2AXUA

Structure of prgx
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
305
structure length
303
Chain Sequence
MFKIGSVLKQIRQELNYHQIDLYSGIMSKSVYIKVEADSRPISVEELSKFSERLGVNFFEILNRAGMNSVNETGKEKLLISKIFTNPDLFDKNFQRIEPKRLTSLQYFSIYLGYISIAHHYNIEVPTFNKTITSDLKHLYDKRTTFFGIDYEIVSNLLNVLPYEEVSSIIKPMYPIVDSFGKDYDLTIQTVLKNALTISIMNRNLKEAQYYINQFEHLKTIKNISINGYYDLEINYLKQIYQFLTDKNIDSYLNAVNIINIFKIIGKEDIHRSLVEELTKISAKEKFTPPKEVTMYYENYVAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PrgX
publication title Structure of peptide sex pheromone receptor PrgX and PrgX/pheromone complexes and regulation of conjugation in Enterococcus faecalis.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Transcription
total genus 111
structure length 303
sequence length 305
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2005-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2axuA01
1.25.40.400 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2axuA02
3U3WA 4MCXA 4PU7A 1VPWA 4Y42A 1HF0A 1OCTC 1BDHA 1S7EA 1RPEL 2JVLA 4Z5CA 3QF3A 1B0NA 2LYPA 1Y7YA 4Z5HA 4X4GA 2LYLA 4X4FA 4J1XA 1ADRA 1QPZA 3EUSA 1POUA 4YG1A 3ZHMA 1JFTA 1CQTA 2OR1L 4X4EA 2AUWA 2IUOA 3SCHA 4PU8A 3FYMA 2XI8A 1ZVVA 2CSFA 3DNVB 2AWIA 4Z58A 1PRUA 1WIZA 1QP0A 3BD1A 3JXBC 2AXVA 2BNOA 3GBFA 3O9XA 2R63A 3FYAA 1ZS4A 2GRLA 4F8DA 2KPJA 1IC8A 4YBAA 3MLFA 3FMYA 1RZSA 3SCGA 2IVQA 1GT0C 1E3OC 1QQBA 1YSEA 3F6WA 3L1PA 3OQNA 3OMTA 4X4IA 2O49A 4IVZA 1X57A 1ZUGA 4IA8A 2L8NA 3R1FA 3VK0A 3JXDL 2LYQA 2AXUA 3PXPA 3SCFA 1SQ8A 3D1NI 5K98B 2JCGA 4Z59A 2A6CA 1O4XA 1WH8A 3LISA 1AU7A 2ICPA 1DWKA 3G7DA 2PUAA 3TRBA 2PUDA 2AW6A 4YARA 3F52A 2BJCA 1QQAA 4I6RA 2XSDC 2BNNA 2IU7A 4X4CA 2PUEA 3BDNA 1WETA 3ZKCA 1ZZ7A 1PERL 4X4BA 2D5VA 2PUGA 2IV1A 3ZHIA 3S8QA 4JCXA 2HINA 2PIJA 1ZPQA 2MEZA 3G5GA 4GHJA 2H8RA 2XCJA 4YG7B 2WUSR 4PU3C 2EF8A 3UFDA 1LLIA 2LYJA 1RZRD 2LYSA 3RZZA 4J1WA 2BNMA 1JFSA 4IWRA 4I8TA 2PUBA 2KZ8A 2LYKA 3KZ3A 4OB4A 3QYXA 2L49A 4I6UA 1R69A 3KJXA 1UTXA 3CLCA 3LFPA 4NDWA 1UXCA 2IVBA 4JQDA 4I6TA 2O4AA 2EWTA 2R1JL 3F51A 1PRVA 1XWRA 1NEQA 1ZZCA 4Z5DA 2HSGA 2LYRA 1BDIA 2OFYA 1WH6A 1DW9A 2O38A 3QWGA 3OQOA 4FBIA 4MCTA 3CECA 1X2LA 2KEIA 3OQMA 2KEJA 2LCVA 1CJGA 2MQKA 1ZAYA 5A7LA 2PUCA 1R63A 1RIOA 1Y9QA 1OSLA 4GQMA 3BS3A 1QP7A 1ZZ8A 3QQ6A 4X4DA 2EBYA 2IVGA 1PRAA 4O8BA 1PNRA 2ICTA 2AXZA 3OP9A 3H5TA 2PE5A 1QP4A 2CROA 3GN5A 3B7HA 1LMB3 1ZZ9A 4X4HA 1NERA 4FN3A 3JXCL 1JH9A 2GRMA 1LCDA 2XJ3A 4PU4C 1L1MA 1ZZBA 2B5AA 3IVPA 1UXDA 3KXAA 1LCCA 2PUFA 2FJRA 4YG4A 1ZZ6A 2PPXA 3GN5B 1EFAA 1RZRA 2KEKA 1JWLA 2GZUA 3HZIB 2XIUA 2WIUB 4JCYA 3CROL 1LQCA
chains in the Genus database with same CATH superfamily
1TNZA 2ETAA 5JMND 5HQ8A 4WWPA 1MX6A 1POUA 4JHRA 4DJAA 4GPKA 3S2AA 4J8EA 2OVBA 4DLQA 2AWIA 2MOWA 3FUMA 1E90A 1E7VA 2Y0BG 3KD7A 1WIZA 1H6OA 2R63A 4O1PA 3EHRA 3BG1B 4F8DA 2HE0A 4CT0A 4NACA 1QBQA 4M3OA 4U63A 1YSEA 1NA0A 4IVZA 2YHEA 2L8NA 3JXDL 4PDXA 3K9IA 2DVWA 3SBTB 1BI8B 4Z59A 4F6RD 2WQ6A 3TWSA 4DUIA 3HG0D 4I6RA 3TWXA 2L9BA 1WG0A 1TR4A 1U2ZA 2X3MA 1KZPA 4LG6A 2DBAA 4FC8A 5AQAA 4PUCA 5FWQA 4YG7B 3ZEFA 4Q94A 3TWVA 5C2YA 1RZRD 3Q15A 4E6HA 2XRZA 4MLPA 5BT1A 2IQCA 2KM4A 1MX4A 3CK8A 2O4AA 5JJ7A 1HQ1A 2JLBA 2I1JA 1Z3YA 2H6FA 4FP7A 2VSYA 1Z3XA 2KC7A 3EU5A 4IYPA 4WWNA 1ZAYA 4G1TA 3ZXSA 3E34A 2NYJA 3FUIA 1ZZ8A 1MJ0A 3SFXA 4GYYA 2AXZA 3B7HA 4ILIA 4IULA 1JH9A 4N3BA 2XQ0A 2B0OE 5FQ4A 1RW2A 5ENQD 4GTSA 4AY5A 2XXPA 4U0ZA 4M7CA 2R59A 4ANVA 3DSSA 3FULA 1RPEL 2CG2A 3Q79A 4X4GA 2LYLA 1A5EA 3NROA 3PNLB 2X6FA 3OTNA 3APDA 4LSZE 2B6CA 4XIFA 2RFMA 3EIJA 3SI5A 2LNMA 5KJMA 1QP0A 2VSXE 3DSUA 1Q2ZA 4N3CA 3ZPJA 1OCRE 4AM9A 3SZ7A 4F1PA 3JYSA 4YDEA 2XEEA 1TJFA 2FI7A 3RU0A 5E76A 1N0RA 3W9FA 1N0QA 1HX8A 4C48B 4GMRA 4B94A 2IOLA 1O1TA 3U64A 2AW6A 3JUEA 1QZ2A 4GZ3A 1X5BA 2BNNA 3ULQA 3KS2A 2IJGX 2GRRB 1OWPA 3T8KA 3CKBA 3RJVA 3PEVB 1UN9A 2FBNA 3NOGD 4EZIA 2OVFA 3P2BA 3KSQA 3HXFA 5AJDA 4BESA 5BV1A 1BI7B 3GZCA 3D3MA 4UUCA 4HNAD 3S7BA 1AP7A 4JHJA 5CERB 3UPVA 2IVGA 3QWVA 2X6JA 2VJ8A 2DWZA 5JJ6A 4AV7A 4GPMA 2KBXA 4ME2A 3GZDA 1ZZ6A 1JCRA 3RRMB 4U0SA 3G2VA 3UM3A 1TNUA 3U3WA 5A7DB 4DX2A 3RRNB 1Y7YA 1ELWA 3UWPA 1ADRA 3VLFA 1TNYA 3C3RA 4A63B 2LSVA 2GGFA 2XRYA 2LAHA 2WXGA 4GA2A 3UXGA 5ANRA 3S7FA 2V4HC 3R09A 3JXBC 3KEZA 2QY7A 1ZS4A 2GRLA 1ELRA 3CSTA 5IY5E 2PM7A 3PE4A 3SF4A 3WXXA 3CGHA 2VTBA 5J90A 1ZUGA 4IA8A 3ONLA 4GYWA 4JL0A 2A6CA 4BWRA 4HI9A 3VTXA 3FTSA 3FU3A 2XS8A 3RAUA 2F0YA 2IV1A 3DRAA 3UM2A 1KLXA 3UIOC 3ZYMA 4GTOA 4R7LA 5EN5D 2WQ7A 4Y6CA 4RSYA 3FUNA 4GZ6A 3TWTA 3UFDA 3B7UX 2BEDA 5CRUA 2BTDA 3MYVA 1NA3A 3Q9UC 1UTXA 5AYWD 1N4SA 1N54A 1WDYA 3F51A 1BDIA 1N52A 2QYJA 4HVBA 3LYAA 4EKIA 3QQ6A 4JW1A 4B89A 2PE5A 3GN5A 3L16A 1ZZ9A 1FT2A 3ASFA 2PXVA 3B7BA 1K1BA 5EYPF 2GROB 4DX6D 1FVFA 4TXQA 5D2MC 4FLHA 1N4RA 4ABNA 4U8VD 5DRYA 4BTAA 3ZYLA 3L6AA 3QC1A 3V2OA 4Z5CA 1B0NA 4CZ2D 3FHEA 5ENPD 4A3TA 4ANXA 5DBKA 3DSTA 3PE3A 3TFLA 2DZNA 2CSFA 4XZ4A 4OYSA 2LAIA 3VTYA 1KZOA 1LTXA 2HM8A 3BUAA 3WG7E 3ABME 3NOCD 1TN6A 2HCNA 3ULEG 3UM1A 4XI9A 1D8EA 3T9KA 4I43A 4AY6A 4C9BB 2CG3A 2EIME 2Q7FA 3D9JA 4I2WA 1DWKA 3G7DA 3TRBA 3EHMA 3ASHA 3ML9A 3PUKA 3G2TA 2PXQA 4CRWA 1HE8A 2R5SA 3Q5MA 4XKBA 3QARA 3OAWA 4FJYA 2EINE 1DCQA 2P9IG 4UWGA 3G2SA 2WVIA 3BQOA 2FO1E 1R69A 1HU3A 3QK0A 1QYMA 3I5PA 4F1SA 2DCPA 3TG4A 3CVUA 1XWRA 2HSGA 3L82A 2O38A 2NC9A 1X2LA 2L0IA 2BUGA 3BS3A 1SW6A 1N94A 3TWUA 2EBYA 3L17A 3JXIA 2OCCE 2BKGA 2WMNA 4MRUA 3EDTB 5G04C 1L1MA 1LCCA 3D9PA 3ZGQA 4EPZA 1D8DA 4HOTA 4EQFA 2WIUB 2EIJE 3ZFWA 5FQ7A 5G04J 3HVEB 1DCEA 5CMWA 2PXKA 4Z5HA 3AJIA 3EUSA 2KCLA 2IY0C 4J8FA 3R7RA 4J0UA 4KVMA 2VGXB 2YBDA 4GZDA 3J5PA 5EX3A 2NSZA 2H6IA 3G2UA 4Q96A 2BNOA 3FU5A 3B13A 3D9MA 4P29A 1H2TC 3ESKA 1FCHA 3IXEA 2CHZA 3CHQA 3D9LA 4UQZA 3ZUVB 3VK0A 3T5XA 3D1NI 3FUFA 5K98B 4GTMA 3D9HA 3BU8A 1WH8A 3LISA 1DULA 1N9AA 5JA4D 4YARA 2PUEA 2XSDC 4HI8A 1SVXA 3QB2A 5DT2A 1PERL 4GA0A 4X4BA 4F7AA 4APFA 3QJZA 3S8QA 3RRUA 3LY8A 5G55A 1O1RA 5H7PA 3AG4E 3CHPA 2JEKA 1NZNA 3AG1E 4A1GA 1ZB1A 3TWWA 2P9NG 3NAWA 1IYGA 4TXRA 5CHEE 3I3NA 2BNMA 3DXMG 3OXLA 4EECA 4L7TA 3LFPA 4NDWA 5HKPA 4G23A 3SFZA 3C98A 4ACKA 3APFA 1GW6A 4OVVA 1DW9A 3S7DA 3OQOA 4FBIA 5EX0A 2PUCA 5FT9A 2MQKA 4XKCA 1IKND 4J7WA 3AU5A 5AJLA 1PRAA 1DC2A 5J08A 2QC9A 4J8YA 4LNUD 1OCCE 4GU5A 1FPPA 2XHEA 5ENSD 5FINA 5DTMA 1L5JA 4MCXA 1VPWA 2WXFA 4B93B 2PXEA 1OWMA 3MCXA 2LXLA 3CVXA 1UG3A 3DNVB 4Z58A 4CCAA 3ASDA 4LNBA 4I1MA 2VSNA 1HFAA 3SR4A 1B89A 2VYIA 2PXBA 4L1BA 4H7YA 1TEZA 