O A;  4CT4 A;  4LCT A;  1N54 A;  5AJL A;  2WIU B;  3S8Q A;  1ZZ7 A;  1RPE L;  4LER A;  5FQ4 A;  4FAD A;  2X38 A;  3QWG A;  1X2L A;  4GQM A;  1UW4 B;  3F51 A;  2CHZ A;  3RKV A;  4CT0 A;  4H7Y A;  4U0U A;  3ML9 A;  4EEC A;  3ZKC A;  2PM6 A;  2LSU A;  4I6U A;  4NDW A;  2XPZ A;  3L22 A;  1IQU A;  2QY7 A;  1QQE A;  3FH8 A;  2FO7 A;  1BPO A;  5CMY A;  3UX4 A;  2NXP A;  1Y6I A;  3QWW A;  5BUZ A;  4F8D A;  3U3W A;  5T3R A;  3RO3 A;  4K03 A;  3KJX A;  3R9A B;  1UN8 A;  4KT6 B;  3CGH A;  4LRZ A;  4YVQ C;  5ANL A;  2I9C A;  2H8R A;  4AJW A;  2KC7 A;  4J8E A;  4R7L A;  4YVO A;  3GZ1 A;  1HH8 A;  4I2Z A;  4L2L A;  5DBK A;  3RK6 A;  1H6K A;  1HF0 A;  1ELK A;  4GPK A;  4X4D A;  4KZ0 A;  3U4T A;  3H5T A;  3FUN A;  4J0U A;  4GMJ A;  3IVP A;  2J08 A;  2WB2 A;  3G2U A;  4XZ4 A;  4GAA A;  3FUH A;  3LIS A;  2B5A A;  5ANR A;  5FTP A;  4JC8 A;  1JH9 A;  3QK0 A;  3B7R L;  4AXH A;  4EPZ A;  4IWR A;  5JJ6 A;  4KBQ A;  1L1M A;  1XWR A;  3FTY A;  4N2S A;  4A3T A;  3GZ2 A;  4OYS A;  4NQ0 A;  2CFZ A;  3FH5 A;  3PS6 A;  4JA7 A;  3ZN3 A;  4EZJ A;  4Z5C A;  5EX3 A;  3R7Q A;  3ONK A;  4Z59 A;  3CRO L;  4I8T A;  4G24 A;  2CG3 A;  2A4Z A;  3FTU A;  3OTN A;  2JCG A;  5ARG A;  4IA8 A;  3I5P A;  2R63 A;  3PXP A;  4GHJ A;  2YQ8 A;  4RSY A;  4I1O B;  2KZ8 A;  3CHP A;  5T8I A;  1E7U A;  2R17 C;  2YHE A;  3IHV A;  4G23 A;  4JHJ A;  3FUM A;  2VSX E;  1PC2 A;  1HS6 A;  4I6G A;  2CG2 A;  4I1A A;  1UTX A;  2I1K A;  3D9P A;  3AU4 A;  3AU5 A;  5C2Y A;  3UPV A;  2VGY A;  4CDR A;  2Q7F A;  2WQH A;  2I6H A;  2AW6 A;  2WXG A;  3RRU A;  1FVF A;  4N3C A;  3SBT B;  3SFZ A;  5CCL A;  3OXL A;  2VSY A;  1EDU A;  3DPD A;  3APF A;  2RG8 A;  4IUL A;  1QQB A;  4KYO B;  3RO2 A;  2MHK A;  2EQX A;  3B7S A;  5KJM A;  3SBS A;  2O4A A;  2LSV A;  3SCH A;  2XCC A;  5EKQ D;  3LFP A;  3O48 A;  3D1N I;  4X4B A;  1HX8 A;  2CSF A;  4MCT A;  4IVZ A;  3FFL A;  2LYP A;  4TV3 A;  1HXI A;  1WH8 A;  2KEJ A;  2VTB B;  2J4D A;  4ABN A;  3GN5 A;  4I6R A;  3B7U X;  3ESL A;  3ZYQ A;  4BTB A;  4HOQ A;  3OQM A;  5J90 A;  2WXJ A;  1JWG A;  3GYZ A;  4UQZ A;  3ASD A;  3FHE A;  4PU7 A;  2XGM A;  2HSG A;  5LOZ A;  1UXC A;  3FYA A;  2WXK A;  3T8M A;  3HDX A;  4B8C B;  2UY1 B;  4L2Y A;  1FVH A;  5DIZ A;  1PRV A;  4ILH B;  4E6H A;  1HF8 A;  3FEY A;  3PVL A;  3HVE A;  3CLJ A;  2FUL A;  5G04 J;  5G2N A;  4DPR A;  4EZL A;  5HQ8 A;  4DK5 A;  2PM7 A;  4UI9 C;  1ZZ6 A;  