2AXUA

Structure of prgx
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
305
structure length
303
Chain Sequence
MFKIGSVLKQIRQELNYHQIDLYSGIMSKSVYIKVEADSRPISVEELSKFSERLGVNFFEILNRAGMNSVNETGKEKLLISKIFTNPDLFDKNFQRIEPKRLTSLQYFSIYLGYISIAHHYNIEVPTFNKTITSDLKHLYDKRTTFFGIDYEIVSNLLNVLPYEEVSSIIKPMYPIVDSFGKDYDLTIQTVLKNALTISIMNRNLKEAQYYINQFEHLKTIKNISINGYYDLEINYLKQIYQFLTDKNIDSYLNAVNIINIFKIIGKEDIHRSLVEELTKISAKEKFTPPKEVTMYYENYVAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PrgX
publication title Structure of peptide sex pheromone receptor PrgX and PrgX/pheromone complexes and regulation of conjugation in Enterococcus faecalis.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Transcription
total genus 111
structure length 303
sequence length 305
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2005-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2axuA01
1.25.40.400 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2axuA02
2LYKA 4PU7A 4PU8A 2LYRA 2HSGA 4FN3A 3G7DA 1HF0A 1WH6A 1ADRA 2GRLA 3QF3A 4MCXA 3H5TA 3LISA 1BDIA 3CLCA 1OCTC 2HINA 3CECA 4PU4C 2CSFA 3KJXA 4F8DA 1R63A 1RZSA 4IA8A 3TRBA 1NERA 4Y42A 1WETA 3CROL 1S7EA 2IVGA 3VK0A 1LQCA 4X4DA 3BDNA 4GHJA 2WIUB 2XIUA 3IVPA 3QQ6A 4J1XA 1RZRD 1JWLA 2OR1L 3UFDA 2PUEA 2O49A 2XI8A 3EUSA 2JVLA 3FYAA 2WUSR 2AXZA 2KZ8A 2LYQA 2PPXA 1JFSA 2D5VA 3JXBC 2MEZA 1LCCA 2OFYA 2LCVA 1UTXA 2BNOA 1WH8A 2EWTA 1QP0A 4I6RA 2KEJA 1ZZ8A 1ZZ6A 2BNMA 3F51A 3LFPA 4Z59A 2AWIA 2R1JL 4Z5HA 4X4GA 3F6WA 4I6UA 3ZKCA 1ZZBA 2IUOA 4NDWA 1PERL 1UXCA 2JCGA 2PUBA 2AW6A 2R63A 4JQDA 4YG1A 1LLIA 1CJGA 2GZUA 2BNNA 1VPWA 2IVBA 1PRVA 1ZUGA 3KZ3A 2PUCA 4X4CA 4PU3C 2IVQA 2ICPA 1IC8A 4O8BA 3ZHMA 2EF8A 3OQOA 2L49A 2XCJA 3R1FA 3D1NI 1DWKA 2L8NA 2AUWA 3OQMA 4J1WA 3HZIB 2BJCA 4YARA 3QYXA 1CQTA 2O38A 3B7HA 1EFAA 1PRAA 3O9XA 3S8QA 4FBIA 2CROA 1QQAA 1NEQA 4JCYA 1POUA 2PUAA 1YSEA 1JFTA 1E3OC 1ZAYA 2KEIA 1BDHA 2LYSA 5K98B 1QPZA 4YBAA 3MLFA 1UXDA 2LYLA 1QQBA 3DNVB 1LCDA 4Z58A 1AU7A 1B0NA 1LMB3 1ZZ9A 1ZPQA 3JXCL 4I6TA 1XWRA 3L1PA 4JCXA 3U3WA 3ZHIA 1L1MA 3SCHA 3OQNA 3GN5B 1O4XA 3OP9A 2PUGA 2MQKA 1Y7YA 3F52A 1ZZ7A 2B5AA 2IV1A 2XSDC 1Y9QA 1RIOA 2LYJA 4Z5DA 2GRMA 4IWRA 4I8TA 3JXDL 2PIJA 1PNRA 1RZRA 1R69A 2FJRA 4IVZA 3PXPA 1ZS4A 1JH9A 2AXVA 3BD1A 3G5GA 4Z5CA 4GQMA 3BS3A 2IU7A 1DW9A 1ZZCA 4X4IA 3FMYA 4X4BA 4X4HA 1OSLA 2H8RA 2EBYA 1ZVVA 3GN5A 5A7LA 2KEKA 1PRUA 2AXUA 3GBFA 2O4AA 2ICTA 4X4EA 1SQ8A 3QWGA 2A6CA 2PUFA 2PUDA 1GT0C 1X2LA 3RZZA 3OMTA 3SCGA 3FYMA 3SCFA 2PE5A 1QP4A 1RPEL 2XJ3A 4OB4A 4MCTA 3KXAA 4YG7B 2KPJA 2LYPA 4YG4A 1QP7A 4X4FA 1WIZA 1X57A
chains in the Genus database with same CATH superfamily
3HIZA 3ZUVB 2XPYA 2DIWA 4L2YA 4GAAA 2ETCA 3Q7FA 3QB2A 4PU4C 4F8DA 4I1MA 5JJTA 2PXTA 4U04A 3DEOA 3UM3A 1JFSA 2NXPA 2OCCE 4ANVA 1OXJA 4RVBA 1QQEA 4BSXA 3LFPA 3EHNA 2IJGX 4KYOB 3CQGB 4GPMA 1NW3A 1NI1A 4NRHB 4CCAA 3Q73A 2BNNA 3EHRA 4KXKB 3EIJA 3J5QB 3IEGA 4EQFA 2L9BA 3FFLA 3G0TA 4XI0A 4I43A 1LF8A 2MRIA 3ASHA 3Q9NC 4G8KA 2L0IA 3CLJA 2MOWA 5KJNA 3ASFA 4I6GA 5A23A 3M9LA 4ER3A 2HR2A 2PL2A 5D0OD 3CK7A 4I6TA 3U3WA 3GN5B 4NACA 3SY2A 3OP9A 5CRUA 3ZKJA 2KZTB 3MV2B 1E7VA 1U2ZA 5HKPA 5FZQA 3R7RA 4CEMA 4APFA 1R69A 3E32A 2H6GA 5A6CA 4Q94A 1ZVVA 5J90A 5FQ7A 3GBFA 2EIJE 1OWLA 2WXNA 3ZIMA 1KT0A 4EZJA 3UIOC 3P2BA 1RPEL 2ZISA 3L17A 3RO3A 4B8CB 2LYPA 5KNHD 5JJ7A 2XXPA 4X4FA 4BEPA 3MKRA 1YYHA 2PNNA 4K5AB 4AVXA 2XZTG 4K5BA 3ZN3A 3APCA 4WNDA 3IKOB 2DYRE 4HRMB 4IA8A 1QNFA 4Q69A 3DSUA 5HQ8A 2WIUB 3IVPA 3CSFA 2QYJA 3EUSA 3SHFA 4EZLA 3S7JA 1YMPA 3FU3A 3ONKA 3HXBA 3ME5A 3FTVA 5LFAA 5BPPA 2XEEA 3DRAA 4FC8A 4AOFA 1U2VG 4AIFA 2R59A 3PUJA 4Z5HA 4GZ6A 5B3SE 2WB2A 1DVPA 4TUUA 4GZ3A 2BEDA 1PRVA 3QK0A 1XGWA 4X4CA 2VEOA 2KM4A 3MKQA 4WNEA 4HI8A 4TV3A 2AUWA 2BJCA 3KL4A 2X38A 4G24A 2UY1A 1N52A 4ILHB 3ASNE 2XEHA 2C0LA 5AQAA 1QQBA 1A5EA 1K1BA 1MFQC 3UQ3A 2Y4UA 4J0UA 4I2ZA 4J7WA 1L5JA 1FCHA 3ABKE 4ER5A 3TWTA 2WXMA 4HFGA 4IULA 5LP0A 3TWUA 4BX9A 2WMOA 2OVFA 4ABNA 3JXIA 5T4YA 3CVXA 3UT8A 4ILGA 1SVXA 1QP4A 4EHMA 1QP7A 3UMVA 3MA5A 2WMNA 2YHCA 4G11A 5KJLA 2GRRB 4EK9A 5G04C 1GW6A 2LNMA 3CLCA 3G2UA 4HBDA 1R63A 4U0SA 1WAO1 3NOGD 2F8YA 1MHQA 4BT9A 4UI9C 3UFDA 2O49A 3EJNA 4ILIA 3A9ZA 1NA3A 2KZ8A 1OY3D 4OAVB 3Q4AB 3UT7A 4LNGA 3BG0B 3F6WA 4DRXE 5G55A 3HVEB 4NDWA 3C3QA 2XPIA 2AJAA 3TXNA 4A3VA 3FTYA 3AG3E 3CKCA 3KSLA 5BXUA 3WG7E 3UTMA 4B94A 2HO1A 2EINE 3B7SA 1O1SA 1YCSB 5CRVA 2F8XK 2L1PA 3QNKA 4WWPA 4YBAA 3ZU7B 4Z58A 4FA6A 5FZRA 2CFUA 2I1KA 1OCCE 2XPZA 3AS4A 4HRAA 2WXIA 4GYWA 3Q15A 5DSXA 1MQSA 3B7UX 5ARGA 1ZZ7A 4NIKA 2LYJA 4FHJA 3ABLE 5FT9A 4URKA 3TEPA 3GZDA 3PE4A 3QDNA 1UJKA 4GMJA 2RFAA 4DI4A 2DVWA 4BETA 3ASDA 4R7LA 3S2AA 3QWVA 3I5PA 2LYRA 1S0PA 4FN3A 4FJYA 4BX8A 1LQCA 3QC1A 2KCKA 2PXQA 3BU8A 4IN3B 2VTBA 4U0ZA 2ZIRA 3ULEG 2IF4A 3FYAA 2V8SE 3NQPA 2D5VA 4F1SA 1NFIE 3T8KA 4Z59A 1H0AA 3D9LA 3V2XA 1HO8A 3SR4A 2P2CP 2Y0BG 1PC2A 3LDZA 5J08A 3AU5A 3ZYLA 1N11A 4CGWA 5AJLA 1Q2ZA 3HZIB 1DCQA 4KBQA 3MKQB 4JCYA 1TNUA 1POUA 2PUAA 4JL0A 5CEDB 2MYOA 4O1OA 3JQ0A 5JHAA 1HX8A 1N4QA 5ENSD 4CYMD 4IRUA 2A5UA 4HLLA 3APDA 4Y6WA 1HZ4A 4TRQA 2WQHA 1TN8A 1NL4A 3TWQA 2F37A 4K5CA 4N39A 2DBAA 4KMOA 3AS5A 3BD1A 1IHBA 2UWJG 4GTPA 3CHRA 3UIPC 4X4BA 3GN5A 2KEKA 4BWRA 4U07A 3TXMA 4YDYA 3ENEA 1SA4A 4YG4A 2OEVA 1X57A 4YVOA 4ATGA 2GRLA 4D10C 4DX6D 3QF3A 3ZHEB 3FTSA 1LD8A 3KJXA 4GCOA 3TRBA 4GA0A 1FT1A 3ZYMA 2FEZA 4GB9A 5KCMA 4F3VA 5FIOA 3U4TA 4HRNA 3R9AB 4MRUA 1LD7A 2Q7FA 3DSTA 4I6UA 1OCZE 4I6EA 2IUOA 5CBNA 1UXCA 5BXOA 3O48A 1Z6TA 3NZLA 2IVBA 3QOWA 2FULA 4UWHA 1JCQA 2PUCA 4C0MA 5DRTA 3SI5A 3RAUA 1D8DA 5AYWD 3SF4A 4AY6A 2ETAA 3ZXPA 4UI9K 1V54E 3APFA 4TXRA 2PXBA 5LOZA 1BDHA 4O1PA 4WNFA 2H6HA 1N4RA 3UPVA 1H2UA 5K98B 4F6RD 2LYLA 2B6CA 3FUNA 3I4GA 2LSVA 4JCXA 2XZDG 2PXLA 2JABA 4G23A 3CVLA 2XRYA 2ZXWE 3CIAA 3DSWA 4GTVA 3U9WA 4IVZA 2A4ZA 2DWZA 4JPSA 3PZ2A 4Z5CA 3TWWA 4GQMA 2HCNA 1ZZCA 4X4IA 1BPOA 1ZU2A 3C98A 3S7BA 3RZZA 3T8MA 2HFZA 2RKKA 3P1UA 4OB4A 3KXAA 3G7DA 2P58C 3DSSA 4LUNU 3H5TA 3CECA 3PZ4A 3BG1B 2QY7A 3RO2A 3ZXSA 5GAHi 1BLXB 5FINA 1TJFA 3FULA 4TXPA 2AVPA 4DJAA 5ENNA 4PH4B 4FADA 3ZPXA 4UQXA 3SBTB 3ZGQA 2YBDA 3F51A 2AWIA 3F6QA 3ASOE 3FTWA 5AQ9A 3LJNA 4YDEA 3L6AA 2GZUA 4UUCA 3KZ3A 4RQIA 1E8YA 4DE9A 4J8FA 2XCJA 1AWCB 2PXDA 2IO3C 1N4PA 4MLPA 1EFAA 3BUAA 2V4HC 3HVEA 4O60A 4FBIA 2CROA 4N5CA 4LRZA 4DX7D 4EECA 4GMRA 2FFHA 1AU7A 3EDTB 2KCVA 3TWRA 1Z3YA 4LSZE 1ZB1A 3AJIA 3NAWA 4I2WA 5G04J 2LSUA 2PXEA 3LS8A 1Y7YA 