4XE0A 5BPPA 1H6KA 2X6IA 3AU4A 3SY2A 2I9CA 3CHSA 4IN3B 3FTXA 4ZHBA 2XEHA 3FP3A 2LUHA 2PUAA 5DTQA 4AJWA 1WM5A 2IF4A 3CHOA 4G11A 1HO8A 4U04A 2J08A 1TYQG 2HCSA 3EUVA 3ZRHA 5BXUA 2XCJA 2EF8A 3UT7A 5LX8A 4U95D 4N2SA 1JCSA 3P1UA 3SBSA 3KZ3A 2MYOA 3TGOA 4DX1A 2LSUA 5M72A 3X2QE 3CHRA 4BT8A 2IU1A 3QWGA 3D9IA 2KEIA 4WNFA 4G8KA 4HOQA 4I17A 1Y9QA 1QP7A 2XXQA 3LS8A 1QP4A 3T8MA 3FTUA 1LCDA 3CV0A 1JWGA 4BTBA 4PH4B 4ER3A 5DSXA 1EFAA 3CEQA 1LQCA 2UY1B 2ILRA 4ILHB 1D9SA 3ZPXA 4FLBA 2C0LA 2IFUA 2L0TB 2NXPA 3ISMC 3PRZA 2XI8A 3LCAA 2CHWA 3UMVA 4YVQC 3QDNA 1OWOA 4JHKA 2OEWA 3O9XA 3IHVA 2KPJA 1BD8A 5FQ6A 3F6WA 4YVOA 5AAOA 3EU9A 3UTMA 5ENTD 4I6EA 4GTRA 4I6JA 2XENA 4Z68A 3RIBA 2X38A 2PXFA 4TRQA 1UOHA 2J8SD 3BDNA 4GZ5A 3FWVA 5FTPA 3FDHA 1ZPQA 4OVUA 5G05C 1LLIA 4GCOA 1SZAA 1SZ9A 4IWRA 3CHMA 5D66A 4CEMA 2WXQA 1MQSA 1YYHA 1HG5A 4RQIA 3T5VA 5JUWA 4U8HA 3UIPC 1QQEA 1RZ4A 3A9XA 1MZCA 4U8YD 2XPZA 1UXCA 3CVLA 5G05J 2LYRA 4TUUA 5A7LA 2KZTB 2PNNA 2RD0A 4X4DA 4PS8A 2ICTA 2P9PG 2KATA 5BV0A 2FULA 4ER6A 2C2LA 3TG5A 4XX5A 1NERA 3JXCL 5DTRA 3E30A 3F6QA 2XXAA 1E8YA 2ZGDA 1MHQA 2EIKE 3CKCA 3PDNA 4OAVB 5G2NA 2PPXA 4J8SA 4JCYA 4GYOA 4PU7A 1AWCB 3N71A 1UN8A 2WXJA 5EDSA 1OCTC 1IQRA 5A23A 3LDZA 2F8XK 4Q69A 2LYPA 5BNWA 3PS6A 2H6HA 1ZBPA 3ZHEB 5KCMA 5A6CA 4L9PA 3E4BA 5ANLA 4EK9A 4B8AA 2A5UA 2X6KA 2AJAA 3SHFA 3PVLA 2HO1A 4UI9K 3SX0A 3RSEG 4KZ0A 3OWQA 3ASGA 4YDOA 3SGHA 4LUNU 5AN8A 3GUUA 4HRLA 4CGVA 3TL5A 3DBSA 4I1OB 3NBNB 5HS0A 3R7QA 3GW4A 2IU7A 3RO3A 4GTTA 4ATGA 5AENA 1E7UA 4OAUC 2ONDA 3FUHA 3TEPA 3D9KA 1Y6IA 3MX3A 5KJKA 4PS3A 2CHXA 4BEPA 2LYKA 4KXKB 1XGWA 2PXPA 3OXGA 5KNHD 4I6TA 3S7JA 2P9SG 3TWQA 2L6JA 1MX2A 2PZIA 3ZU7B 4ATZD 4AEZC 3NB2A 5D0OD 3NZUA 4AIFA 3JQ0A 3R9MA 4I2ZA 2B5AA 3KXAA 1QZXA 5GAHi 2FJRA 2V8SE 3CQGB 5BXOA 3GZDC 3TXNA 4UWHA 1PAQA 4DRXE 3CROL 3HIZA 5BW8C 2XGOA 4ZFHA 4N39A 4RVBA 2VGEA 4WWOA 2P58C 1X81A 2R05A 4DX5D 5KWDA 5ENOD 2XZDG 2RKKA 2QZAA 2P9KG 3OMTA 3R1FA 2J09A 3ABKE 2AXUA 1SQ8A 2XGSA 3CSFA 3ULYA 2Y69E 1INZA 2XPYA 3QOUA 2WXMA 3F52A 2XS1A 3OKZA 1WETA 3RKVA 5JHAA 3FTZA 4U07A 2PUGA 3PZ4A 1H2VC 4L23A 1UJKA 5ITZF 4G8LA 1NW3A 3QWPA 1TN7A 1UW4B 4XEIG 2PXTA 5CRVA 2LYSA 3TXMA 3CVNA 3PNTB 2I6HA 4G26A 4I1AA 3LVRE 2VGXA 5AARA 4MCTA 3FUEA 4KMOA 2KEJA 1EDUA 4GTPA 3IBEA 5FQ8A 3OXFA 3PZ2A 3GZ2A 1OWNA 4O8BA 2ZISA 2GRQB 2JQEA 3TJPA 4KYOB 3QFIA 1SA4A 1K1AA 4HOUA 4HLEA 4FU3A 2FF4A 3ZXPA 2PUFA 2L1PA 3GN5B 1RZRA 3DEOA 2ZIRA 4UWKA 3A9YA 4J1XA 1QPZA 3ZYKA 4EZKA 4N2QA 2KCKA 2PXDA 4GMLA 1ZVVA 4WUYA 3DPDA 4BERA 3MKQA 5ARFA 2XZTG 3CVQA 3BEEA 5T4YA 3PZ3A 4PS7A 3NZSA 3AS4A 3NXHA 2XEVA 4WNEA 1QQBA 1FVHA 1OCZE 3MV3B 2O49A 3QKYA 4HORA 4NQ0A 3DSXA 4HQDA 2FFHA 4C0MA 2H6GA 3CQCB 3APCA 3DSWA 1O4XA 3B7RL 4OBMA 4ANWA 1AU7A 3UKUG 4CT4A 2I2OA 2BJCA 1UJJA 2DZOA 5KNGA 5LCWC 3FU0A 1XNFA 4AVXA 1JUQA 1WY6A 1ZU2A 4KT6B 3ESLA 4UWLA 4C0EA 2HINA 2KCVA 3GZSA 3Q75A 2R17C 3MGBA 4LCTA 4EQZA 1DNPA 5LCWJ 2P9UG 1DVPA 4DK5A 2WXLA 3EHNA 4DI4A 4BSXA 1TN8A 5CMYA 3OQMA 3NDBB 3Q73A 1G3NB 1OSLA 4N5QA 4A1SA 5DIZA 3Q9NC 3ASNE 3I4GA 2LXMA 1S64A 3CK7A 3UX4A 1E96B 3V31A 4JEUA 3R9AB 3IV0A 2QFCA 4O1OA 2IO3C 1H2UA 1U2VG 4BSZB 1HF0A 1BDHA 4URKA 4GA1A 3QF3A 2DYSE 3GZ1A 1OY3D 2J7UA 3DPYA 4YG1A 3SD5A 4CYMD 5LFAA 1PRUA 1V54E 2J07A 2PXLA 4HB5A 2AXVA 3ONKA 3LJ3A 1EYHA 2X6HA 3U4TA 4E85A 3SCGA 3EIQC 1H6PA 5CEDB 1H19A 2V3CC 4U0UA 2CFZA 2JCGA 3KSLA 1N4QA 3Q49B 2WXRA 5ENNA 4X4CA 2A5EA 3CLJA 2YINA 3B7SA 4L2LA 1LD8A 3FTWA 1BU9A 4JCXA 3G5GA 5KBAA 2J7WA 1NP7A 3E33A 4GB9A 2J4BA 3DSVA 4QQIA 4WNDA 2KZ8A 1VDYA 3EJNA 2XCBA 2L49A 3KJXA 3CLCA 4RG9A 4JQDA 3U9WA 1ZZCA 4YDYA 4EHMA 2Y1LE 1KT1A 5ARGA 2C0MA 3FH8A 5AQBA 2EQXA 2CROA 4J8DA 4KZCA 2R2LA 5JHBA 4PU4C 3E37A 3D9NA 4RG6A 4GCNA 4N5CA 1IXVA 5FZSA 2KEKA 1U3CA 2F8YA 2R02A 2IOSA 1H0AA 1MYOA 3CVVA 1N95A 1S7EA 4BETA 2LO6A 1HF8A 4K0RA 4G24A 5AIJA 1YMPA 1JFTA 5EIBE 3NF1A 4CDRA 1OXJA 3Q7AA 4K03A 3TWRA 3KEAA 3B95A 3ZIMA 3Q78A 1IC8A 1IHBA 1LD7A 1FT1A 2WM9A 1E3OC 3CK9A 3L1PA 5CCLA 3MEKA 5CBNA 3KL4A 2L6BA 2MXDA 1SQMA 2WXOA 3AAAC 5FZRA 2LYQA 3URZA 3IHYA 3ZYQA 2ICPA 2KZTA 2PUDA 3PEUB 4HRNA 3HRAA 3ZKCA 4WNGA 4BX8A 2GW1A 1A17A 3CVPA 3PE5A 3IEGA 2YQ8A 2H8RA 2Y4UA 1IQUA 1S63A 4AP2A 3QYXA 2WXHA 3C72A 4JA9A 1EF1C 1TJCA 2R1JL 3V2XA 2DYRE 2JABA 3V79K 3ENEA 3ZHEA 5EILA 5JJTA 5GAGi 4FADA 4HRMB 4AOFA 1E8ZA 2MHKA 2WPVA 2E0IA 3JQ1A 3H5TA 2V5FA 3LJNA 1K3ZD 4X4HA 3NQPA 4JZYA 3PUJA 4JA7A 4U7EB 3Q7FA 1ZZBA 3G0TA 4UQYA 3C3OA 3FUDA 4G25A 3HZIB 4WAFA 4CDNA 1E8WA 3Q47B 3ME5A 3FTYA 4FA6A 1P5QA 2OEVA 1NFIE 3C3QA 1KT0A 4B0ZA 2OR1L 3LEWA 2UWJG 4UQXA 4LEUA 2IUOA 1QNFA 3HXEA 3L9TA 4IRUA 1BLXB 3AS8A 2PQRA 2P9LG 2Y3AA 5EKQD 3MJWA 3A9ZA 5HRYA 1KPSB 2LLVA 3ZW3A 1GT0C 3C5RA 3L13A 2PXUA 2WMOA 1X57A 4ER7A 3PXPA 3SCFA 4EBAG 3QOXA 3AS5A 3EHQA 3ZN3A 4H7XA 2VGYA 4K5AB 4V3IA 2CFUA 2BKKB 4UWFA 1QQAA 4HS2A 4GTQA 2D5VA 3VLEA 4DX7D 4YDWA 3ZHIA 2FO7A 4WVLA 1O1SA 1N4PA 4JXTA 1PC2A 5KJNA 4DLOA 2PIJA 4I9CA 1WAO1 1YA0A 3FEXA 3HYMB 3TELA 4BFRA 4O6FA 5FZQA 1Z6TA 4ER0A 2PL2A 2LYJA 1Z5SC 3RZZA 1N11A 4I8TA 3FH5A 5LOZA 3UT8A 4I6UA 3HXDA 2WQHA 3MA5A 1NEQA 3PZDA 4Z5DA 5AQ7A 4NURA 5EIDA 2OFYA 1WH6A 5DRTA 2WXPA 4GMJA 1CJGA 2LCVA 1OWLA 4NIKA 4GQMA 4QFVA 4GAAA 3NZLA 3OP9A 4AXHA 3ZVVA 1LMB3 5T8IA 2IEJA 1LF8A 1HH8A 3ABLE 4YG4A 3JCKC 2ETBA 2HR2A 2XIUA 3ML8A 4JC8A 1HG2A 2JVLA 4FULA 3CVWA 3QNKA 3ZHMA 4Y6WA 3FY4A 4X4EA 3L08A 1TNOA 1OUVA 4APOA 4HBDA 4EZJA 1NI1A 3MV2B 4HFGA 3TAXA 1S70B 4YBAA 3SFYA 1HZ4A 4HXIA 2ZU6B 4X4IA 3SQVA 2V4LA 3Q4AB 4GZCA 2IONA 2R03A 3ZKJA 5BUZA 3MKRA 3LXUX 2BF0X 2Y4TA 4I9EA 1PY1A 3VWSA 3O4ZA 1S0PA 1W3BA 5ENRD 1HXIA 3L54A 4RLYA 2DIWA 2V0PA 3HXCA 4GHJA 4EKGA 3I4RB 3UI2A 4J1WA 3IKOB 3HXBA 2WB2A 1JFSA 1V55E 2PQNA 5CEAA 2VTBB 3UQ3A 3E32A 4BT9A 4Q2JA 2IVBA 3CR3A 4X8QA 1PRVA 2F37A 4A55A 4JD2G 4CGWA 2RFAA 1RIOA 3MEJA 3LY9A 3SNXA 2J4DA 3SO8A 3O48A 3M9LA 1QB2A 1JPLA 5FJYA 2IO2C 4FN3A 2GRMA 2XJ3A 4TXPA 3HVEA 5C1DA 3FEYA 4J6IA 5CBOA 2A4ZA 5E75A 2XCCA 2GZUA 5B3SE 4Y42A 2AVPA 3GYZA 3FTVA 3UM0A 4FJZA 1IHGA 1JWFA 4MS6A 3HDXA 5KJLA 2LNIA 2AUWA 4PU8A 3FYMA 3CVYA 2ZXWE 3HHMA 4LRZA 4EBAA 5D0QD 3BD1A 3FMYA 5HI7A 2IVQA 2J9QA 1JCQA 3RK6A 4JEHA 2FEZA 3J5QB 3KAEA 3FU6A 2I1KA 2OV8A 3LQXA 3U66A 2XPIA 2GRNB 4HRAA 2VEOA 4YNDA 4EZLA 3MZLB 1HS6A 4NRHB 3RO2A 3PZ1A 2PM6A 2WXKA 4ACLA 2LLWA 4ER5A 2HFZA 2MEZA 3JUIA 1U3DA 4GTVA 4W9RA 3UT4A 2M63A 3L22A 4K5CA 5CECB 1MFQC 2ZGGA 4DI3A 3DEPA 4OB4A 4UI9C 3LVQE 3ZNGA 3FUKA 2EWTA 2J49A 1SA5A 3V30A 4A3VA 2ETCA 1BPOA 2GRPB 2QYUA 3DWLG 3AG2E 4G2VA 4UI9J 3LY7A 3CIAA 3VLDA 2XGMA 2VSOE 3UINC 3BG0B 4F3VA 4HLLA 3IVPA 1UXDA 4I6GA 3FFLA 4F53A 4JVSA 4DE8A 3LKUA 3UKRG 1TNBA 2HYZA 1K8KG 4CDMA 4DE9A 4D10C 2KXPC 4X4FA 1O5MA 4LNGA 1CQTA 3FUJA 4BX9A 3SCHA 2ODRD 3DM5A 4MBGA 4XI0A 1OCOE 2RG8A 1YCSB 3GBFA 3FYAA 2WXIA 3MLFA 4O60A 1RZSA 4B8CB 3FH7A 1ELKA 5T3RA 4ANUA 4JPSA 3OQNA 3MKQB 5EYLA 2WXNA 1OT8A 1EPUA 1Y8MA 3PH0C 3LPZA 2OOEA 3G2WA 3W9GA 3UUXA 4DPRA 2P2CP 1ZZ7A 3ASOE 5AQ9A 5CCMA 1E8XA 3DXKG 3B7TA 2WUSR 4PU3C 3QAQA 2VQ2A 4U96D 4ILGA 2E2EA 4KBQA 2PUBA 2EILE 5B1BE 4L2YA 4MKTA 3AG3E 5FIOA 4FHJA 1NL4A 3D9OA 3CECA 4TUMA 4FHKA 2YHCA 1R63A 3JXJA 2MRIA 3QWWA 1PNRA 2V5QC 4N3AA 4HOSA 4JB8P 5LP0A 4K5BA 3PREA 4BY6A 2UY1A 3QOWA 4KVOA 2YNQA 2M4HA 4TV3A 5B1AE 1JWLA 4LERA
