2AXUA

Structure of prgx
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
305
structure length
303
Chain Sequence
MFKIGSVLKQIRQELNYHQIDLYSGIMSKSVYIKVEADSRPISVEELSKFSERLGVNFFEILNRAGMNSVNETGKEKLLISKIFTNPDLFDKNFQRIEPKRLTSLQYFSIYLGYISIAHHYNIEVPTFNKTITSDLKHLYDKRTTFFGIDYEIVSNLLNVLPYEEVSSIIKPMYPIVDSFGKDYDLTIQTVLKNALTISIMNRNLKEAQYYINQFEHLKTIKNISINGYYDLEINYLKQIYQFLTDKNIDSYLNAVNIINIFKIIGKEDIHRSLVEELTKISAKEKFTPPKEVTMYYENYVAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords PrgX
publication title Structure of peptide sex pheromone receptor PrgX and PrgX/pheromone complexes and regulation of conjugation in Enterococcus faecalis.
pubmed doi rcsb
source organism Enterococcus faecalis
total genus 111
structure length 303
sequence length 305
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2005-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2axuA01
1.25.40.400 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2axuA02
1QPZA 4PU4C 1S7EA 1QP7A 3F52A 3JXCL 3GN5A 2AUWA 2KEKA 1EFAA 4YBAA 1RZRA 2PIJA 3TRBA 2XIUA 4I6UA 3SCGA 1QQBA 1RZSA 1VPWA 1ZPQA 3DNVB 1JH9A 3GBFA 1WETA 2JCGA 2OFYA 3KJXA 4YARA 1NEQA 4O8BA 3OQOA 1Y9QA 4Z5CA 2GRLA 3KZ3A 2FJRA 4GHJA 4OB4A 4X4DA 1R69A 1CQTA 2GRMA 4Z58A 1OCTC 1ZZ8A 4IA8A 1PRVA 3F6WA 1UTXA 1DWKA 1RZRD 1OSLA 2CROA 3CECA 4YG4A 1QP0A 3F51A 1WH8A 2BNMA 2KEIA 2AXZA 1UXDA 2A6CA 1PRUA 1POUA 4X4BA 4MCXA 2LYPA 2XI8A 1L1MA 2PUAA 1XWRA 3O9XA 1RIOA 4GQMA 2WIUB 1LCDA 2CSFA 3QQ6A 2O49A 1DW9A 4Z59A 1PNRA 3D1NI 4IVZA 3UFDA 3OQNA 3MLFA 1JFTA 2EWTA 2O4AA 1YSEA 1HF0A 2B5AA 2HINA 2XSDC 2OR1L 4JCXA 4YG7B 1WH6A 2O38A 4Z5DA 3BDNA 1ZZCA 2PUGA 1UXCA 3EUSA 4X4FA 4JCYA 2PE5A 3L1PA 3HZIB 2PPXA 3ZHMA 4YG1A 1LMB3 3VK0A 3JXBC 2AXVA 4Y42A 5K98B 3QYXA 1ZS4A 1CJGA 4FN3A 4X4GA 4I8TA 1BDIA 3OP9A 1ZAYA 3SCHA 2KPJA 1QQAA 2GZUA 1R63A 2L8NA 1BDHA 2R63A 4MCTA 2BJCA 3FMYA 1RPEL 4X4EA 3FYAA 2IVQA 2H8RA 3LFPA 1SQ8A 1PRAA 3SCFA 2MQKA 4PU8A 1NERA 3CROL 3BD1A 2ICTA 3S8QA 3CLCA 2LYQA 4JQDA 2MEZA 3FYMA 4PU7A 1E3OC 2BNNA 2AWIA 1ZZ9A 2PUFA 3QF3A 2PUCA 1O4XA 1ZZ7A 1ZUGA 2LYSA 3IVPA 3KXAA 1Y7YA 1ZVVA 1QP4A 4NDWA 4Z5HA 3OQMA 4X4CA 2KEJA 4J1XA 4FBIA 4J1WA 1B0NA 2KZ8A 4I6TA 3RZZA 2LYJA 2IUOA 4X4HA 2XJ3A 3ZHIA 3GN5B 2JVLA 2LCVA 3JXDL 1LCCA 2AW6A 1X2LA 2IVBA 3G7DA 2L49A 3OMTA 3QWGA 4X4IA 2R1JL 2PUBA 2LYKA 3BS3A 1ADRA 3B7HA 2D5VA 3R1FA 3PXPA 3ZKCA 1LQCA 1JWLA 2PUEA 1ZZ6A 2LYRA 4I6RA 2LYLA 2WUSR 1PERL 4PU3C 2AXUA 2EF8A 1IC8A 5A7LA 1AU7A 2PUDA 4IWRA 1ZZBA 3LISA 1GT0C 3U3WA 1LLIA 2EBYA 2IV1A 3H5TA 2BNOA 1JFSA 2IVGA 4F8DA 3G5GA 2IU7A 1X57A 2ICPA 1WIZA 2XCJA 2HSGA
chains in the Genus database with same CATH superfamily
2KCLA 3JXCL 4YBAA 4O1OA 2GROB 4QQIA 3AS4A 3OQOA 1OCTC 4RG6A 3F6WA 4LSZE 2I1KA 3CECA 3CR3A 3UINC 4JEUA 2AXZA 2WXQA 1QNFA 2V4LA 4ZFHA 3OXFA 3PREA 5BV1A 3LKUA 1SA4A 3L6AA 1YSEA 2B5AA 4QFVA 3FULA 2PPXA 5CERB 4PS7A 1D8DA 3V30A 1G3NB 1TJFA 3SCHA 1OY3D 3E32A 2WXRA 4G11A 4NACA 1BI8B 4M3OA 3L16A 3KSQA 4MCTA 3FYAA 1HX8A 1DULA 5HRYA 5KJNA 4WNDA 4DRXE 3DSSA 4N2SA 5EIDA 3ZN3A 4O1PA 5AARA 2PXEA 4X4CA 5E75A 3RZZA 4DX7D 2WXMA 3CHSA 1Y6IA 2R1JL 5FIOA 3BS3A 1L5JA 1H6OA 2LUHA 1LQCA 5JJ7A 2V5QC 2V3CC 3U3WA 1LLIA 4NRHB 4HLLA 3GW4A 3ZXSA 3DRAA 1OWLA 3D9OA 3HIZA 4Q94A 2QYUA 2KXPC 5B1AE 5J90A 2DBAA 4BSXA 3DNVB 1UOHA 2WPVA 2FJRA 5BT1A 5FT9A 3CVXA 3JUIA 4KMOA 3F51A 2WXOA 3S2AA 4LNBA 1Z5SC 4WNEA 4RVBA 2PQNA 2X6HA 1XWRA 4UI9J 4AM9A 3PZ1A 3C3OA 2XEHA 3D1NI 4HRAA 2ZU6B 4ILGA 4GTRA 4I1OB 3HG0D 1FPPA 5CEDB 4URKA 1LF8A 3HYMB 3NQPA 3G2TA 4I1AA 2MHKA 1LD7A 4N3BA 5CEAA 3L54A 3ZEFA 3APCA 2DZNA 1PRAA 5DBKA 5CRVA 4RSYA 2OVBA 4GTOA 2UY1A 3QF3A 1ZUGA 2LYSA 4NQ0A 3SNXA 3PE4A 2WXLA 5BPPA 4HI8A 2IUOA 1HH8A 1X2LA 3FUEA 3B7HA 1DC2A 2IU1A 5ENTD 4BX9A 2X38A 5CMYA 4DPRA 1ZU2A 1HE8A 4UWKA 2B0OE 4CT4A 2XGMA 4RLYA 1TEZA 3VLEA 3CK9A 2QYJA 2IF4A 4F8DA 4GMLA 4BETA 3D9PA 2FEZA 2M63A 1S7EA 3PZ2A 2WXFA 4F1SA 3ASGA 1MQSA 1KZPA 1H0AA 1H2UA 3LQXA 3ENEA 4WNGA 1ZZ8A 5G05J 2WMNA 4LG6A 3ZIMA 3CLJA 2UWJG 4HRLA 4MBGA 3ML8A 5CRUA 2VTBB 1LCDA 2XEEA 1DW9A 2XRYA 3UTMA 3VTXA 2J08A 3D9HA 4AXHA 4BERA 4K5AB 4M7CA 4X4GA 1JCQA 2LAHA 3OP9A 5FQ8A 1ZAYA 2GZUA 3TWVA 4A3TA 2LLWA 4D10C 5FZQA 1SQ8A 2H6HA 4HOUA 3SD5A 3HXFA 3W9FA 3CIAA 3D9KA 3FU6A 4U0ZA 3JUEA 3NOCD 4ER7A 3CHMA 3TWTA 3OQMA 4DI4A 4C0EA 2J9QA 3ZNGA 2PXPA 3D3MA 2XENA 2PXFA 2PUBA 3Q7AA 3FUJA 1TNOA 2J4BA 3TG5A 4U7EB 4EECA 5CMWA 4I6JA 3TXNA 2WXIA 3QB2A 5CHEE 2AXUA 1IC8A 2CHXA 1ZZBA 2HYZA 3LISA 3ULQA 4I17A 1JFSA 2FFHA 3C5RA 3QDNA 5ARGA 4EKIA 1P5QA 4YVOA 1O5MA 1XGWA 4PU4C 5AYWD 2KATA 3LJ3A 5DTMA 3T8KA 2PIJA 2IJGX 5ENRD 1VPWA 3NBNB 4J8SA 4N5CA 4Z68A 2GRMA 4UQXA 2Y69E 2DVWA 4L1BA 4J8EA 1E8YA 3UI2A 3MZLB 2ZGDA 3PRZA 2A6CA 4HRNA 3J5PA 1QYMA 2OEWA 4UWLA 3UQ3A 3Q5MA 3TWUA 3FWVA 1YCSB 4DE8A 1UJJA 5IY5E 3D9MA 4OAUC 2I6HA 4AOFA 2ONDA 3BQOA 2AJAA 4X4FA 2E0IA 1LD8A 4I43A 4X8QA 4JEHA 2VYIA 3R9AB 1BDIA 2BUGA 1Z6TA 5ENSD 1JUQA 2LXLA 3FU0A 2PXKA 4GTSA 1NZNA 4F6RD 2ODRD 3BD1A 4KYOB 3DXKG 2ETAA 2HFZA 1ZZ7A 4WWOA 4EBAA 2WXKA 3D9IA 1MX4A 3URZA 3HDXA 4EHMA 5AQAA 4XKCA 5AIJA 1ELWA 2RFAA 3B7SA 4CDNA 4L2YA 2EILE 1IKND 3PVLA 3U66A 4BEPA 3EHNA 4JHRA 4OAVB 4GMRA 3SFYA 3TWQA 1FT1A 3QOWA 2XZTG 2JEKA 3NXHA 2ICPA 4BX8A 3CEQA 3LY8A 2V5FA 5EDSA 2WQHA 1JCRA 3Q7FA 1BPOA 3D9JA 4H7XA 3NROA 3DM5A 3FUDA 3LY7A 2I2OA 1OWMA 5JJTA 4YVQC 1DVPA 3B13A 3CVYA 5D66A 4ACKA 4U8YD 2BTDA 2XXQA 1NFIE 4PS8A 4GQMA 1X5BA 4XE0A 3WXXA 2O49A 4BT9A 3TEPA 1PNRA 4HORA 5B3SE 2EWTA 3EHMA 5DIZA 3UWPA 4GYOA 2BEDA 2O38A 3EUSA 2AVPA 4EK9A 2P9NG 3DSVA 3DBSA 1HXIA 2PXBA 4ABNA 1ELRA 1CJGA 4I8TA 2LXMA 3TWRA 1QB2A 3FY4A 2KPJA 1HZ4A 3SQVA 4BESA 3SFZA 3S7JA 3WG7E 3PE5A 3CLCA 5KJMA 4EZIA 2BNNA 5A6CA 1SVXA 3DSUA 2RFMA 4X4HA 3KEAA 3G7DA 2WXJA 3QFIA 4YNDA 3UT8A 3GZ1A 2R02A 3CK8A 1X81A 3K9IA 2JABA 3UIOC 3HXCA 1PC2A 1NA0A 1FVFA 3RRMB 3I4GA 5KCMA 1X57A 3CHOA 5AJDA 3SHFA 3Q9NC 2DZOA 2L0TB 4L9PA 3GZDC 1WETA 3EUVA 3GBFA 1RZRD 4I1MA 4GZDA 2KCKA 1OCZE 3VWSA 1FCHA 1K1BA 4B94A 1UTXA 3Q75A 4GTPA 3G2VA 4GPKA 2PQRA 1N54A 3NDBB 3O9XA 1RIOA 3GZ2A 2CSFA 1Z3XA 4C48B 2V8SE 3FUKA 4U0SA 3OAWA 4N39A 3FTXA 2DWZA 1E96B 2O4AA 5GAGi 4GCNA 1HF0A 3MEJA 3HXBA 4N3AA 5JUWA 4J7WA 4FN3A 3B7TA 2PXQA 1YYHA 1SW6A 4GZ6A 3FMYA 1HU3A 2ILRA 3CROL 2ICTA 4JQDA 4GA2A 1TNYA 2EIKE 1S70B 3NZLA 1D8EA 4NDWA 2XCBA 5KWDA 2I9CA 5GAHi 2NYJA 2F37A 2IOSA 5EYLA 2EIJE 4JVSA 4GYYA 1SZ9A 3CVNA 4B93B 1OCOE 2AW6A 3C3QA 3ESLA 2LYKA 5D2MC 4H7YA 3R1FA 5FQ7A 3FU5A 5LX8A 4HI9A 