3QKYA 3UX4A 4ANWA 3L16A 3CHPA 3DPYA 2GRMA 2R02A 1PY1A 3CVYA 1TJCA 3VTXA 5EIDA 3TG5A 5BW8C 1IQRA 4CT0A 3BS3A 2LO6A 2XCCA 5AARA 3I4RB 1TNZA 1PRUA 4WWNA 5IY5E 1SQ8A 4XKCA 2PUDA 4AXHA 2PE5A 4E6HA 5JJ6A 5E75A 4RLYA 4BT8A 3CHSA 3W9FA 3JUEA 4XIFA 2PXKA 1IHGA 3CV0A 3CKBA 1ADRA 2WXOA 1V55E 3ZFWA 4JXTA 4UQZA 3FUHA 1FVHA 4L7TA 1WETA 4LNBA 2GGFA 2PXUA 4HB5A 2XI8A 2M63A 4CDRA 3L13A 2Y1LE 3JCKC 2MEZA 1UTXA 2BNMA 3Q7AA 3AG1E 3CK8A 1H6OA 2HE0A 1SA5A 1NP7A 2PUBA 2GRQB 4GU5A 2GROB 3ABME 4AJWA 3FUFA 2QYUA 3DWLG 5JUWA 3EU5A 3OQOA 3D9HA 3PUKA 5FJYA 5BV0A 4O6FA 1HXIA 3FUKA 3OQMA 4L23A 3IXEA 5JHBA 1KLXA 4N3BA 2XGSA 3CSTA 4GZCA 1D8EA 1YSEA 1ZAYA 1N54A 3TGOA 2V5QC 2LYSA 5G2NA 5ARFA 3GZSA 3MLFA 3OXLA 1E8XA 5DBKA 3L08A 4I1AA 4J8SA 4OYSA 3Q5MA 1H6PA 2YHEA 4JA7A 3SGHA 1ZZ9A 2F0YA 1K3ZD 4J6IA 2J49A 4RSYA 1DULA 4HORA 2RFMA 4GCNA 4C0EA 2X3MA 3OQNA 3KS2A 3F52A 3V31A 2A5EA 4U8VD 2VGXA 5DTRA 4WUYA 3FUDA 3FUMA 2PIJA 3UI2A 1JH9A 2VSOE 3GYZA 2LLVA 3G5GA 2XEVA 2PM7A 1JUQA 3FU0A 2A6CA 1O1RA 3UXGA 4N3CA 3PS6A 1HU3A 3GZDC 4FLHA 5ENQD 3Q78A 2PXPA 2M4HA 1HF0A 4DUIA 2WXPA 3D9PA 3DXMG 4U8HA 4AV7A 4I1OB 2CSFA 4CDMA 3TG4A 1NERA 3B7RL 3VK0A 1TYQG 3KSQA 3B95A 3VLDA 3SZ7A 3PEUB 3FU6A 2WUSR 3C3OA 5AENA 3ZHEA 1S63A 4JHKA 1U3DA 1OCRE 1JWFA 2WXQA 2IU1A 3ZKCA 3PRZA 3V79K 3U66A 3LCAA 1LLIA 5JMND 3JXJA 4V3IA 3CGHA 4JB8P 3ZHMA 3JQ1A 4FHKA 3QWWA 4DK5A 3B7HA 1EYHA 4MBGA 3NOCD 4YDWA 4HVBA 1BI8B 3OXFA 4H7XA 3W9GA 2I9CA 2ONDA 3D9MA 3T5VA 4H7YA 2MXDA 4MS6A 2WXRA 1ZPQA 4PS8A 2QZAA 3VWSA 2XRZA 4DX1A 1LTXA 2IONA 2IV1A 2XSDC 1OCOE 2P9SG 3LEWA 3MV3B 1ZS4A 5EKQD 2HCSA 1EDUA 1OWMA 3CHMA 4U7EB 2BUGA 3LY7A 2XGMA 4FLBA 5T8IA 3R9MA 2H8RA 4JA9A 1OSLA 4RG6A 2ICTA 2J7UA 4ACKA 4G25A 2WXLA 1JWGA 3FU5A 4PDXA 3FH8A 2LUHA 3VTYA 3AS8A 4JVSA 5B1BE 3TAXA 4PU8A 4ZHBA 2X6HA 3TL5A 4A3TA 5HRYA 1RZSA 3L54A 5H7PA 3SFZA 4BERA 4LCTA 3AG2E 2P9IG 2EIKE 3S7FA 1H19A 3JXBC 4G26A 3ZYKA 1QP0A 2KATA 5FTPA 3NZSA 4X4GA 4HLEA 3QWPA 4A1GA 3HXCA 1IYGA 3S7DA 1VPWA 2I2OA 4M7CA 2DCPA 2IVQA 4IYPA 2EF8A 1HH8A 3CK9A 4KT6B 2WXGA 4J8EA 1O1TA 3OXGA 2VSYA 3TWVA 1TEZA 2LNIA 4BSZB 1U3CA 2J07A 4JC8A 4ER7A 3JXCL 2KBXA 1DNPA 1WDYA 2XHEA 3V2OA 3SD5A 2P9LG 2FF4A 3URZA 1B89A 4Y6CA 5A7DB 1NA0A 5EX3A 3B7TA 4JHRA 2LXLA 4ATZD 4EQZA 1PNRA 4EBAA 1YA0A 3PXPA 2J8SD 2WXHA 2VGXB 5KJMA 1FPPA 3LXUX 3T9KA 4KVOA 4F1PA 1HG2A 3KEAA 5B1AE 2I1JA 3ZEFA 3FDHA 2PPXA 3N71A 4APOA 3Q47B 3SBSA 2VSNA 4MKTA 1WH6A 1QYMA 1DC2A 2ETBA 4GA1A 4WNGA 4MCXA 3CVPA 2ZGGA 2RD0A 3FH7A 3G2SA 1N95A 3PZ1A 1QBQA 3BDNA 2XCBA 2V5FA 3C72A 3FWVA 2E2EA 4WAFA 5ENRD 2DZOA 5AN8A 3UM2A 5AQBA 3MYVA 4CT4A 2V0PA 2V3CC 3PVLA 4I6RA 5EDSA 2R1JL 2CG3A 2BTDA 4BTBA 3AAAC 5ANRA 2DYSE 4YG1A 4B93B 1CJGA 2KC7A 5AQ7A 1ZUGA 4O8BA 3V30A 3D1NI 3BQOA 3ASGA 3HYMB 2OOEA 3S8QA 1NEQA 3DBSA 1TNYA 3C5RA 1KZPA 1QPZA 2EIME 3E34A 2CHXA 1LMB3 3LY8A 1L1MA 5JA4D 2R03A 5ENOD 4LG6A 4OBMA 1XNFA 1SW6A 4Z5DA 2FBNA 4IWRA 2WQ6A 4XEIG 2R05A 2Y4TA 5D2MC 2LAIA 2IU7A 4UWFA 3FMYA 2WXKA 2P9UG 1WM5A 5EILA 5D0QD 4GTOA 5KJKA 3PNLB 4JEUA 1S64A 1WIZA 4UWKA 1HQ1A 3G2WA 3D9KA 2HSGA 2B0OE 4JZYA 4N5QA 4XKBA 2X6JA 3MX3A 2EILE 4KZCA 3NXHA 1SZAA 4YVQC 3L82A 4GMLA 1MX6A 4G2VA 4J1XA 1VDYA 4DI3A 5CBOA 4XZ4A 3OAWA 2JVLA 3J5PA 3EHQA 4N3AA 2GW1A 5EYLA 4F53A 1WH8A 4EKGA 3CVVA 5HI7A 2YNQA 1ZZ8A 2OEWA 2BF0X 1FVFA 1TR4A 3OTNA 3O4ZA 2JLBA 3ESKA 4G8LA 3CVQA 4J8YA 3ULYA 3ZW3A 3DM5A 3UWPA 1IC8A 4U96D 3JYSA 3D3MA 1CQTA 2O38A 3ZVVA 4GYOA 2ZGDA 3WXXA 4A63B 2PXFA 3MJWA 3DEPA 1N4SA 2GRNB 2LLWA 1UOHA 3KD7A 3DNVB 5G05C 3SFYA 3GW4A 1XWRA 1JPLA 3ZHIA 1O4XA 4HXIA 1TN6A 2I6HA 1BU9A 1QB2A 5C1DA 2BKKB 2J4BA 1Z3XA 1ELRA 1RIOA 4QQIA 1IQUA 1DCEA 3L22A 3BEEA 1RZRA 5LCWC 4UQYA 3NF1A 2XS1A 1QZ2A 1DW9A 3QFIA 3G2VA 4LNUD 2O4AA 4X4EA 4OAUC 2PUFA 2PQNA 1GT0C 5CCMA 3OMTA 1N94A 2WXJA 1N0RA 2PQRA 1UW4B 4EPZA 5M72A 3VLEA 4EZIA 1N9AA 1FT2A 5CMYA 3PZDA 2LYKA 4PU7A 2LAHA 4W9RA 2NYJA 1NZNA 3GZ2A 3LPZA 4UI9J 1KT1A 3Q9UC 4JEHA 3QOXA 2PXVA 2VGYA 2IVGA 4HS2A 4PUCA 5EX0A 3IHYA 3ULQA 3C3RA 4PS7A 4F7AA 1H6KA 4EKIA 2C0MA 3FUJA 3RK6A 3HXDA 3FTXA 1JCSA 3UM1A 2J7WA 2XQ0A 4KVMA 1PERL 3EHMA 3CHQA 3PZ3A 2DZNA 1PAQA 4HOTA 2Y3AA 3HXFA 4TUMA 3DSVA 3I3NA 2ICPA 5CHEE 5EN5D 5FQ8A 3ML9A 3SO8A 4EBAG 1OWNA 3PNTB 5FQ4A 2FO1E 3IV0A 3GZCA 5DT2A 1ELWA 3UKRG 2P9KG 5GAGi 3RRUA 2R5SA 4Q96A 2FI7A 2JEKA 5KWDA 4CZ2D 3R09A 3CQCB 4HOQA 2H6IA 3QOUA 2VYIA 1S70B 4I8TA 1X81A 1OT8A 1K8KG 1RW2A 3DPDA 5FWQA 2WQ7A 2WVIA 4YDOA 5EYPF 5BT1A 3OWQA 5HS0A 1X2LA 4GA2A 2WXFA 4MCTA 5DTMA 3TJPA 3U64A 4CDNA 3PDNA 2CG2A 3LISA 4QFVA 3UT4A 3QARA 1HF8A 2OV8A 3MZLB 5ANLA 4HNAD 1BI7B 2XS8A 3AU4A 4Z68A 1H2TC 3B7BA 3D9NA 5ENTD 1ZZ6A 2R17C 2QC9A 3T5XA 2X6KA 2IY0C 4JQDA 3MEKA 5DIZA 4ER0A 1UN8A 4OVVA 4I6JA 2L49A 3FTUA 1EPUA 3AG4E 3HHMA 4YARA 4OVUA 2WM9A 5FZSA 3O9XA 3CVUA 1OUVA 5CECB 1HFAA 4CGVA 3VLFA 1E3OC 3SNXA 2J09A 4AP2A 4HOUA 4AM9A 3PE3A 4NQ0A 3CHOA 3TWSA 3NDBB 3L1PA 1SQMA 4GTSA 2RG8A 3CR3A 1G3NB 2B5AA 4L1BA 4AEZC 1E90A 3HG0D 3D9JA 3E30A 2C2LA 3MCXA 4ACLA 2QFCA 2NSZA 2L6JA 1ELKA 2XXAA 5BUZA 2EBYA 4C48B 3G2TA 5CERB 4GTMA 3SX0A 5CEAA 3UKUG 2HYZA 4FULA 1OWPA 2NC9A 4ANUA 3QAQA 5EIBE 3FHEA 4BTAA 5D66A 3PH0C 3MGBA 3TFLA 5CCLA 1OCTC 2IOSA 3RJVA 3IHVA 4A1SA 3Q75A 3EU9A 4Y42A 2J9QA 5LX8A 3ZYQA 3FUEA 1RZRD 1WG0A 3E33A 1K1AA 5KNGA 3SQVA 2AXZA 2LYQA 2IOLA 1QZXA 2EWTA 3LQXA 1E8WA 2ODRD 4P29A 2KEJA 2JQEA 4N2QA 1TN7A 3FP3A 3E37A 4UWGA 1KPSB 3FH5A 4WWOA 3NROA 3UM0A 3X2QE 2AW6A 2R63A 1MYOA 4I9EA 3LYAA 1HG5A 4AY5A 1Y6IA 1IXVA 4FU3A 4DX2A 2PZIA 2V4LA 2LXMA 3CVNA 3HDXA 3D9IA 3OKZA 3DXKG 3R1FA 4FP7A 4E85A 2L8NA 3CEQA 1E7UA 1PRAA 1HE8A 1QQAA 1JCRA 1O5MA 1WY6A 3NZUA 3PEVB 1H2VC 3FUIA 2ILRA 4GZ5A 4NURA 3RIBA 4XE0A 1AP7A 1TNOA 3SCHA 1SZ9A 5AIJA 1RZ4A 2PUGA 1Y8MA 4GYYA 2L0TB 4B89A 4FJZA 2KXPC 4XI9A 3DSXA 5T3RA 3NB2A 1UJJA 3FY4A 1X5BA 4M3OA 4GPKA 4X4HA 2XGOA 5AJDA 1E96B 5C2YA 3SCGA 3PREA 2VQ2A 4JHJA 3RKVA 4HI9A 1BDIA 2HINA 4RG9A 4K0RA 4DE8A 3CROL 1S7EA 4X4DA 4UWLA 2XIUA 1JWLA 2PUEA 5ENPD 2P9PG 2MHKA 4J8DA 1LCCA 4PS3A 2LCVA 1UN9A 2BNOA 4N2SA 3A9YA 3HRAA 4ME2A 3FEXA 5G05J 2VSXE 4XX5A 1BD8A 3ZRHA 5BV1A 1HS6A 1MX4A 2JCGA 2UY1B 5KBAA 4GTTA 4L9PA 4YNDA 4GZDA 3RRNB 4I17A 4PU3C 2EQXA 5LCWJ 3TELA 1DWKA 3GUUA 4J1WA 5CMWA 3QYXA 4BESA 1W3BA 3PE5A 3QJZA 4DLOA 1JFTA 2KEIA 4HRLA 3MEJA 1UXDA 1N0QA 3L9TA 5DRYA 2PM6A 1KZOA 3UUXA 2IFUA 1B0NA 2KZTA 2YINA 3EIQC 5E76A 1EF1C 1TNBA 3FTZA 2MQKA 3KAEA 4X8QA 2BKGA 3LKUA 1Y9QA 3LY9A 3GZ1A 3K9IA 3JXDL 3Q79A 4B0ZA 2FJRA 2AXVA 3ONLA 1OWOA 4U8YD 3ZNGA 1UG3A 5A7LA 2AXUA 2E0IA 2X6IA 4GTRA 3QWGA 4ER6A 3SCFA 2VGEA 1D9SA 4ZFHA 1Z5SC 3B13A 5BNWA 2KPJA 3HXEA 3LVRE 3CVWA 4I9CA 2J08A 4HQDA 2XENA 5ITZF 3TWXA 2IO2C 1MX2A 2CHWA 1ZBPA 2IEJA 5FQ6A 4C9BB 4K03A 2KCLA 4GHJA 3QQ6A 3SFXA 2OR1L 4G1TA 3ESLA 4JW1A 3ML8A 3E4BA 3FEYA 2OFYA 4KZ0A 2P9NG 4CRWA 3RSEG 3EUVA 3KEZA 2YQ8A 1ZZBA 2XXQA 4WVLA 4EZKA 3D9OA 4U63A 3LJ3A 3RU0A 3Q49B 2ZU6B 2GRPB 3ISMC 3LVQE 5DTQA 4A55A 2FO7A 4LEUA 2WPVA 3IBEA 4L2LA 1INZA 3R7QA 2X6FA 4B8AA 1P5QA 2J4DA 1E8ZA 2CHZA 4GTQA 2HM8A 1LCDA 4TXQA 2H6FA 1MZCA 2OVBA 3UINC 4ANXA 4DX5D 4DLQA 4Q2JA 3RRMB 3NBNB 5AAOA 2L6BA 4DPRA 2Y69E 4JD2G 4LERA 1A17A 4U95D 2CFZA 2VJ8A 4BY6A 1IKND 4BFRA 2IQCA 3ZPJA 4HOSA 3FYMA 3A9XA 2R2LA 4U0UA 2XJ3A 3JUIA 4YG7B 1MJ0A 2VTBB