chains in the Genus database with same CATH topology
5FQ7A 3HIZA 5BW8C 5G04J 3HVEB 4CDNA 1E8WA 3Q47B 3FTYA 4FA6A 1P5QA 5CMWA 4Z5HA 5HQ8A 4WWPA 3EUSA 1POUA 2XGOA 2KCLA 1KT0A 4JHRA 4DJAA 4GPKA 4N39A 2OR1L 4J8FA 4J0UA 3LEWA 4RVBA 2UWJG 2VGXB 4KVMA 4LEUA 4UQXA 2IUOA 4WWOA 1QNFA 2P58C 4GZDA 3S2AA 4J8EA 2OVBA 4DLQA 2AWIA 2MOWA 5EX3A 3FUMA 1E90A 2NSZA 1E7VA 3KD7A 4IRUA 3AS8A 3G2UA 2PQRA 1WIZA 4Q96A 2BNOA 2Y3AA 3FU5A 2R63A 3MJWA 5EKQD 3B13A 3D9MA 3BG1B 4F8DA 4P29A 3ZW3A 1GT0C 4CT0A 4NACA 1H2TC 4M3OA 4U63A 3L13A 1YSEA 3ESKA 1NA0A 3OMTA 2WMOA 4IVZA 1FCHA 1X57A 2YHEA 2CHZA 3CHQA 2L8NA 3R1FA 3D9LA 4UQZA 3VK0A 3JXDL 2J09A 3T5XA 4PDXA 2AXUA 3PXPA 3SCFA 1SQ8A 3D1NI 3FUFA 5K98B 3K9IA 4EBAG 2XGSA 3CSFA 3SBTB 4Z59A 3AS5A 3ZN3A 1WH8A 2WQ6A 2XPYA 3LISA 1INZA 4H7XA 2VGYA 3QOUA 4V3IA 2CFUA 2WXMA 4YARA 3F52A 4UWFA 1QQAA 4I6RA 2XSDC 2PUEA 4HS2A 3QB2A 1WETA 3RKVA 1PERL 2L9BA 4X4BA 4GA0A 2D5VA 3FTZA 3VLEA 4U07A 2PUGA 5JHAA 4F7AA 3ZHIA 4APFA 3QJZA 2FO7A 3S8QA 1H2VC 2X3MA 3RRUA 3LY8A 4L23A 1UJKA 4JXTA 1PC2A 5G55A 5KJNA 2DBAA 2PIJA 4FC8A 4I9CA 1WAO1 1YA0A 3FEXA 3HYMB 3QWPA 4DLOA 3CHPA 2JEKA 1UW4B 1NZNA 4PUCA 5FWQA 4BFRA 4YG7B 3ZEFA 4O6FA 4A1GA 5FZQA 1Z6TA 4Q94A 2PL2A 1IYGA 5C2YA 2LYJA 1RZRD 2LYSA 3Q15A 3RZZA 3I3NA 5CHEE 4GMJA 2BNMA 3TXMA 4I8TA 3CVNA 3OXLA 3PNTB 4EECA 4E6HA 2XRZA 3FH5A 2I6HA 5LOZA 3R7RA 3UT8A 4I6UA 4MLPA 4G26A 5BT1A 2IQCA 4L7TA 3LFPA 4NDWA 2KM4A 2WQHA 4I1AA 3CK8A 2O4AA 5JJ7A 4G23A 2JLBA 3MA5A 3SFZA 1NEQA 1Z3YA 4Z5DA 2I1JA 3C98A 3APFA 2OFYA 1WH6A 1GW6A 1DW9A 3LVRE 2VGXA 4FP7A 4NURA 4OVVA 3OQOA 4FBIA 2VSYA 5EX0A 4MCTA 3FUEA 3S7DA 1Z3XA 2KEJA 1CJGA 2LCVA 2PUCA 2MQKA 1ZAYA 1EDUA 1OWLA 2KC7A 4G1TA 4WWNA 4XKCA 3IBEA 4GQMA 4QFVA 5FQ8A 3AU5A 1ZZ8A 3FUIA 3OXFA 3GZ2A 4GAAA 1OWNA 4GYYA 1PRAA 4O8BA 5AJLA 3OP9A 2AXZA 4AXHA 5J08A 4IYPA 3ZVVA 3TJPA 3B7HA 1LMB3 4KYOB 5T8IA 4ILIA 4IULA 1JH9A 4N3BA 4HOUA 1LF8A 2XQ0A 4HLEA 1HH8A 5FQ4A 4FU3A 2FF4A 2PUFA 4GU5A 4YG4A 4AY5A 2XHEA 3JCKC 3GN5B 2HR2A 1RZRA 4U0ZA 2XIUA 3ML8A 2R59A 1L5JA 4MCXA 1VPWA 2WXFA 4UWKA 4JC8A 4ANVA 3FULA 1RPEL 2JVLA 1HG2A 2CG2A 4FULA 3CVWA 4X4GA 1OWMA 2LYLA 3QNKA 4J1XA 3MCXA 1QPZA 3ZHMA 3ZYKA 4EZKA 4N2QA 4Y6WA 2KCKA 3ZFWA 3FY4A 4X4EA 3PNLB 3CVXA 3L08A 2X6FA 3OTNA 4GMLA 3APDA 1UG3A 1OUVA 1ZVVA 4WUYA 3DNVB 4APOA 4EZJA 4Z58A 4CCAA 3DPDA 3ASDA 4XIFA 4I1MA 2VSNA 3MKQA 3EIJA 3MV2B 5ARFA 3SI5A 5KJMA 1QP0A 3CVQA 2VSXE 3BEEA 5T4YA 4HFGA 4N3CA 3ZPJA 4PS7A 3TAXA 3NZSA 4YBAA 1HFAA 3AS4A 4AM9A 1HZ4A 2XEVA 4HXIA 4WNEA 1QQBA 1FVHA 1B89A 2VYIA 3MV3B 2ZU6B 3SZ7A 4X4IA 2O49A 3QKYA 4L1BA 4H7YA 1TEZA 4XE0A 2V4LA 4HORA 3Q4AB 4NQ0A 3JYSA 4GZCA 1TJFA 2IONA 5BPPA 1H6KA 2X6IA 3ZXSA 3AU4A 3MKRA 5BUZA 2I9CA 3CHSA 2FI7A 4IN3B 3LXUX 4C0MA 3RU0A 3FTXA 3CQCB 5E76A 3APCA 1O4XA 2BF0X 1HX8A 2Y4TA 1PY1A 3B7RL 4I9EA 4ANWA 1AU7A 2IOLA 3FP3A 3O4ZA 4B94A 3U64A 1S0PA 2PUAA 4CT4A 2AW6A 2I2OA 2BJCA 1W3BA 1QZ2A 4GZ3A 1X5BA 2BNNA 1UJJA 1WM5A 2IF4A 3KS2A 2IJGX 3ULQA 3CHOA 1HXIA 4G11A 5LCWC 3FU0A 3L54A 5BV0A 1OWPA 1HO8A 1XNFA 4U04A 4AVXA 1JUQA 1WY6A 1ZU2A 4KT6B 2DIWA 2J08A 2V0PA 3CKBA 3ESLA 4UWLA 4C0EA 3RJVA 2HINA 3ZRHA 2KCVA 3PEVB 4GHJA 1UN9A 2FBNA 3GZSA 2XCJA 2R17C 3I4RB 3MGBA 4LCTA 2EF8A 1DNPA 3UT7A 5LCWJ 2OVFA 5LX8A 3P2BA 5AJDA 4J1WA 4N2SA 3IKOB 2WB2A 3P1UA 1JFSA 3SBSA 5BV1A 3KZ3A 2PQNA 1DVPA 2VTBB 3UQ3A 3TGOA 4DK5A 4BT9A 3CR3A 2IVBA 3D3MA 2LSUA 3S7BA 2WXLA 2WXPA 5M72A 1PRVA 3EHNA 3CHRA 4BT8A 4DI4A 4A55A 4BSXA 2IU1A 4CGWA 3QWGA 5CMYA 3D9IA 2KEIA 4JHJA 4WNFA 3OQMA 4HOQA 4I17A 1RIOA 1Y9QA 1OSLA 4A1SA 3LY9A 5DIZA 1QP7A 3SNXA 3UPVA 2IVGA 2J4DA 2X6JA 3LS8A 3O48A 3QWVA 3I4GA 2VJ8A 1QP4A 3T8MA 1JPLA 3CK7A 5FJYA 5JJ6A 4AV7A 4FN3A 3UX4A 2GRMA 1LCDA 1E96B 3CV0A 3FTUA 4JEUA 2XJ3A 1JWGA 3HVEA 4PH4B 4BTBA 3R9AB 5C1DA 3FEYA 4ME2A 3IV0A 4J6IA 2A4ZA 1ZZ6A 5E75A 3RRMB 1EFAA 2QFCA 2XCCA 4U0SA 2GZUA 3CEQA 1H2UA 3G2VA 1LQCA 3U3WA 4Y42A 2UY1B 2AVPA 1HF0A 2ILRA 1BDHA 5A7DB 4ILHB 4URKA 3RRNB 3GYZA 4GA1A 3QF3A 3FTVA 1Y7YA 3GZ1A 1ELWA 4FLBA 1ADRA 4FJZA 2C0LA 4YG1A 1IHGA 1JWFA 3SD5A 2IFUA 3VLFA 2L0TB 4MS6A 3HDXA 5KJLA 2LNIA 2AUWA 2NXPA 4PU8A 3PRZA 3FYMA 2XI8A 2LSVA 2GGFA 2XRYA 2LAHA 3LCAA 5LFAA 2WXGA 2CHWA 1PRUA 4GA2A 3UMVA 5ANRA 3HHMA 4LRZA 3S7FA 4YVQC 3QDNA 4EBAA 1OWOA 2J07A 4JHKA 5D0QD 3BD1A 3KEZA 3JXBC 2AXVA 3ONKA 3O9XA 3IHVA 2QY7A 3LJ3A 1EYHA 1ZS4A 2GRLA 2X6HA 2KPJA 3U4TA 1ELRA 3CSTA 4E85A 3FMYA 5HI7A 3SCGA 2IVQA 2PM7A 3PE4A 2J9QA 4ACKA 5FQ6A 3F6WA 3EIQC 3SF4A 3RK6A 3WXXA 3CGHA 4JEHA 2VTBA 4YVOA 2FEZA 5J90A 1ZUGA 4IA8A 3KAEA 3FU6A 1H19A 2I1KA 2OV8A 3ONLA 4I6EA 4U0UA 2CFZA 4AJWA 2JCGA 3U66A 4GYWA 2XPIA 4JL0A 2A6CA 4I6JA 3Q49B 4BWRA 4YNDA 3RIBA 3VTXA 2X38A 4B0ZA 4EZLA 2WXRA 5ENNA 3MZLB 1HS6A 4TRQA 3FTSA 3FU3A 4NRHB 3RO2A 4X4CA 3CLJA 2YINA 3BDNA 3B7SA 4GZ5A 2PM6A 2WXKA 4ACLA 3FWVA 4L2LA 5FTPA 2IV1A 3FTWA 1KLXA 4JCXA 3FDHA 1ZPQA 2MEZA 4R7LA 3JUIA 3ZYMA 1U3DA 3G5GA 2WQ7A 4OVUA 4W9RA 4Y6CA 3UT4A 4RSYA 2M63A 3L22A 3FUNA 4GZ6A 1NP7A 5G05C 4GB9A 3UFDA 1LLIA 3B7UX 4GCOA 1SZAA 2J4BA 1SZ9A 4WNDA 4IWRA 3CHMA 4CEMA 2WXQA 1MQSA 4DI3A 1HG5A 2BTDA 2KZ8A 1VDYA 1NA3A 4OB4A 2XCBA 2L49A 3EJNA 3MYVA 4U8HA 3KJXA 1UTXA 1PAQA 3CLCA 1QQEA 4UI9C 4RG9A 5AYWD 2XPZA 1UXCA 4JQDA 3U9WA 3LVQE 1N54A 3CVLA 3FUKA 2EWTA 2J49A 3F51A 5G05J 1ZZCA 2LYRA 1BDIA 4A3VA 1BPOA 1KT1A 1N52A 5ARGA 2C0MA 4G2VA 4TUUA 5A7LA 2KZTB 4UI9J 4HVBA 3FH8A 3LYAA 2RD0A 3QQ6A 4X4DA 3LY7A 2EQXA 3CIAA 4JW1A 4PS8A 4B89A 2ICTA 3VLDA 2XGMA 2PE5A 2CROA 3GN5A 2FULA 2KATA 2C2LA 3L16A 4J8DA 1ZZ9A 4KZCA 2VSOE 1NERA 4XX5A 3TG5A 3JXCL 3ASFA 3BG0B 4F3VA 1E8YA 5JHBA 4PU4C 3D9NA 3IVPA 1MHQA 1UXDA 4I6GA 4RG6A 3CKCA 3PDNA 3FFLA 4GCNA 4F53A 3T5VA 4JVSA 4N5CA 1FVFA 5G2NA 2PPXA 4J8SA 4FLHA 