4G8LA 3DSTA 4I2ZA 1AU7A 4ATZD 1NA3A 1HG5A 3HHMA 2BNOA 3MV2B 4YDEA 3GZCA 1N94A 3FH8A 2GRQB 4FJYA 4F7AA 4ACLA 2PXUA 3JXIA 1N4QA 3G2SA 4XX5A 4O8BA 2PNNA 1Y8MA 4G24A 1R69A 2P9UG 5T8IA 3Q49B 4GTTA 1V55E 2P9IG 4ME2A 4ER6A 2A5EA 5FJYA 3GYZA 3EJNA 3NF1A 5LFAA 4DJAA 3UM2A 1INZA 4LUNU 3OKZA 3DPYA 4HOQA 4PUCA 3AJIA 4F1PA 2NC9A 1ZZCA 4R7LA 4JCYA 4HRMB 1LMB3 2DYSE 4A55A 2X6KA 4DX6D 4C9BB 2IEJA 2ZIRA 4I6EA 4BY6A 3EIQC 3FEXA 4RQIA 4N3CA 4U0UA 4F3VA 4PU8A 3GUUA 2LYQA 3S7BA 2KC7A 2J09A 2KBXA 3VTYA 3ASFA 3LEWA 2F8YA 1TN7A 5ANLA 5A23A 2VJ8A 3SFXA 3QWGA 4JA7A 3I3NA 2XPZA 4RG9A 3FEYA 2L9BA 4OBMA 3AAAC 3PNLB 1WG0A 3TELA 3RO3A 1JCSA 3ISMC 1TN8A 1D9SA 3NAWA 4FHJA 3H5TA 4HFGA 3T9KA 1OCCE 3UM1A 5HI7A 1SZAA 4U8HA 3D9LA 4J8DA 3N71A 1XNFA 2XCJA 2F0YA 2J7UA 2HE0A 4UI9C 4J8FA 1DNPA 1IQUA 4UWGA 2KEKA 1S0PA 3CHQA 3FUFA 3ULEG 2L1PA 4ANUA 3PZDA 4GHJA 2J7WA 2CG2A 3LVRE 5LCWJ 3DPDA 5JHAA 1DWKA 1E8ZA 5ENQD 3V2OA 1N4PA 3VLFA 4FU3A 4TRQA 4AVXA 3ML9A 2PUAA 4HQDA 3KL4A 3ZYMA 2YBDA 4Z59A 3UX4A 2Y0BG 3MLFA 1OUVA 4TUUA 4GU5A 2VGEA 2PUGA 4KVOA 2I1JA 3ESKA 2PE5A 4EZKA 1N9AA 2B6CA 2VSXE 3T8MA 4XI0A 5BNWA 2PXVA 3FUHA 4CT0A 1HG2A 2J8SD 4GZ3A 4UI9K 4AY6A 2R63A 4X4EA 4CCAA 3E30A 3Q79A 2GRNB 4DX2A 5KBAA 2WXPA 5BUZA 4HNAD 4XIFA 1KLXA 2PUFA 1A5EA 1QP4A 3CGHA 5EILA 4BTAA 2QFCA 3P2BA 5KNGA 2CFUA 4AV7A 4B0ZA 4HOTA 4GA1A 3OMTA 4ER0A 2XZDG 2J4DA 4JW1A 3TL5A 2HCSA 3ZXPA 3FUMA 4U04A 5EYPF 4YDWA 1ZZ6A 1B89A 2YINA 4PDXA 3UM0A 3CVPA 3OXLA 2XHEA 2R5SA 4K03A 5G05C 5B1BE 2P9KG 4OVUA 1IYGA 4J0UA 5CBOA 5EN5D 3IKOB 1N95A 2XGOA 3BG0B 2LO6A 2HO1A 3F52A 4ILIA 1Q2ZA 2P58C 3Q9UC 1EFAA 5BXOA 2LAIA 3AG1E 2OCCE 4ER3A 3OTNA 5AJLA 5H7PA 2OFYA 5AENA 1CQTA 3FTVA 4IRUA 4OB4A 3LS8A 1EDUA 4B8CB 1BI7B 2GRRB 4EKGA 4YG4A 1HF8A 2QZAA 2Q7FA 4JA9A 5G04J 4W9RA 2L6BA 4B8AA 3QC1A 1NL4A 3CVQA 1EYHA 3APDA 2A5UA 3R7RA 2YQ8A 3CK7A 4DK5A 2H6GA 1KZOA 5DTQA 4JPSA 1WH6A 2XXPA 3ASHA 3ASNE 3ZHMA 3E34A 2VQ2A 3RJVA 1H2VC 2VGYA 3B7BA 4GTVA 2XXAA 3RU0A 1IHBA 3L13A 2NXPA 1MFQC 3T5XA 4Q96A 3HRAA 2H8RA 2HR2A 4EZJA 1Z3YA 5G2NA 3IVPA 5JHBA 4G25A 4J1XA 3QKYA 4I6TA 3FH7A 3PE3A 3IV0A 5FQ4A 4FLHA 3DEOA 3ULYA 4CDRA 4U95D 4GZCA 3QWPA 3CHPA 1MX2A 1RZ4A 1JWGA 3ME5A 1YA0A 2LYLA 3S7DA 2EF8A 1IQRA 3B7UX 4A1SA 1BU9A 1KT0A 4IULA 5KJKA 3E4BA 3SI5A 4GTMA 3SZ7A 2PM7A 4Q2JA 3NB2A 3GZSA 2PXLA 2C0LA 1TJCA 3U4TA 4UWHA 4JB8P 5ANRA 2CG3A 2CHZA 2GRLA 4NIKA 2CROA 1SA5A 3L08A 3ZYKA 2BNMA 1LTXA 4U8VD 1OWPA 3SF4A 4WWPA 3DSWA 4GMJA 1U2ZA 3CKBA 3BU8A 3MKRA 3KSLA 4Z5DA 4KZCA 2YHCA 2R59A 2GGFA 3VK0A 1ZS4A 3AU5A 4JL0A 4APFA 2BKGA 2M4HA 3A9YA 2BJCA 4Y6CA 4GCOA 2UY1B 3S8QA 4TXRA 2MEZA 3FYMA 3L82A 2FO1E 1MHQA 3HVEA 3LJNA 4FLBA 2OEVA 1QBQA 4CGWA 3O4ZA 1JWFA 3SBSA 4FP7A 2LCVA 4JZYA 4LNUD 4AIFA 4CDMA 5KJLA 2DIWA 4I6RA 3C72A 3RIBA 5FQ6A 4A1GA 1GT0C 2BKKB 4JD2G 2X3MA 4NURA 4EQFA 1TNBA 4UQZA 3QOUA 4ZHBA 2R05A 1EPUA 3ZFWA 2Y3AA 1E90A 1W3BA 3AS8A 5CBNA 4I2WA 3D9NA 3Q15A 1QQBA 5ENOD 2WB2A 5AQ7A 3EHQA 4KXKB 1MJ0A 3IXEA 4KT6B 3PZ3A 2E2EA 1O1TA 1S63A 3PH0C 2VGXA 3B7RL 1A17A 3LPZA 2XPIA 1OXJA 3NOGD 4P29A 3PS6A 2XQ0A 3E33A 4UWFA 5ENNA 3MEKA 1PAQA 4YG7B 2OVFA 3TJPA 1E7VA 3JXBC 2AXVA 5J08A 4EQZA 3ABKE 3NZSA 1R63A 2LSUA 4XZ4A 2EQXA 4XKBA 1RPEL 5FZSA 2IVQA 2YNQA 2R17C 4G8KA 4FULA 3S7FA 3W9GA 4I9EA 4GAAA 3AG4E 3JQ0A 3CVVA 1PY1A 5BV0A 2YHEA 2Y4UA 4Z5HA 5AN8A 2XS1A 3OWQA 4APOA 4FBIA 3CVUA 4UQYA 4J6IA 3FUNA 3E37A 2L6JA 3EU9A 2P9LG 2XJ3A 4XI9A 4WVLA 3AS5A 4X4IA 4PH4B 1NW3A 5FZRA 3CSTA 4I6GA 3EU5A 3TAXA 5FTPA 4PU3C 3RRNB 3C3RA 3KAEA 2JLBA 1N52A 4MKTA 2DYRE 2LNIA 2FI7A 3MX3A 4DX1A 3M9LA 3MGBA 5BXUA 2MRIA 3FP3A 4U07A 4LEUA 4FADA 2C2LA 1IHGA 3GN5A 2XPYA 5HS0A 3V31A 2P2CP 4Y6WA 3DEPA 3IEGA 3QK0A 4J8YA 2HCNA 4YARA 2KZTA 2CHWA 5T3RA 3MCXA 3FTSA 4TV3A 3ZHEA 4GPMA 4CRWA 2IQCA 1POUA 2WIUB 3BG1B 4U96D 4BT8A 2FBNA 3RKVA 3TFLA 4A3VA 2F8XK 1JFTA 3VLDA 3I5PA 2XSDC 2WXGA 3TWXA 3BDNA 3FU3A 5CCLA 4GB9A 3UKUG 5KNHD 3EHRA 4BFRA 3LY9A 5AAOA 3ZPXA 5AQBA 5EKQD 3IHYA 4EPZA 5HQ8A 4MS6A 4Q69A 3DSXA 2XRZA 2FULA 1ZZ9A 1O4XA 4HS2A 1Y7YA 5JJ6A 2LYJA 1U3DA 4G26A 3JXDL 5G55A 4K0RA 4CZ2D 4LCTA 4JC8A 3RAUA 1ADRA 3FTZA 4ATGA 2V4HC 2PUEA 5ITZF 4HBDA 1E8WA 5EX3A 1VDYA 4AEZC 4AY5A 5A7LA 1OWNA 1OT8A 2ZGGA 1IXVA 2QC9A 3CV0A 4V3IA 3EDTB 3ZKJA 5FINA 1WM5A 4L7TA 4DLQA 2HSGA 4E85A 3JXJA 1YMPA 3GZDA 3LXUX 4BWRA 3PZ4A 5ENPD 4LRZA 5D0OD 3UXGA 3TRBA 4I6UA 4DI3A 1ZPQA 3CQCB 3KJXA 1OWOA 1H19A 1NEQA 3DWLG 3QJZA 4X4DA 3G0TA 5LP0A 1N4SA 3CHRA 1OSLA 1BD8A 3PUKA 1WH8A 2KEIA 2VEOA 3FTWA 3SBTB 3Q4AB 3QNKA 2PXDA 2LNMA 3C98A 5C2YA 3KEZA 4TUMA 3HVEB 4OVVA 1KPSB 3QARA 1UXCA 3A9ZA 3QYXA 3A9XA 1N11A 2IOLA 2NSZA 2XS8A 2PZIA 4DX5D 2CFZA 4GA0A 3R7QA 1SQMA 3QWWA 2KZ8A 4WUYA 4E6HA 3DXMG 3T5VA 4O6FA 1K1AA 2JVLA 2XCCA 3ASDA 2IVBA 1WAO1 2L49A 4GTQA 3G2UA 1WY6A 2HM8A 2BF0X 4N5QA 3ABLE 3SR4A 3QAQA 2LYRA 4HVBA 2GW1A 5FWQA 4ANWA 3U64A 1TNUA 5LCWC 4JXTA 1E7UA 2IV1A 5DTRA 3LYAA 5AQ9A 2VGXB 3P1UA 5A7DB 1O1SA 3HXEA 2RKKA 3IBEA 1QPZA 3ONLA 3L17A 3JQ1A 3QOXA 2AUWA 2MOWA 4DLOA 3ZGQA 2XIUA 1RZSA 4O60A 4BSZB 1MYOA 4Z5CA 3KZ3A 5JMND 4Z58A 1PRVA 3CSFA 4ANXA 1UG3A 3PUJA 4CGVA 1PRUA 2V0PA 1RW2A 2XI8A 2X6FA 4GYWA 2OOEA 3QQ6A 4KZ0A 5DSXA 4KVMA 2ZISA 4ANVA 3MKQA 2LLVA 4LNGA 4AP2A 1AP7A 1K3ZD 3J5QB 5T4YA 4Y42A 3RK6A 3ONKA 3UKRG 4OYSA 4N2QA 2GRPB 2L8NA 2IY0C 3ZYLA 3ZYQA 1U3CA 1HO8A 4LERA 5LOZA 5ARFA 3LFPA 5E76A 1NERA 4PU7A 3O48A 3FTUA 1QZ2A 4WNFA 2ETBA 1QZXA 3UIPC 1BLXB 1ELKA 2X6JA 3TWWA 3ZHIA 3GN5B 1LCCA 4C0MA 2DCPA 5D0QD 5CCMA 3AG2E 1ZB1A 2ETCA 4BTBA 2D5VA 3BUAA 3TG4A 2KZTB 1PERL 3LCAA 1AWCB 3ZHEB 2EBYA 3UPVA 3TGOA 1N0QA 3G5GA 3MYVA 3FH5A 4PS3A 5G04C 2IU7A 3X2QE 3FDHA 4K5BA 3R9MA 4GZ5A 1MX6A 4IYPA 1UN9A 3BEEA 3U9WA 3L9TA 1RZRA 2KCVA 3SCGA 3TXMA 1DCEA 4KBQA 4XEIG 1Y9QA 3Q47B 2RD0A 1U2VG 5DRTA 3FUIA 2VSNA 3UT7A 3UM3A 4HLEA 4G23A 2H6FA 3ASOE 4JHKA 1UXDA 2FO7A 4YDOA 3JCKC 4X4BA 4FHKA 4MLPA 5EIBE 4IN3B 3SX0A 4DE9A 3JYSA 4ILHB 1EF1C 3AU4A 3UFDA 3OQNA 1H6PA 2HINA 3QWVA 4JCXA 5JA4D 1WDYA 2ZXWE 3HZIB 4TXPA 4YG1A 2P9SG 1N4RA 3NZUA 4FC8A 4DUIA 5CECB 3R09A 1K8KG 2JQEA 4G2VA 4HXIA 3SCFA 3UUXA 2MQKA 2H6IA 5C1DA 3RO2A 2R2LA 1TYQG 2AWIA 1UJKA 2PUCA 3MA5A 3ZUVB 3KXAA 4CEMA 2MYOA 3SO8A 3ZW3A 2KM4A 1B0NA 3Q73A 3OXGA 1HFAA 4EBAG 1MZCA 2PL2A 3ZVVA 3FHEA 3B95A 2Y4TA 1HQ1A 5DT2A 3PXPA 2WQ6A 3TWSA 4B89A 1HS6A 2J49A 4HB5A 2PUDA 3APFA 4I9CA 2PXTA 2IVGA 3KS2A 4WAFA 3FFLA 3CQGB 1FT2A 2J07A 2Y1LE 1E8XA 4TXQA 1UW4B 2P9PG 3LVQE 1QP7A 1NI1A 3V79K 5EX0A 3L22A 2RG8A 2EINE 3CVLA 1JH9A 2PM6A 2JCGA 4ER5A 1GW6A 3PNTB 2L0IA 4YDYA 4IA8A 2WVIA 3LDZA 2WMOA 3CVWA 1TNZA 1QP0A 2IFUA 4FJZA 4MCXA 2LYPA 1L1MA 2OV8A 2R03A 1NP7A 3IHVA 4AJWA 3HXDA 2WM9A 3CKCA 2WXNA 4G1TA 5DRYA 4MRUA 4IVZA 2A4ZA 2OR1L 1OCRE 3AG3E 3UMVA 1H6KA 3RSEG 3SGHA 3L1PA 1V54E 4WWNA 2WQ7A 5HKPA 2MXDA 4HOSA 5K98B 4FA6A 4L23A 2WXHA 2IO2C 2QY7A 1S64A 3V2XA 1QQAA 3ZU7B 2LSVA 3UT4A 3Q78A 2VSOE 1QQEA 3SY2A 1BDHA 3G2WA 3PEVB 3MV3B 1ZBPA 2IO3C 2VTBA 1TR4A 1JPLA 1FVHA 3EIJA 1KT1A 2EIME 1E3OC 2XEVA 1DCQA 4CYMD 4U63A 1ZVVA 3KD7A 3I4RB 1N0RA 2KEJA 3ABME 3RRUA 4J1WA 3PDNA 4F53A 1H2TC 3ZPJA 2FF4A 3FTYA 2XGSA 4EZLA 3ZKCA 3PEUB 4A63B 1JWLA 2VSYA 4JHJA 1O1RA 2WUSR 3MJWA 4L2LA 4IWRA 5M72A 3ZRHA 4UUCA 2X6IA 4K5CA 2C0MA 1UN8A 1TN6A 5BW8C 1WIZA 3F6QA 3MKQB 2IONA