chains in the Genus database with same CATH topology
3TAXA 4PU8A 4CDNA 4ATGA 3HIZA 2X6HA 2XPYA 3PDNA 2GRLA 4D10C 3QF3A 3TL5A 3ZHEB 2DIWA 4L2YA 4A3TA 2CG2A 3FTSA 3LISA 4GAAA 3QB2A 4PU4C 3KJXA 4F8DA 4I1MA 5JHBA 4QFVA 1RZSA 4GCOA 3UT4A 5JJTA 3TRBA 3L54A 3SFZA 4GA0A 3QARA 1HF8A 4LCTA 4U04A 2OV8A 3MZLB 5ANLA 3ZYMA 2FEZA 4GB9A 5KCMA 3S7FA 4F3VA 3U4TA 1JFSA 3AU4A 1H19A 3JXBC 4G26A 3R9AB 3ZYKA 1H2TC 2NXPA 4ANVA 4MRUA 1QP0A 3D9NA 2KATA 2Q7FA 4RVBA 1ZZ6A 1QQEA 2R17C 4BSXA 3LFPA 3EHNA 5FTPA 3NZSA 2IJGX 4X4GA 4I6UA 4KYOB 3T5XA 4HLEA 3CQGB 3QWPA 4A1GA 4I6EA 2IUOA 2X6KA 1UXCA 4NRHB 4CCAA 3O48A 4JQDA 3MEKA 1Z6TA 5DIZA 1IYGA 2BNNA 3S7DA 1VPWA 2IVBA 2I2OA 4KXKB 2FULA 3EIJA 4UWHA 2PUCA 2DCPA 3IEGA 4C0MA 2IVQA 2L9BA 4IYPA 4EQFA 1UN8A 3FFLA 4OVVA 3SI5A 2EF8A 1HH8A 4I6JA 2L49A 3CK9A 4XI0A 4I43A 4KT6B 1LF8A 2WXGA 3FTUA 1EPUA 4J8EA 3HHMA 5AYWD 2MRIA 4YARA 3ASHA 3SF4A 4AY6A 3OXGA 4OVUA 2VSYA 2WM9A 3O9XA 2L0IA 3APFA 4UI9K 1OUVA 5FZSA 1HFAA 3CLJA 3CVUA 2MOWA 5LOZA 4CGVA 3VLFA 1E3OC 5KJNA 3SNXA 1BDHA 4WNFA 3UPVA 2LNIA 1H2UA 3ASFA 1U3CA 5K98B 2J09A 2J07A 4I6GA 2LYLA 4AP2A 4HOUA 4AM9A 5A23A 4JC8A 3PE3A 2HR2A 3CHOA 2PL2A 4NQ0A 3FUNA 3I4GA 5D0OD 3JXCL 3CK7A 1DNPA 4I6TA 3L1PA 2LSVA 2XHEA 4JCXA 3U3WA 1SQMA 2RG8A 3SD5A 3CR3A 2FF4A 3URZA 3GN5B 1B89A 4NACA 3OP9A 4Y6CA 2KZTB 4G23A 5A7DB 1NA0A 2B5AA 3MV2B 1E7VA 3CVLA 3B7TA 4JHRA 4L1BA 1E90A 5EX3A 5FZQA 3R7RA 4AEZC 4CEMA 3D9JA 2XRYA 3CIAA 3U9WA 2C2LA 1PNRA 4APFA 4EBAA 1R69A 4IVZA 1YA0A 3PXPA 2A4ZA 3MCXA 4ACLA 2WXHA 4JPSA 2QFCA 4Z5CA 2NSZA 4GQMA 2VGXB 5A6CA 2L6JA 1ELKA 5KJMA 1ZZCA 4X4IA 1BPOA 5BUZA 4Q94A 2EBYA 1ZVVA 5J90A 3G2TA 5FQ7A 3GBFA 3LXUX 4KVOA 1ZU2A 1OWLA 2WXNA 3C98A 3S7BA 1HG2A 1KT0A 3ZIMA 3RZZA 4EZJA 2I1JA 3T8MA 3P2BA 1RPEL 3L17A 3RO3A 3FDHA 4OB4A 2HYZA 3P1UA 4FULA 3ZEFA 4B8CB 3KXAA 1OWPA 2LYPA 2NC9A 4ANUA 3QAQA 4X4FA 5JJ7A 2PPXA 3N71A 4APOA 3FHEA 3MKRA 3Q47B 4BTAA 3SBSA 3G7DA 2P58C 2VSNA 4MKTA 1WH6A 4AVXA 3PH0C 3ZN3A 4GA1A 4WNGA 3MGBA 4LUNU 4MCXA 3H5TA 3CVPA 3APCA 4WNDA 1OCTC 2IOSA 3CECA 2RD0A 3FH7A 3G2SA 3IKOB 5CCLA 3RJVA 3BG1B 2QY7A 3IHVA 3RO2A 4A1SA 3ZXSA 4IA8A 1QNFA 4Q69A 4Y42A 2J9QA 3BDNA 5LX8A 2XCBA 1TJFA 3ZYQA 5HQ8A 2WIUB 3IVPA 1RZRD 2V5FA 3CSFA 3FWVA 2E2EA 3FULA 3FUEA 2AVPA 4WAFA 4DJAA 3EUSA 3SHFA 4EZLA 3S7JA 2AXZA 2LYQA 5ENNA 4PH4B 3FU3A 3MYVA 3ONKA 2IOLA 4CT4A 2V0PA 3FTVA 4FADA 4UQXA 5BPPA 5LFAA 4FC8A 2EWTA 3PVLA 4I6RA 1E8WA 4P29A 2KEJA 3SBTB 4AOFA 3ZGQA 3F51A 4AIFA 2R1JL 2CG3A 2AWIA 2R59A 2BTDA 5EDSA 3FP3A 4Z5HA 3PUJA 4N2QA 4UWGA 4GZ6A 4BTBA 3FTWA 3FH5A 4WWOA 2WB2A 5ANRA 1DVPA 2AW6A 2R63A 4YG1A 3L6AA 3LYAA 4I9EA 1CJGA 2GZUA 1HG5A 1Y6IA 4GZ3A 4TUUA 4AY5A 1PRVA 2KC7A 1ZUGA 3QK0A 4FU3A 3KZ3A 1XGWA 4X4CA 2PZIA 2V4LA 1E8YA 3CVNA 2KM4A 4J8FA 4O8BA 3MKQA 3HDXA 3D9IA 4WNEA 2XCJA 3R1FA 3D1NI 4FP7A 4TV3A 2L8NA 2AUWA 4E85A 3CEQA 2BJCA 3ASGA 3HYMB 2OOEA 4MLPA 1EFAA 1E7UA 2X38A 3HVEA 1PRAA 1HE8A 2UY1A 4G24A 3S8QA 4FBIA 2CROA 1QQAA 1NEQA 4N5CA 3DBSA 1N52A 1WY6A 3NZUA 3PEVB 1H2VC 4ILHB 3FUIA 1QPZA 2C0LA 2ILRA 4LRZA 1QQBA 4GZ5A 4EECA 4NURA 1AU7A 3RIBA 2CHXA 1LMB3 4XE0A 3EDTB 3UQ3A 2Y4UA 2KCVA 1Z3YA 4J0UA 4I2ZA 3LY8A 1L1MA 5G04J 4I2WA 3SCHA 1L5JA 1SZ9A 2LSUA 1FCHA 5AIJA 2PUGA 3LS8A 1Y7YA 1Y8MA 3QKYA 3UX4A 4ANWA 3L16A 3CHPA 4GYYA 2WXMA 1XNFA 2L0TB 4B89A 4FJZA 4Z5DA 2FBNA 4HFGA 2GRMA 4IWRA 4IULA 1PY1A 4XI9A 5LP0A 2WQ6A 3CVYA 1TJCA 5T3RA 3VTXA 4BX9A 2Y4TA 5BW8C 1IQRA 1UJJA 3FY4A 3TG5A 2LAIA 4CT0A 3BS3A 2IU7A 1X5BA 2LO6A 4M3OA 2XCCA 4UWFA 3FMYA 4X4HA 4GPKA 2XGOA 2WMOA 2OVFA 2WXKA 4ABNA 3I4RB 1PRUA 5AJDA 5T4YA 1WM5A 1E96B 4WWNA 3UT8A 5D0QD 3CVXA 1SQ8A 4XKCA 5KJKA 2PUDA 5C2YA 3SCGA 4ILGA 4AXHA 2PE5A 1QP4A 4E6HA 3PNLB 4JEUA 5E75A 5JJ6A 4BT8A 3PREA 3CHSA 2VQ2A 4JHJA 1QP7A 3UMVA 3MA5A 1WIZA 2WMNA 3G2WA 2YHCA 4UWKA 4G11A 4XIFA 5KJLA 3D9KA 5G04C 1GW6A 2HSGA 1IHGA 3CV0A 3RKVA 4JZYA 3CKBA 1ADRA 2WXOA 4XKBA 2X6JA 3MX3A 1BDIA 3CLCA 3G2UA 2HINA 4KZCA 1SZAA 4YVQC 3ZFWA 4JXTA 1R63A 4RG9A 4U0SA 4UQZA 3FUHA 1WAO1 1FVHA 4GMLA 4K0RA 4L7TA 1WETA 3CROL 4G2VA 1S7EA 1MHQA 4BT9A 4X4DA 4UWLA 2XIUA 4J1XA 1VDYA 2GGFA 4UI9C 4DI3A 1JWLA 3UFDA 2PUEA 2O49A 2XI8A 4XZ4A 2M63A 3OAWA 2JVLA 3EJNA 3L13A 4ILIA 4CDRA 1NA3A 2KZ8A 4N3AA 3JCKC 2GW1A 2MHKA 1LCCA 2MEZA 4J8DA 4PS3A 2LCVA 1UTXA 1UN9A 2BNOA 4N2SA 4F53A 1WH8A 3CVVA 3Q4AB 5HI7A 3UT7A 2YNQA 1ZZ8A 2BNMA 3FEXA 4ME2A 5G05J 3BG0B 2VSXE 4XX5A 3F6WA 3ZRHA 3CK8A 2BF0X 5BV1A 5G55A 1FVFA 1HS6A 3HVEB 4NDWA 2JCGA 2UY1B 3O4ZA 1NP7A 2PUBA 3OTNA 3TJPA 2JLBA 2XPIA 3ESKA 3CVQA 4GU5A 4YNDA 4GZDA 4AJWA 3TXNA 3RRNB 3FUFA 3ZW3A 4I17A 4PU3C 4A3VA 1IC8A 3FTYA 2EQXA 3OQOA 5LCWJ 3CKCA 3PUKA 5FJYA 5BV0A 4O6FA 1HXIA 1DWKA 3FUKA 3OQMA 4L23A 4J1WA 3JYSA 3D3MA 5CMWA 4B94A 3QYXA 1CQTA 2O38A 1KLXA 2HO1A 2XGSA 3CSTA 4N3BA 4GZCA 3B7SA 1W3BA 3ZVVA 4GYOA 3QJZA 3WXXA 4DLOA 1YSEA 1JFTA 1ZAYA 2KEIA 1N54A 3TGOA 2LYSA 3MJWA 3QNKA 4WWPA 5G2NA 5ARFA 4YBAA 3GZSA 3MLFA 1UXDA 3KD7A 3OXLA 3DNVB 1E8XA 5DBKA 2PM6A 4Z58A 3L08A 4I1AA 4J8SA 4OYSA 5FZRA 2CFUA 3Q5MA 2IFUA 1B0NA 2KZTA 2I1KA 2YHEA 4JA7A 1ZZ9A 4J6IA 2XPZA 2YINA 2J49A 3GW4A 1XWRA 4RSYA 4HORA 3EIQC 3AS4A 1JPLA 4GCNA 1EF1C 3ZHIA 2WXIA 5E76A 4C0EA 3FTZA 4GYWA 2X3MA 3OQNA 1O4XA 4HXIA 2MQKA 3KAEA 1MQSA 3KS2A 3F52A 2I6HA 3B7UX 3Q15A 5ARGA 1ZZ7A 3LKUA 5C1DA 2J4BA 1Z3XA 1ELRA 1Y9QA 1RIOA 2VGXA 2LYJA 1IQUA 3LY9A 4FHJA 4WUYA 3FUDA 3GZ1A 3FUMA 3K9IA 3L22A 3JXDL 2PIJA 5FT9A 3BEEA 1RZRA 4B0ZA 2FJRA 5LCWC 4URKA 1JH9A 2AXVA 4UQYA 3ONLA 1OWOA 3NF1A 2VSOE 3GYZA 3G5GA 1QZ2A 2XEVA 1DW9A 3PE4A 3G2VA 1UG3A 1UJKA 3QDNA 4GMJA 4DI4A 5A7LA 2AXUA 2O4AA 2PM7A 4X4EA 2E0IA 2X6IA 1JUQA 3QWGA 2A6CA 2PUFA 2PQNA 1GT0C 3FU0A 5G05C 3ASDA 3OMTA 4N3CA 5CCMA 3SCFA 4R7LA 3PS6A 