1X57A

Solution structures of the hth domain of human edf-1 protein
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
91
structure length
91
Chain Sequence
GSSGSSGDRVTLEVGKVIQQGRQSKGLTQKDLATKINEKPQVIADYESGRAIPNNQVLGKIERAIGLKLRGKDIGKPIEKGPRAKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structures of the HTH domain of human EDF-1 protein
rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords Endothelial differentiation-related factor 1
total genus 21
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2005-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 1x57A00
2KEKA 3RZZA 1PRVA 3G7DA 4YG7B 3BD1A 1UXCA 1YSEA 2XJ3A 3GN5A 2MQKA 3KZ3A 4JCYA 4X4GA 1CQTA 5K98B 1LCDA 1JFTA 2AUWA 1UXDA 4X4EA 2IUOA 3KXAA 3UFDA 2CROA 3LFPA 4PU3C 1POUA 3CECA 2IVBA 2PUAA 4Y42A 4X4FA 4X4HA 4I6RA 1HF0A 2PUEA 3OMTA 2LYJA 2LYSA 1UTXA 1ZZ7A 2OR1L 4O8BA 3QF3A 2MEZA 3ZHMA 2EF8A 2HINA 3SCHA 1LLIA 1S7EA 3R1FA 2LYKA 2AWIA 1X2LA 2O38A 2XCJA 3QWGA 2BJCA 2JVLA 1LMB3 4YBAA 3BS3A 3FYMA 4FN3A 4Z59A 4I8TA 1ZS4A 4IWRA 1WH8A 2AXUA 4X4BA 1XWRA 1ZPQA 1QPZA 1WETA 4MCTA 3FMYA 2PUGA 2PE5A 4J1XA 3GBFA 3SCGA 1CJGA 2LCVA 2HSGA 1BDIA 2BNMA 2AXZA 3PXPA 1RIOA 4JCXA 1QP7A 1X57A 4J1WA 1VPWA 2IVQA 4Z5CA 3JXBC 2OFYA 3GN5B 1RZRA 1EFAA 2PUFA 4PU4C 3F6WA 1PERL 3B7HA 2BNOA 1OCTC 1SQ8A 3CROL 5A7LA 4YARA 2PUCA 4JQDA 1ZUGA 4GHJA 1OSLA 2D5VA 3KJXA 1R63A 3ZHIA 2BNNA 1QQAA 2IU7A 1BDHA 4I6TA 3S8QA 2O49A 2ICTA 3MLFA 1AU7A 1JWLA 3G5GA 4I6UA 3OQNA 3DNVB 1RZRD 2L49A 4X4IA 4Z5DA 3F51A 1QP4A 1IC8A 3VK0A 1GT0C 2PPXA 3JXCL 1Y9QA 3ZKCA 4IVZA 2PUBA 1JH9A 1ADRA 1B0NA 2A6CA 2WIUB 3D1NI 2GZUA 1PNRA 1PRAA 2IV1A 1ZVVA 2LYLA 2LYPA 3L1PA 3SCFA 3HZIB 4PU8A 1L1MA 4IA8A 2B5AA 2EBYA 2H8RA 2WUSR 1QQBA 1LCCA 3OP9A 4FBIA 4X4DA 1LQCA 1O4XA 1NERA 1WH6A 4X4CA 2XIUA 2KZ8A 2LYQA 2LYRA 3O9XA 1E3OC 3TRBA 4NDWA 1ZAYA 1PRUA 2FJRA 1RPEL 3IVPA 2R1JL 2JCGA 3QYXA 2R63A 1ZZ8A 3CLCA 3U3WA 1DW9A 3OQOA 2AXVA 1DWKA 4PU7A 3JXDL 4Z58A 1JFSA 2KEJA 1R69A 2PUDA 4F8DA 4GQMA 2EWTA 4MCXA 1WIZA 1ZZ6A 3EUSA 1Y7YA 1ZZBA 2PIJA 2XI8A 1QP0A 2XSDC 3H5TA 1ZZCA 3F52A 1ZZ9A 3FYAA 4YG1A 3QQ6A 3OQMA 2L8NA 2IVGA 2ICPA 2KPJA 4Z5HA 2CSFA 4YG4A 1NEQA 2AW6A 2GRLA 4OB4A 2KEIA 1RZSA 3BDNA 3LISA 2O4AA 2GRMA