chains in the Genus database with same CATH topology
4E85A 5EDSA 2WQHA 2KCLA 2HO1A 2LO6A 3F52A 3LXUX 4ILIA 3JXCL 4BWRA 2P58C 1BPOA 4LRZA 5D0OD 1EFAA 4YBAA 3D9JA 2LAIA 4H7XA 3TRBA 4I6UA 4DI3A 1ZPQA 3OTNA 5AJLA 3AS4A 3CQCB 3FUDA 3LY7A 2OFYA 3KJXA 1H19A 1NEQA 3OQOA 1OWMA 4X4DA 1OWOA 1CQTA 1OCTC 3FTVA 3QJZA 4OB4A 4IRUA 4RG6A 4YVQC 5JJTA 3LS8A 1DVPA 3B13A 1EDUA 5LP0A 4B8CB 3F6WA 3CVYA 3CHRA 1OSLA 4YG4A 3CECA 2I1KA 3CR3A 1HF8A 3PUKA 1WH8A 2Q7FA 4JA9A 2KEIA 2AXZA 2WXQA 4JEUA 4ACKA 5G04J 3FTWA 4W9RA 3SBTB 1QNFA 2V4LA 3Q4AB 2BTDA 4B8AA 3QC1A 4PS8A 3QNKA 4GQMA 1X5BA 4XE0A 3WXXA 3C98A 3CVQA 2O49A 5C2YA 3KEZA 3OXFA 3PREA 4BT9A 1EYHA 3APDA 2A5UA 3R7RA 2YQ8A 1PNRA 3CK7A 3HVEB 3LKUA 4DK5A 5BV1A 4HORA 2EWTA 3EHMA 3L6AA 1YSEA 5DIZA 4GYOA 2B5AA 4OVVA 4QFVA 3FULA 4JPSA 1WH6A 2O38A 3QARA 3ASHA 1UXCA 3EUSA 2AVPA 3ZHMA 3DBSA 2PPXA 2VQ2A 1HXIA 3RJVA 4PS7A 4ABNA 3QYXA 1CJGA 1ELRA 1H2VC 4I8TA 2VGYA 1TJFA 3SCHA 3FY4A 2KPJA 3RU0A 2WXRA 4G11A 2IOLA 2NSZA 4NACA 4M3OA 1HZ4A 3L16A 3L13A 2NXPA 4MCTA 3T5XA 3SFZA 3S7JA 4Q96A 3FYAA 2H8RA 1HX8A 2PZIA 2HR2A 5KJNA 4WNDA 1Z3YA 5G2NA 4EZJA 3CLCA 2CFZA 4N2SA 5KJMA 2BNNA 2I2OA 4GA0A 3R7QA 3ZN3A 3LY8A 3IVPA 5A6CA 1SQMA 5JHBA 4G25A 4X4CA 3QWWA 4J1XA 3QKYA 4I6TA 2KZ8A 3FH7A 5E75A 3RZZA 3PE3A 4WUYA 3IV0A 2WXMA 4E6HA 3T5VA 5FQ4A 4X4HA 4FLHA 3CHSA 4O6FA 1Y6IA 2JVLA 2XCCA 4CDRA 3ASDA 3G7DA 2IVBA 2R1JL 2L49A 1WAO1 3QWPA 4GZCA 3G2UA 3BS3A 2WXJA 1WY6A 3CHPA 2HM8A 4YNDA 2BF0X 1L5JA 3UT8A 4AM9A 3GZ1A 3QAQA 1JWGA 1LQCA 5JJ7A 1YA0A 2LYRA 3CK8A 2LYLA 4HVBA 3K9IA 3S7DA 2GW1A 5FWQA 4ANWA 2EF8A 1IQRA 3B7UX 4A1SA 3U64A 5LCWC 4JXTA 3U3WA 1LLIA 1E7UA 1NA0A 2IV1A 1PC2A 4NRHB 1KT0A 4IULA 3GW4A 3ZXSA 1FVFA 5KJKA 3RRMB 3LYAA 3E4BA 2VGXB 3I4GA 3SI5A 3P1UA 1OWLA 5KCMA 2PM7A 5A7DB 3SZ7A 1X57A 3D9OA 3HIZA 3CHOA 4Q94A 3IBEA 5AJDA 3SHFA 3GZSA 1QPZA 3ONLA 2C0LA 3L17A 2L0TB 3JQ1A 1TJCA 2AUWA 2MOWA 5J90A 3U4TA 4UWHA 4DLOA 2DBAA 3ZGQA 2XIUA 4BSXA 1RZSA 5ANRA 2CG3A 1WETA 3DNVB 2CHZA 3GBFA 1RZRD 2WPVA 4I1MA 4Z5CA 2GRLA 3KZ3A 2FJRA 2KCKA 4GZDA 5BT1A 5FT9A 4Z58A 3CVXA 1FCHA 4B94A 1PRVA 3JUIA 1UTXA 4GPKA 3G2VA 2CROA 4KMOA 2PQRA 3CSFA 3L08A 3F51A 2WXOA 1UG3A 3S2AA 3PUJA 3ZYKA 4ANXA 2BNMA 4CGVA 1N54A 4WNEA 1PRUA 4RVBA 2V0PA 1OWPA 2PQNA 2XI8A 2X6FA 1XWRA 3O9XA 1RIOA 2X6HA 2OOEA 3GZ2A 2CSFA 3QQ6A 1Z3XA 4GYWA 4KZ0A 4WWPA 3SF4A 2V8SE 3FUKA 4U0SA 4GMJA 3OAWA 4N39A 4KVMA 3CKBA 3FTXA 3D1NI 4ANVA 3MKQA 1E96B 2O4AA 2ZU6B 1HF0A 4GCNA 4AP2A 3MKRA 4ILGA 4Z5DA 4KZCA 2YHCA 2R59A 2GGFA 4N3AA 3VK0A 4I1OB 5T4YA 4Y42A 1ZS4A 4FN3A 3RK6A 3AU5A 3ONKA 4JL0A 4APFA 4URKA 1LF8A 4OYSA 3B7TA 4N2QA 3HYMB 3NQPA 3G2TA 2L8NA 4I1AA 2MHKA 4N3BA 3ZYLA 3ZYQA 3L54A 1U3CA 2BJCA 4GZ6A 3FMYA 1HO8A 4LERA 5LOZA 3ZEFA 3APCA 5ARFA 4Y6CA 3LFPA 1HU3A 2ILRA 4GCOA 1PRAA 5E76A 5DBKA 1NERA 3CROL 2ICTA 3S8QA 4JQDA 2UY1B 2MEZA 3FYMA 4GA2A 4PU7A 4RSYA 2OVBA 3O48A 3FTUA 1MHQA 3QF3A 1QZ2A 2UY1A 4WNFA 1ZUGA 2LYSA 3HVEA 4NQ0A 4FLBA 4NDWA 2XCBA 3SNXA 4CGWA 3PE4A 2I9CA 2WXLA 5BPPA 1ELKA 2IOSA 2X6JA 1JWFA 3O4ZA 4JVSA 4GYYA 3SBSA 1SZ9A 3CVNA 2IUOA 4FP7A 3ZHIA 3GN5B 2LCVA 1LCCA 1HH8A 4C0MA 2AW6A 2DCPA 1X2LA 4JZYA 5D0QD 3CVUA 3FUEA 4AIFA 5CCMA 3ESLA 2LYKA 4H7YA 3B7HA 2D5VA 3R1FA 5FQ7A 4BTBA 3TG4A 4CDMA 5KJLA 2KZTB 4DLQA 2IU1A 3FU5A 5LX8A 2DIWA 2X38A 4BX9A 5CMYA 4I6RA 4DPRA 1PERL 1ZU2A 1HE8A 3LCAA 4I2ZA 3RIBA 3ZHEB 1AU7A 4UWKA 1NA3A 5FQ6A 1HG5A 2XGMA 4CT4A 4A1GA 3HHMA 1GT0C 1TEZA 2EBYA 3VLEA 3CK9A 2BNOA 2X3MA 4NURA 3TGOA 2IF4A 4F8DA 4GMLA 4EQFA 3UPVA 3D9PA 3MV2B 2FEZA 3G5GA 3MYVA 4UQZA 3QOUA 3FH5A 4PS3A 5G04C 2IU7A 3FDHA 3MKQB 2M63A 3FH8A 4GZ5A 4IYPA 1EPUA 1UN9A 1S7EA 3ZFWA 2Y3AA 3BEEA 1E90A 1W3BA 2WXFA 4FJYA 3AS8A 3U9WA 4F7AA 4ACLA 4I2WA 1RZRA 2KCVA 3D9NA 3Q15A 1QQBA 3SCGA 4F1SA 3ASGA 1MQSA 3G2SA 1H0AA 4KBQA 3TXMA 2WB2A 1H2UA 4O8BA 4XX5A 1Y9QA 3Q47B 2RD0A 1Y8MA 4G24A 3FUIA 1R69A 3ENEA 4WNGA 1ZZ8A 2VSNA 5T8IA 3UT7A 5G05J 3Q49B 4KXKB 2WMNA 4HLEA 4ME2A 4G23A 3ZIMA 3CLJA 2UWJG 1UXDA 4JHKA 4KT6B 2FO7A 3ML8A 3JCKC 2E2EA 2VTBB 4X4BA 5FJYA 3GYZA 4FHKA 4MLPA 5AENA 1LCDA 3EJNA 3PH0C 2VGXA 3B7RL 4IN3B 3NF1A 1DW9A 1A17A 3LPZA 5LFAA 2XRYA 2XPIA 4P29A 4DJAA 3PS6A 3JYSA 4ILHB 1EF1C 3AU4A 1INZA 3UFDA 3OQNA 4LUNU 3VTXA 2XQ0A 2J08A 4UWFA 5ENNA 3MEKA 2HINA 4HOQA 3QWVA 4JCXA 1PAQA 4PUCA 4YG7B 2OVFA 2NC9A 3TJPA 4AXHA 1ZZCA 4R7LA 4JCYA 3HZIB 1E7VA 4YG1A 1LMB3 4A55A 3JXBC 2AXVA 2X6KA 5J08A 4X4GA 4C9BB 2LAHA 3NZUA 3OP9A 4FC8A 1ZAYA 4I6EA 5FQ8A 3NZSA 4BY6A 2GZUA 1R63A 3EIQC 2LSUA 4A3TA 4XZ4A 2EQXA 4XKBA 4D10C 5FZQA 1RPEL 5FZSA 3FEXA 2IVQA 4G2VA 4N3CA 4HXIA 2YNQA 2R17C 1SQ8A 4HOUA 4U0UA 4FULA 3SCFA 3S7FA 2MQKA 4PU8A 4I9EA 3SD5A 3UUXA 4BX8A 5C1DA 3CIAA 3D9KA 2LYQA 3FU6A 4U0ZA 3RO2A 4GAAA 3S7BA 3JQ0A 3CVVA 2KC7A 1PY1A 3CHMA 2AWIA 1UJKA 2J09A 2PUCA 2YHEA 3ASFA 3LEWA 2Y4UA 3KXAA 3MA5A 3VTYA 4CEMA 4Z5HA 3OQMA 3ZW3A 4APOA 4FBIA 2KM4A 1B0NA 3OXGA 1HFAA 4UQYA 4DI4A 4J6IA 4EBAG 2PL2A 3FUNA 2L6JA 3ZVVA 5ANLA 2J9QA 4C0EA 5A23A 3FHEA 2XJ3A 4XI9A 2Y4TA 2VJ8A 3D3MA 3AS5A 3QWGA 4X4IA 2PUBA 4PH4B 4JA7A 3FUJA 3I3NA 2J4BA 2XPZA 5FZRA 3PXPA 3CSTA 4I6GA 3FEYA 2L9BA 4RG9A 3TG5A 4EECA 5CMWA 2WQ6A 4I6JA 3TXNA 2WXIA 3QB2A 5CHEE 3TAXA 3PNLB 4B89A 1HS6A 5FTPA 4PU3C 3RRNB 2AXUA 2J49A 1IC8A 2CHXA 3RO3A 2PUDA 3APFA 4I9CA 4F3VA 5BV0A 1ZZBA 2HYZA 3LISA 3KAEA 4FHJA 3ULQA 5LCWJ 4I17A 3H5TA 2JLBA 4HFGA 1JFSA 2IVGA 1N52A 4MKTA 3KS2A 4WAFA 2LNIA 3FFLA 2FI7A 3MX3A 3QDNA 5ARGA 5HI7A 1SZAA 3CQGB 1P5QA 4U8HA 3D9LA 2J07A 4YVOA 1E8XA 3MGBA 1UW4B 2MRIA 3N71A 1XNFA 3FP3A 4J8DA 2XCJA 4UI9C 1XGWA 4J8FA 4U07A 4PU4C 1DNPA 2KATA 3LVQE 4LEUA 1QP7A 5AYWD 5T3RA 4FADA 1IQUA 3LJ3A 2C2LA 1IHGA 3GN5A 2XPYA 2KEKA 4UWGA 5EX0A 1S0PA 3CHQA 2RG8A 3L22A 3FUFA 2PIJA 