3S2AA 1HU3A 2WXJA 3QWVA 3B13A 2PQRA 1UW4B 4EPZA 5BNWA 5M72A 2KPJA 3VLEA 3LVRE 3I5PA 5CMYA 3PZDA 2LYKA 4PU7A 2LAHA 4FLHA 2LYRA 1S0PA 3CVWA 3UUXA 4FN3A 4I9CA 1HF0A 4W9RA 4FJYA 2J08A 4BX8A 2WXPA 1NZNA 3D9PA 4U8HA 3GZ2A 2CHWA 3LPZA 2CSFA 4I1OB 4UI9J 1ZBPA 4AV7A 4CDMA 1KT1A 4JEHA 3TG4A 1NERA 5FQ6A 3B7RL 2VGYA 2IVGA 3VK0A 1LQCA 4HS2A 4K03A 2KCLA 3QC1A 4C9BB 4GHJA 2KCKA 3QQ6A 3IHYA 4IN3B 2OR1L 4PUCA 5EX0A 4U0ZA 2VTBA 4G1TA 3ULQA 3VLDA 3SZ7A 3ESLA 4JW1A 3ML8A 3E4BA 4PS7A 2IF4A 3FYAA 2V8SE 3FEYA 2WUSR 3FU6A 3NQPA 3PEUB 4F7AA 1H6KA 4FA6A 2D5VA 5AENA 3ZHEA 4F1SA 2OFYA 4KZ0A 2C0MA 3FUJA 4JHKA 3RK6A 4CRWA 1U3DA 3KEZA 2YQ8A 4Z59A 1H0AA 3FTXA 3D9LA 1JWFA 2WXQA 2IU1A 3ZKCA 1ZZBA 3PRZA 2XQ0A 4KVMA 1PERL 3SGHA 1HO8A 3CHQA 3EHMA 4EZKA 3D9OA 4U63A 3LCAA 3U66A 1TEZA 3LJ3A 1LLIA 3RU0A 1PC2A 1PAQA 4HOTA 2Y3AA 3LDZA 5J08A 3Q49B 3I3NA 2ZU6B 3AU5A 4V3IA 3ZYLA 3CGHA 4CGWA 2ICPA 3LVQE 3ZHMA 5CHEE 5AJLA 5FQ8A 4A55A 3JQ1A 3ML9A 2FO7A 4FHKA 4LEUA 3QWWA 2WPVA 3IBEA 3HZIB 4DK5A 4EBAG 1OWNA 4L2LA 3B7HA 1EYHA 3PNTB 5FQ4A 4KBQA 1INZA 3R7QA 3MKQB 4JCYA 2X6FA 4HVBA 3IV0A 1POUA 2PUAA 1ELWA 1P5QA 2J4DA 1E8ZA 4B8AA 2CHZA 4JL0A 3OXFA 2HM8A 4H7XA 2I9CA 2ONDA 3JQ0A 3RRUA 3D9MA 3T5VA 2R5SA 5JHAA 4Q96A 1LCDA 4H7YA 2FI7A 1HX8A 2JEKA 4MS6A 2WXRA 1ZPQA 4PS8A 4IRUA 2A5UA 3APDA 3CQCB 4HOQA 3QOUA 2XRZA 2OVBA 2IONA 2VYIA 1HZ4A 4TRQA 4Y6WA 2WQHA 4ANXA 4DLQA 2IV1A 2XSDC 3LEWA 3RRMB 4I8TA 4DPRA 4N39A 2DBAA 3MV3B 1ZS4A 4KMOA 5EKQD 3AS5A 1EDUA 1OWMA 3BD1A 3CHMA 2BUGA 3DPDA 4LERA 5FWQA 3LY7A 2XGMA 1A17A 2UWJG 3CHRA 4FLBA 5T8IA 2WQ7A 4X4BA 2H8RA 2CFZA 1OSLA 2VJ8A 2WVIA 4JA9A 3GN5A 2KEKA 4RG6A 4BY6A 4BWRA 2ICTA 5BT1A 4U07A 3TXMA 4ACKA 4BFRA 4G25A 2WXLA 1X2LA 1JWGA 2IQCA 3ZPJA 4HOSA 3FYMA 3FU5A 3ENEA 4PDXA 4GA2A 3FH8A 4U0UA 3VTYA 2WXFA 2XJ3A 3JUIA 4MCTA 3AS8A 4YG7B 4YG4A 4JVSA 2VTBB 1X57A 4YVOA 3U64A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LYK A;  4PU7 A;  4PU8 A;  2LYR A;  2HSG A;  4FN3 A;  3G7D A;  1HF0 A;  1WH6 A;  1ADR A;  2GRL A;  3QF3 A;  4MCX A;  3H5T A;  3LIS A;  1BDI A;  3CLC A;  1OCT C;  2HIN A;  3CEC A;  4PU4 C;  2CSF A;  3KJX A;  4F8D A;  1R63 A;  1RZS A;  4IA8 A;  3TRB A;  1NER A;  4Y42 A;  1WET A;  3CRO L;  1S7E A;  2IVG A;  3VK0 A;  1LQC A;  4X4D A;  3BDN A;  4GHJ A;  2WIU B;  2XIU A;  3IVP A;  3QQ6 A;  4J1X A;  1RZR D;  1JWL A;  2OR1 L;  3UFD A;  2PUE A;  2O49 A;  2XI8 A;  3EUS A;  2JVL A;  3FYA A;  2WUS R;  2AXZ A;  2KZ8 A;  2LYQ A;  2PPX A;  1JFS A;  2D5V A;  3JXB C;  2MEZ A;  1LCC A;  2OFY A;  2LCV A;  1UTX A;  2BNO A;  1WH8 A;  2EWT A;  1QP0 A;  4I6R A;  2KEJ A;  1ZZ8 A;  1ZZ6 A;  2BNM A;  3F51 A;  3LFP A;  4Z59 A;  2AWI A;  2R1J L;  4Z5H A;  4X4G A;  3F6W A;  4I6U A;  3ZKC A;  1ZZB A;  2IUO A;  4NDW A;  1PER L;  1UXC A;  2JCG A;  2PUB A;  2AW6 A;  2R63 A;  4JQD A;  4YG1 A;  1LLI A;  1CJG A;  2GZU A;  2BNN A;  1VPW A;  2IVB A;  1PRV A;  1ZUG A;  3KZ3 A;  2PUC A;  4X4C A;  4PU3 C;  2IVQ A;  2ICP A;  1IC8 A;  4O8B A;  3ZHM A;  2EF8 A;  3OQO A;  2L49 A;  2XCJ A;  3R1F A;  3D1N I;  1DWK A;  2L8N A;  2AUW A;  3OQM A;  4J1W A;  3HZI B;  2BJC A;  4YAR A;  3QYX A;  1CQT A;  2O38 A;  3B7H A;  1EFA A;  1PRA A;  3O9X A;  3S8Q A;  4FBI A;  2CRO A;  1QQA A;  1NEQ A;  4JCY A;  1POU A;  2PUA A;  1YSE A;  1JFT A;  1E3O C;  1ZAY A;  2KEI A;  1BDH A;  2LYS A;  5K98 B;  1QPZ A;  4YBA A;  3MLF A;  1UXD A;  2LYL A;  1QQB A;  3DNV B;  1LCD A;  4Z58 A;  1AU7 A;  1B0N A;  1LMB 3;  1ZZ9 A;  1ZPQ A;  3JXC L;  4I6T A;  1XWR A;  3L1P A;  4JCX A;  3U3W A;  3ZHI A;  1L1M A;  3SCH A;  3OQN A;  3GN5 B;  1O4X A;  3OP9 A;  2PUG A;  2MQK A;  1Y7Y A;  3F52 A;  1ZZ7 A;  2B5A A;  2IV1 A;  2XSD C;  1Y9Q A;  1RIO A;  2LYJ A;  4Z5D A;  2GRM A;  4IWR A;  4I8T A;  3JXD L;  2PIJ A;  1PNR A;  1RZR A;  1R69 A;  2FJR A;  4IVZ A;  3PXP A;  1ZS4 A;  1JH9 A;  2AXV A;  3BD1 A;  3G5G A;  4Z5C A;  4GQM A;  3BS3 A;  2IU7 A;  1DW9 A;  1ZZC A;  4X4I A;  3FMY A;  4X4B A;  4X4H A;  1OSL A;  2H8R A;  2EBY A;  1ZVV A;  3GN5 A;  5A7L A;  2KEK A;  1PRU A;  2AXU A;  3GBF A;  2O4A A;  2ICT A;  4X4E A;  1SQ8 A;  3QWG A;  2A6C A;  2PUF A;  2PUD A;  1GT0 C;  1X2L A;  3RZZ A;  3OMT A;  3SCG A;  3FYM A;  3SCF A;  2PE5 A;  1QP4 A;  1RPE L;  2XJ3 A;  4OB4 A;  4MCT A;  3KXA A;  4YG7 B;  2KPJ A;  2LYP A;  4YG4 A;  1QP7 A;  4X4F A;  1WIZ A;  1X57 A; 
#chains in the Genus database with same CATH topology
 3HIZ A;  3ZUV B;  2XPY A;  2DIW A;  4L2Y A;  4GAA A;  2ETC A;  3Q7F A;  3QB2 A;  4PU4 C;  4F8D A;  4I1M A;  5JJT A;  2PXT A;  4U04 A;  3DEO A;  3UM3 A;  1JFS A;  2NXP A;  2OCC E;  4ANV A;  1OXJ A;  4RVB A;  1QQE A;  4BSX A;  3LFP A;  3EHN A;  2IJG X;  4KYO B;  3CQG B;  4GPM A;  1NW3 A;  1NI1 A;  4NRH B;  4CCA A;  3Q73 A;  2BNN A;  3EHR A;  4KXK B;  3EIJ A;  3J5Q B;  3IEG A;  4EQF A;  2L9B A;  3FFL A;  3G0T A;  4XI0 A;  4I43 A;  1LF8 A;  2MRI A;  3ASH A;  3Q9N C;  4G8K A;  2L0I A;  3CLJ A;  2MOW A;  5KJN A;  3ASF A;  4I6G A;  5A23 A;  3M9L A;  4ER3 A;  2HR2 A;  2PL2 A;  5D0O D;  3CK7 A;  4I6T A;  3U3W A;  3GN5 B;  4NAC A;  3SY2 A;  3OP9 A;  5CRU A;  3ZKJ A;  2KZT B;  3MV2 B;  1E7V A;  1U2Z A;  5HKP A;  5FZQ A;  3R7R A;  4CEM A;  4APF A;  1R69 A;  3E32 A;  2H6G A;  5A6C A;  4Q94 A;  1ZVV A;  5J90 A;  5FQ7 A;  3GBF A;  2EIJ E;  1OWL A;  2WXN A;  3ZIM A;  1KT0 A;  4EZJ A;  3UIO C;  3P2B A;  1RPE L;  2ZIS A;  3L17 A;  3RO3 A;  4B8C B;  2LYP A;  5KNH D;  5JJ7 A;  2XXP A;  4X4F A;  4BEP A;  3MKR A;  1YYH A;  2PNN A;  4K5A B;  4AVX A;  2XZT G;  4K5B A;  3ZN3 A;  3APC A;  4WND A;  3IKO B;  2DYR E;  4HRM B;  4IA8 A;  1QNF A;  4Q69 A;  3DSU A;  5HQ8 A;  2WIU B;  3IVP A;  3CSF A;  2QYJ A;  3EUS A;  3SHF A;  4EZL A;  3S7J A;  1YMP A;  3FU3 A;  3ONK A;  3HXB A;  3ME5 A;  3FTV A;  5LFA A;  5BPP A;  2XEE A;  3DRA A;  4FC8 A;  4AOF A;  1U2V G;  4AIF A;  2R59 A;  3PUJ A;  4Z5H A;  4GZ6 A;  5B3S E;  2WB2 A;  1DVP A;  4TUU A;  4GZ3 A;  2BED A;  1PRV A;  3QK0 A;  1XGW A;  4X4C A;  2VEO A;  2KM4 A;  3MKQ A;  4WNE A;  4HI8 A;  4TV3 A;  2AUW A;  2BJC A;  3KL4 A;  2X38 A;  4G24 A;  2UY1 A;  1N52 A;  4ILH B;  3ASN E;  2XEH A;  2C0L A;  5AQA A;  1QQB A;  1A5E A;  1K1B A;  1MFQ C;  3UQ3 A;  2Y4U A;  4J0U A;  4I2Z A;  4J7W A;  1L5J A;  1FCH A;  3ABK E;  4ER5 A;  3TWT A;  2WXM A;  4HFG A;  4IUL A;  5LP0 A;  3TWU A;  4BX9 A;  2WMO A;  2OVF A;  4ABN A;  3JXI A;  5T4Y A;  3CVX A;  3UT8 A;  4ILG A;  1SVX A;  1QP4 A;  4EHM A;  1QP7 