5FZSA 2KEKA 1U3CA 3LKUA 4ABNA 5FT9A 4JCYA 4BTAA 2IOSA 4GYOA 3ZYLA 4PU7A 1H0AA 3N71A 1UN8A 2WXJA 5EDSA 3CVVA 1OCTC 1IQRA 2HYZA 5A23A 3LDZA 1S7EA 3L6AA 3QC1A 4Z5CA 4CDMA 2LO6A 1B0NA 4D10C 2LYPA 4Q69A 5BNWA 1HF8A 4K0RA 4X4FA 3FHEA 3PS6A 4A3TA 4G24A 5AIJA 4ANXA 1JFTA 5DBKA 1CQTA 3FUJA 4BX9A 1ZBPA 3CVYA 3PE3A 3ZHEB 5KCMA 5A6CA 3SCHA 3NF1A 4XZ4A 2CSFA 4XI0A 3E4BA 5ANLA 4OYSA 2LAIA 4CDRA 4B8AA 2A5UA 2RG8A 4K03A 2X6KA 3VTYA 3ZIMA 3GBFA 3FYAA 3SHFA 3PVLA 2HM8A 2WXIA 1IC8A 2HO1A 3MLFA 1RZSA 2WM9A 4B8CB 1E3OC 4UI9K 3FH7A 3CK9A 1ELKA 5T3RA 3L1PA 4ANUA 4JPSA 3OQNA 4KZ0A 3MEKA 3MKQB 5CCLA 3ASGA 4XI9A 3SGHA 1SQMA 2WXOA 5FZRA 4LUNU 2WXNA 2LYQA 4I43A 1EPUA 4AY6A 4C9BB 1Y8MA 3PH0C 3URZA 3IHYA 3ZYQA 2CG3A 3TL5A 4CGVA 3DBSA 3LPZA 2ICPA 2Q7FA 4I1OB 2KZTA 3D9JA 4I2WA 1DWKA 3G7DA 3TRBA 2PUDA 2OOEA 3R7QA 3G2WA 3GW4A 3PEUB 3EHMA 2IU7A 3ASHA 3ML9A 3PUKA 3G2TA 3UUXA 4CRWA 1HE8A 3ZKCA 1ZZ7A 4WNGA 4DPRA 2R5SA 3RO3A 4BX8A 2GW1A 5CCMA 1E8XA 3PZDA 4ATGA 3Q5MA 4XKBA 5AENA 1A17A 1E7UA 3CVPA 2ONDA 3FUHA 3IEGA 2YQ8A 3D9KA 3QARA 2H8RA 3B7TA 1Y6IA 3OAWA 2WUSR 4FJYA 4KMOA 2Y4UA 4PU3C 3QAQA 1IQUA 3MX3A 2VQ2A 5KJKA 4AP2A 4ILGA 4UWGA 3G2SA 2CHXA 2E2EA 4KBQA 4PS3A 2PUBA 2WVIA 2LYKA 3QYXA 4KXKB 2WXHA 1R69A 1HU3A 1XGWA 1EF1C 3OXGA 3QK0A 4JA9A 3I5PA 4L2YA 4F1SA 2DCPA 4MKTA 4I6TA 3TG4A 1TJCA 3S7JA 2R1JL 4FHJA 3CVUA 1XWRA 3ENEA 2HSGA 3D9OA 3ZHEA 2O38A 2L6JA 3CECA 1X2LA 2NC9A 2L0IA 4FHKA 2YHCA 2BUGA 2PZIA 1R63A 5JJTA 4FADA 4AOFA 3BS3A 1E8ZA 2MRIA 4AEZC 2EBYA 2MHKA 3QWWA 5D0OD 1PNRA 3L17A 2WPVA 2E0IA 3JQ1A 3H5TA 3NZUA 2V5FA 4N3AA 2WMNA 4HOSA 4MRUA 4X4HA 3EDTB 4AIFA 3NQPA 3JQ0A 4JZYA 5G04C 5LP0A 3PUJA 4JA7A 3PREA 4BY6A 1L1MA 4I2ZA 2UY1A 1ZZBA 2B5AA 1LCCA 3KXAA 4KVOA 2YNQA 4UQYA 2FJRA 3D9PA 2V8SE 3ZGQA 4TV3A 3CQGB 4EPZA 3FUDA 4G25A 1JWLA 4LERA 3HZIB 4UWHA 3TXNA 4WAFA 4EQFA 2WIUB 4HOTA 3CROL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U3W A;  4MCX A;  4PU7 A;  1VPW A;  4Y42 A;  1HF0 A;  1OCT C;  1BDH A;  1S7E A;  1RPE L;  2JVL A;  4Z5C A;  3QF3 A;  1B0N A;  2LYP A;  1Y7Y A;  4Z5H A;  4X4G A;  2LYL A;  4X4F A;  4J1X A;  1ADR A;  1QPZ A;  3EUS A;  1POU A;  4YG1 A;  3ZHM A;  1JFT A;  1CQT A;  2OR1 L;  4X4E A;  2AUW A;  2IUO A;  3SCH A;  4PU8 A;  3FYM A;  2XI8 A;  1ZVV A;  2CSF A;  3DNV B;  2AWI A;  4Z58 A;  1PRU A;  1WIZ A;  1QP0 A;  3BD1 A;  3JXB C;  2AXV A;  2BNO A;  3GBF A;  3O9X A;  2R63 A;  3FYA A;  1ZS4 A;  2GRL A;  4F8D A;  2KPJ A;  1IC8 A;  4YBA A;  3MLF A;  3FMY A;  1RZS A;  3SCG A;  2IVQ A;  1GT0 C;  1E3O C;  1QQB A;  1YSE A;  3F6W A;  3L1P A;  3OQN A;  3OMT A;  4X4I A;  2O49 A;  4IVZ A;  1X57 A;  1ZUG A;  4IA8 A;  2L8N A;  3R1F A;  3VK0 A;  3JXD L;  2LYQ A;  2AXU A;  3PXP A;  3SCF A;  1SQ8 A;  3D1N I;  5K98 B;  2JCG A;  4Z59 A;  2A6C A;  1O4X A;  1WH8 A;  3LIS A;  1AU7 A;  2ICP A;  1DWK A;  3G7D A;  2PUA A;  3TRB A;  2PUD A;  2AW6 A;  4YAR A;  3F52 A;  2BJC A;  1QQA A;  4I6R A;  2XSD C;  2BNN A;  2IU7 A;  4X4C A;  2PUE A;  3BDN A;  1WET A;  3ZKC A;  1ZZ7 A;  1PER L;  4X4B A;  2D5V A;  2PUG A;  2IV1 A;  3ZHI A;  3S8Q A;  4JCX A;  2HIN A;  2PIJ A;  1ZPQ A;  2MEZ A;  3G5G A;  4GHJ A;  2H8R A;  2XCJ A;  4YG7 B;  2WUS R;  4PU3 C;  2EF8 A;  3UFD A;  1LLI A;  2LYJ A;  1RZR D;  2LYS A;  3RZZ A;  4J1W A;  2BNM A;  1JFS A;  4IWR A;  4I8T A;  2PUB A;  2KZ8 A;  2LYK A;  3KZ3 A;  4OB4 A;  3QYX A;  2L49 A;  4I6U A;  1R69 A;  3KJX A;  1UTX A;  3CLC A;  3LFP A;  4NDW A;  1UXC A;  2IVB A;  4JQD A;  4I6T A;  2O4A A;  2EWT A;  2R1J L;  3F51 A;  1PRV A;  1XWR A;  1NEQ A;  1ZZC A;  4Z5D A;  2HSG A;  2LYR A;  1BDI A;  2OFY A;  1WH6 A;  1DW9 A;  2O38 A;  3QWG A;  3OQO A;  4FBI A;  4MCT A;  3CEC A;  1X2L A;  2KEI A;  3OQM A;  2KEJ A;  2LCV A;  1CJG A;  2MQK A;  1ZAY A;  5A7L A;  2PUC A;  1R63 A;  1RIO A;  1Y9Q A;  1OSL A;  4GQM A;  3BS3 A;  1QP7 A;  1ZZ8 A;  3QQ6 A;  4X4D A;  2EBY A;  2IVG A;  1PRA A;  4O8B A;  1PNR A;  2ICT A;  2AXZ A;  3OP9 A;  3H5T A;  2PE5 A;  1QP4 A;  2CRO A;  3GN5 A;  3B7H A;  1LMB 3;  1ZZ9 A;  4X4H A;  1NER A;  4FN3 A;  3JXC L;  1JH9 A;  2GRM A;  1LCD A;  2XJ3 A;  4PU4 C;  1L1M A;  1ZZB A;  2B5A A;  3IVP A;  1UXD A;  3KXA A;  1LCC A;  2PUF A;  2FJR A;  4YG4 A;  1ZZ6 A;  2PPX A;  3GN5 B;  1EFA A;  1RZR A;  2KEK A;  1JWL A;  2GZU A;  3HZI B;  2XIU A;  2WIU B;  4JCY A;  3CRO L;  1LQC A; 
#chains in the Genus database with same CATH topology
 1TNZ A;  2ETA A;  5JMN D;  5HQ8 A;  4WWP A;  1MX6 A;  1POU A;  4JHR A;  4DJA A;  4GPK A;  3S2A A;  4J8E A;  2OVB A;  4DLQ A;  2AWI A;  2MOW A;  3FUM A;  1E90 A;  1E7V A;  2Y0B G;  3KD7 A;  1WIZ A;  1H6O A;  2R63 A;  4O1P A;  3EHR A;  3BG1 B;  4F8D A;  2HE0 A;  4CT0 A;  4NAC A;  1QBQ A;  4M3O A;  4U63 A;  1YSE A;  1NA0 A;  4IVZ A;  2YHE A;  2L8N A;  3JXD L;  4PDX A;  3K9I A;  2DVW A;  3SBT B;  1BI8 B;  4Z59 A;  4F6R D;  2WQ6 A;  3TWS A;  4DUI A;  3HG0 D;  4I6R A;  3TWX A;  2L9B A;  1WG0 A;  1TR4 A;  1U2Z A;  2X3M A;  1KZP A;  4LG6 A;  2DBA A;  4FC8 A;  5AQA A;  4PUC A;  5FWQ A;  4YG7 B;  3ZEF A;  4Q94 A;  3TWV A;  5C2Y A;  1RZR D;  3Q15 A;  4E6H A;  2XRZ A;  4MLP A;  5BT1 A;  2IQC A;  2KM4 A;  1MX4 A;  3CK8 A;  2O4A A;  5JJ7 A;  1HQ1 A;  2JLB A;  2I1J A;  1Z3Y A;  2H6F A;  4FP7 A;  2VSY A;  1Z3X A;  2KC7 A;  3EU5 A;  4IYP A;  4WWN A;  1ZAY A;  4G1T A;  3ZXS A;  3E34 A;  2NYJ A;  3FUI A;  1ZZ8 A;  1MJ0 A;  3SFX A;  4GYY A;  2AXZ A;  3B7H A;  4ILI A;  4IUL A;  1JH9 A;  4N3B A;  2XQ0 A;  2B0O E;  5FQ4 A;  1RW2 A;  5ENQ D;  4GTS A;  4AY5 A;  2XXP A;  4U0Z A;  4M7C A;  2R59 A;  4ANV A;  3DSS A;  3FUL A;  1RPE L;  2CG2 A;  3Q79 A;  4X4G A;  2LYL A;  1A5E A;  3NRO A;  3PNL B;  2X6F A;  3OTN A;  3APD A;  4LSZ E;  2B6C A;  4XIF A;  2RFM A;  3EIJ A;  3SI5 A;  2LNM A;  5KJM A;  1QP0 A;  2VSX E;  3DSU A;  1Q2Z A;  4N3C A;  3ZPJ A;  1OCR E;  4AM9 A;  3SZ7 A;  4F1P A;  3JYS A;  4YDE A;  2XEE A;  1TJF A;  2FI7 A;  3RU0 A;  5E76 A;  1N0R A;  3W9F A;  1N0Q A;  1HX8 A;  4C48 B;  4GMR A;  4B94 A;  2IOL A;  1O1T A;  3U64 A;  2AW6 A;  3JUE A;  1QZ2 A;  4GZ3 A;  1X5B A;  2BNN A;  3ULQ A;  3KS2 A;  2IJG X;  2GRR B;  1OWP A;  3T8K A;  3CKB A;  3RJV A;  3PEV B;  1UN9 A;  2FBN A;  3NOG D;  4EZI A;  2OVF A;  3P2B A;  3KSQ A;  3HXF A;  5AJD A;  4BES A;  5BV1 A;  1BI7 B;  3GZC A;  3D3M A;  4UUC A;  4HNA D;  3S7B A;  1AP7 A;  4JHJ A;  5CER B;  3UPV A;  2IVG A;  3QWV A;  2X6J A;  2VJ8 A;  2DWZ A;  5JJ6 A;  4AV7 A;  4GPM A;  2KBX