2PQN A;  1E8X A;  4WWP A;  3VTY A;  3L1P A;  5FJY A;  3TL5 A;  1LQC A;  4BY6 A;  4FN3 A;  3ESK A;  4WNE A;  4CGW A;  1X5B A;  2WXO A;  4N3A A;  2LAH A;  2YHC A;  4FLB A;  4DI3 A;  5AIJ A;  4L1B A;  4UQY A;  2L0I A;  4F1S A;  2FF4 A;  4D10 C;  1DVP A;  5LCW J;  3T5V A;  3SD5 A;  1LMB 3;  4ME2 A;  2AXU A;  2AVP A;  4XI9 A;  4WNG A;  3CVQ A;  1NP7 A;  3CQC B;  3FU0 A;  4AIF A;  4P29 A;  1ZU2 A;  5J08 A;  5JJ7 A;  4JQD A;  1VDY A;  3Q5M A;  2LYK A;  1XNF A;  4JA9 A;  3LYA A;  3HZI B;  1UG3 A;  4U04 A;  5KJL A;  1X57 A;  3PRE A;  5FZS A;  4AP2 A;  3CVV A;  4AY5 A;  1SZA A;  3EUS A;  2KPJ A;  3LCA A;  4O8B A;  4GZ3 A;  2PUD A;  2KCK A;  4BWR A;  3EDT B;  4TRQ A;  1PNR A;  4ANX A;  1PY1 A;  3BEE A;  2BNM A;  3FYM A;  3FMY A;  1RZR D;  2PUB A;  1IHG A;  3CEQ A;  4UWH A;  3D9I A;  4I6T A;  3U64 A;  1FCH A;  1S0P A;  3QYX A;  2PUG A;  2O38 A;  1UJJ A;  3MA5 A;  3UUX A;  4DI4 A;  3PE4 A;  4UI9 J;  1R63 A;  2C2L A;  3CK8 A;  2PUC A;  4PS7 A;  4BX9 A;  3AS4 A;  4PS3 A;  1JFS A;  1CJG A;  3URZ A;  4H7X A;  3ZXS A;  4BT9 A;  5KJN A;  2UY1 A;  3WXX A;  3KEZ A;  4MKT A;  3LY9 A;  5CHE E;  1QPZ A;  3FUJ A;  4J8S A;  1PRA A;  2IUO A;  2XPY A;  3FU3 A;  4U07 A;  4B0Z A;  4ILG A;  4CEM A;  1P5Q A;  4U0Z A;  1B89 A;  1E3O C;  3CHO A;  4HOR A;  3CKB A;  3FTZ A;  4JXT A;  3S7D A;  3ZHM A;  3HVE B;  3MV2 B;  3CR3 A;  3BDN A;  3BS3 A;  4I2W A;  4Z5D A;  4FA6 A;  3FU6 A;  3CVU A;  1HG5 A;  1OWN A;  2DCP A;  3ZYK A;  3MLF A;  3MKQ B;  4UQX A;  1XGW A;  5FT9 A;  5BV1 A;  3D3M A;  1W3B A;  1SQM A;  2BTD A;  3L08 A;  4GCO A;  4HOS A;  2PPX A;  4Y42 A;  3PDN A;  2L9B A;  5BT1 A;  1OSL A;  3HHM A;  4HOU A;  4UWK A;  4WWN A;  4URK A;  3MJW A;  2ZU6 B;  4FHK A;  2LYQ A;  4FJY A;  2GRM A;  4WAF A;  3CVY A;  1ZUG A;  2WMN A;  3BG0 B;  4JHK A;  4J6I A;  4QFV A;  3RU0 A;  2HR2 A;  3I3N A;  3QWV A;  2IU7 A;  4JCX A;  2LO6 A;  4APF A;  1H0A A;  1ZAY A;  2J49 A;  3FH7 A;  3PUK A;  3TXN A;  3VTX A;  2MRI A;  3CHS A;  4IRU A;  4UI9 K;  4G11 A;  4I9C A;  3JXD L;  3ZGQ A;  5AEN A;  3JXB C;  1NEQ A;  1OUV A;  3L16 A;  4FU3 A;  3JQ1 A;  4U0S A;  5FQ8 A;  3T5X A;  3ZVV A;  5EDS A;  4IYP A;  2PL2 A;  3LY7 A;  1WM5 A;  3LKU A;  3QAQ A;  2XRZ A;  4NRH B;  2E0I A;  1RZS A;  1ZZC A;  5FZR A;  3FEX A;  3E4B A;  2KZT B;  4AEZ C;  3SZ7 A;  3EHN A;  3PH0 C;  4KVM A;  3ZYM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...