A;  3UMV A;  3MA5 A;  2WMN A;  2YHC A;  4G11 A;  5KJL A;  2GRR B;  4EK9 A;  5G04 C;  1GW6 A;  2LNM A;  3CLC A;  3G2U A;  4HBD A;  1R63 A;  4U0S A;  1WAO 1;  3NOG D;  2F8Y A;  1MHQ A;  4BT9 A;  4UI9 C;  3UFD A;  2O49 A;  3EJN A;  4ILI A;  3A9Z A;  1NA3 A;  2KZ8 A;  1OY3 D;  4OAV B;  3Q4A B;  3UT7 A;  4LNG A;  3BG0 B;  3F6W A;  4DRX E;  5G55 A;  3HVE B;  4NDW A;  3C3Q A;  2XPI A;  2AJA A;  3TXN A;  4A3V A;  3FTY A;  3AG3 E;  3CKC A;  3KSL A;  5BXU A;  3WG7 E;  3UTM A;  4B94 A;  2HO1 A;  2EIN E;  3B7S A;  1O1S A;  1YCS B;  5CRV A;  2F8X K;  2L1P A;  3QNK A;  4WWP A;  4YBA A;  3ZU7 B;  4Z58 A;  4FA6 A;  5FZR A;  2CFU A;  2I1K A;  1OCC E;  2XPZ A;  3AS4 A;  4HRA A;  2WXI A;  4GYW A;  3Q15 A;  5DSX A;  1MQS A;  3B7U X;  5ARG A;  1ZZ7 A;  4NIK A;  2LYJ A;  4FHJ A;  3ABL E;  5FT9 A;  4URK A;  3TEP A;  3GZD A;  3PE4 A;  3QDN A;  1UJK A;  4GMJ A;  2RFA A;  4DI4 A;  2DVW A;  4BET A;  3ASD A;  4R7L A;  3S2A A;  3QWV A;  3I5P A;  2LYR A;  1S0P A;  4FN3 A;  4FJY A;  4BX8 A;  1LQC A;  3QC1 A;  2KCK A;  2PXQ A;  3BU8 A;  4IN3 B;  2VTB A;  4U0Z A;  2ZIR A;  3ULE G;  2IF4 A;  3FYA A;  2V8S E;  3NQP A;  2D5V A;  4F1S A;  1NFI E;  3T8K A;  4Z59 A;  1H0A A;  3D9L A;  3V2X A;  1HO8 A;  3SR4 A;  2P2C P;  2Y0B G;  1PC2 A;  3LDZ A;  5J08 A;  3AU5 A;  3ZYL A;  1N11 A;  4CGW A;  5AJL A;  1Q2Z A;  3HZI B;  1DCQ A;  4KBQ A;  3MKQ B;  4JCY A;  1TNU A;  1POU A;  2PUA A;  4JL0 A;  5CED B;  2MYO A;  4O1O A;  3JQ0 A;  5JHA A;  1HX8 A;  1N4Q A;  5ENS D;  4CYM D;  4IRU A;  2A5U A;  4HLL A;  3APD A;  4Y6W A;  1HZ4 A;  4TRQ A;  2WQH A;  1TN8 A;  1NL4 A;  3TWQ A;  2F37 A;  4K5C A;  4N39 A;  2DBA A;  4KMO A;  3AS5 A;  3BD1 A;  1IHB A;  2UWJ G;  4GTP A;  3CHR A;  3UIP C;  4X4B A;  3GN5 A;  2KEK A;  4BWR A;  4U07 A;  3TXM A;  4YDY A;  3ENE A;  1SA4 A;  4YG4 A;  2OEV A;  1X57 A;  4YVO A;  4ATG A;  2GRL A;  4D10 C;  4DX6 D;  3QF3 A;  3ZHE B;  3FTS A;  1LD8 A;  3KJX A;  4GCO A;  3TRB A;  4GA0 A;  1FT1 A;  3ZYM A;  2FEZ A;  4GB9 A;  5KCM A;  4F3V A;  5FIO A;  3U4T A;  4HRN A;  3R9A B;  4MRU A;  1LD7 A;  2Q7F A;  3DST A;  4I6U A;  1OCZ E;  4I6E A;  2IUO A;  5CBN A;  1UXC A;  5BXO A;  3O48 A;  1Z6T A;  3NZL A;  2IVB A;  3QOW A;  2FUL A;  4UWH A;  1JCQ A;  2PUC A;  4C0M A;  5DRT A;  3SI5 A;  3RAU A;  1D8D A;  5AYW D;  3SF4 A;  4AY6 A;  2ETA A;  3ZXP A;  4UI9 K;  1V54 E;  3APF A;  4TXR A;  2PXB A;  5LOZ A;  1BDH A;  4O1P A;  4WNF A;  2H6H A;  1N4R A;  3UPV A;  1H2U A;  5K98 B;  4F6R D;  2LYL A;  2B6C A;  3FUN A;  3I4G A;  2LSV A;  4JCX A;  2XZD G;  2PXL A;  2JAB A;  4G23 A;  3CVL A;  2XRY A;  2ZXW E;  3CIA A;  3DSW A;  4GTV A;  3U9W A;  4IVZ A;  2A4Z A;  2DWZ A;  4JPS A;  3PZ2 A;  4Z5C A;  3TWW A;  4GQM A;  2HCN A;  1ZZC A;  4X4I A;  1BPO A;  1ZU2 A;  3C98 A;  3S7B A;  3RZZ A;  3T8M A;  2HFZ A;  2RKK A;  3P1U A;  4OB4 A;  3KXA A;  3G7D A;  2P58 C;  3DSS A;  4LUN U;  3H5T A;  3CEC A;  3PZ4 A;  3BG1 B;  2QY7 A;  3RO2 A;  3ZXS A;  5GAH i;  1BLX B;  5FIN A;  1TJF A;  3FUL A;  4TXP A;  2AVP A;  4DJA A;  5ENN A;  4PH4 B;  4FAD A;  3ZPX A;  4UQX A;  3SBT B;  3ZGQ A;  2YBD A;  3F51 A;  2AWI A;  3F6Q A;  3ASO E;  3FTW A;  5AQ9 A;  3LJN A;  4YDE A;  3L6A A;  2GZU A;  4UUC A;  3KZ3 A;  4RQI A;  1E8Y A;  4DE9 A;  4J8F A;  2XCJ A;  1AWC B;  2PXD A;  2IO3 C;  1N4P A;  4MLP A;  1EFA A;  3BUA A;  2V4H C;  3HVE A;  4O60 A;  4FBI A;  2CRO A;  4N5C A;  4LRZ A;  4DX7 D;  4EEC A;  4GMR A;  2FFH A;  1AU7 A;  3EDT B;  2KCV A;  3TWR A;  1Z3Y A;  4LSZ E;  1ZB1 A;  3AJI A;  3NAW A;  4I2W A;  5G04 J;  2LSU A;  2PXE A;  3LS8 A;  1Y7Y A;  3QKY A;  3UX4 A;  4ANW A;  3L16 A;  3CHP A;  3DPY A;  2GRM A;  2R02 A;  1PY1 A;  3CVY A;  1TJC A;  3VTX A;  5EID A;  3TG5 A;  5BW8 C;  1IQR A;  4CT0 A;  3BS3 A;  2LO6 A;  2XCC A;  5AAR A;  3I4R B;  1TNZ A;  1PRU A;  4WWN A;  5IY5 E;  1SQ8 A;  4XKC A;  2PUD A;  4AXH A;  2PE5 A;  4E6H A;  5JJ6 A;  5E75 A;  4RLY A;  4BT8 A;  3CHS A;  3W9F A;  3JUE A;  4XIF A;  2PXK A;  1IHG A;  3CV0 A;  3CKB A;  1ADR A;  2WXO A;  1V55 E;  3ZFW A;  4JXT A;  4UQZ A;  3FUH A;  1FVH A;  4L7T A;  1WET A;  4LNB A;  2GGF A;  2PXU A;  4HB5 A;  2XI8 A;  2M63 A;  4CDR A;  3L13 A;  2Y1L E;  3JCK C;  2MEZ A;  1UTX A;  2BNM A;  3Q7A A;  3AG1 E;  3CK8 A;  1H6O A;  2HE0 A;  1SA5 A;  1NP7 A;  2PUB A;  2GRQ B;  4GU5 A;  2GRO B;  3ABM E;  4AJW A;  3FUF A;  2QYU A;  3DWL G;  5JUW A;  3EU5 A;  3OQO A;  3D9H A;  3PUK A;  5FJY A;  5BV0 A;  4O6F A;  1HXI A;  3FUK A;  3OQM A;  4L23 A;  3IXE A;  5JHB A;  1KLX A;  4N3B A;  2XGS A;  3CST A;  4GZC A;  1D8E A;  1YSE A;  1ZAY A;  1N54 A;  3TGO A;  2V5Q C;  2LYS A;  5G2N A;  5ARF A;  3GZS A;  3MLF A;  3OXL A;  1E8X A;  5DBK A;  3L08 A;  4I1A A;  4J8S A;  4OYS A;  3Q5M A;  1H6P A;  2YHE A;  4JA7 A;  3SGH A;  1ZZ9 A;  2F0Y A;  1K3Z D;  4J6I A;  2J49 A;  4RSY A;  1DUL A;  4HOR A;  2RFM A;  4GCN A;  4C0E A;  2X3M A;  3OQN A;  3KS2 A;  3F52 A;  3V31 A;  2A5E A;  4U8V D;  2VGX A;  5DTR A;  4WUY A;  3FUD A;  3FUM A;  2PIJ A;  3UI2 A;  1JH9 A;  2VSO E;  3GYZ A;  2LLV A;  3G5G A;  2XEV A;  2PM7 A;  1JUQ A;  3FU0 A;  2A6C A;  1O1R A;  3UXG A;  4N3C A;  3PS6 A;  1HU3 A;  3GZD C;  4FLH A;  5ENQ D;  3Q78 A;  2PXP A;  2M4H A;  1HF0 A;  4DUI A;  2WXP A;  3D9P A;  3DXM G;  4U8H A;  4AV7 A;  4I1O B;  2CSF A;  4CDM A;  3TG4 A;  1NER A;  3B7R L;  3VK0 A;  1TYQ G;  3KSQ A;  3B95 A;  3VLD A;  3SZ7 A;  3PEU B;  3FU6 A;  2WUS R;  3C3O A;  5AEN A;  3ZHE A;  1S63 A;  4JHK A;  1U3D A;  1OCR E;  1JWF A;  2WXQ A;  2IU1 A;  3ZKC A;  3PRZ A;  3V79 K;  3U66 A;  3LCA A;  1LLI A;  5JMN D;  3JXJ A;  4V3I A;  3CGH A;  4JB8 P;  3ZHM A;  3JQ1 A;  4FHK A;  3QWW A;  4DK5 A;  3B7H A;  1EYH A;  4MBG A;  3NOC D;  4YDW A;  4HVB A;  1BI8 B;  3OXF A;  4H7X A;  3W9G A;  2I9C A;  2OND A;  3D9M A;  3T5V A;  4H7Y A;  2MXD A;  4MS6 A;  2WXR A;  1ZPQ A;  4PS8 A;  2QZA A;  3VWS A;  2XRZ A;  4DX1 A;  1LTX A;  2ION A;  2IV1 A;  2XSD C;  1OCO E;  2P9S G;  3LEW A;  3MV3 B;  1ZS4 A;  5EKQ D;  2HCS A;  1EDU A;  1OWM A;  3CHM A;  4U7E B;  2BUG A;  3LY7 A;  2XGM A;  4FLB A;  5T8I A;  3R9M A;  2H8R A;  4JA9 A;  1OSL A;  4RG6 A;  2ICT A;  2J7U A;  4ACK A;  4G25 A;  2WXL A;  1JWG A;  3FU5 A;  4PDX A;  3FH8 A;  2LUH A;  3VTY A;  3AS8 A;  4JVS A;  5B1B E;  3TAX A;  4PU8 A;  4ZHB A;  2X6H A;  3TL5 A;  4A3T A;  5HRY A;  1RZS A;  3L54 A;  5H7P A;  3SFZ A;  4BER A;  4LCT A;  3AG2 E;  2P9I G;  2EIK E;  3S7F