chains in the Genus database with same CATH superfamily
3BD1A 2ODRD 3KZ3A 2LNMA 5K98B 1JFTA 3A9XA 4OBMA 4X4EA 4EKIA 2YBDA 3SR4A 3UFDA 3LFPA 4PU3C 2IVBA 1HF0A 2LYJA 2HINA 1S7EA 2O38A 2XCJA 3QWGA 4YBAA 3FYMA 4FN3A 4I8TA 4X4BA 1QPZA 1WETA 2PE5A 2JQEA 2LCVA 1X57A 4J1WA 2LLWA 4Z5CA 3JXBC 2OFYA 3GN5B 5GAHi 2HCSA 3QOWA 1OCTC 2PXLA 3KJXA 2XXAA 2HFZA 3ZPXA 4EQZA 2HCNA 3S8QA 3MLFA 3DNVB 4X4IA 3F51A 3VK0A 2PPXA 3ZKCA 4IVZA 2PUBA 3GZCA 2VEOA 1B0NA 2WIUB 3GZDA 2IV1A 3L1PA 5DRYA 4IA8A 2B5AA 2H8RA 2M4HA 3OP9A 4FBIA 1LQCA 1E3OC 1WH6A 2LYRA 5DTQA 3QYXA 3OQOA 2AXVA 3M9LA 3PE5A 1DULA 2FFHA 3MEJA 4Z58A 2KEJA 2PUDA 2EWTA 1ZZ6A 1QP0A 3CROL 3H5TA 4YG1A 2L8NA 2IVGA 4HRAA 3NDBB 3NZLA 3NXHA 4OB4A 1RZSA 2O4AA 2GRMA 2KEKA 2PXPA 4YG7B 1UXCA 3R09A 3GN5A 2MQKA 4ER6A 1LCDA 2AUWA 1NW3A 2J7UA 2CROA 5JUWA 2PXKA 2PUAA 4Y42A 2PUEA 3OMTA 2PXFA 1ZZ7A 4O8BA 3QF3A 3SX0A 2MEZA 2EF8A 2LYKA 2AWIA 1X2LA 4Z59A 3BS3A 2AXUA 1XWRA 3NROA 3G0TA 2HSGA 2AXZA 3A9ZA 2PXUA 2PUFA 2BNOA 4GHJA 1R63A 2BNNA 4I6TA 2ICTA 1AU7A 1JWLA 1MFQC 3G5GA 1RZRD 1IC8A 1Y9QA 3ME5A 3TELA 1PNRA 2LYLA 2LYPA 2MXDA 2EBYA 5DRTA 1QQBA 1LCCA 2XIUA 2LYQA 4NDWA 3IVPA 2R1JL 2JCGA 2R63A 2PXVA 3CLCA 1DW9A 1QZXA 1DWKA 4PU7A 1JFSA 4F8DA 4ER5A 3GUUA 1Y7YA 1ZZBA 1QP7A 3F52A 1ZZ9A 4IWRA 3BDNA 3KL4A 2AW6A 3LISA 3RZZA 3G7DA 1YSEA 4JCYA 1CQTA 1UXDA 2IUOA 3KXAA 3CECA 4X4FA 3QFIA 4I6RA 2LYSA 2OR1L 3ZHMA 3R1FA 2BJCA 1LMB3 5DT2A 1WH8A 4WVLA 1ZPQA 4MCTA 3GBFA 3SCGA 1CJGA 4ER7A 4DE9A 4JCXA 2IVQA 1RZRA 5DSXA 3QOXA 4PU4C 2LLVA 5A7LA 2PUCA 4JQDA 2D5VA 2IU7A 5DTMA 4I6UA 3OQNA 3OWQA 2L49A 1QP4A 4Z5DA 1GT0C 1ADRA 2A6CA 2PXQA 1ZVVA 3HZIB 3SCFA 2WUSR 3OKZA 4X4CA 2KZ8A 1ZAYA 1PRUA 1RPEL 4EKGA 1ZZ8A 3U3WA 3LQXA 4ER0A 1WIZA 2XXPA 3EUSA 2XI8A 2PIJA 4ER3A 1ZZCA 3FYAA 3QQ6A 2KPJA 3GZDC 4Z5HA 2KEIA 1NEQA 2GRLA 3VWSA 