A;  4ME2 A;  3GZD A;  1ZZ6 A;  1JCR A;  3RRM B;  4U0S A;  3G2V A;  3UM3 A;  1TNU A;  3U3W A;  5A7D B;  4DX2 A;  3RRN B;  1Y7Y A;  1ELW A;  3UWP A;  1ADR A;  3VLF A;  1TNY A;  3C3R A;  4A63 B;  2LSV A;  2GGF A;  2XRY A;  2LAH A;  2WXG A;  4GA2 A;  3UXG A;  5ANR A;  3S7F A;  2V4H C;  3R09 A;  3JXB C;  3KEZ A;  2QY7 A;  1ZS4 A;  2GRL A;  1ELR A;  3CST A;  5IY5 E;  2PM7 A;  3PE4 A;  3SF4 A;  3WXX A;  3CGH A;  2VTB A;  5J90 A;  1ZUG A;  4IA8 A;  3ONL A;  4GYW A;  4JL0 A;  2A6C A;  4BWR A;  4HI9 A;  3VTX A;  3FTS A;  3FU3 A;  2XS8 A;  3RAU A;  2F0Y A;  2IV1 A;  3DRA A;  3UM2 A;  1KLX A;  3UIO C;  3ZYM A;  4GTO A;  4R7L A;  5EN5 D;  2WQ7 A;  4Y6C A;  4RSY A;  3FUN A;  4GZ6 A;  3TWT A;  3UFD A;  3B7U X;  2BED A;  5CRU A;  2BTD A;  3MYV A;  1NA3 A;  3Q9U C;  1UTX A;  5AYW D;  1N4S A;  1N54 A;  1WDY A;  3F51 A;  1BDI A;  1N52 A;  2QYJ A;  4HVB A;  3LYA A;  4EKI A;  3QQ6 A;  4JW1 A;  4B89 A;  2PE5 A;  3GN5 A;  3L16 A;  1ZZ9 A;  1FT2 A;  3ASF A;  2PXV A;  3B7B A;  1K1B A;  5EYP F;  2GRO B;  4DX6 D;  1FVF A;  4TXQ A;  5D2M C;  4FLH A;  1N4R A;  4ABN A;  4U8V D;  5DRY A;  4BTA A;  3ZYL A;  3L6A A;  3QC1 A;  3V2O A;  4Z5C A;  1B0N A;  4CZ2 D;  3FHE A;  5ENP D;  4A3T A;  4ANX A;  5DBK A;  3DST A;  3PE3 A;  3TFL A;  2DZN A;  2CSF A;  4XZ4 A;  4OYS A;  2LAI A;  3VTY A;  1KZO A;  1LTX A;  2HM8 A;  3BUA A;  3WG7 E;  3ABM E;  3NOC D;  1TN6 A;  2HCN A;  3ULE G;  3UM1 A;  4XI9 A;  1D8E A;  3T9K A;  4I43 A;  4AY6 A;  4C9B B;  2CG3 A;  2EIM E;  2Q7F A;  3D9J A;  4I2W A;  1DWK A;  3G7D A;  3TRB A;  3EHM A;  3ASH A;  3ML9 A;  3PUK A;  3G2T A;  2PXQ A;  4CRW A;  1HE8 A;  2R5S A;  3Q5M A;  4XKB A;  3QAR A;  3OAW A;  4FJY A;  2EIN E;  1DCQ A;  2P9I G;  4UWG A;  3G2S A;  2WVI A;  3BQO A;  2FO1 E;  1R69 A;  1HU3 A;  3QK0 A;  1QYM A;  3I5P A;  4F1S A;  2DCP A;  3TG4 A;  3CVU A;  1XWR A;  2HSG A;  3L82 A;  2O38 A;  2NC9 A;  1X2L A;  2L0I A;  2BUG A;  3BS3 A;  1SW6 A;  1N94 A;  3TWU A;  2EBY A;  3L17 A;  3JXI A;  2OCC E;  2BKG A;  2WMN A;  4MRU A;  3EDT B;  5G04 C;  1L1M A;  1LCC A;  3D9P A;  3ZGQ A;  4EPZ A;  1D8D A;  4HOT A;  4EQF A;  2WIU B;  2EIJ E;  3ZFW A;  5FQ7 A;  5G04 J;  3HVE B;  1DCE A;  5CMW A;  2PXK A;  4Z5H A;  3AJI A;  3EUS A;  2KCL A;  2IY0 C;  4J8F A;  3R7R A;  4J0U A;  4KVM A;  2VGX B;  2YBD A;  4GZD A;  3J5P A;  5EX3 A;  2NSZ A;  2H6I A;  3G2U A;  4Q96 A;  2BNO A;  3FU5 A;  3B13 A;  3D9M A;  4P29 A;  1H2T C;  3ESK A;  1FCH A;  3IXE A;  2CHZ A;  3CHQ A;  3D9L A;  4UQZ A;  3ZUV B;  3VK0 A;  3T5X A;  3D1N I;  3FUF A;  5K98 B;  4GTM A;  3D9H A;  3BU8 A;  1WH8 A;  3LIS A;  1DUL A;  1N9A A;  5JA4 D;  4YAR A;  2PUE A;  2XSD C;  4HI8 A;  1SVX A;  3QB2 A;  5DT2 A;  1PER L;  4GA0 A;  4X4B A;  4F7A A;  4APF A;  3QJZ A;  3S8Q A;  3RRU A;  3LY8 A;  5G55 A;  1O1R A;  5H7P A;  3AG4 E;  3CHP A;  2JEK A;  1NZN A;  3AG1 E;  4A1G A;  1ZB1 A;  3TWW A;  2P9N G;  3NAW A;  1IYG A;  4TXR A;  5CHE E;  3I3N A;  2BNM A;  3DXM G;  3OXL A;  4EEC A;  4L7T A;  3LFP A;  4NDW A;  5HKP A;  4G23 A;  3SFZ A;  3C98 A;  4ACK A;  3APF A;  1GW6 A;  4OVV A;  1DW9 A;  3S7D A;  3OQO A;  4FBI A;  5EX0 A;  2PUC A;  5FT9 A;  2MQK A;  4XKC A;  1IKN D;  4J7W A;  3AU5 A;  5AJL A;  1PRA A;  1DC2 A;  5J08 A;  2QC9 A;  4J8Y A;  4LNU D;  1OCC E;  4GU5 A;  1FPP A;  2XHE A;  5ENS D;  5FIN A;  5DTM A;  1L5J A;  4MCX A;  1VPW A;  2WXF A;  4B93 B;  2PXE A;  1OWM A;  3MCX A;  2LXL A;  3CVX A;  1UG3 A;  3DNV B;  4Z58 A;  4CCA A;  3ASD A;  4LNB A;  4I1M A;  2VSN A;  1HFA A;  3SR4 A;  1B89 A;  2VYI A;  2PXB A;  4L1B A;  4H7Y A;  1TEZ A;  4XE0 A;  5BPP A;  1H6K A;  2X6I A;  3AU4 A;  3SY2 A;  2I9C A;  3CHS A;  4IN3 B;  3FTX A;  4ZHB A;  2XEH A;  3FP3 A;  2LUH A;  2PUA A;  5DTQ A;  4AJW A;  1WM5 A;  2IF4 A;  3CHO A;  4G11 A;  1HO8 A;  4U04 A;  2J08 A;  1TYQ G;  2HCS A;  3EUV A;  3ZRH A;  5BXU A;  2XCJ A;  2EF8 A;  3UT7 A;  5LX8 A;  4U95 D;  4N2S A;  1JCS A;  3P1U A;  3SBS A;  3KZ3 A;  2MYO A;  3TGO A;  4DX1 A;  2LSU A;  5M72 A;  3X2Q E;  3CHR A;  4BT8 A;  2IU1 A;  3QWG A;  3D9I A;  2KEI A;  4WNF A;  4G8K A;  4HOQ A;  4I17 A;  1Y9Q A;  1QP7 A;  2XXQ A;  3LS8 A;  1QP4 A;  3T8M A;  3FTU A;  1LCD A;  3CV0 A;  1JWG A;  4BTB A;  4PH4 B;  4ER3 A;  5DSX A;  1EFA A;  3CEQ A;  1LQC A;  2UY1 B;  2ILR A;  4ILH B;  1D9S A;  3ZPX A;  4FLB A;  2C0L A;  2IFU A;  2L0T B;  2NXP A;  3ISM C;  3PRZ A;  2XI8 A;  3LCA A;  2CHW A;  3UMV A;  4YVQ C;  3QDN A;  1OWO A;  4JHK A;  2OEW A;  3O9X A;  3IHV A;  2KPJ A;  1BD8 A;  5FQ6 A;  3F6W A;  4YVO A;  5AAO A;  3EU9 A;  3UTM A;  5ENT D;  4I6E A;  4GTR A;  4I6J A;  2XEN A;  4Z68 A;  3RIB A;  2X38 A;  2PXF A;  4TRQ A;  1UOH A;  2J8S D;  3BDN A;  4GZ5 A;  3FWV A;  5FTP A;  3FDH A;  1ZPQ A;  4OVU A;  5G05 C;  1LLI A;  4GCO A;  1SZA A;  1SZ9 A;  4IWR A;  3CHM A;  5D66 A;  4CEM A;  2WXQ A;  1MQS A;  1YYH A;  1HG5 A;  4RQI A;  3T5V A;  5JUW A;  4U8H A;  3UIP C;  1QQE A;  1RZ4 A;  3A9X A;  1MZC A;  4U8Y D;  2XPZ A;  1UXC A;  3CVL A;  5G05 J;  2LYR A;  4TUU A;  5A7L A;  2KZT B;  2PNN A;  2RD0 A;  4X4D A;  4PS8 A;  2ICT A;  2P9P G;  2KAT A;  5BV0 A;  2FUL A;  4ER6 A;  2C2L A;  3TG5 A;  4XX5 A;  1NER A;  3JXC L;  5DTR A;  3E30 A;  3F6Q A;  2XXA A;  1E8Y A;  2ZGD A;  1MHQ A;  2EIK E;  3CKC A;  3PDN A;  4OAV B;  5G2N A;  2PPX A;  4J8S A;  4JCY A;  4GYO A;  4PU7 A;  1AWC B;  3N71 A;  1UN8 A;  2WXJ A;  5EDS A;  1OCT C;  1IQR A;  5A23 A;  3LDZ A;  2F8X K;  4Q69 A;  2LYP A;  5BNW A;  3PS6 A;  2H6H A;  1ZBP A;  3ZHE B;  5KCM A;  5A6C A;  4L9P A;  3E4B A;  5ANL A;  4EK9 A;  4B8A A;  2A5U A;  2X6K A;  2AJA A;  3SHF A;  3PVL A;  2HO1 A;  4UI9 K;  3SX0 A;  3RSE G;  4KZ0 A;  3OWQ A;  3ASG A;  4YDO A;  3SGH A;  4LUN U;  5AN8 A;  3GUU A;  4HRL A;  4CGV A;  3TL5 A;  3DBS A;  4I1O B;  3NBN B;  5HS0 A;  3R7Q A;  3GW4 A;  2IU7 A;  3RO3 A;  4GTT A;  4ATG A;  5AEN A;  1E7U A;  4OAU C;  2OND A;  3FUH A;  3TEP A;  3D9K A;  1Y6I A;  3MX3 A;  5KJK A;  4PS3 A;  2CHX A;  4BEP A;  2LYK A;  4KXK B;  1XGW A;  2PXP A;  3OXG A;  5KNH D;  4I6T A;  3S7J A;  2P9S G;  3TWQ A;  2L6J A;  1MX2 A;  2PZI A;  3ZU7 B;  4ATZ D;  4AEZ C;  3NB2 A;  5D0O D;  3NZU A;  4AIF A;  3JQ0 A;  3R9M A;  4I2Z A;  2B5A A;  3KXA A;  1QZX A;  5GAH i;  2FJR A;  2V8S E;  3CQG B;  5BXO A;  3GZD C;  3TXN A;  4UWH A;  1PAQ A;  4DRX E;  3CRO L;  3HIZ A;  5BW8 C;  2XGO A;  4ZFH A;  4N39 A;  4RVB A;  2VGE A;  4WWO A;  2P58 C;  1X81 