A;  1H19 A;  3JXB C;  4G26 A;  3ZYK A;  1QP0 A;  2KAT A;  5FTP A;  3NZS A;  4X4G A;  4HLE A;  3QWP A;  4A1G A;  3HXC A;  1IYG A;  3S7D A;  1VPW A;  2I2O A;  4M7C A;  2DCP A;  2IVQ A;  4IYP A;  2EF8 A;  1HH8 A;  3CK9 A;  4KT6 B;  2WXG A;  4J8E A;  1O1T A;  3OXG A;  2VSY A;  3TWV A;  1TEZ A;  2LNI A;  4BSZ B;  1U3C A;  2J07 A;  4JC8 A;  4ER7 A;  3JXC L;  2KBX A;  1DNP A;  1WDY A;  2XHE A;  3V2O A;  3SD5 A;  2P9L G;  2FF4 A;  3URZ A;  1B89 A;  4Y6C A;  5A7D B;  1NA0 A;  5EX3 A;  3B7T A;  4JHR A;  2LXL A;  4ATZ D;  4EQZ A;  1PNR A;  4EBA A;  1YA0 A;  3PXP A;  2J8S D;  2WXH A;  2VGX B;  5KJM A;  1FPP A;  3LXU X;  3T9K A;  4KVO A;  4F1P A;  1HG2 A;  3KEA A;  5B1A E;  2I1J A;  3ZEF A;  3FDH A;  2PPX A;  3N71 A;  4APO A;  3Q47 B;  3SBS A;  2VSN A;  4MKT A;  1WH6 A;  1QYM A;  1DC2 A;  2ETB A;  4GA1 A;  4WNG A;  4MCX A;  3CVP A;  2ZGG A;  2RD0 A;  3FH7 A;  3G2S A;  1N95 A;  3PZ1 A;  1QBQ A;  3BDN A;  2XCB A;  2V5F A;  3C72 A;  3FWV A;  2E2E A;  4WAF A;  5ENR D;  2DZO A;  5AN8 A;  3UM2 A;  5AQB A;  3MYV A;  4CT4 A;  2V0P A;  2V3C C;  3PVL A;  4I6R A;  5EDS A;  2R1J L;  2CG3 A;  2BTD A;  4BTB A;  3AAA C;  5ANR A;  2DYS E;  4YG1 A;  4B93 B;  1CJG A;  2KC7 A;  5AQ7 A;  1ZUG A;  4O8B A;  3V30 A;  3D1N I;  3BQO A;  3ASG A;  3HYM B;  2OOE A;  3S8Q A;  1NEQ A;  3DBS A;  1TNY A;  3C5R A;  1KZP A;  1QPZ A;  2EIM E;  3E34 A;  2CHX A;  1LMB 3;  3LY8 A;  1L1M A;  5JA4 D;  2R03 A;  5ENO D;  4LG6 A;  4OBM A;  1XNF A;  1SW6 A;  4Z5D A;  2FBN A;  4IWR A;  2WQ6 A;  4XEI G;  2R05 A;  2Y4T A;  5D2M C;  2LAI A;  2IU7 A;  4UWF A;  3FMY A;  2WXK A;  2P9U G;  1WM5 A;  5EIL A;  5D0Q D;  4GTO A;  5KJK A;  3PNL B;  4JEU A;  1S64 A;  1WIZ A;  4UWK A;  1HQ1 A;  3G2W A;  3D9K A;  2HSG A;  2B0O E;  4JZY A;  4N5Q A;  4XKB A;  2X6J A;  3MX3 A;  2EIL E;  4KZC A;  3NXH A;  1SZA A;  4YVQ C;  3L82 A;  4GML A;  1MX6 A;  4G2V A;  4J1X A;  1VDY A;  4DI3 A;  5CBO A;  4XZ4 A;  3OAW A;  2JVL A;  3J5P A;  3EHQ A;  4N3A A;  2GW1 A;  5EYL A;  4F53 A;  1WH8 A;  4EKG A;  3CVV A;  5HI7 A;  2YNQ A;  1ZZ8 A;  2OEW A;  2BF0 X;  1FVF A;  1TR4 A;  3OTN A;  3O4Z A;  2JLB A;  3ESK A;  4G8L A;  3CVQ A;  4J8Y A;  3ULY A;  3ZW3 A;  3DM5 A;  3UWP A;  1IC8 A;  4U96 D;  3JYS A;  3D3M A;  1CQT A;  2O38 A;  3ZVV A;  4GYO A;  2ZGD A;  3WXX A;  4A63 B;  2PXF A;  3MJW A;  3DEP A;  1N4S A;  2GRN B;  2LLW A;  1UOH A;  3KD7 A;  3DNV B;  5G05 C;  3SFY A;  3GW4 A;  1XWR A;  1JPL A;  3ZHI A;  1O4X A;  4HXI A;  1TN6 A;  2I6H A;  1BU9 A;  1QB2 A;  5C1D A;  2BKK B;  2J4B A;  1Z3X A;  1ELR A;  1RIO A;  4QQI A;  1IQU A;  1DCE A;  3L22 A;  3BEE A;  1RZR A;  5LCW C;  4UQY A;  3NF1 A;  2XS1 A;  1QZ2 A;  1DW9 A;  3QFI A;  3G2V A;  4LNU D;  2O4A A;  4X4E A;  4OAU C;  2PUF A;  2PQN A;  1GT0 C;  5CCM A;  3OMT A;  1N94 A;  2WXJ A;  1N0R A;  2PQR A;  1UW4 B;  4EPZ A;  5M72 A;  3VLE A;  4EZI A;  1N9A A;  1FT2 A;  5CMY A;  3PZD A;  2LYK A;  4PU7 A;  2LAH A;  4W9R A;  2NYJ A;  1NZN A;  3GZ2 A;  3LPZ A;  4UI9 J;  1KT1 A;  3Q9U C;  4JEH A;  3QOX A;  2PXV A;  2VGY A;  2IVG A;  4HS2 A;  4PUC A;  5EX0 A;  3IHY A;  3ULQ A;  3C3R A;  4PS7 A;  4F7A A;  1H6K A;  4EKI A;  2C0M A;  3FUJ A;  3RK6 A;  3HXD A;  3FTX A;  1JCS A;  3UM1 A;  2J7W A;  2XQ0 A;  4KVM A;  1PER L;  3EHM A;  3CHQ A;  3PZ3 A;  2DZN A;  1PAQ A;  4HOT A;  2Y3A A;  3HXF A;  4TUM A;  3DSV A;  3I3N A;  2ICP A;  5CHE E;  5EN5 D;  5FQ8 A;  3ML9 A;  3SO8 A;  4EBA G;  1OWN A;  3PNT B;  5FQ4 A;  2FO1 E;  3IV0 A;  3GZC A;  5DT2 A;  1ELW A;  3UKR G;  2P9K G;  5GAG i;  3RRU A;  2R5S A;  4Q96 A;  2FI7 A;  2JEK A;  5KWD A;  4CZ2 D;  3R09 A;  3CQC B;  4HOQ A;  2H6I A;  3QOU A;  2VYI A;  1S70 B;  4I8T A;  1X81 A;  1OT8 A;  1K8K G;  1RW2 A;  3DPD A;  5FWQ A;  2WQ7 A;  2WVI A;  4YDO A;  5EYP F;  5BT1 A;  3OWQ A;  5HS0 A;  1X2L A;  4GA2 A;  2WXF A;  4MCT A;  5DTM A;  3TJP A;  3U64 A;  4CDN A;  3PDN A;  2CG2 A;  3LIS A;  4QFV A;  3UT4 A;  3QAR A;  1HF8 A;  2OV8 A;  3MZL B;  5ANL A;  4HNA D;  1BI7 B;  2XS8 A;  3AU4 A;  4Z68 A;  1H2T C;  3B7B A;  3D9N A;  5ENT D;  1ZZ6 A;  2R17 C;  2QC9 A;  3T5X A;  2X6K A;  2IY0 C;  4JQD A;  3MEK A;  5DIZ A;  4ER0 A;  1UN8 A;  4OVV A;  4I6J A;  2L49 A;  3FTU A;  1EPU A;  3AG4 E;  3HHM A;  4YAR A;  4OVU A;  2WM9 A;  5FZS A;  3O9X A;  3CVU A;  1OUV A;  5CEC B;  1HFA A;  4CGV A;  3VLF A;  1E3O C;  3SNX A;  2J09 A;  4AP2 A;  4HOU A;  4AM9 A;  3PE3 A;  4NQ0 A;  3CHO A;  3TWS A;  3NDB B;  3L1P A;  1SQM A;  4GTS A;  2RG8 A;  3CR3 A;  1G3N B;  2B5A A;  4L1B A;  4AEZ C;  1E90 A;  3HG0 D;  3D9J A;  3E30 A;  2C2L A;  3MCX A;  4ACL A;  2QFC A;  2NSZ A;  2L6J A;  1ELK A;  2XXA A;  5BUZ A;  2EBY A;  4C48 B;  3G2T A;  5CER B;  4GTM A;  3SX0 A;  5CEA A;  3UKU G;  2HYZ A;  4FUL A;  1OWP A;  2NC9 A;  4ANU A;  3QAQ A;  5EIB E;  3FHE A;  4BTA A;  5D66 A;  3PH0 C;  3MGB A;  3TFL A;  5CCL A;  1OCT C;  2IOS A;  3RJV A;  3IHV A;  4A1S A;  3Q75 A;  3EU9 A;  4Y42 A;  2J9Q A;  5LX8 A;  3ZYQ A;  3FUE A;  1RZR D;  1WG0 A;  3E33 A;  1K1A A;  5KNG A;  3SQV A;  2AXZ A;  2LYQ A;  2IOL A;  1QZX A;  2EWT A;  3LQX A;  1E8W A;  2ODR D;  4P29 A;  2KEJ A;  2JQE A;  4N2Q A;  1TN7 A;  3FP3 A;  3E37 A;  4UWG A;  1KPS B;  3FH5 A;  4WWO A;  3NRO A;  3UM0 A;  3X2Q E;  2AW6 A;  2R63 A;  1MYO A;  4I9E A;  3LYA A;  1HG5 A;  4AY5 A;  1Y6I A;  1IXV A;  4FU3 A;  4DX2 A;  2PZI A;  2V4L A;  2LXM A;  3CVN A;  3HDX A;  3D9I A;  3OKZ A;  3DXK G;  3R1F A;  4FP7 A;  4E85 A;  2L8N A;  3CEQ A;  1E7U A;  1PRA A;  1HE8 A;  1QQA A;  1JCR A;  1O5M A;  1WY6 A;  3NZU A;  3PEV B;  1H2V C;  3FUI A;  2ILR A;  4GZ5 A;  4NUR A;  3RIB A;  4XE0 A;  1AP7 A;  1TNO A;  3SCH A;  1SZ9 A;  5AIJ A;  1RZ4 A;  2PUG A;  1Y8M A;  4GYY A;  2L0T B;  4B89 A;  4FJZ A;  2KXP C;  4XI9 A;  3DSX A;  5T3R A;  3NB2 A;  1UJJ A;  3FY4 A;  1X5B A;  4M3O A;  4GPK A;  4X4H A;  2XGO A;  5AJD A;  1E96 B;  5C2Y A;  3SCG A;  3PRE A;  2VQ2 A;  4JHJ A;  3RKV A;  4HI9 A;  1BDI A;  2HIN A;  4RG9 A;  4K0R A;  4DE8 A;  3CRO L;  1S7E A;  4X4D A;  4UWL A;  2XIU A;  1JWL A;  2PUE A;  5ENP D;  2P9P G;  2MHK A;  4J8D A;  1LCC A;  4PS3 A;  2LCV A;  1UN9 A;  2BNO A;  4N2S A;  3A9Y A;  3HRA A;  4ME2 A;  3FEX A;  5G05 J;  2VSX E;  4XX5 A;  1BD8 A;  3ZRH A;  5BV1 A;  1HS6 A;  1MX4 A;  2JCG A;  2UY1 B;  5KBA A;  4GTT A;  4L9P A;  4YND A;  4GZD A;  3RRN B;  4I17 A;  4PU3 C;  2EQX A;  5LCW J;  3TEL A;  1DWK A;  3GUU A;  4J1W A;  5CMW A;  3QYX A;  4BES A;  1W3B A;  3PE5 A;  3QJZ A;  4DLO A;  1JFT A;  2KEI A;  4HRL A;  3MEJ A;  1UXD A;  1N0Q A;  3L9T A;  5DRY A;  2PM6 A;  1KZO A;  3UUX A;  2IFU A;  1B0N A;  2KZT A;  2YIN A;  3EIQ C;  5E76 A;  1EF1 C;  1TNB A;  3FTZ A;  2MQK A;  3KAE A;  4X8Q A;  2BKG A;  3LKU A;  1Y9Q A;  3LY9 A;  3GZ1 A;  3K9I A;  3JXD L;  3Q79 A;  4B0Z A;  2FJR A;  2AXV A;  3ONL A;  1OWO A;  4U8Y D;  3ZNG A;  1UG3 A;  5A7L A;  2AXU A;  2E0I A;  2X6I A;  4GTR A;  3QWG A;  4ER6 A;  3SCF A;  2VGE A;  1D9S A;  4ZFH A;  1Z5S C;  3B13 A;  5BNW A;  2KPJ A;  3HXE A;  3LVR E;  3CVW A;  4I9C A;  2J08 A;  4HQD A;  2XEN A;  5ITZ F;  3TWX A;  2IO2 C;  1MX2 A;  2CHW A;  1ZBP A;  2IEJ A;  5FQ6 A;  4C9B B;  4K03 A;  2KCL A;  4GHJ A;  3QQ6 A;  3SFX A;  2OR1 L;  4G1T A;  3ESL A;  4JW1 A;  3ML8 A;  3E4B A;  3FEY A;  2OFY A;  4KZ0 A;  2P9N G;  4CRW A;  3RSE G;  3EUV A;  3KEZ A;  2YQ8 A;  1ZZB A;  2XXQ A;  4WVL A;  4EZK A;  3D9O A;  4U63 A;  3LJ3 A;  3RU0 A;  3Q49 B;  2ZU6 B;  2GRP B;  3ISM C;  3LVQ E;  5DTQ A;  4A55 A;  2FO7 A;  4LEU A;  2WPV A;  3IBE A;  4L2L A;  1INZ A;  3R7Q A;  2X6F A;  4B8A A;  1P5Q A;  2J4D A;  1E8Z A;  2CHZ A;  4GTQ A;  2HM8 A;  1LCD A;  4TXQ A;  2H6F A;  1MZC A;  2OVB A;  3UIN C;  4ANX A;  4DX5 D;  4DLQ A;  4Q2J A;  3RRM B;  3NBN B;  5AAO A;  2L6B A;  4DPR A;  2Y69 E;  4JD2 G;  4LER A;  1A17 A;  4U95 D;  2CFZ A;  2VJ8 A;  4BY6 A;  1IKN D;  4BFR A;  2IQC A;  3ZPJ A;  4HOS A;  3FYM A;  3A9X A;  2R2L A;  4U0U A;  2XJ3 A;  3JUI A;  4YG7 B;  1MJ0 A;  2VTB B; 
#chains in the Genus database with same CATH homology
 3TAX A;  4PU8 A;  4CDN A;  4ATG A;  3HIZ A;  2X6H A;  2XPY A;  3PDN A;  2GRL A;  4D10 C;  3QF3 A;  3TL5 A;  3ZHE B;  2DIW A;  4L2Y A;  4A3T A;  2CG2 A;  3FTS A;  3LIS A;  4GAA A;  3QB2 A;  4PU4 C;  3KJX A;  4F8D A;  4I1M A;  5JHB A;  4QFV A;  1RZS A;  4GCO A;  3UT4 A;  5JJT A;  3TRB A;  3L54 A;  3SFZ A;  4GA0 A;  3QAR A;  1HF8 A;  4LCT A;  4U04 A;  2OV8 A;  3MZL B;  5ANL A;  3ZYM A;  2FEZ A;  4GB9 A;  5KCM A;  3S7F A;  4F3V A;  3U4T A;  1JFS A;  3AU4 A;  1H19 A;  3JXB C;  4G26 A;  3R9A B;  3ZYK A;  1H2T C;  2NXP A;  4ANV A;  4MRU A;  1QP0 A;  3D9N A;  2KAT A;  2Q7F A;  4RVB A;  1ZZ6 A;  1QQE A;  2R17 C;  4BSX A;  3LFP A;  3EHN A;  5FTP A;  3NZS A;  2IJG X;  4X4G A;  4I6U A;  4KYO B;  3T5X A;  4HLE A;  3CQG B;  3QWP A;  4A1G A;  4I6E A;  2IUO A;  2X6K A;  1UXC A;  4NRH B;  4CCA A;  3O48 A;  4JQD A;  3MEK A;  1Z6T A;  5DIZ A;  1IYG A;  2BNN A;  3S7D A;  1VPW A;  2IVB A;  2I2O A;  4KXK B;  2FUL A;  3EIJ A;  4UWH A;  2PUC A;  2DCP A;  3IEG A;  4C0M A;  2IVQ A;  2L9B A;  4IYP A;  4EQF A;  1UN8 A;  3FFL A;  4OVV A;  3SI5 A;  2EF8 A;  1HH8 A;  4I6J A;  2L49 A;  3CK9 A;  4XI0 A;  4I43 A;  4KT6 B;  1LF8 A;  2WXG A;  3FTU A;  1EPU A;  4J8E A;  3HHM A;  5AYW D;  2MRI A;  4YAR A;  3ASH A;  3SF4 A;  4AY6 A;  3OXG A;  4OVU A;  2VSY A;  2WM9 A;  3O9X A;  2L0I A;  3APF A;  4UI9 K;  1OUV A;  5FZS A;  1HFA A;  3CLJ A;  3CVU A;  2MOW A;  5LOZ A;  4CGV A;  3VLF A;  1E3O C;  5KJN A;  3SNX A;  1BDH A;  4WNF A;  3UPV A;  2LNI A;  1H2U A;  3ASF A;  1U3C A;  5K98 B;  2J09 A;  2J07 A;  4I6G A;  2LYL A;  4AP2 A;  4HOU A;  4AM9 A;  5A23 A;  4JC8 A;  3PE3 A;  2HR2 A;  3CHO A;  2PL2 A;  4NQ0 A;  3FUN A;  3I4G A;  5D0O D;  3JXC L;  3CK7 A;  1DNP A;  4I6T A;  3L1P A;  2LSV A;  2XHE A;  4JCX A;  3U3W A;  1SQM A;  2RG8 A;  3SD5 A;  3CR3 A;  2FF4 A;  3URZ A;  3GN5 B;  1B89 A;  4NAC A;  3OP9 A;  4Y6C A;  2KZT B;  4G23 A;  5A7D B;  1NA0 A;  2B5A A;  3MV2 B;  1E7V A;  3CVL A;  3B7T A;  4JHR A;  4L1B A;  1E90 A;  5EX3 A;  5FZQ A;  3R7R A;  4AEZ C;  4CEM A;  3D9J A;  2XRY A;  3CIA A;  3U9W A;  2C2L A;  1PNR A;  4APF A;  4EBA A;  1R69 A;  4IVZ A;  1YA0 A;  3PXP A;  2A4Z A;  3MCX A;  4ACL A;  2WXH A;  4JPS A;  2QFC A;  4Z5C A;  2NSZ A;  4GQM A;  2VGX B;  5A6C A;  2L6J A;  1ELK A;  5KJM A;  1ZZC A;  4X4I A;  1BPO A;  5BUZ A;  4Q94 A;  2EBY A;  1ZVV A;  5J90 A;  3G2T A;  5FQ7 A;  3GBF A;  3LXU X;  4KVO A;  1ZU2 A;  1OWL A;  2WXN A;  3C98 A;  3S7B A;  1HG2 A;  1KT0 A;  3ZIM A;  3RZZ A;  4EZJ A;  2I1J A;  3T8M A;  3P2B A;  1RPE L;  3L17 A;  3RO3 A;  3FDH A;  4OB4 A;  2HYZ A;  3P1U A;  4FUL A;  3ZEF A;  4B8C B;  3KXA A;  1OWP A;  2LYP A;  2NC9 A;  4ANU A;  3QAQ A;  4X4F A;  5JJ7 A;  2PPX A;  3N71 A;  4APO A;  3FHE A;  3MKR A;  3Q47 B;  4BTA A;  3SBS A;  3G7D A;  2P58 C;  2VSN A;  4MKT A;  1WH6 A;  4AVX A;  3PH0 C;  3ZN3 A;  4GA1 A;  4WNG A;  3MGB A;  4LUN U;  4MCX A;  3H5T A;  3CVP A;  3APC A;  4WND A;  1OCT C;  2IOS A;  3CEC A;  2RD0 A;  3FH7 A;  3G2S A;  3IKO B;  5CCL A;  3RJV A;  3BG1 B;  2QY7 A;  3IHV A;  3RO2 A;  4A1S A;  3ZXS A;  4IA8 A;  1QNF A;  4Q69 A;  4Y42 A;  2J9Q A;  3BDN A;  5LX8 A;  2XCB A;  1TJF A;  3ZYQ A;  5HQ8 A;  2WIU B;  3IVP A;  1RZR D;  2V5F A;  3CSF A;  3FWV A;  2E2E A;  3FUL A;  3FUE A;  2AVP A;  4WAF A;  4DJA A;  3EUS A;  3SHF A;  4EZL A;  3S7J A;  2AXZ A;  2LYQ A;  5ENN A;  4PH4 B;  3FU3 A;  3MYV A;  3ONK A;  2IOL A;  4CT4 A;  2V0P A;  3FTV A;  4FAD A;  4UQX A;  5BPP A;  5LFA A;  4FC8 A;  2EWT A;  3PVL A;  4I6R A;  1E8W A;  4P29 A;  2KEJ A;  3SBT B;  4AOF A;  3ZGQ A;  3F51 A;  4AIF A;  2R1J L;  2CG3 A;  2AWI A;  2R59 A;  2BTD A;  5EDS A;  3FP3 A;  4Z5H A;  3PUJ A;  4N2Q A;  4UWG A;  4GZ6 A;  4BTB A;  3FTW A;  3FH5 A;  4WWO A;  2WB2 A;  5ANR A;  1DVP A;  2AW6 A;  2R63 A;  4YG1 A;  3L6A A;  3LYA A;  4I9E A;  1CJG A;  2GZU A;  1HG5 A;  1Y6I A;  4GZ3 A;  4TUU A;  4AY5 A;  1PRV A;  2KC7 A;  1ZUG A;  3QK0 A;  4FU3 A;  3KZ3 A;  1XGW A;  4X4C A;  2PZI A;  2V4L A;  1E8Y A;  3CVN A;  2KM4 A;  4J8F A;  4O8B A;  3MKQ A;  3HDX A;  3D9I A;  4WNE A;  2XCJ A;  3R1F A;  3D1N I;  4FP7 A;  4TV3 A;  2L8N A;  2AUW A;  4E85 A;  3CEQ A;  2BJC A;  3ASG A;  3HYM B;  2OOE A;  4MLP A;  1EFA A;  1E7U A;  2X38 A;  3HVE A;  1PRA A;  1HE8 A;  2UY1 A;  4G24 A;  3S8Q A;  4FBI A;  2CRO A;  1QQA A;  1NEQ A;  4N5C A;  3DBS A;  1N52 A;  1WY6 A;  3NZU A;  3PEV B;  1H2V C;  4ILH B;  3FUI A;  1QPZ A;  2C0L A;  2ILR A;  4LRZ A;  1QQB A;  4GZ5 A;  4EEC A;  4NUR A;  1AU7 A;  3RIB A;  2CHX A;  1LMB 3;  4XE0 A;  3EDT B;  3UQ3 A;  2Y4U A;  2KCV A;  1Z3Y A;  4J0U A;  4I2Z A;  3LY8 A;  1L1M A;  5G04 J;  4I2W A;  3SCH A;  1L5J A;  1SZ9 A;  2LSU A;  1FCH A;  5AIJ A;  2PUG A;  3LS8 A;  1Y7Y A;  1Y8M A;  3QKY A;  3UX4 A;  4ANW A;  3L16 A;  3CHP A;  4GYY A;  2WXM A;  1XNF A;  