2IJGX 4Y6WA 1VPWA 4J8SA 3CVLA 1JH9A 2PM6A 3IEGA 2JCGA 3QK0A 4YARA 4ANUA 2KZTA 4N5CA 1GW6A 3PNTB 3PZDA 4GHJA 2V5FA 2CG2A 2L0IA 2GRMA 2CHWA 3LVRE 3MCXA 4IA8A 3FTSA 4L1BA 4UQXA 4J8EA 2WVIA 3DPDA 3LDZA 5JHAA 1DWKA 4TV3A 1E8ZA 1E8YA 2WMOA 3CVWA 3ZHEA 1QP0A 2IFUA 3MZLB 3VLFA 4FJZA 4CRWA 3PRZA 2A6CA 4FU3A 4TRQA 2IQCA 4AVXA 1POUA 4MCXA 2LYPA 1L1MA 2PUAA 2OV8A 3ML9A 4UWLA 3UQ3A 2WIUB 3BG1B 1NP7A 3IHVA 3ZYMA 4Z59A 3U66A 4AJWA 3Q5MA 2WM9A 4BT8A 3CKCA 2WXNA 2FBNA 4G1TA 3RKVA 3FWVA 3UX4A 4A3VA 4MRUA 4IVZA 1UJJA 3MLFA 1JFTA 2A4ZA 3D9MA 1OUVA 4TUUA 3VLDA 2I6HA 3I5PA 4AOFA 2XSDC 2OR1L 2WXGA 4GU5A 3BDNA 2ONDA 3UMVA 2PUGA 1H6KA 4KVOA 2I1JA 4X4FA 2E0IA 2PE5A 3ESKA 3L1PA 3FU3A 3SGHA 4EZKA 4GB9A 4I43A 4WWNA 5CCLA 2VSXE 2WQ7A 3T8MA 4JEHA 2VYIA 3R9AB 5K98B 4XI0A 4FA6A 5BNWA 4L23A 4HOSA 2WXHA 1BDIA 2QY7A 2BUGA 1QQAA 3LY9A 3FUHA 4BFRA 1Z6TA 2LSVA 4CT0A 3UT4A 1HG2A 1QQEA 2VSOE 1JUQA 3FU0A 1BDHA 4GZ3A 4UI9K 4AY6A 2R63A 1NZNA 5EKQD 4X4EA 3IHYA 4CCAA 4EPZA 5HQ8A 3G2WA 3PEVB 3MV3B 1ZBPA 2VTBA 4MS6A 2WXPA 1JPLA 3BD1A 1FVHA 3EIJA 4KYOB 4Q69A 5BUZA 1KT1A 1E3OC 4XIFA 2XEVA 2XRZA 1KLXA 2FULA 1ZZ9A 2PUFA 1O4XA 1ZZ7A 4HS2A 4U63A 1ZVVA 1Y7YA 3KD7A 1QP4A 3CGHA 4WWOA 4EBAA 2WXKA 5JJ6A 3I4RB 4BTAA 2KEJA 2QFCA 3D9IA 3RRUA 3P2BA 4J1WA 3PDNA 3URZA 4F53A 3HDXA 1H2TC 2LYJA 1U3DA 3ZPJA 2CFUA 4G26A 4XKCA 2FF4A 4AV7A 4B0ZA 1ELWA 5AIJA 4HOTA 3JXDL 5G55A 4K0RA 4GA1A 3FTYA 3B7SA 4LCTA 3OMTA 2XGSA 4EZLA 4JC8A 2J4DA 4JW1A 3TL5A 1ADRA 3FTZA 4ATGA 4UI9J 3ZKCA 3FUMA 3PEUB 4U04A 4CDNA 4L2YA 1JWLA 2PUEA 1ZZ6A 2VSYA 3PVLA 4JHJA 1E8WA 1B89A 2WUSR 5EX3A 1VDYA 2YINA 3MJWA 3CVPA 4L2LA 4PDXA 4AEZC 4AY5A 3OXLA 3EHNA 4JHRA 2XHEA 5A7LA 1OWNA 4IWRA 2R5SA 4K03A 5G05C 5M72A 3ZRHA 4OVUA 2X6IA 3CV0A 4V3IA 1IYGA 4J0UA 3EDTB 2C0MA 1UN8A 2JEKA 1WM5A 2ICPA 3IKOB 2XGOA 4L7TA 1WIZA 5BW8C 3CEQA 3BG0B 2HSGA 2IONA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QPZ A;  4PU4 C;  1S7E A;  1QP7 A;  3F52 A;  3JXC L;  3GN5 A;  2AUW A;  2KEK A;  1EFA A;  4YBA A;  1RZR A;  2PIJ A;  3TRB A;  2XIU A;  4I6U A;  3SCG A;  1QQB A;  1RZS A;  1VPW A;  1ZPQ A;  3DNV B;  1JH9 A;  3GBF A;  1WET A;  2JCG A;  2OFY A;  3KJX A;  4YAR A;  1NEQ A;  4O8B A;  3OQO A;  1Y9Q A;  4Z5C A;  2GRL A;  3KZ3 A;  2FJR A;  4GHJ A;  4OB4 A;  4X4D A;  1R69 A;  1CQT A;  2GRM A;  4Z58 A;  1OCT C;  1ZZ8 A;  4IA8 A;  1PRV A;  3F6W A;  1UTX A;  1DWK A;  1RZR D;  1OSL A;  2CRO A;  3CEC A;  4YG4 A;  1QP0 A;  3F51 A;  1WH8 A;  2BNM A;  2KEI A;  2AXZ A;  1UXD A;  2A6C A;  1PRU A;  1POU A;  4X4B A;  4MCX A;  2LYP A;  2XI8 A;  1L1M A;  2PUA A;  1XWR A;  3O9X A;  1RIO A;  4GQM A;  2WIU B;  1LCD A;  2CSF A;  3QQ6 A;  2O49 A;  1DW9 A;  4Z59 A;  1PNR A;  3D1N I;  4IVZ A;  3UFD A;  3OQN A;  3MLF A;  1JFT A;  2EWT A;  2O4A A;  1YSE A;  1HF0 A;  2B5A A;  2HIN A;  2XSD C;  2OR1 L;  4JCX A;  4YG7 B;  1WH6 A;  2O38 A;  4Z5D A;  3BDN A;  1ZZC A;  2PUG A;  1UXC A;  3EUS A;  4X4F A;  4JCY A;  2PE5 A;  3L1P A;  3HZI B;  2PPX A;  3ZHM A;  4YG1 A;  1LMB 3;  3VK0 A;  3JXB C;  2AXV A;  4Y42 A;  5K98 B;  3QYX A;  1ZS4 A;  1CJG A;  4FN3 A;  4X4G A;  4I8T A;  1BDI A;  3OP9 A;  1ZAY A;  3SCH A;  2KPJ A;  1QQA A;  2GZU A;  1R63 A;  2L8N A;  1BDH A;  2R63 A;  4MCT A;  2BJC A;  3FMY A;  1RPE L;  4X4E A;  3FYA A;  2IVQ A;  2H8R A;  3LFP A;  1SQ8 A;  1PRA A;  3SCF A;  2MQK A;  4PU8 A;  1NER A;  3CRO L;  3BD1 A;  2ICT A;  3S8Q A;  3CLC A;  2LYQ A;  4JQD A;  2MEZ A;  3FYM A;  4PU7 A;  1E3O C;  2BNN A;  2AWI A;  1ZZ9 A;  2PUF A;  3QF3 A;  2PUC A;  1O4X A;  1ZZ7 A;  1ZUG A;  2LYS A;  3IVP A;  3KXA A;  1Y7Y A;  1ZVV A;  1QP4 A;  4NDW A;  4Z5H A;  3OQM A;  4X4C A;  2KEJ A;  4J1X A;  4FBI A;  4J1W A;  1B0N A;  2KZ8 A;  4I6T A;  3RZZ A;  2LYJ A;  2IUO A;  4X4H A;  2XJ3 A;  3ZHI A;  3GN5 B;  2JVL A;  2LCV A;  3JXD L;  1LCC A;  2AW6 A;  1X2L A;  2IVB A;  3G7D A;  2L49 A;  3OMT A;  3QWG A;  4X4I A;  2R1J L;  2PUB A;  2LYK A;  3BS3 A;  1ADR A;  3B7H A;  2D5V A;  3R1F A;  3PXP A;  3ZKC A;  1LQC A;  1JWL A;  2PUE A;  1ZZ6 A;  2LYR A;  4I6R A;  2LYL A;  2WUS R;  1PER L;  4PU3 C;  2AXU A;  2EF8 A;  1IC8 A;  5A7L A;  1AU7 A;  2PUD A;  4IWR A;  1ZZB A;  3LIS A;  1GT0 C;  3U3W A;  1LLI A;  2EBY A;  2IV1 A;  3H5T A;  2BNO A;  1JFS A;  2IVG A;  4F8D A;  3G5G A;  2IU7 A;  1X57 A;  2ICP A;  1WIZ A;  2XCJ A;  2HSG A; 
#chains in the Genus database with same CATH topology
 2KCL A;  3JXC L;  4YBA A;  4O1O A;  2GRO B;  4QQI A;  3AS4 A;  3OQO A;  1OCT C;  4RG6 A;  3F6W A;  4LSZ E;  2I1K A;  3CEC A;  3CR3 A;  3UIN C;  4JEU A;  2AXZ A;  2WXQ A;  1QNF A;  2V4L A;  4ZFH A;  3OXF A;  3PRE A;  5BV1 A;  3LKU A;  1SA4 A;  3L6A A;  1YSE A;  2B5A A;  4QFV A;  3FUL A;  2PPX A;  5CER B;  4PS7 A;  1D8D A;  3V30 A;  1G3N B;  1TJF A;  3SCH A;  1OY3 D;  3E32 A;  2WXR A;  4G11 A;  4NAC A;  1BI8 B;  4M3O A;  3L16 A;  3KSQ A;  4MCT A;  3FYA A;  1HX8 A;  1DUL A;  5HRY A;  5KJN A;  4WND A;  4DRX E;  3DSS A;  4N2S A;  5EID A;  3ZN3 A;  4O1P A;  5AAR A;  2PXE A;  4X4C A;  5E75 A;  3RZZ A;  4DX7 D;  2WXM A;  3CHS A;  1Y6I A;  2R1J L;  5FIO A;  3BS3 A;  1L5J A;  1H6O A;  2LUH A;  1LQC A;  5JJ7 A;  2V5Q C;  2V3C C;  3U3W A;  1LLI A;  4NRH B;  4HLL A;  3GW4 A;  3ZXS A;  3DRA A;  1OWL A;  3D9O A;  3HIZ A;  4Q94 A;  2QYU A;  2KXP C;  5B1A E;  5J90 A;  2DBA A;  4BSX A;  3DNV B;  1UOH A;  2WPV A;  2FJR A;  5BT1 A;  5FT9 A;  3CVX A;  3JUI A;  4KMO A;  3F51 A;  2WXO A;  3S2A A;  4LNB A;  1Z5S C;  4WNE A;  4RVB A;  2PQN A;  2X6H A;  1XWR A;  4UI9 J;  4AM9 A;  3PZ1 A;  3C3O A;  2XEH A;  3D1N I;  4HRA A;  2ZU6 B;  4ILG A;  4GTR A;  4I1O B;  3HG0 D;  1FPP A;  5CED B;  4URK A;  1LF8 A;  3HYM B;  3NQP A;  3G2T A;  4I1A A;  2MHK A;  1LD7 A;  4N3B A;  5CEA A;  3L54 A;  3ZEF A;  3APC A;  2DZN A;  1PRA A;  5DBK A;  5CRV A;  4RSY A;  2OVB A;  4GTO A;  2UY1 A;  3QF3 A;  1ZUG A;  2LYS A;  4NQ0 A;  3SNX A;  3PE4 A;  2WXL A;  5BPP A;  4HI8 A;  2IUO A;  1HH8 A;  1X2L A;  3FUE A;  3B7H A;  1DC2 A;  2IU1 A;  5ENT D;  4BX9 A;  2X38 A;  5CMY A;  4DPR A;  1ZU2 A;  1HE8 A;  4UWK A;  2B0O E;  4CT4 A;  2XGM A;  4RLY A;  1TEZ A;  3VLE A;  3CK9 A;  2QYJ A;  2IF4 A;  4F8D A;  4GML A;  4BET A;  3D9P A;  2FEZ A;  2M63 A;  1S7E A;  3PZ2 A;  2WXF A;  4F1S A;  3ASG A;  1MQS A;  1KZP A;  1H0A A;  1H2U A;  3LQX A;  3ENE A;  4WNG A;  1ZZ8 A;  5G05 J;  2WMN A;  4LG6 A;  3ZIM A;  3CLJ A;  2UWJ G;  4HRL A;  4MBG A;  3ML8 A;  5CRU A;  2VTB B;  