2PUGA 1PRVA 2XJ3A 4X4GA 1POUA 4X4HA 3UWPA 2PXDA 3DM5A 1UTXA 3SCHA 2PXBA 1LLIA 2JVLA 4DE8A 1ZS4A 3FMYA 2V3CC 4J1XA 1BDIA 2BNMA 3PXPA 2PXEA 1RIOA 1VPWA 1EFAA 3TEPA 5GAGi 2XXQA 3F6WA 1PERL 3B7HA 1SQ8A 4YARA 1ZUGA 1OSLA 3A9YA 3ZHIA 1QQAA 1BDHA 2O49A 3JXCL 1JH9A 2PXTA 3D1NI 2GZUA 1PRAA 4PU8A 1L1MA 1QB2A 5DTRA 4X4DA 1O4XA 1NERA 3O9XA 2J7WA 4Q2JA 3TRBA 4EZIA 2FJRA 1U2ZA 1HQ1A 3JXDL 1R69A 4GQMA 4MCXA 2XSDC 3OQMA 3TFLA 4YG4A 2ICPA 2CSFA 4EK9A 2L1PA
chains in the Genus database with same CATH topology
2KEKA 3RZZA 1PRVA 3G7DA 4YG7B 3BD1A 1UXCA 1YSEA 2XJ3A 3GN5A 2MQKA 3KZ3A 4JCYA 4X4GA 1CQTA 5K98B 1LCDA 1JFTA 2AUWA 1UXDA 4X4EA 2IUOA 3KXAA 3UFDA 2CROA 3LFPA 4PU3C 1POUA 3CECA 2IVBA 2PUAA 4Y42A 4X4FA 4X4HA 4I6RA 1HF0A 2PUEA 3OMTA 2LYJA 2LYSA 1UTXA 1ZZ7A 2OR1L 4O8BA 3QF3A 2MEZA 3ZHMA 2EF8A 2HINA 3SCHA 1LLIA 1S7EA 3R1FA 2LYKA 2AWIA 1X2LA 2O38A 2XCJA 3QWGA 2BJCA 2JVLA 1LMB3 4YBAA 3BS3A 3FYMA 4FN3A 4Z59A 4I8TA 1ZS4A 4IWRA 1WH8A 2AXUA 4X4BA 1XWRA 1ZPQA 1QPZA 1WETA 4MCTA 3FMYA 2PUGA 2PE5A 4J1XA 3GBFA 3SCGA 1CJGA 2LCVA 2HSGA 1BDIA 2BNMA 2AXZA 3PXPA 1RIOA 4JCXA 1QP7A 1X57A 4J1WA 1VPWA 2IVQA 4Z5CA 3JXBC 2OFYA 3GN5B 1RZRA 1EFAA 2PUFA 4PU4C 3F6WA 1PERL 3B7HA 2BNOA 1OCTC 1SQ8A 3CROL 5A7LA 4YARA 2PUCA 4JQDA 1ZUGA 4GHJA 1OSLA 2D5VA 3KJXA 1R63A 3ZHIA 2BNNA 1QQAA 2IU7A 1BDHA 4I6TA 3S8QA 2O49A 2ICTA 3MLFA 1AU7A 1JWLA 3G5GA 4I6UA 3OQNA 3DNVB 1RZRD 2L49A 4X4IA 4Z5DA 3F51A 1QP4A 1IC8A 3VK0A 1GT0C 2PPXA 3JXCL 1Y9QA 3ZKCA 4IVZA 2PUBA 1JH9A 1ADRA 1B0NA 2A6CA 2WIUB 3D1NI 2GZUA 1PNRA 1PRAA 2IV1A 1ZVVA 2LYLA 2LYPA 3L1PA 3SCFA 3HZIB 4PU8A 1L1MA 4IA8A 2B5AA 2EBYA 2H8RA 2WUSR 1QQBA 1LCCA 3OP9A 4FBIA 4X4DA 1LQCA 1O4XA 1NERA 1WH6A 4X4CA 2XIUA 2KZ8A 2LYQA 2LYRA 3O9XA 1E3OC 3TRBA 4NDWA 1ZAYA 1PRUA 2FJRA 1RPEL 3IVPA 2R1JL 2JCGA 3QYXA 2R63A 1ZZ8A 3CLCA 3U3WA 1DW9A 3OQOA 2AXVA 1DWKA 4PU7A 3JXDL 4Z58A 1JFSA 2KEJA 1R69A 2PUDA 4F8DA 4GQMA 2EWTA 4MCXA 1WIZA 1ZZ6A 3EUSA 1Y7YA 1ZZBA 2PIJA 2XI8A 1QP0A 2XSDC 3H5TA 1ZZCA 3F52A 1ZZ9A 3FYAA 4YG1A 3QQ6A 