A;  2R05 A;  4DX5 D;  5KWD A;  5ENO D;  2XZD G;  2RKK A;  2QZA A;  2P9K G;  3OMT A;  3R1F A;  2J09 A;  3ABK E;  2AXU A;  1SQ8 A;  2XGS A;  3CSF A;  3ULY A;  2Y69 E;  1INZ A;  2XPY A;  3QOU A;  2WXM A;  3F52 A;  2XS1 A;  3OKZ A;  1WET A;  3RKV A;  5JHA A;  3FTZ A;  4U07 A;  2PUG A;  3PZ4 A;  1H2V C;  4L23 A;  1UJK A;  5ITZ F;  4G8L A;  1NW3 A;  3QWP A;  1TN7 A;  1UW4 B;  4XEI G;  2PXT A;  5CRV A;  2LYS A;  3TXM A;  3CVN A;  3PNT B;  2I6H A;  4G26 A;  4I1A A;  3LVR E;  2VGX A;  5AAR A;  4MCT A;  3FUE A;  4KMO A;  2KEJ A;  1EDU A;  4GTP A;  3IBE A;  5FQ8 A;  3OXF A;  3PZ2 A;  3GZ2 A;  1OWN A;  4O8B A;  2ZIS A;  2GRQ B;  2JQE A;  3TJP A;  4KYO B;  3QFI A;  1SA4 A;  1K1A A;  4HOU A;  4HLE A;  4FU3 A;  2FF4 A;  3ZXP A;  2PUF A;  2L1P A;  3GN5 B;  1RZR A;  3DEO A;  2ZIR A;  4UWK A;  3A9Y A;  4J1X A;  1QPZ A;  3ZYK A;  4EZK A;  4N2Q A;  2KCK A;  2PXD A;  4GML A;  1ZVV A;  4WUY A;  3DPD A;  4BER A;  3MKQ A;  5ARF A;  2XZT G;  3CVQ A;  3BEE A;  5T4Y A;  3PZ3 A;  4PS7 A;  3NZS A;  3AS4 A;  3NXH A;  2XEV A;  4WNE A;  1QQB A;  1FVH A;  1OCZ E;  3MV3 B;  2O49 A;  3QKY A;  4HOR A;  4NQ0 A;  3DSX A;  4HQD A;  2FFH A;  4C0M A;  2H6G A;  3CQC B;  3APC A;  3DSW A;  1O4X A;  3B7R L;  4OBM A;  4ANW A;  1AU7 A;  3UKU G;  4CT4 A;  2I2O A;  2BJC A;  1UJJ A;  2DZO A;  5KNG A;  5LCW C;  3FU0 A;  1XNF A;  4AVX A;  1JUQ A;  1WY6 A;  1ZU2 A;  4KT6 B;  3ESL A;  4UWL A;  4C0E A;  2HIN A;  2KCV A;  3GZS A;  3Q75 A;  2R17 C;  3MGB A;  4LCT A;  4EQZ A;  1DNP A;  5LCW J;  2P9U G;  1DVP A;  4DK5 A;  2WXL A;  3EHN A;  4DI4 A;  4BSX A;  1TN8 A;  5CMY A;  3OQM A;  3NDB B;  3Q73 A;  1G3N B;  1OSL A;  4N5Q A;  4A1S A;  5DIZ A;  3Q9N C;  3ASN E;  3I4G A;  2LXM A;  1S64 A;  3CK7 A;  3UX4 A;  1E96 B;  3V31 A;  4JEU A;  3R9A B;  3IV0 A;  2QFC A;  4O1O A;  2IO3 C;  1H2U A;  1U2V G;  4BSZ B;  1HF0 A;  1BDH A;  4URK A;  4GA1 A;  3QF3 A;  2DYS E;  3GZ1 A;  1OY3 D;  2J7U A;  3DPY A;  4YG1 A;  3SD5 A;  4CYM D;  5LFA A;  1PRU A;  1V54 E;  2J07 A;  2PXL A;  4HB5 A;  2AXV A;  3ONK A;  3LJ3 A;  1EYH A;  2X6H A;  3U4T A;  4E85 A;  3SCG A;  3EIQ C;  1H6P A;  5CED B;  1H19 A;  2V3C C;  4U0U A;  2CFZ A;  2JCG A;  3KSL A;  1N4Q A;  3Q49 B;  2WXR A;  5ENN A;  4X4C A;  2A5E A;  3CLJ A;  2YIN A;  3B7S A;  4L2L A;  1LD8 A;  3FTW A;  1BU9 A;  4JCX A;  3G5G A;  5KBA A;  2J7W A;  1NP7 A;  3E33 A;  4GB9 A;  2J4B A;  3DSV A;  4QQI A;  4WND A;  2KZ8 A;  1VDY A;  3EJN A;  2XCB A;  2L49 A;  3KJX A;  3CLC A;  4RG9 A;  4JQD A;  3U9W A;  1ZZC A;  4YDY A;  4EHM A;  2Y1L E;  1KT1 A;  5ARG A;  2C0M A;  3FH8 A;  5AQB A;  2EQX A;  2CRO A;  4J8D A;  4KZC A;  2R2L A;  5JHB A;  4PU4 C;  3E37 A;  3D9N A;  4RG6 A;  4GCN A;  4N5C A;  1IXV A;  5FZS A;  2KEK A;  1U3C A;  2F8Y A;  2R02 A;  2IOS A;  1H0A A;  1MYO A;  3CVV A;  1N95 A;  1S7E A;  4BET A;  2LO6 A;  1HF8 A;  4K0R A;  4G24 A;  5AIJ A;  1YMP A;  1JFT A;  5EIB E;  3NF1 A;  4CDR A;  1OXJ A;  3Q7A A;  4K03 A;  3TWR A;  3KEA A;  3B95 A;  3ZIM A;  3Q78 A;  1IC8 A;  1IHB A;  1LD7 A;  1FT1 A;  2WM9 A;  1E3O C;  3CK9 A;  3L1P A;  5CCL A;  3MEK A;  5CBN A;  3KL4 A;  2L6B A;  2MXD A;  1SQM A;  2WXO A;  3AAA C;  5FZR A;  2LYQ A;  3URZ A;  3IHY A;  3ZYQ A;  2ICP A;  2KZT A;  2PUD A;  3PEU B;  4HRN A;  3HRA A;  3ZKC A;  4WNG A;  4BX8 A;  2GW1 A;  1A17 A;  3CVP A;  3PE5 A;  3IEG A;  2YQ8 A;  2H8R A;  2Y4U A;  1IQU A;  1S63 A;  4AP2 A;  3QYX A;  2WXH A;  3C72 A;  4JA9 A;  1EF1 C;  1TJC A;  2R1J L;  3V2X A;  2DYR E;  2JAB A;  3V79 K;  3ENE A;  3ZHE A;  5EIL A;  5JJT A;  5GAG i;  4FAD A;  4HRM B;  4AOF A;  1E8Z A;  2MHK A;  2WPV A;  2E0I A;  3JQ1 A;  3H5T A;  2V5F A;  3LJN A;  1K3Z D;  4X4H A;  3NQP A;  4JZY A;  3PUJ A;  4JA7 A;  4U7E B;  3Q7F A;  1ZZB A;  3G0T A;  4UQY A;  3C3O A;  3FUD A;  4G25 A;  3HZI B;  4WAF A;  4CDN A;  1E8W A;  3Q47 B;  3ME5 A;  3FTY A;  4FA6 A;  1P5Q A;  2OEV A;  1NFI E;  3C3Q A;  1KT0 A;  4B0Z A;  2OR1 L;  3LEW A;  2UWJ G;  4UQX A;  4LEU A;  2IUO A;  1QNF A;  3HXE A;  3L9T A;  4IRU A;  1BLX B;  3AS8 A;  2PQR A;  2P9L G;  2Y3A A;  5EKQ D;  3MJW A;  3A9Z A;  5HRY A;  1KPS B;  2LLV A;  3ZW3 A;  1GT0 C;  3C5R A;  3L13 A;  2PXU A;  2WMO A;  1X57 A;  4ER7 A;  3PXP A;  3SCF A;  4EBA G;  3QOX A;  3AS5 A;  3EHQ A;  3ZN3 A;  4H7X A;  2VGY A;  4K5A B;  4V3I A;  2CFU A;  2BKK B;  4UWF A;  1QQA A;  4HS2 A;  4GTQ A;  2D5V A;  3VLE A;  4DX7 D;  4YDW A;  3ZHI A;  2FO7 A;  4WVL A;  1O1S A;  1N4P A;  4JXT A;  1PC2 A;  5KJN A;  4DLO A;  2PIJ A;  4I9C A;  1WAO 1;  1YA0 A;  3FEX A;  3HYM B;  3TEL A;  4BFR A;  4O6F A;  5FZQ A;  1Z6T A;  4ER0 A;  2PL2 A;  2LYJ A;  1Z5S C;  3RZZ A;  1N11 A;  4I8T A;  3FH5 A;  5LOZ A;  3UT8 A;  4I6U A;  3HXD A;  2WQH A;  3MA5 A;  1NEQ A;  3PZD A;  4Z5D A;  5AQ7 A;  4NUR A;  5EID A;  2OFY A;  1WH6 A;  5DRT A;  2WXP A;  4GMJ A;  1CJG A;  2LCV A;  1OWL A;  4NIK A;  4GQM A;  4QFV A;  4GAA A;  3NZL A;  3OP9 A;  4AXH A;  3ZVV A;  1LMB 3;  5T8I A;  2IEJ A;  1LF8 A;  1HH8 A;  3ABL E;  4YG4 A;  3JCK C;  2ETB A;  2HR2 A;  2XIU A;  3ML8 A;  4JC8 A;  1HG2 A;  2JVL A;  4FUL A;  3CVW A;  3QNK A;  3ZHM A;  4Y6W A;  3FY4 A;  4X4E A;  3L08 A;  1TNO A;  1OUV A;  4APO A;  4HBD A;  4EZJ A;  1NI1 A;  3MV2 B;  4HFG A;  3TAX A;  1S70 B;  4YBA A;  3SFY A;  1HZ4 A;  4HXI A;  2ZU6 B;  4X4I A;  3SQV A;  2V4L A;  3Q4A B;  4GZC A;  2ION A;  2R03 A;  3ZKJ A;  5BUZ A;  3MKR A;  3LXU X;  2BF0 X;  2Y4T A;  4I9E A;  1PY1 A;  3VWS A;  3O4Z A;  1S0P A;  1W3B A;  5ENR D;  1HXI A;  3L54 A;  4RLY A;  2DIW A;  2V0P A;  3HXC A;  4GHJ A;  4EKG A;  3I4R B;  3UI2 A;  4J1W A;  3IKO B;  3HXB A;  2WB2 A;  1JFS A;  1V55 E;  2PQN A;  5CEA A;  2VTB B;  3UQ3 A;  3E32 A;  4BT9 A;  4Q2J A;  2IVB A;  3CR3 A;  4X8Q A;  1PRV A;  2F37 A;  4A55 A;  4JD2 G;  4CGW A;  2RFA A;  1RIO A;  3MEJ A;  3LY9 A;  3SNX A;  2J4D A;  3SO8 A;  3O48 A;  3M9L A;  1QB2 A;  1JPL A;  5FJY A;  2IO2 C;  4FN3 A;  2GRM A;  2XJ3 A;  4TXP A;  3HVE A;  5C1D A;  3FEY A;  4J6I A;  5CBO A;  2A4Z A;  5E75 A;  2XCC A;  2GZU A;  5B3S E;  4Y42 A;  2AVP A;  3GYZ A;  3FTV A;  3UM0 A;  4FJZ A;  1IHG A;  1JWF A;  4MS6 A;  3HDX A;  5KJL A;  2LNI A;  2AUW A;  4PU8 A;  3FYM A;  3CVY A;  2ZXW E;  3HHM A;  4LRZ A;  4EBA A;  5D0Q D;  3BD1 A;  3FMY A;  5HI7 A;  2IVQ A;  2J9Q A;  1JCQ A;  3RK6 A;  4JEH A;  2FEZ A;  3J5Q B;  3KAE A;  3FU6 A;  2I1K A;  2OV8 A;  3LQX A;  3U66 A;  2XPI A;  2GRN B;  4HRA A;  