1LCD A;  2XEE A;  1DW9 A;  2XRY A;  3UTM A;  3VTX A;  2J08 A;  3D9H A;  4AXH A;  4BER A;  4K5A B;  4M7C A;  4X4G A;  1JCQ A;  2LAH A;  3OP9 A;  5FQ8 A;  1ZAY A;  2GZU A;  3TWV A;  4A3T A;  2LLW A;  4D10 C;  5FZQ A;  1SQ8 A;  2H6H A;  4HOU A;  3SD5 A;  3HXF A;  3W9F A;  3CIA A;  3D9K A;  3FU6 A;  4U0Z A;  3JUE A;  3NOC D;  4ER7 A;  3CHM A;  3TWT A;  3OQM A;  4DI4 A;  4C0E A;  2J9Q A;  3ZNG A;  2PXP A;  3D3M A;  2XEN A;  2PXF A;  2PUB A;  3Q7A A;  3FUJ A;  1TNO A;  2J4B A;  3TG5 A;  4U7E B;  4EEC A;  5CMW A;  4I6J A;  3TXN A;  2WXI A;  3QB2 A;  5CHE E;  2AXU A;  1IC8 A;  2CHX A;  1ZZB A;  2HYZ A;  3LIS A;  3ULQ A;  4I17 A;  1JFS A;  2FFH A;  3C5R A;  3QDN A;  5ARG A;  4EKI A;  1P5Q A;  4YVO A;  1O5M A;  1XGW A;  4PU4 C;  5AYW D;  2KAT A;  3LJ3 A;  5DTM A;  3T8K A;  2PIJ A;  2IJG X;  5ENR D;  1VPW A;  3NBN B;  4J8S A;  4N5C A;  4Z68 A;  2GRM A;  4UQX A;  2Y69 E;  2DVW A;  4L1B A;  4J8E A;  1E8Y A;  3UI2 A;  3MZL B;  2ZGD A;  3PRZ A;  2A6C A;  4HRN A;  3J5P A;  1QYM A;  2OEW A;  4UWL A;  3UQ3 A;  3Q5M A;  3TWU A;  3FWV A;  1YCS B;  4DE8 A;  1UJJ A;  5IY5 E;  3D9M A;  4OAU C;  2I6H A;  4AOF A;  2OND A;  3BQO A;  2AJA A;  4X4F A;  2E0I A;  1LD8 A;  4I43 A;  4X8Q A;  4JEH A;  2VYI A;  3R9A B;  1BDI A;  2BUG A;  1Z6T A;  5ENS D;  1JUQ A;  2LXL A;  3FU0 A;  2PXK A;  4GTS A;  1NZN A;  4F6R D;  2ODR D;  3BD1 A;  4KYO B;  3DXK G;  2ETA A;  2HFZ A;  1ZZ7 A;  4WWO A;  4EBA A;  2WXK A;  3D9I A;  1MX4 A;  3URZ A;  3HDX A;  4EHM A;  5AQA A;  4XKC A;  5AIJ A;  1ELW A;  2RFA A;  3B7S A;  4CDN A;  4L2Y A;  2EIL E;  1IKN D;  3PVL A;  3U66 A;  4BEP A;  3EHN A;  4JHR A;  4OAV B;  4GMR A;  3SFY A;  3TWQ A;  1FT1 A;  3QOW A;  2XZT G;  2JEK A;  3NXH A;  2ICP A;  4BX8 A;  3CEQ A;  3LY8 A;  2V5F A;  5EDS A;  2WQH A;  1JCR A;  3Q7F A;  1BPO A;  3D9J A;  4H7X A;  3NRO A;  3DM5 A;  3FUD A;  3LY7 A;  2I2O A;  1OWM A;  5JJT A;  4YVQ C;  1DVP A;  3B13 A;  3CVY A;  5D66 A;  4ACK A;  4U8Y D;  2BTD A;  2XXQ A;  1NFI E;  4PS8 A;  4GQM A;  1X5B A;  4XE0 A;  3WXX A;  2O49 A;  4BT9 A;  3TEP A;  1PNR A;  4HOR A;  5B3S E;  2EWT A;  3EHM A;  5DIZ A;  3UWP A;  4GYO A;  2BED A;  2O38 A;  3EUS A;  2AVP A;  4EK9 A;  2P9N G;  3DSV A;  3DBS A;  1HXI A;  2PXB A;  4ABN A;  1ELR A;  1CJG A;  4I8T A;  2LXM A;  3TWR A;  1QB2 A;  3FY4 A;  2KPJ A;  1HZ4 A;  3SQV A;  4BES A;  3SFZ A;  3S7J A;  3WG7 E;  3PE5 A;  3CLC A;  5KJM A;  4EZI A;  2BNN A;  5A6C A;  1SVX A;  3DSU A;  2RFM A;  4X4H A;  3KEA A;  3G7D A;  2WXJ A;  3QFI A;  4YND A;  3UT8 A;  3GZ1 A;  2R02 A;  3CK8 A;  1X81 A;  3K9I A;  2JAB A;  3UIO C;  3HXC A;  1PC2 A;  1NA0 A;  1FVF A;  3RRM B;  3I4G A;  5KCM A;  1X57 A;  3CHO A;  5AJD A;  3SHF A;  3Q9N C;  2DZO A;  2L0T B;  4L9P A;  3GZD C;  1WET A;  3EUV A;  3GBF A;  1RZR D;  4I1M A;  4GZD A;  2KCK A;  1OCZ E;  3VWS A;  1FCH A;  1K1B A;  4B94 A;  1UTX A;  3Q75 A;  4GTP A;  3G2V A;  4GPK A;  2PQR A;  1N54 A;  3NDB B;  3O9X A;  1RIO A;  3GZ2 A;  2CSF A;  1Z3X A;  4C48 B;  2V8S E;  3FUK A;  4U0S A;  3OAW A;  4N39 A;  3FTX A;  2DWZ A;  1E96 B;  2O4A A;  5GAG i;  4GCN A;  1HF0 A;  3MEJ A;  3HXB A;  4N3A A;  5JUW A;  4J7W A;  4FN3 A;  3B7T A;  2PXQ A;  1YYH A;  1SW6 A;  4GZ6 A;  3FMY A;  1HU3 A;  2ILR A;  3CRO L;  2ICT A;  4JQD A;  4GA2 A;  1TNY A;  2EIK E;  1S70 B;  3NZL A;  1D8E A;  4NDW A;  2XCB A;  5KWD A;  2I9C A;  5GAH i;  2NYJ A;  2F37 A;  2IOS A;  5EYL A;  2EIJ E;  4JVS A;  4GYY A;  1SZ9 A;  3CVN A;  4B93 B;  1OCO E;  2AW6 A;  3C3Q A;  3ESL A;  2LYK A;  5D2M C;  4H7Y A;  3R1F A;  5FQ7 A;  3FU5 A;  5LX8 A;  4HI9 A;  4G8L A;  3DST A;  4I2Z A;  1AU7 A;  4ATZ D;  1NA3 A;  1HG5 A;  3HHM A;  2BNO A;  3MV2 B;  4YDE A;  3GZC A;  1N94 A;  3FH8 A;  2GRQ B;  4FJY A;  4F7A A;  4ACL A;  2PXU A;  3JXI A;  1N4Q A;  3G2S A;  4XX5 A;  4O8B A;  2PNN A;  1Y8M A;  4G24 A;  1R69 A;  2P9U G;  5T8I A;  3Q49 B;  4GTT A;  1V55 E;  2P9I G;  4ME2 A;  4ER6 A;  2A5E A;  5FJY A;  3GYZ A;  3EJN A;  3NF1 A;  5LFA A;  4DJA A;  3UM2 A;  1INZ A;  4LUN U;  3OKZ A;  3DPY A;  4HOQ A;  4PUC A;  3AJI A;  4F1P A;  2NC9 A;  1ZZC A;  4R7L A;  4JCY A;  4HRM B;  1LMB 3;  2DYS E;  4A55 A;  2X6K A;  4DX6 D;  4C9B B;  2IEJ A;  2ZIR A;  4I6E A;  4BY6 A;  3EIQ C;  3FEX A;  4RQI A;  4N3C A;  4U0U A;  4F3V A;  4PU8 A;  3GUU A;  2LYQ A;  3S7B A;  2KC7 A;  2J09 A;  2KBX A;  3VTY A;  3ASF A;  3LEW A;  2F8Y A;  1TN7 A;  5ANL A;  5A23 A;  2VJ8 A;  3SFX A;  3QWG A;  4JA7 A;  3I3N A;  2XPZ A;  4RG9 A;  3FEY A;  2L9B A;  4OBM A;  3AAA C;  3PNL B;  1WG0 A;  3TEL A;  3RO3 A;  1JCS A;  3ISM C;  1TN8 A;  1D9S A;  3NAW A;  4FHJ A;  3H5T A;  4HFG A;  3T9K A;  1OCC E;  3UM1 A;  5HI7 A;  1SZA A;  4U8H A;  3D9L A;  4J8D A;  3N71 A;  1XNF A;  2XCJ A;  2F0Y A;  2J7U A;  2HE0 A;  4UI9 C;  4J8F A;  1DNP A;  1IQU A;  4UWG A;  2KEK A;  1S0P A;  3CHQ A;  3FUF A;  3ULE G;  2L1P A;  4ANU A;  3PZD A;  4GHJ A;  2J7W A;  2CG2 A;  3LVR E;  5LCW J;  3DPD A;  5JHA A;  1DWK A;  1E8Z A;  5ENQ D;  3V2O A;  1N4P A;  3VLF A;  4FU3 A;  4TRQ A;  4AVX A;  3ML9 A;  2PUA A;  4HQD A;  3KL4 A;  3ZYM A;  2YBD A;  4Z59 A;  3UX4 A;  2Y0B G;  3MLF A;  1OUV A;  4TUU A;  4GU5 A;  2VGE A;  2PUG A;  4KVO A;  2I1J A;  3ESK A;  2PE5 A;  4EZK A;  1N9A A;  2B6C A;  2VSX E;  3T8M A;  4XI0 A;  5BNW A;  2PXV A;  3FUH A;  4CT0 A;  1HG2 A;  2J8S D;  4GZ3 A;  4UI9 K;  4AY6 A;  2R63 A;  4X4E A;  4CCA A;  3E30 A;  3Q79 A;  2GRN B;  4DX2 A;  5KBA A;  2WXP A;  5BUZ A;  4HNA D;  4XIF A;  1KLX A;  2PUF A;  1A5E A;  1QP4 A;  3CGH A;  5EIL A;  4BTA A;  2QFC A;  3P2B A;  5KNG A;  2CFU A;  4AV7 A;  4B0Z A;  4HOT A;  4GA1 A;  3OMT A;  4ER0 A;  2XZD G;  2J4D A;  4JW1 A;  3TL5 A;  2HCS A;  3ZXP A;  3FUM A;  4U04 A;  5EYP F;  4YDW A;  1ZZ6 A;  1B89 A;  2YIN A;  4PDX A;  3UM0 A;  3CVP A;  3OXL A;  2XHE A;  2R5S A;  4K03 A;  5G05 C;  5B1B E;  2P9K G;  4OVU A;  1IYG A;  4J0U A;  5CBO A;  5EN5 D;  3IKO B;  1N95 A;  2XGO A;  3BG0 B;  2LO6 A;  2HO1 A;  3F52 A;  4ILI A;  1Q2Z A;  2P58 C;  3Q9U C;  1EFA A;  5BXO A;  2LAI A;  3AG1 E;  2OCC E;  4ER3 A;  3OTN A;  5AJL A;  5H7P A;  2OFY A;  5AEN A;  1CQT A;  3FTV A;  4IRU A;  4OB4 A;  3LS8 A;  1EDU A;  4B8C B;  1BI7 B;  2GRR B;  4EKG A;  4YG4 A;  1HF8 A;  2QZA A;  2Q7F A;  4JA9 A;  5G04 J;  4W9R A;  2L6B A;  4B8A A;  3QC1 A;  1NL4 A;  3CVQ A;  1EYH A;  3APD A;  2A5U A;  3R7R A;  2YQ8 A;  3CK7 A;  4DK5 A;  2H6G A;  1KZO A;  5DTQ A;  4JPS A;  1WH6 A;  2XXP A;  3ASH A;  3ASN E;  3ZHM A;  3E34 A;  2VQ2 A;  3RJV A;  1H2V C;  2VGY A;  3B7B A;  4GTV A;  2XXA A;  3RU0 A;  1IHB A;  3L13 A;  2NXP A;  1MFQ C;  3T5X A;  4Q96 A;  3HRA A;  2H8R A;  2HR2 A;  4EZJ A;  1Z3Y A;  5G2N A;  3IVP A;  5JHB A;  4G25 A;  4J1X A;  3QKY A;  4I6T A;  3FH7 A;  3PE3 A;  3IV0 A;  5FQ4 A;  4FLH A;  3DEO A;  3ULY A;  4CDR A;  4U95 D;  4GZC A;  3QWP A;  3CHP A;  1MX2 A;  1RZ4 A;  1JWG A;  3ME5 A;  1YA0 A;  2LYL A;  3S7D A;  2EF8 A;  1IQR A;  3B7U X;  4A1S A;  1BU9 A;  1KT0 A;  4IUL A;  5KJK A;  3E4B A;  3SI5 A;  4GTM A;  3SZ7 A;  2PM7 A;  4Q2J A;  3NB2 A;  3GZS A;  2PXL A;  2C0L A;  1TJC A;  3U4T A;  4UWH A;  4JB8 P;  5ANR A;  2CG3 A;  2CHZ A;  2GRL A;  4NIK A;  2CRO A;  1SA5 A;  3L08 A;  3ZYK A;  2BNM A;  1LTX A;  4U8V D;  1OWP A;  3SF4 A;  4WWP A;  3DSW A;  4GMJ A;  1U2Z A;  3CKB A;  3BU8 A;  3MKR A;  3KSL A;  4Z5D A;  4KZC A;  2YHC A;  2R59 A;  2GGF A;  3VK0 A;  1ZS4 A;  3AU5 A;  4JL0 A;  4APF A;  2BKG A;  2M4H A;  3A9Y A;  2BJC A;  4Y6C A;  4GCO A;  2UY1 B;  3S8Q A;  4TXR A;  2MEZ A;  3FYM A;  3L82 A;  2FO1 E;  1MHQ A;  3HVE A;  3LJN A;  4FLB A;  2OEV A;  1QBQ A;  4CGW A;  3O4Z A;  1JWF A;  3SBS A;  4FP7 A;  2LCV A;  4JZY A;  4LNU D;  4AIF A;  4CDM A;  5KJL A;  2DIW A;  4I6R A;  3C72 A;  3RIB A;  5FQ6 A;  4A1G A;  1GT0 C;  2BKK B;  4JD2 G;  2X3M A;  4NUR A;  4EQF A;  1TNB A;  4UQZ A;  3QOU A;  4ZHB A;  2R05 A;  1EPU A;  3ZFW A;  2Y3A A;  1E90 A;  1W3B A;  3AS8 A;  5CBN A;  4I2W A;  3D9N A;  3Q15 A;  1QQB A;  5ENO D;  2WB2 A;  5AQ7 A;  3EHQ A;  4KXK B;  1MJ0 A;  3IXE A;  4KT6 B;  3PZ3 A;  2E2E A;  1O1T A;  1S63 A;  3PH0 C;  2VGX A;  3B7R L;  1A17 A;  3LPZ A;  2XPI A;  1OXJ A;  3NOG D;  4P29 A;  3PS6 A;  2XQ0 A;  3E33 A;  4UWF A;  5ENN A;  3MEK A;  1PAQ A;  4YG7 B;  2OVF A;  3TJP A;  1E7V A;  3JXB C;  2AXV A;  5J08 A;  4EQZ A;  3ABK E;  3NZS A;  1R63 A;  2LSU A;  4XZ4 A;  2EQX A;  4XKB A;  1RPE L;  5FZS A;  2IVQ A;  2YNQ A;  2R17 C;  4G8K A;  4FUL A;  3S7F A;  3W9G A;  4I9E A;  4GAA A;  3AG4 E;  3JQ0 A;  3CVV A;  1PY1 A;  5BV0 A;  2YHE A;  2Y4U A;  4Z5H A;  5AN8 A;  2XS1 A;  3OWQ A;  4APO A;  4FBI A;  3CVU A;  4UQY A;  4J6I A;  3FUN A;  3E37 A;  2L6J A;  3EU9 A;  2P9L G;  2XJ3 A;  4XI9 A;  4WVL A;  3AS5 A;  4X4I A;  4PH4 B;  1NW3 A;  5FZR A;  3CST A;  4I6G A;  3EU5 A;  3TAX A;  5FTP A;  4PU3 C;  3RRN B;  3C3R A;  3KAE A;  2JLB A;  1N52 A;  4MKT A;  2DYR E;  2LNI A;  2FI7 A;  3MX3 A;  4DX1 A;  3M9L A;  3MGB A;  5BXU A;  2MRI A;  3FP3 A;  4U07 A;  4LEU A;  4FAD A;  2C2L A;  1IHG A;  3GN5 A;  2XPY A;  5HS0 A;  3V31 A;  2P2C P;  4Y6W A;  3DEP A;  3IEG A;  3QK0 A;  4J8Y A;  2HCN A;  4YAR A;  2KZT A;  2CHW A;  5T3R A;  3MCX A;  3FTS A;  4TV3 A;  3ZHE A;  4GPM A;  4CRW A;  2IQC A;  1POU A;  2WIU B;  3BG1 B;  4U96 D;  4BT8 A;  2FBN A;  3RKV A;  3TFL A;  4A3V A;  2F8X K;  1JFT A;  3VLD A;  3I5P A;  2XSD C;  2WXG A;  3TWX A;  3BDN A;  3FU3 A;  5CCL A;  4GB9 A;  3UKU G;  5KNH D;  3EHR A;  4BFR A;  3LY9 A;  5AAO A;  3ZPX A;  5AQB A;  5EKQ D;  3IHY A;  4EPZ A;  5HQ8 A;  4MS6 A;  4Q69 A;  3DSX A;  2XRZ A;  2FUL A;  1ZZ9 A;  1O4X A;  4HS2 A;  1Y7Y A;  5JJ6 A;  2LYJ A;  1U3D A;  4G26 A;  3JXD L;  5G55 A;  4K0R A;  4CZ2 D;  4LCT A;  4JC8 A;  3RAU A;  1ADR A;  3FTZ A;  4ATG A;  2V4H C;  2PUE A;  5ITZ F;  4HBD A;  1E8W A;  5EX3 A;  1VDY A;  4AEZ C;  4AY5 A;  5A7L A;  1OWN A;  1OT8 A;  2ZGG A;  1IXV A;  2QC9 A;  3CV0 A;  4V3I A;  3EDT B;  3ZKJ A;  5FIN A;  1WM5 A;  4L7T A;  4DLQ A;  2HSG A;  4E85 A;  3JXJ A;  1YMP A;  3GZD A;  3LXU X;  4BWR A;  3PZ4 A;  5ENP D;  4LRZ A;  5D0O D;  3UXG A;  3TRB A;  4I6U A;  4DI3 A;  1ZPQ A;  3CQC B;  3KJX A;  1OWO A;  1H19 A;  1NEQ A;  3DWL G;  3QJZ A;  4X4D A;  3G0T A;  5LP0 A;  1N4S A;  3CHR A;  1OSL A;  1BD8 A;  3PUK A;  1WH8 A;  2KEI A;  2VEO A;  3FTW A;  3SBT B;  3Q4A B;  3QNK A;  2PXD A;  2LNM A;  3C98 A;  5C2Y A;  3KEZ A;  4TUM A;  3HVE B;  4OVV A;  1KPS B;  3QAR A;  1UXC A;  3A9Z A;  3QYX A;  3A9X A;  1N11 A;  2IOL A;  2NSZ A;  2XS8 A;  2PZI A;  4DX5 D;  2CFZ A;  4GA0 A;  3R7Q A;  1SQM A;  3QWW A;  2KZ8 A;  4WUY A;  4E6H A;  3DXM G;  3T5V A;  4O6F A;  1K1A A;  2JVL A;  2XCC A;  3ASD A;  2IVB A;  1WAO 1;  2L49 A;  4GTQ A;  3G2U A;  1WY6 A;  2HM8 A;  2BF0 X;  4N5Q A;  3ABL E;  3SR4 A;  3QAQ A;  2LYR A;  4HVB A;  2GW1 A;  5FWQ A;  4ANW A;  3U64 A;  1TNU A;  5LCW C;  4JXT A;  1E7U A;  2IV1 A;  5DTR A;  3LYA A;  5AQ9 A;  2VGX B;  3P1U A;  5A7D B;  1O1S A;  3HXE A;  2RKK A;  3IBE A;  1QPZ A;  3ONL A;  3L17 A;  3JQ1 A;  3QOX A;  2AUW A;  2MOW A;  4DLO A;  3ZGQ A;  2XIU A;  1RZS A;  4O60 A;  4BSZ B;  1MYO A;  4Z5C A;  3KZ3 A;  5JMN D;  4Z58 A;  1PRV A;  3CSF A;  4ANX A;  1UG3 A;  3PUJ A;  4CGV A;  1PRU A;  2V0P A;  1RW2 A;  2XI8 A;  2X6F A;  4GYW A;  2OOE A;  3QQ6 A;  4KZ0 A;  5DSX A;  4KVM A;  2ZIS A;  4ANV A;  3MKQ A;  2LLV A;  4LNG A;  4AP2 A;  1AP7 A;  1K3Z D;  3J5Q B;  5T4Y A;  4Y42 A;  3RK6 A;  3ONK A;  3UKR G;  4OYS A;  4N2Q A;  2GRP B;  2L8N A;  2IY0 C;  3ZYL A;  3ZYQ A;  1U3C A;  1HO8 A;  4LER A;  5LOZ A;  5ARF A;  3LFP A;  5E76 A;  1NER A;  4PU7 A;  3O48 A;  3FTU A;  1QZ2 A;  4WNF A;  2ETB A;  1QZX A;  3UIP C;  1BLX B;  1ELK A;  2X6J A;  3TWW A;  3ZHI A;  3GN5 B;  1LCC A;  4C0M A;  2DCP A;  5D0Q D;  5CCM A;  3AG2 E;  1ZB1 A;  2ETC A;  4BTB A;  2D5V A;  3BUA A;  3TG4 A;  2KZT B;  1PER L;  3LCA A;  1AWC B;  3ZHE B;  2EBY A;  3UPV A;  3TGO A;  1N0Q A;  3G5G A;  3MYV A;  3FH5 A;  4PS3 A;  5G04 C;  2IU7 A;  3X2Q E;  3FDH A;  4K5B A;  3R9M A;  4GZ5 A;  1MX6 A;  4IYP A;  1UN9 A;  3BEE A;  3U9W A;  3L9T A;  1RZR A;  2KCV A;  3SCG A;  3TXM A;  1DCE A;  4KBQ A;  4XEI G;  1Y9Q A;  3Q47 B;  2RD0 A;  1U2V G;  5DRT A;  3FUI A;  2VSN A;  3UT7 A;  3UM3 A;  4HLE A;  4G23 A;  2H6F A;  3ASO E;  4JHK A;  1UXD A;  2FO7 A;  4YDO A;  3JCK C;  4X4B A;  4FHK A;  4MLP A;  5EIB E;  4IN3 B;  3SX0 A;  4DE9 A;  3JYS A;  4ILH B;  1EF1 C;  3AU4 A;  3UFD A;  3OQN A;  1H6P A;  2HIN A;  3QWV A;  4JCX A;  5JA4 D;  1WDY A;  2ZXW E;  3HZI B;  4TXP A;  4YG1 A;  2P9S G;  1N4R A;  3NZU A;  4FC8 A;  4DUI A;  5CEC B;  3R09 A;  1K8K G;  2JQE A;  4G2V A;  4HXI A;  3SCF A;  3UUX A;  2MQK A;  2H6I A;  5C1D A;  3RO2 A;  2R2L A;  1TYQ G;  2AWI A;  1UJK A;  2PUC A;  3MA5 A;  3ZUV B;  3KXA A;  4CEM A;  2MYO A;  3SO8 A;  3ZW3 A;  2KM4 A;  1B0N A;  3Q73 A;  3OXG A;  1HFA A;  4EBA