3OQMA 2L8NA 2IVGA 2ICPA 2KPJA 4Z5HA 2CSFA 4YG4A 1NEQA 2AW6A 2GRLA 4OB4A 2KEIA 1RZSA 3BDNA 3LISA 2O4AA 2GRMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KEK A;  3RZZ A;  1PRV A;  3G7D A;  4YG7 B;  3BD1 A;  1UXC A;  1YSE A;  2XJ3 A;  3GN5 A;  2MQK A;  3KZ3 A;  4JCY A;  4X4G A;  1CQT A;  5K98 B;  1LCD A;  1JFT A;  2AUW A;  1UXD A;  4X4E A;  2IUO A;  3KXA A;  3UFD A;  2CRO A;  3LFP A;  4PU3 C;  1POU A;  3CEC A;  2IVB A;  2PUA A;  4Y42 A;  4X4F A;  4X4H A;  4I6R A;  1HF0 A;  2PUE A;  3OMT A;  2LYJ A;  2LYS A;  1UTX A;  1ZZ7 A;  2OR1 L;  4O8B A;  3QF3 A;  2MEZ A;  3ZHM A;  2EF8 A;  2HIN A;  3SCH A;  1LLI A;  1S7E A;  3R1F A;  2LYK A;  2AWI A;  1X2L A;  2O38 A;  2XCJ A;  3QWG A;  2BJC A;  2JVL A;  1LMB 3;  4YBA A;  3BS3 A;  3FYM A;  4FN3 A;  4Z59 A;  4I8T A;  1ZS4 A;  4IWR A;  1WH8 A;  2AXU A;  4X4B A;  1XWR A;  1ZPQ A;  1QPZ A;  1WET A;  4MCT A;  3FMY A;  2PUG A;  2PE5 A;  4J1X A;  3GBF A;  3SCG A;  1CJG A;  2LCV A;  2HSG A;  1BDI A;  2BNM A;  2AXZ A;  3PXP A;  1RIO A;  4JCX A;  1QP7 A;  1X57 A;  4J1W A;  1VPW A;  2IVQ A;  4Z5C A;  3JXB C;  2OFY A;  3GN5 B;  1RZR A;  1EFA A;  2PUF A;  4PU4 C;  3F6W A;  1PER L;  3B7H A;  2BNO A;  1OCT C;  1SQ8 A;  3CRO L;  5A7L A;  4YAR A;  2PUC A;  4JQD A;  1ZUG A;  4GHJ A;  1OSL A;  2D5V A;  3KJX A;  1R63 A;  3ZHI A;  2BNN A;  1QQA A;  2IU7 A;  1BDH A;  4I6T A;  3S8Q A;  2O49 A;  2ICT A;  3MLF A;  1AU7 A;  1JWL A;  3G5G A;  4I6U A;  3OQN A;  3DNV B;  1RZR D;  2L49 A;  4X4I A;  4Z5D A;  3F51 A;  1QP4 A;  1IC8 A;  3VK0 A;  1GT0 C;  2PPX A;  3JXC L;  1Y9Q A;  3ZKC A;  4IVZ A;  2PUB A;  1JH9 A;  1ADR A;  1B0N A;  2A6C A;  2WIU B;  3D1N I;  2GZU A;  1PNR A;  1PRA A;  2IV1 A;  1ZVV A;  2LYL A;  2LYP A;  3L1P A;  3SCF A;  3HZI B;  4PU8 A;  1L1M A;  4IA8 A;  2B5A A;  2EBY A;  2H8R A;  2WUS R;  1QQB A;  1LCC A;  3OP9 A;  4FBI A;  4X4D A;  1LQC A;  1O4X A;  1NER A;  1WH6 A;  4X4C A;  2XIU A;  2KZ8 A;  2LYQ A;  2LYR A;  3O9X A;  1E3O C;  3TRB A;  4NDW A;  1ZAY A;  1PRU