2VEO A;  4YND A;  4EZL A;  3MZL B;  1HS6 A;  4NRH B;  3RO2 A;  3PZ1 A;  2PM6 A;  2WXK A;  4ACL A;  2LLW A;  4ER5 A;  2HFZ A;  2MEZ A;  3JUI A;  1U3D A;  4GTV A;  4W9R A;  3UT4 A;  2M63 A;  3L22 A;  4K5C A;  5CEC B;  1MFQ C;  2ZGG A;  4DI3 A;  3DEP A;  4OB4 A;  4UI9 C;  3LVQ E;  3ZNG A;  3FUK A;  2EWT A;  2J49 A;  1SA5 A;  3V30 A;  4A3V A;  2ETC A;  1BPO A;  2GRP B;  2QYU A;  3DWL G;  3AG2 E;  4G2V A;  4UI9 J;  3LY7 A;  3CIA A;  3VLD A;  2XGM A;  2VSO E;  3UIN C;  3BG0 B;  4F3V A;  4HLL A;  3IVP A;  1UXD A;  4I6G A;  3FFL A;  4F53 A;  4JVS A;  4DE8 A;  3LKU A;  3UKR G;  1TNB A;  2HYZ A;  1K8K G;  4CDM A;  4DE9 A;  4D10 C;  2KXP C;  4X4F A;  1O5M A;  4LNG A;  1CQT A;  3FUJ A;  4BX9 A;  3SCH A;  2ODR D;  3DM5 A;  4MBG A;  4XI0 A;  1OCO E;  2RG8 A;  1YCS B;  3GBF A;  3FYA A;  2WXI A;  3MLF A;  4O60 A;  1RZS A;  4B8C B;  3FH7 A;  1ELK A;  5T3R A;  4ANU A;  4JPS A;  3OQN A;  3MKQ B;  5EYL A;  2WXN A;  1OT8 A;  1EPU A;  1Y8M A;  3PH0 C;  3LPZ A;  2OOE A;  3G2W A;  3W9G A;  3UUX A;  4DPR A;  2P2C P;  1ZZ7 A;  3ASO E;  5AQ9 A;  5CCM A;  1E8X A;  3DXK G;  3B7T A;  2WUS R;  4PU3 C;  3QAQ A;  2VQ2 A;  4U96 D;  4ILG A;  2E2E A;  4KBQ A;  2PUB A;  2EIL E;  5B1B E;  4L2Y A;  4MKT A;  3AG3 E;  5FIO A;  4FHJ A;  1NL4 A;  3D9O A;  3CEC A;  4TUM A;  4FHK A;  2YHC A;  1R63 A;  3JXJ A;  2MRI A;  3QWW A;  1PNR A;  2V5Q C;  4N3A A;  4HOS A;  4JB8 P;  5LP0 A;  4K5B A;  3PRE A;  4BY6 A;  2UY1 A;  3QOW A;  4KVO A;  2YNQ A;  2M4H A;  4TV3 A;  5B1A E;  1JWL A;  4LER A; 
#chains in the Genus database with same CATH homology
 5FQ7 A;  3HIZ A;  5BW8 C;  5G04 J;  3HVE B;  4CDN A;  1E8W A;  3Q47 B;  3FTY A;  4FA6 A;  1P5Q A;  5CMW A;  4Z5H A;  5HQ8 A;  4WWP A;  3EUS A;  1POU A;  2XGO A;  2KCL A;  1KT0 A;  4JHR A;  4DJA A;  4GPK A;  4N39 A;  2OR1 L;  4J8F A;  4J0U A;  3LEW A;  4RVB A;  2UWJ G;  2VGX B;  4KVM A;  4LEU A;  4UQX A;  2IUO A;  4WWO A;  1QNF A;  2P58 C;  4GZD A;  3S2A A;  4J8E A;  2OVB A;  4DLQ A;  2AWI A;  2MOW A;  5EX3 A;  3FUM A;  1E90 A;  2NSZ A;  1E7V A;  3KD7 A;  4IRU A;  3AS8 A;  3G2U A;  2PQR A;  1WIZ A;  4Q96 A;  2BNO A;  2Y3A A;  3FU5 A;  2R63 A;  3MJW A;  5EKQ D;  3B13 A;  3D9M A;  3BG1 B;  4F8D A;  4P29 A;  3ZW3 A;  1GT0 C;  4CT0 A;  4NAC A;  1H2T C;  4M3O A;  4U63 A;  3L13 A;  1YSE A;  3ESK A;  1NA0 A;  3OMT A;  2WMO A;  4IVZ A;  1FCH A;  1X57 A;  2YHE A;  2CHZ A;  3CHQ A;  2L8N A;  3R1F A;  3D9L A;  4UQZ A;  3VK0 A;  3JXD L;  2J09 A;  3T5X A;  4PDX A;  2AXU A;  3PXP A;  3SCF A;  1SQ8 A;  3D1N I;  3FUF A;  5K98 B;  3K9I A;  4EBA G;  2XGS A;  3CSF A;  3SBT B;  4Z59 A;  3AS5 A;  3ZN3 A;  1WH8 A;  2WQ6 A;  2XPY A;  3LIS A;  1INZ A;  4H7X A;  2VGY A;  3QOU A;  4V3I A;  2CFU A;  2WXM A;  4YAR A;  3F52 A;  4UWF A;  1QQA A;  4I6R A;  2XSD C;  2PUE A;  4HS2 A;  3QB2 A;  1WET A;  3RKV A;  1PER L;  2L9B A;  4X4B A;  4GA0 A;  2D5V A;  3FTZ A;  3VLE A;  4U07 A;  2PUG A;  5JHA A;  4F7A A;  3ZHI A;  4APF A;  3QJZ A;  2FO7 A;  3S8Q A;  1H2V C;  2X3M A;  3RRU A;  3LY8 A;  4L23 A;  1UJK A;  4JXT A;  1PC2 A;  5G55 A;  5KJN A;  2DBA A;  2PIJ A;  4FC8 A;  4I9C A;  1WAO 1;  1YA0 A;  3FEX A;  3HYM B;  3QWP A;  4DLO A;  3CHP A;  2JEK A;  1UW4 B;  1NZN A;  4PUC A;  5FWQ A;  4BFR A;  4YG7 B;  3ZEF A;  4O6F A;  4A1G A;  5FZQ A;  1Z6T A;  4Q94 A;  2PL2 A;  1IYG A;  5C2Y A;  2LYJ A;  1RZR D;  2LYS A;  3Q15 A;  3RZZ A;  3I3N A;  5CHE E;  4GMJ A;  2BNM A;  3TXM A;  4I8T A;  3CVN A;  3OXL A;  3PNT B;  4EEC A;  4E6H A;  2XRZ A;  3FH5 A;  2I6H A;  5LOZ A;  3R7R A;  3UT8 A;  4I6U A;  4MLP A;  4G26 A;  5BT1 A;  2IQC A;  4L7T A;  3LFP A;  4NDW A;  2KM4 A;  2WQH A;  4I1A A;  3CK8 A;  2O4A A;  5JJ7 A;  4G23 A;  2JLB A;  3MA5 A;  3SFZ A;  1NEQ A;  1Z3Y A;  4Z5D A;  2I1J A;  3C98 A;  3APF A;  2OFY A;  1WH6 A;  1GW6 A;  1DW9 A;  3LVR E;  2VGX A;  4FP7 A;  4NUR A;  4OVV A;  3OQO A;  4FBI A;  2VSY A;  5EX0 A;  4MCT A;  3FUE A;  3S7D A;  1Z3X A;  2KEJ A;  1CJG A;  2LCV A;  2PUC A;  2MQK A;  1ZAY A;  1EDU A;  1OWL A;  2KC7 A;  4G1T A;  4WWN A;  4XKC A;  3IBE A;  4GQM A;  4QFV A;  5FQ8 A;  3AU5 A;  1ZZ8 A;  3FUI A;  3OXF A;  3GZ2 A;  4GAA A;  1OWN A;  4GYY A;  1PRA A;  4O8B A;  5AJL A;  3OP9 A;  2AXZ A;  4AXH A;  5J08 A;  4IYP A;  3ZVV A;  3TJP A;  3B7H A;  1LMB 3;  4KYO B;  5T8I A;  4ILI A;  4IUL A;  1JH9 A;  4N3B A;  4HOU A;  1LF8 A;  2XQ0 A;  4HLE A;  1HH8 A;  5FQ4 A;  4FU3 A;  2FF4 A;  2PUF A;  4GU5 A;  4YG4 A;  4AY5 A;  2XHE A;  3JCK C;  3GN5 B;  2HR2 A;  1RZR A;  4U0Z A;  2XIU A;  3ML8 A;  2R59 A;  1L5J A;  4MCX A;  1VPW A;  2WXF A;  4UWK A;  4JC8 A;  4ANV A;  3FUL A;  1RPE L;  2JVL A;  1HG2 A;  2CG2 A;  4FUL A;  3CVW A;  4X4G A;  1OWM A;  2LYL A;  3QNK A;  4J1X A;  3MCX A;  1QPZ A;  3ZHM A;  3ZYK A;  4EZK A;  4N2Q A;  4Y6W A;  2KCK A;  3ZFW A;  3FY4 A;  4X4E A;  3PNL B;  3CVX A;  3L08 A;  2X6F A;  3OTN A;  4GML A;  3APD A;  1UG3 A;  1OUV A;  1ZVV A;  4WUY A;  3DNV B;  4APO A;  4EZJ A;  4Z58 A;  4CCA A;  3DPD A;  3ASD A;  4XIF A;  4I1M A;  2VSN A;  3MKQ A;  3EIJ A;  3MV2 B;  5ARF A;  3SI5 A;  5KJM A;  1QP0 A;  3CVQ A;  2VSX E;  3BEE A;  5T4Y A;  4HFG A;  4N3C A;  3ZPJ A;  4PS7 A;  3TAX A;  3NZS A;  4YBA A;  1HFA A;  3AS4 A;  4AM9 A;  1HZ4 A;  2XEV A;  4HXI A;  4WNE A;  1QQB A;  1FVH A;  1B89 A;  2VYI A;  3MV3 B;  2ZU6 B;  3SZ7 A;  4X4I A;  2O49 A;  3QKY A;  4L1B A;  4H7Y A;  1TEZ A;  4XE0 A;  2V4L A;  4HOR A;  3Q4A B;  4NQ0 A;  3JYS A;  4GZC A;  1TJF A;  2ION A;  5BPP A;  1H6K A;  2X6I A;  3ZXS A;  3AU4 A;  3MKR A;  5BUZ A;  2I9C A;  3CHS A;  2FI7 A;  4IN3 B;  3LXU X;  4C0M A;  3RU0 A;  3FTX A;  3CQC B;  5E76 A;  3APC A;  1O4X A;  2BF0 X;  1HX8 A;  2Y4T A;  1PY1 A;  3B7R L;  4I9E A;  4ANW A;  1AU7 A;  2IOL A;  3FP3 A;  3O4Z A;  4B94 A;  3U64 A;  1S0P A;  2PUA A;  4CT4 A;  2AW6 A;  2I2O A;  2BJC A;  1W3B A;  1QZ2 A;  4GZ3 A;  1X5B A;  2BNN A;  1UJJ A;  1WM5 A;  2IF4 A;  3KS2 A;  2IJG X;  3ULQ A;  3CHO A;  1HXI A;  4G11 A;  5LCW C;  3FU0 A;  3L54 A;  5BV0 A;  1OWP A;  1HO8 A;  1XNF A;  4U04 A;  4AVX A;  1JUQ A;  1WY6 A;  1ZU2 A;  4KT6 B;  2DIW A;  2J08 A;  2V0P A;  3CKB A;  3ESL A;  4UWL A;  4C0E A;  3RJV A;  2HIN A;  3ZRH A;  2KCV A;  3PEV B;  4GHJ A;  1UN9 A;  2FBN A;  3GZS A;  2XCJ A;  2R17 C;  3I4R B;  3MGB A;  4LCT A;  2EF8 A;  1DNP A;  3UT7 A;  5LCW J;  2OVF A;  5LX8 A;  3P2B A;  5AJD A;  4J1W A;  4N2S A;  3IKO B;  2WB2 A;  3P1U A;  1JFS A;  