G;  1MZC A;  2PL2 A;  3ZVV A;  3FHE A;  3B95 A;  2Y4T A;  1HQ1 A;  5DT2 A;  3PXP A;  2WQ6 A;  3TWS A;  4B89 A;  1HS6 A;  2J49 A;  4HB5 A;  2PUD A;  3APF A;  4I9C A;  2PXT A;  2IVG A;  3KS2 A;  4WAF A;  3FFL A;  3CQG B;  1FT2 A;  2J07 A;  2Y1L E;  1E8X A;  4TXQ A;  1UW4 B;  2P9P G;  3LVQ E;  1QP7 A;  1NI1 A;  3V79 K;  5EX0 A;  3L22 A;  2RG8 A;  2EIN E;  3CVL A;  1JH9 A;  2PM6 A;  2JCG A;  4ER5 A;  1GW6 A;  3PNT B;  2L0I A;  4YDY A;  4IA8 A;  2WVI A;  3LDZ A;  2WMO A;  3CVW A;  1TNZ A;  1QP0 A;  2IFU A;  4FJZ A;  4MCX A;  2LYP A;  1L1M A;  2OV8 A;  2R03 A;  1NP7 A;  3IHV A;  4AJW A;  3HXD A;  2WM9 A;  3CKC A;  2WXN A;  4G1T A;  5DRY A;  4MRU A;  4IVZ A;  2A4Z A;  2OR1 L;  1OCR E;  3AG3 E;  3UMV A;  1H6K A;  3RSE G;  3SGH A;  3L1P A;  1V54 E;  4WWN A;  2WQ7 A;  5HKP A;  2MXD A;  4HOS A;  5K98 B;  4FA6 A;  4L23 A;  2WXH A;  2IO2 C;  2QY7 A;  1S64 A;  3V2X A;  1QQA A;  3ZU7 B;  2LSV A;  3UT4 A;  3Q78 A;  2VSO E;  1QQE A;  3SY2 A;  1BDH A;  3G2W A;  3PEV B;  3MV3 B;  1ZBP A;  2IO3 C;  2VTB A;  1TR4 A;  1JPL A;  1FVH A;  3EIJ A;  1KT1 A;  2EIM E;  1E3O C;  2XEV A;  1DCQ A;  4CYM D;  4U63 A;  1ZVV A;  3KD7 A;  3I4R B;  1N0R A;  2KEJ A;  3ABM E;  3RRU A;  4J1W A;  3PDN A;  4F53 A;  1H2T C;  3ZPJ A;  2FF4 A;  3FTY A;  2XGS A;  4EZL A;  3ZKC A;  3PEU B;  4A63 B;  1JWL A;  2VSY A;  4JHJ A;  1O1R A;  2WUS R;  3MJW A;  4L2L A;  4IWR A;  5M72 A;  3ZRH A;  4UUC A;  2X6I A;  4K5C A;  2C0M A;  1UN8 A;  1TN6 A;  5BW8 C;  1WIZ A;  3F6Q A;  3MKQ B;  2ION A; 
#chains in the Genus database with same CATH homology
 4E85 A;  5EDS A;  2WQH A;  2KCL A;  2HO1 A;  2LO6 A;  3F52 A;  3LXU X;  4ILI A;  3JXC L;  4BWR A;  2P58 C;  1BPO A;  4LRZ A;  5D0O D;  1EFA A;  4YBA A;  3D9J A;  2LAI A;  4H7X A;  3TRB A;  4I6U A;  4DI3 A;  1ZPQ A;  3OTN A;  5AJL A;  3AS4 A;  3CQC B;  3FUD A;  3LY7 A;  2OFY A;  3KJX A;  1H19 A;  1NEQ A;  3OQO A;  1OWM A;  4X4D A;  1OWO A;  1CQT A;  1OCT C;  3FTV A;  3QJZ A;  4OB4 A;  4IRU A;  4RG6 A;  4YVQ C;  5JJT A;  3LS8 A;  1DVP A;  3B13 A;  1EDU A;  5LP0 A;  4B8C B;  3F6W A;  3CVY A;  3CHR A;  1OSL A;  4YG4 A;  3CEC A;  2I1K A;  3CR3 A;  1HF8 A;  3PUK A;  1WH8 A;  2Q7F A;  4JA9 A;  2KEI A;  2AXZ A;  2WXQ A;  4JEU A;  4ACK A;  5G04 J;  3FTW A;  4W9R A;  3SBT B;  1QNF A;  2V4L A;  3Q4A B;  2BTD A;  4B8A A;  3QC1 A;  4PS8 A;  3QNK A;  4GQM A;  1X5B A;  4XE0 A;  3WXX A;  3C98 A;  3CVQ A;  2O49 A;  5C2Y A;  3KEZ A;  3OXF A;  3PRE A;  4BT9 A;  1EYH A;  3APD A;  2A5U A;  3R7R A;  2YQ8 A;  1PNR A;  3CK7 A;  3HVE B;  3LKU A;  4DK5 A;  5BV1 A;  4HOR A;  2EWT A;  3EHM A;  3L6A A;  1YSE A;  5DIZ A;  4GYO A;  2B5A A;  4OVV A;  4QFV A;  3FUL A;  4JPS A;  1WH6 A;  2O38 A;  3QAR A;  3ASH A;  1UXC A;  3EUS A;  2AVP A;  3ZHM A;  3DBS A;  2PPX A;  2VQ2 A;  1HXI A;  3RJV A;  4PS7 A;  4ABN A;  3QYX A;  1CJG A;  1ELR A;  1H2V C;  4I8T A;  2VGY A;  1TJF A;  3SCH A;  3FY4 A;  2KPJ A;  3RU0 A;  2WXR A;  4G11 A;  2IOL A;  2NSZ A;  4NAC A;  4M3O A;  1HZ4 A;  3L16 A;  3L13 A;  2NXP A;  4MCT A;  3T5X A;  3SFZ A;  3S7J A;  4Q96 A;  3FYA A;  2H8R A;  1HX8 A;  2PZI A;  2HR2 A;  5KJN A;  4WND A;  1Z3Y A;  5G2N A;  4EZJ A;  3CLC A;  2CFZ A;  4N2S A;  5KJM A;  2BNN A;  2I2O A;  4GA0 A;  3R7Q A;  3ZN3 A;  3LY8 A;  3IVP A;  5A6C A;  1SQM A;  5JHB A;  4G25 A;  4X4C A;  3QWW A;  4J1X A;  3QKY A;  4I6T A;  2KZ8 A;  3FH7 A;  5E75 A;  3RZZ A;  3PE3 A;  4WUY A;  3IV0 A;  2WXM A;  4E6H A;  3T5V A;  5FQ4 A;  4X4H A;  4FLH A;  3CHS A;  4O6F A;  1Y6I A;  2JVL A;  2XCC A;  4CDR A;  3ASD A;  3G7D A;  2IVB A;  2R1J L;  2L49 A;  1WAO 1;  3QWP A;  4GZC A;  3G2U A;  3BS3 A;  2WXJ A;  1WY6 A;  3CHP A;  2HM8 A;  4YND A;  2BF0 X;  1L5J A;  3UT8 A;  4AM9 A;  3GZ1 A;  3QAQ A;  1JWG A;  1LQC A;  5JJ7 A;  1YA0 A;  2LYR A;  3CK8 A;  2LYL A;  4HVB A;  3K9I A;  3S7D A;  2GW1 A;  5FWQ A;  4ANW A;  2EF8 A;  1IQR A;  3B7U X;  4A1S A;  3U64 A;  5LCW C;  4JXT A;  3U3W A;  1LLI A;  1E7U A;  1NA0 A;  2IV1 A;  1PC2 A;  4NRH B;  1KT0 A;  4IUL A;  3GW4 A;  3ZXS A;  1FVF A;  5KJK A;  3RRM B;  3LYA A;  3E4B A;  2VGX B;  3I4G A;  3SI5 A;  3P1U A;  1OWL A;  5KCM A;  2PM7 A;  5A7D B;  3SZ7 A;  1X57 A;  3D9O A;  3HIZ A;  3CHO A;  4Q94 A;  3IBE A;  5AJD A;  3SHF A;  3GZS A;  1QPZ A;  3ONL A;  2C0L A;  3L17 A;  2L0T B;  3JQ1 A;  1TJC A;  2AUW A;  2MOW A;  5J90 A;  3U4T A;  4UWH A;  4DLO A;  2DBA A;  3ZGQ A;  2XIU A;  4BSX A;  1RZS A;  5ANR A;  2CG3 A;  1WET A;  3DNV B;  2CHZ A;  3GBF A;  1RZR D;  2WPV A;  4I1M A;  4Z5C A;  2GRL A;  3KZ3 A;  2FJR A;  2KCK A;  4GZD A;  5BT1 A;  5FT9 A;  4Z58 A;  3CVX A;  1FCH A;  4B94 A;  1PRV A;  3JUI A;  1UTX A;  4GPK A;  3G2V A;  2CRO A;  4KMO A;  2PQR A;  3CSF A;  3L08 A;  3F51 A;  2WXO A;  1UG3 A;  3S2A A;  3PUJ A;  3ZYK A;  4ANX A;  2BNM A;  4CGV A;  1N54 A;  4WNE A;  1PRU A;  4RVB A;  2V0P A;  1OWP A;  2PQN A;  2XI8 A;  2X6F A;  1XWR A;  3O9X A;  1RIO A;  2X6H A;  2OOE A;  3GZ2 A;  2CSF A;  3QQ6 A;  1Z3X A;  4GYW A;  4KZ0 A;  4WWP A;  3SF4 A;  2V8S E;  3FUK A;  4U0S A;  4GMJ A;  3OAW A;  4N39 A;  4KVM A;  3CKB A;  3FTX A;  3D1N I;  4ANV A;  3MKQ A;  1E96 B;  2O4A A;  2ZU6 B;  1HF0 A;  4GCN A;  4AP2 A;  3MKR A;  4ILG A;  4Z5D A;  4KZC A;  2YHC A;  2R59 A;  2GGF A;  4N3A A;  3VK0 A;  4I1O B;  5T4Y A;  4Y42 A;  1ZS4 A;  4FN3 A;  3RK6 A;  3AU5 A;  3ONK A;  4JL0 A;  4APF A;  4URK A;  1LF8 A;  4OYS A;  3B7T A;  4N2Q A;  3HYM B;  3NQP A;  3G2T A;  2L8N A;  4I1A A;  2MHK A;  4N3B A;  3ZYL A;  3ZYQ A;  3L54 A;  1U3C A;  2BJC A;  4GZ6 A;  3FMY A;  1HO8 A;  4LER A;  5LOZ A;  3ZEF A;  3APC A;  5ARF A;  4Y6C A;  3LFP A;  1HU3 A;  2ILR A;  4GCO A;  1PRA A;  5E76 A;  5DBK A;  1NER A;  3CRO L;  2ICT A;  3S8Q A;  4JQD A;  2UY1 B;  2MEZ A;  3FYM A;  4GA2 A;  4PU7 A;  4RSY A;  2OVB A;  3O48 A;  3FTU A;  1MHQ A;  3QF3 A;  1QZ2 A;  2UY1 A;  4WNF A;  1ZUG A;  2LYS A;  3HVE A;  4NQ0 A;  4FLB A;  4NDW A;  2XCB A;  3SNX A;  4CGW A;  3PE4 A;  2I9C A;  2WXL A;  5BPP A;  1ELK A;  2IOS A;  2X6J A;  1JWF A;  3O4Z A;  4JVS A;  4GYY A;  3SBS A;  1SZ9 A;  3CVN A;  2IUO A;  4FP7 A;  3ZHI A;  3GN5 B;  2LCV A;  1LCC A;  1HH8 A;  4C0M A;  2AW6 A;  2DCP A;  1X2L A;  4JZY A;  5D0Q D;  3CVU A;  3FUE A;  4AIF A;  5CCM A;  3ESL A;  2LYK A;  4H7Y A;  3B7H A;  2D5V A;  3R1F A;  5FQ7 A;  4BTB A;  3TG4 A;  4CDM A;  5KJL A;  2KZT B;  4DLQ A;  2IU1 A;  3FU5 A;  5LX8 A;  2DIW A;  2X38 A;  