2L0T B;  4B89 A;  4FJZ A;  4Z5D A;  2FBN A;  4HFG A;  2GRM A;  4IWR A;  4IUL A;  1PY1 A;  4XI9 A;  5LP0 A;  2WQ6 A;  3CVY A;  1TJC A;  5T3R A;  3VTX A;  4BX9 A;  2Y4T A;  5BW8 C;  1IQR A;  1UJJ A;  3FY4 A;  3TG5 A;  2LAI A;  4CT0 A;  3BS3 A;  2IU7 A;  1X5B A;  2LO6 A;  4M3O A;  2XCC A;  4UWF A;  3FMY A;  4X4H A;  4GPK A;  2XGO A;  2WMO A;  2OVF A;  2WXK A;  4ABN A;  3I4R B;  1PRU A;  5AJD A;  5T4Y A;  1WM5 A;  1E96 B;  4WWN A;  3UT8 A;  5D0Q D;  3CVX A;  1SQ8 A;  4XKC A;  5KJK A;  2PUD A;  5C2Y A;  3SCG A;  4ILG A;  4AXH A;  2PE5 A;  1QP4 A;  4E6H A;  3PNL B;  4JEU A;  5E75 A;  5JJ6 A;  4BT8 A;  3PRE A;  3CHS A;  2VQ2 A;  4JHJ A;  1QP7 A;  3UMV A;  3MA5 A;  1WIZ A;  2WMN A;  3G2W A;  2YHC A;  4UWK A;  4G11 A;  4XIF A;  5KJL A;  3D9K A;  5G04 C;  1GW6 A;  2HSG A;  1IHG A;  3CV0 A;  3RKV A;  4JZY A;  3CKB A;  1ADR A;  2WXO A;  4XKB A;  2X6J A;  3MX3 A;  1BDI A;  3CLC A;  3G2U A;  2HIN A;  4KZC A;  1SZA A;  4YVQ C;  3ZFW A;  4JXT A;  1R63 A;  4RG9 A;  4U0S A;  4UQZ A;  3FUH A;  1WAO 1;  1FVH A;  4GML A;  4K0R A;  4L7T A;  1WET A;  3CRO L;  4G2V A;  1S7E A;  1MHQ A;  4BT9 A;  4X4D A;  4UWL A;  2XIU A;  4J1X A;  1VDY A;  2GGF A;  4UI9 C;  4DI3 A;  1JWL A;  3UFD A;  2PUE A;  2O49 A;  2XI8 A;  4XZ4 A;  2M63 A;  3OAW A;  2JVL A;  3EJN A;  3L13 A;  4ILI A;  4CDR A;  1NA3 A;  2KZ8 A;  4N3A A;  3JCK C;  2GW1 A;  2MHK A;  1LCC A;  2MEZ A;  4J8D A;  4PS3 A;  2LCV A;  1UTX A;  1UN9 A;  2BNO A;  4N2S A;  4F53 A;  1WH8 A;  3CVV A;  3Q4A B;  5HI7 A;  3UT7 A;  2YNQ A;  1ZZ8 A;  2BNM A;  3FEX A;  4ME2 A;  5G05 J;  3BG0 B;  2VSX E;  4XX5 A;  3F6W A;  3ZRH A;  3CK8 A;  2BF0 X;  5BV1 A;  5G55 A;  1FVF A;  1HS6 A;  3HVE B;  4NDW A;  2JCG A;  2UY1 B;  3O4Z A;  1NP7 A;  2PUB A;  3OTN A;  3TJP A;  2JLB A;  2XPI A;  3ESK A;  3CVQ A;  4GU5 A;  4YND A;  4GZD A;  4AJW A;  3TXN A;  3RRN B;  3FUF A;  3ZW3 A;  4I17 A;  4PU3 C;  4A3V A;  1IC8 A;  3FTY A;  2EQX A;  3OQO A;  5LCW J;  3CKC A;  3PUK A;  5FJY A;  5BV0 A;  4O6F A;  1HXI A;  1DWK A;  3FUK A;  3OQM A;  4L23 A;  4J1W A;  3JYS A;  3D3M A;  5CMW A;  4B94 A;  3QYX A;  1CQT A;  2O38 A;  1KLX A;  2HO1 A;  2XGS A;  3CST A;  4N3B A;  4GZC A;  3B7S A;  1W3B A;  3ZVV A;  4GYO A;  3QJZ A;  3WXX A;  4DLO A;  1YSE A;  1JFT A;  1ZAY A;  2KEI A;  1N54 A;  3TGO A;  2LYS A;  3MJW A;  3QNK A;  4WWP A;  5G2N A;  5ARF A;  4YBA A;  3GZS A;  3MLF A;  1UXD A;  3KD7 A;  3OXL A;  3DNV B;  1E8X A;  5DBK A;  2PM6 A;  4Z58 A;  3L08 A;  4I1A A;  4J8S A;  4OYS A;  5FZR A;  2CFU A;  3Q5M A;  2IFU A;  1B0N A;  2KZT A;  2I1K A;  2YHE A;  4JA7 A;  1ZZ9 A;  4J6I A;  2XPZ A;  2YIN A;  2J49 A;  3GW4 A;  1XWR A;  4RSY A;  4HOR A;  3EIQ C;  3AS4 A;  1JPL A;  4GCN A;  1EF1 C;  3ZHI A;  2WXI A;  5E76 A;  4C0E A;  3FTZ A;  4GYW A;  2X3M A;  3OQN A;  1O4X A;  4HXI A;  2MQK A;  3KAE A;  1MQS A;  3KS2 A;  3F52 A;  2I6H A;  3B7U X;  3Q15 A;  5ARG A;  1ZZ7 A;  3LKU A;  5C1D A;  2J4B A;  1Z3X A;  1ELR A;  1Y9Q A;  1RIO A;  2VGX A;  2LYJ A;  1IQU A;  3LY9 A;  4FHJ A;  4WUY A;  3FUD A;  3GZ1 A;  3FUM A;  3K9I A;  3L22 A;  3JXD L;  2PIJ A;  5FT9 A;  3BEE A;  1RZR A;  4B0Z A;  2FJR A;  5LCW C;  4URK A;  1JH9 A;  2AXV A;  4UQY A;  3ONL A;  1OWO A;  3NF1 A;  2VSO E;  3GYZ A;  3G5G A;  1QZ2 A;  2XEV A;  1DW9 A;  3PE4 A;  3G2V A;  1UG3 A;  1UJK A;  3QDN A;  4GMJ A;  4DI4 A;  5A7L A;  2AXU A;  2O4A A;  2PM7 A;  4X4E A;  2E0I A;  2X6I A;  1JUQ A;  3QWG A;  2A6C A;  2PUF A;  2PQN A;  1GT0 C;  3FU0 A;  5G05 C;  3ASD A;  3OMT A;  4N3C A;  5CCM A;  3SCF A;  4R7L A;  3PS6 A;  3S2A A;  1HU3 A;  2WXJ A;  3QWV A;  3B13 A;  2PQR A;  1UW4 B;  4EPZ A;  5BNW A;  5M72 A;  2KPJ A;  3VLE A;  3LVR E;  3I5P A;  5CMY A;  3PZD A;  2LYK A;  4PU7 A;  2LAH A;  4FLH A;  2LYR A;  1S0P A;  3CVW A;  3UUX A;  4FN3 A;  4I9C A;  1HF0 A;  4W9R A;  4FJY A;  2J08 A;  4BX8 A;  2WXP A;  1NZN A;  3D9P A;  4U8H A;  3GZ2 A;  2CHW A;  3LPZ A;  2CSF A;  4I1O B;  4UI9 J;  1ZBP A;  4AV7 A;  4CDM A;  1KT1 A;  4JEH A;  3TG4 A;  1NER A;  5FQ6 A;  3B7R L;  2VGY A;  2IVG A;  3VK0 A;  1LQC A;  4HS2 A;  4K03 A;  2KCL A;  3QC1 A;  4C9B B;  4GHJ A;  2KCK A;  3QQ6 A;  3IHY A;  4IN3 B;  2OR1 L;  4PUC A;  5EX0 A;  4U0Z A;  2VTB A;  4G1T A;  3ULQ A;  3VLD A;  3SZ7 A;  3ESL A;  4JW1 A;  3ML8 A;  3E4B A;  4PS7 A;  2IF4 A;  3FYA A;  2V8S E;  3FEY A;  2WUS R;  3FU6 A;  3NQP A;  3PEU B;  4F7A A;  1H6K A;  4FA6 A;  2D5V A;  5AEN A;  3ZHE A;  4F1S A;  2OFY A;  4KZ0 A;  2C0M A;  3FUJ A;  4JHK A;  3RK6 A;  4CRW A;  1U3D A;  3KEZ A;  2YQ8 A;  4Z59 A;  1H0A A;  3FTX A;  3D9L A;  1JWF A;  2WXQ A;  2IU1 A;  3ZKC A;  1ZZB A;  3PRZ A;  2XQ0 A;  4KVM A;  1PER L;  3SGH A;  1HO8 A;  3CHQ A;  3EHM A;  4EZK A;  3D9O A;  4U63 A;  3LCA A;  3U66 A;  1TEZ A;  3LJ3 A;  1LLI A;  3RU0 A;  1PC2 A;  1PAQ A;  4HOT A;  2Y3A A;  3LDZ A;  5J08 A;  3Q49 B;  3I3N A;  2ZU6 B;  3AU5 A;  4V3I A;  3ZYL A;  3CGH A;  4CGW A;  2ICP A;  3LVQ E;  3ZHM A;  5CHE E;  5AJL A;  5FQ8 A;  4A55 A;  3JQ1 A;  3ML9 A;  2FO7 A;  4FHK A;  4LEU A;  3QWW A;  2WPV A;  3IBE A;  3HZI B;  4DK5 A;  4EBA G;  1OWN A;  4L2L A;  3B7H A;  1EYH A;  3PNT B;  5FQ4 A;  4KBQ A;  1INZ A;  3R7Q A;  3MKQ B;  4JCY A;  2X6F A;  4HVB A;  3IV0 A;  1POU A;  2PUA A;  1ELW A;  1P5Q A;  2J4D A;  1E8Z A;  4B8A A;  2CHZ A;  4JL0 A;  3OXF A;  2HM8 A;  4H7X A;  2I9C A;  2OND A;  3JQ0 A;  3RRU A;  3D9M A;  3T5V A;  2R5S A;  5JHA A;  4Q96 A;  1LCD A;  4H7Y A;  2FI7 A;  1HX8 A;  2JEK A;  4MS6 A;  2WXR A;  1ZPQ A;  4PS8 A;  4IRU A;  2A5U A;  3APD A;  3CQC B;  4HOQ A;  3QOU A;  2XRZ A;  2OVB A;  2ION A;  2VYI A;  1HZ4 A;  4TRQ A;  4Y6W A;  2WQH A;  4ANX A;  4DLQ A;  2IV1 A;  2XSD C;  3LEW A;  3RRM B;  4I8T A;  4DPR A;  4N39 A;  2DBA A;  3MV3 B;  1ZS4 A;  4KMO A;  5EKQ D;  3AS5 A;  1EDU A;  1OWM A;  3BD1 A;  3CHM A;  2BUG A;  3DPD A;  4LER A;  5FWQ A;  3LY7 A;  2XGM A;  1A17 A;  2UWJ G;  3CHR A;  4FLB A;  5T8I A;  2WQ7 A;  4X4B A;  2H8R A;  2CFZ A;  1OSL A;  2VJ8 A;  2WVI A;  4JA9 A;  3GN5 A;  2KEK A;  4RG6 A;  4BY6 A;  4BWR A;  2ICT A;  5BT1 A;  4U07 A;  3TXM A;  4ACK A;  4BFR A;  4G25 A;  2WXL A;  1X2L A;  1JWG A;  2IQC A;  3ZPJ A;  4HOS A;  3FYM A;  3FU5 A;  3ENE A;  4PDX A;  4GA2 A;  3FH8 A;  4U0U A;  3VTY A;  2WXF A;  2XJ3 A;  3JUI A;  4MCT A;  3AS8 A;  4YG7 B;  4YG4 A;  4JVS A;  2VTB B;  1X57 A;  4YVO A;  3U64 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...