3SBS A;  5BV1 A;  3KZ3 A;  2PQN A;  1DVP A;  2VTB B;  3UQ3 A;  3TGO A;  4DK5 A;  4BT9 A;  3CR3 A;  2IVB A;  3D3M A;  2LSU A;  3S7B A;  2WXL A;  2WXP A;  5M72 A;  1PRV A;  3EHN A;  3CHR A;  4BT8 A;  4DI4 A;  4A55 A;  4BSX A;  2IU1 A;  4CGW A;  3QWG A;  5CMY A;  3D9I A;  2KEI A;  4JHJ A;  4WNF A;  3OQM A;  4HOQ A;  4I17 A;  1RIO A;  1Y9Q A;  1OSL A;  4A1S A;  3LY9 A;  5DIZ A;  1QP7 A;  3SNX A;  3UPV A;  2IVG A;  2J4D A;  2X6J A;  3LS8 A;  3O48 A;  3QWV A;  3I4G A;  2VJ8 A;  1QP4 A;  3T8M A;  1JPL A;  3CK7 A;  5FJY A;  5JJ6 A;  4AV7 A;  4FN3 A;  3UX4 A;  2GRM A;  1LCD A;  1E96 B;  3CV0 A;  3FTU A;  4JEU A;  2XJ3 A;  1JWG A;  3HVE A;  4PH4 B;  4BTB A;  3R9A B;  5C1D A;  3FEY A;  4ME2 A;  3IV0 A;  4J6I A;  2A4Z A;  1ZZ6 A;  5E75 A;  3RRM B;  1EFA A;  2QFC A;  2XCC A;  4U0S A;  2GZU A;  3CEQ A;  1H2U A;  3G2V A;  1LQC A;  3U3W A;  4Y42 A;  2UY1 B;  2AVP A;  1HF0 A;  2ILR A;  1BDH A;  5A7D B;  4ILH B;  4URK A;  3RRN B;  3GYZ A;  4GA1 A;  3QF3 A;  3FTV A;  1Y7Y A;  3GZ1 A;  1ELW A;  4FLB A;  1ADR A;  4FJZ A;  2C0L A;  4YG1 A;  1IHG A;  1JWF A;  3SD5 A;  2IFU A;  3VLF A;  2L0T B;  4MS6 A;  3HDX A;  5KJL A;  2LNI A;  2AUW A;  2NXP A;  4PU8 A;  3PRZ A;  3FYM A;  2XI8 A;  2LSV A;  2GGF A;  2XRY A;  2LAH A;  3LCA A;  5LFA A;  2WXG A;  2CHW A;  1PRU A;  4GA2 A;  3UMV A;  5ANR A;  3HHM A;  4LRZ A;  3S7F A;  4YVQ C;  3QDN A;  4EBA A;  1OWO A;  2J07 A;  4JHK A;  5D0Q D;  3BD1 A;  3KEZ A;  3JXB C;  2AXV A;  3ONK A;  3O9X A;  3IHV A;  2QY7 A;  3LJ3 A;  1EYH A;  1ZS4 A;  2GRL A;  2X6H A;  2KPJ A;  3U4T A;  1ELR A;  3CST A;  4E85 A;  3FMY A;  5HI7 A;  3SCG A;  2IVQ A;  2PM7 A;  3PE4 A;  2J9Q A;  4ACK A;  5FQ6 A;  3F6W A;  3EIQ C;  3SF4 A;  3RK6 A;  3WXX A;  3CGH A;  4JEH A;  2VTB A;  4YVO A;  2FEZ A;  5J90 A;  1ZUG A;  4IA8 A;  3KAE A;  3FU6 A;  1H19 A;  2I1K A;  2OV8 A;  3ONL A;  4I6E A;  4U0U A;  2CFZ A;  4AJW A;  2JCG A;  3U66 A;  4GYW A;  2XPI A;  4JL0 A;  2A6C A;  4I6J A;  3Q49 B;  4BWR A;  4YND A;  3RIB A;  3VTX A;  2X38 A;  4B0Z A;  4EZL A;  2WXR A;  5ENN A;  3MZL B;  1HS6 A;  4TRQ A;  3FTS A;  3FU3 A;  4NRH B;  3RO2 A;  4X4C A;  3CLJ A;  2YIN A;  3BDN A;  3B7S A;  4GZ5 A;  2PM6 A;  2WXK A;  4ACL A;  3FWV A;  4L2L A;  5FTP A;  2IV1 A;  3FTW A;  1KLX A;  4JCX A;  3FDH A;  1ZPQ A;  2MEZ A;  4R7L A;  3JUI A;  3ZYM A;  1U3D A;  3G5G A;  2WQ7 A;  4OVU A;  4W9R A;  4Y6C A;  3UT4 A;  4RSY A;  2M63 A;  3L22 A;  3FUN A;  4GZ6 A;  1NP7 A;  5G05 C;  4GB9 A;  3UFD A;  1LLI A;  3B7U X;  4GCO A;  1SZA A;  2J4B A;  1SZ9 A;  4WND A;  4IWR A;  3CHM A;  4CEM A;  2WXQ A;  1MQS A;  4DI3 A;  1HG5 A;  2BTD A;  2KZ8 A;  1VDY A;  1NA3 A;  4OB4 A;  2XCB A;  2L49 A;  3EJN A;  3MYV A;  4U8H A;  3KJX A;  1UTX A;  1PAQ A;  3CLC A;  1QQE A;  4UI9 C;  4RG9 A;  5AYW D;  2XPZ A;  1UXC A;  4JQD A;  3U9W A;  3LVQ E;  1N54 A;  3CVL A;  3FUK A;  2EWT A;  2J49 A;  3F51 A;  5G05 J;  1ZZC A;  2LYR A;  1BDI A;  4A3V A;  1BPO A;  1KT1 A;  1N52 A;  5ARG A;  2C0M A;  4G2V A;  4TUU A;  5A7L A;  2KZT B;  4UI9 J;  4HVB A;  3FH8 A;  3LYA A;  2RD0 A;  3QQ6 A;  4X4D A;  3LY7 A;  2EQX A;  3CIA A;  4JW1 A;  4PS8 A;  4B89 A;  2ICT A;  3VLD A;  2XGM A;  2PE5 A;  2CRO A;  3GN5 A;  2FUL A;  2KAT A;  2C2L A;  3L16 A;  4J8D A;  1ZZ9 A;  4KZC A;  2VSO E;  1NER A;  4XX5 A;  3TG5 A;  3JXC L;  3ASF A;  3BG0 B;  4F3V A;  1E8Y A;  5JHB A;  4PU4 C;  3D9N A;  3IVP A;  1MHQ A;  1UXD A;  4I6G A;  4RG6 A;  3CKC A;  3PDN A;  3FFL A;  4GCN A;  4F53 A;  3T5V A;  4JVS A;  4N5C A;  1FVF A;  5G2N A;  2PPX A;  4J8S A;  4FLH A;  5FZS A;  2KEK A;  1U3C A;  3LKU A;  4ABN A;  5FT9 A;  4JCY A;  4BTA A;  2IOS A;  4GYO A;  3ZYL A;  4PU7 A;  1H0A A;  3N71 A;  1UN8 A;  2WXJ A;  5EDS A;  3CVV A;  1OCT C;  1IQR A;  2HYZ A;  5A23 A;  3LDZ A;  1S7E A;  3L6A A;  3QC1 A;  4Z5C A;  4CDM A;  2LO6 A;  1B0N A;  4D10 C;  2LYP A;  4Q69 A;  5BNW A;  1HF8 A;  4K0R A;  4X4F A;  3FHE A;  3PS6 A;  4A3T A;  4G24 A;  5AIJ A;  4ANX A;  1JFT A;  5DBK A;  1CQT A;  3FUJ A;  4BX9 A;  1ZBP A;  3CVY A;  3PE3 A;  3ZHE B;  5KCM A;  5A6C A;  3SCH A;  3NF1 A;  4XZ4 A;  2CSF A;  4XI0 A;  3E4B A;  5ANL A;  4OYS A;  2LAI A;  4CDR A;  4B8A A;  2A5U A;  2RG8 A;  4K03 A;  2X6K A;  3VTY A;  3ZIM A;  3GBF A;  3FYA A;  3SHF A;  3PVL A;  2HM8 A;  2WXI A;  1IC8 A;  2HO1 A;  3MLF A;  1RZS A;  2WM9 A;  4B8C B;  1E3O C;  4UI9 K;  3FH7 A;  3CK9 A;  1ELK A;  5T3R A;  3L1P A;  4ANU A;  4JPS A;  3OQN A;  4KZ0 A;  3MEK A;  3MKQ B;  5CCL A;  3ASG A;  4XI9 A;  3SGH A;  1SQM A;  2WXO A;  5FZR A;  4LUN U;  2WXN A;  2LYQ A;  4I43 A;  1EPU A;  4AY6 A;  4C9B B;  1Y8M A;  3PH0 C;  3URZ A;  3IHY A;  3ZYQ A;  2CG3 A;  3TL5 A;  4CGV A;  3DBS A;  3LPZ A;  2ICP A;  2Q7F A;  4I1O B;  2KZT A;  3D9J A;  4I2W A;  1DWK A;  3G7D A;  3TRB A;  2PUD A;  2OOE A;  3R7Q A;  3G2W A;  3GW4 A;  3PEU B;  3EHM A;  2IU7 A;  3ASH A;  3ML9 A;  3PUK A;  3G2T A;  3UUX A;  4CRW A;  1HE8 A;  3ZKC A;  1ZZ7 A;  4WNG A;  4DPR A;  2R5S A;  3RO3 A;  4BX8 A;  2GW1 A;  5CCM A;  1E8X A;  3PZD A;  4ATG A;  3Q5M A;  4XKB A;  5AEN A;  1A17 A;  1E7U A;  3CVP A;  2OND A;  3FUH A;  3IEG A;  2YQ8 A;  3D9K A;  3QAR A;  2H8R A;  3B7T A;  1Y6I A;  3OAW A;  2WUS R;  4FJY A;  4KMO A;  2Y4U A;  4PU3 C;  3QAQ A;  1IQU A;  3MX3 A;  2VQ2 A;  5KJK A;  4AP2 A;  4ILG A;  4UWG A;  3G2S A;  2CHX A;  2E2E A;  4KBQ A;  4PS3 A;  2PUB A;  2WVI A;  2LYK A;  3QYX A;  4KXK B;  2WXH A;  1R69 A;  1HU3 A;  1XGW A;  1EF1 C;  3OXG A;  3QK0 A;  4JA9 A;  3I5P A;  4L2Y A;  4F1S A;  2DCP A;  4MKT A;  4I6T A;  3TG4 A;  1TJC A;  3S7J A;  2R1J L;  4FHJ A;  3CVU A;  1XWR A;  3ENE A;  2HSG A;  3D9O A;  3ZHE A;  2O38 A;  2L6J A;  3CEC A;  1X2L A;  2NC9 A;  2L0I A;  4FHK A;  2YHC A;  2BUG A;  2PZI A;  1R63 A;  5JJT A;  4FAD A;  4AOF A;  3BS3 A;  1E8Z A;  2MRI A;  4AEZ C;  2EBY A;  2MHK A;  3QWW A;  5D0O D;  1PNR A;  3L17 A;  2WPV A;  2E0I A;  3JQ1 A;  3H5T A;  3NZU A;  2V5F A;  4N3A A;  2WMN A;  4HOS A;  4MRU A;  4X4H A;  3EDT B;  4AIF A;  3NQP A;  3JQ0 A;  4JZY A;  5G04 C;  5LP0 A;  3PUJ A;  4JA7 A;  3PRE A;  4BY6 A;  1L1M A;  4I2Z A;  2UY1 A;  1ZZB A;  2B5A A;  1LCC A;  3KXA A;  4KVO A;  2YNQ A;  4UQY A;  2FJR A;  3D9P A;  2V8S E;  3ZGQ A;  4TV3 A;  3CQG B;  4EPZ A;  3FUD A;  4G25 A;  1JWL A;  4LER A;  3HZI B;  4UWH A;  3TXN A;  4WAF A;  4EQF A;  2WIU B;  4HOT A;  3CRO L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...