4BX9 A;  5CMY A;  4I6R A;  4DPR A;  1PER L;  1ZU2 A;  1HE8 A;  3LCA A;  4I2Z A;  3RIB A;  3ZHE B;  1AU7 A;  4UWK A;  1NA3 A;  5FQ6 A;  1HG5 A;  2XGM A;  4CT4 A;  4A1G A;  3HHM A;  1GT0 C;  1TEZ A;  2EBY A;  3VLE A;  3CK9 A;  2BNO A;  2X3M A;  4NUR A;  3TGO A;  2IF4 A;  4F8D A;  4GML A;  4EQF A;  3UPV A;  3D9P A;  3MV2 B;  2FEZ A;  3G5G A;  3MYV A;  4UQZ A;  3QOU A;  3FH5 A;  4PS3 A;  5G04 C;  2IU7 A;  3FDH A;  3MKQ B;  2M63 A;  3FH8 A;  4GZ5 A;  4IYP A;  1EPU A;  1UN9 A;  1S7E A;  3ZFW A;  2Y3A A;  3BEE A;  1E90 A;  1W3B A;  2WXF A;  4FJY A;  3AS8 A;  3U9W A;  4F7A A;  4ACL A;  4I2W A;  1RZR A;  2KCV A;  3D9N A;  3Q15 A;  1QQB A;  3SCG A;  4F1S A;  3ASG A;  1MQS A;  3G2S A;  1H0A A;  4KBQ A;  3TXM A;  2WB2 A;  1H2U A;  4O8B A;  4XX5 A;  1Y9Q A;  3Q47 B;  2RD0 A;  1Y8M A;  4G24 A;  3FUI A;  1R69 A;  3ENE A;  4WNG A;  1ZZ8 A;  2VSN A;  5T8I A;  3UT7 A;  5G05 J;  3Q49 B;  4KXK B;  2WMN A;  4HLE A;  4ME2 A;  4G23 A;  3ZIM A;  3CLJ A;  2UWJ G;  1UXD A;  4JHK A;  4KT6 B;  2FO7 A;  3ML8 A;  3JCK C;  2E2E A;  2VTB B;  4X4B A;  5FJY A;  3GYZ A;  4FHK A;  4MLP A;  5AEN A;  1LCD A;  3EJN A;  3PH0 C;  2VGX A;  3B7R L;  4IN3 B;  3NF1 A;  1DW9 A;  1A17 A;  3LPZ A;  5LFA A;  2XRY A;  2XPI A;  4P29 A;  4DJA A;  3PS6 A;  3JYS A;  4ILH B;  1EF1 C;  3AU4 A;  1INZ A;  3UFD A;  3OQN A;  4LUN U;  3VTX A;  2XQ0 A;  2J08 A;  4UWF A;  5ENN A;  3MEK A;  2HIN A;  4HOQ A;  3QWV A;  4JCX A;  1PAQ A;  4PUC A;  4YG7 B;  2OVF A;  2NC9 A;  3TJP A;  4AXH A;  1ZZC A;  4R7L A;  4JCY A;  3HZI B;  1E7V A;  4YG1 A;  1LMB 3;  4A55 A;  3JXB C;  2AXV A;  2X6K A;  5J08 A;  4X4G A;  4C9B B;  2LAH A;  3NZU A;  3OP9 A;  4FC8 A;  1ZAY A;  4I6E A;  5FQ8 A;  3NZS A;  4BY6 A;  2GZU A;  1R63 A;  3EIQ C;  2LSU A;  4A3T A;  4XZ4 A;  2EQX A;  4XKB A;  4D10 C;  5FZQ A;  1RPE L;  5FZS A;  3FEX A;  2IVQ A;  4G2V A;  4N3C A;  4HXI A;  2YNQ A;  2R17 C;  1SQ8 A;  4HOU A;  4U0U A;  4FUL A;  3SCF A;  3S7F A;  2MQK A;  4PU8 A;  4I9E A;  3SD5 A;  3UUX A;  4BX8 A;  5C1D A;  3CIA A;  3D9K A;  2LYQ A;  3FU6 A;  4U0Z A;  3RO2 A;  4GAA A;  3S7B A;  3JQ0 A;  3CVV A;  2KC7 A;  1PY1 A;  3CHM A;  2AWI A;  1UJK A;  2J09 A;  2PUC A;  2YHE A;  3ASF A;  3LEW A;  2Y4U A;  3KXA A;  3MA5 A;  3VTY A;  4CEM A;  4Z5H A;  3OQM A;  3ZW3 A;  4APO A;  4FBI A;  2KM4 A;  1B0N A;  3OXG A;  1HFA A;  4UQY A;  4DI4 A;  4J6I A;  4EBA G;  2PL2 A;  3FUN A;  2L6J A;  3ZVV A;  5ANL A;  2J9Q A;  4C0E A;  5A23 A;  3FHE A;  2XJ3 A;  4XI9 A;  2Y4T A;  2VJ8 A;  3D3M A;  3AS5 A;  3QWG A;  4X4I A;  2PUB A;  4PH4 B;  4JA7 A;  3FUJ A;  3I3N A;  2J4B A;  2XPZ A;  5FZR A;  3PXP A;  3CST A;  4I6G A;  3FEY A;  2L9B A;  4RG9 A;  3TG5 A;  4EEC A;  5CMW A;  2WQ6 A;  4I6J A;  3TXN A;  2WXI A;  3QB2 A;  5CHE E;  3TAX A;  3PNL B;  4B89 A;  1HS6 A;  5FTP A;  4PU3 C;  3RRN B;  2AXU A;  2J49 A;  1IC8 A;  2CHX A;  3RO3 A;  2PUD A;  3APF A;  4I9C A;  4F3V A;  5BV0 A;  1ZZB A;  2HYZ A;  3LIS A;  3KAE A;  4FHJ A;  3ULQ A;  5LCW J;  4I17 A;  3H5T A;  2JLB A;  4HFG A;  1JFS A;  2IVG A;  1N52 A;  4MKT A;  3KS2 A;  4WAF A;  2LNI A;  3FFL A;  2FI7 A;  3MX3 A;  3QDN A;  5ARG A;  5HI7 A;  1SZA A;  3CQG B;  1P5Q A;  4U8H A;  3D9L A;  2J07 A;  4YVO A;  1E8X A;  3MGB A;  1UW4 B;  2MRI A;  3N71 A;  1XNF A;  3FP3 A;  4J8D A;  2XCJ A;  4UI9 C;  1XGW A;  4J8F A;  4U07 A;  4PU4 C;  1DNP A;  2KAT A;  3LVQ E;  4LEU A;  1QP7 A;  5AYW D;  5T3R A;  4FAD A;  1IQU A;  3LJ3 A;  2C2L A;  1IHG A;  3GN5 A;  2XPY A;  2KEK A;  4UWG A;  5EX0 A;  1S0P A;  3CHQ A;  2RG8 A;  3L22 A;  3FUF A;  2PIJ A;  2IJG X;  4Y6W A;  1VPW A;  4J8S A;  3CVL A;  1JH9 A;  2PM6 A;  3IEG A;  2JCG A;  3QK0 A;  4YAR A;  4ANU A;  2KZT A;  4N5C A;  1GW6 A;  3PNT B;  3PZD A;  4GHJ A;  2V5F A;  2CG2 A;  2L0I A;  2GRM A;  2CHW A;  3LVR E;  3MCX A;  4IA8 A;  3FTS A;  4L1B A;  4UQX A;  4J8E A;  2WVI A;  3DPD A;  3LDZ A;  5JHA A;  1DWK A;  4TV3 A;  1E8Z A;  1E8Y A;  2WMO A;  3CVW A;  3ZHE A;  1QP0 A;  2IFU A;  3MZL B;  3VLF A;  4FJZ A;  4CRW A;  3PRZ A;  2A6C A;  4FU3 A;  4TRQ A;  2IQC A;  4AVX A;  1POU A;  4MCX A;  2LYP A;  1L1M A;  2PUA A;  2OV8 A;  3ML9 A;  4UWL A;  3UQ3 A;  2WIU B;  3BG1 B;  1NP7 A;  3IHV A;  3ZYM A;  4Z59 A;  3U66 A;  4AJW A;  3Q5M A;  2WM9 A;  4BT8 A;  3CKC A;  2WXN A;  2FBN A;  4G1T A;  3RKV A;  3FWV A;  3UX4 A;  4A3V A;  4MRU A;  4IVZ A;  1UJJ A;  3MLF A;  1JFT A;  2A4Z A;  3D9M A;  1OUV A;  4TUU A;  3VLD A;  2I6H A;  3I5P A;  4AOF A;  2XSD C;  2OR1 L;  2WXG A;  4GU5 A;  3BDN A;  2OND A;  3UMV A;  2PUG A;  1H6K A;  4KVO A;  2I1J A;  4X4F A;  2E0I A;  2PE5 A;  3ESK A;  3L1P A;  3FU3 A;  3SGH A;  4EZK A;  4GB9 A;  4I43 A;  4WWN A;  5CCL A;  2VSX E;  2WQ7 A;  3T8M A;  4JEH A;  2VYI A;  3R9A B;  5K98 B;  4XI0 A;  4FA6 A;  5BNW A;  4L23 A;  4HOS A;  2WXH A;  1BDI A;  2QY7 A;  2BUG A;  1QQA A;  3LY9 A;  3FUH A;  4BFR A;  1Z6T A;  2LSV A;  4CT0 A;  3UT4 A;  1HG2 A;  1QQE A;  2VSO E;  1JUQ A;  3FU0 A;  1BDH A;  4GZ3 A;  4UI9 K;  4AY6 A;  2R63 A;  1NZN A;  5EKQ D;  4X4E A;  3IHY A;  4CCA A;  4EPZ A;  5HQ8 A;  3G2W A;  3PEV B;  3MV3 B;  1ZBP A;  2VTB A;  4MS6 A;  2WXP A;  1JPL A;  3BD1 A;  1FVH A;  3EIJ A;  4KYO B;  4Q69 A;  5BUZ A;  1KT1 A;  1E3O C;  4XIF A;  2XEV A;  2XRZ A;  1KLX A;  2FUL A;  1ZZ9 A;  2PUF A;  1O4X A;  1ZZ7 A;  4HS2 A;  4U63 A;  1ZVV A;  1Y7Y A;  3KD7 A;  1QP4 A;  3CGH A;  4WWO A;  4EBA A;  2WXK A;  5JJ6 A;  3I4R B;  4BTA A;  2KEJ A;  2QFC A;  3D9I A;  3RRU A;  3P2B A;  4J1W A;  3PDN A;  3URZ A;  4F53 A;  3HDX A;  1H2T C;  2LYJ A;  1U3D A;  3ZPJ A;  2CFU A;  4G26 A;  4XKC A;  2FF4 A;  4AV7 A;  4B0Z A;  1ELW A;  5AIJ A;  4HOT A;  3JXD L;  5G55 A;  4K0R A;  4GA1 A;  3FTY A;  3B7S A;  4LCT A;  3OMT A;  2XGS A;  4EZL A;  4JC8 A;  2J4D A;  4JW1 A;  3TL5 A;  1ADR A;  3FTZ A;  4ATG A;  4UI9 J;  3ZKC A;  3FUM A;  3PEU B;  4U04 A;  4CDN A;  4L2Y A;  1JWL A;  2PUE A;  1ZZ6 A;  2VSY A;  3PVL A;  4JHJ A;  1E8W A;  1B89 A;  2WUS R;  5EX3 A;  1VDY A;  2YIN A;  3MJW A;  3CVP A;  4L2L A;  4PDX A;  4AEZ C;  4AY5 A;  3OXL A;  3EHN A;  4JHR A;  2XHE A;  5A7L A;  1OWN A;  4IWR A;  2R5S A;  4K03 A;  5G05 C;  5M72 A;  3ZRH A;  4OVU A;  2X6I A;  3CV0 A;  4V3I A;  1IYG A;  4J0U A;  3EDT B;  2C0M A;  1UN8 A;  2JEK A;  1WM5 A;  2ICP A;  3IKO B;  2XGO A;  4L7T A;  1WIZ A;  5BW8 C;  3CEQ A;  3BG0 B;  2HSG A;  2ION A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...