A;  2FJR A;  1RPE L;  3IVP A;  2R1J L;  2JCG A;  3QYX A;  2R63 A;  1ZZ8 A;  3CLC A;  3U3W A;  1DW9 A;  3OQO A;  2AXV A;  1DWK A;  4PU7 A;  3JXD L;  4Z58 A;  1JFS A;  2KEJ A;  1R69 A;  2PUD A;  4F8D A;  4GQM A;  2EWT A;  4MCX A;  1WIZ A;  1ZZ6 A;  3EUS A;  1Y7Y A;  1ZZB A;  2PIJ A;  2XI8 A;  1QP0 A;  2XSD C;  3H5T A;  1ZZC A;  3F52 A;  1ZZ9 A;  3FYA A;  4YG1 A;  3QQ6 A;  3OQM A;  2L8N A;  2IVG A;  2ICP A;  2KPJ A;  4Z5H A;  2CSF A;  4YG4 A;  1NEQ A;  2AW6 A;  2GRL A;  4OB4 A;  2KEI A;  1RZS A;  3BDN A;  3LIS A;  2O4A A;  2GRM A; 
#chains in the Genus database with same CATH topology
 3BD1 A;  2ODR D;  3KZ3 A;  2LNM A;  5K98 B;  1JFT A;  3A9X A;  4OBM A;  4X4E A;  4EKI A;  2YBD A;  3SR4 A;  3UFD A;  3LFP A;  4PU3 C;  2IVB A;  1HF0 A;  2LYJ A;  2HIN A;  1S7E A;  2O38 A;  2XCJ A;  3QWG A;  4YBA A;  3FYM A;  4FN3 A;  4I8T A;  4X4B A;  1QPZ A;  1WET A;  2PE5 A;  2JQE A;  2LCV A;  1X57 A;  4J1W A;  2LLW A;  4Z5C A;  3JXB C;  2OFY A;  3GN5 B;  5GAH i;  2HCS A;  3QOW A;  1OCT C;  2PXL A;  3KJX A;  2XXA A;  2HFZ A;  3ZPX A;  4EQZ A;  2HCN A;  3S8Q A;  3MLF A;  3DNV B;  4X4I A;  3F51 A;  3VK0 A;  2PPX A;  3ZKC A;  4IVZ A;  2PUB A;  3GZC A;  2VEO A;  1B0N A;  2WIU B;  3GZD A;  2IV1 A;  3L1P A;  5DRY A;  4IA8 A;  2B5A A;  2H8R A;  2M4H A;  3OP9 A;  4FBI A;  1LQC A;  1E3O C;  1WH6 A;  2LYR A;  5DTQ A;  3QYX A;  3OQO A;  2AXV A;  3M9L A;  3PE5 A;  1DUL A;  2FFH A;  3MEJ A;  4Z58 A;  2KEJ A;  2PUD A;  2EWT A;  1ZZ6 A;  1QP0 A;  3CRO L;  3H5T A;  4YG1 A;  2L8N A;  2IVG A;  4HRA A;  3NDB B;  3NZL A;  3NXH A;  4OB4 A;  1RZS A;  2O4A A;  2GRM A;  2KEK A;  2PXP A;  4YG7 B;  1UXC A;  3R09 A;  3GN5 A;  2MQK A;  4ER6 A;  1LCD A;  2AUW A;  1NW3 A;  2J7U A;  2CRO A;  5JUW A;  2PXK A;  2PUA A;  4Y42 A;  2PUE A;  3OMT A;  2PXF A;  1ZZ7 A;  4O8B A;  3QF3 A;  3SX0 A;  2MEZ A;  2EF8 A;  2LYK A;  2AWI A;  1X2L A;  4Z59 A;  3BS3 A;  2AXU A;  1XWR A;  3NRO A;  3G0T A;  2HSG A;  2AXZ A;  3A9Z A;  2PXU A;  2PUF A;  2BNO A;  4GHJ A;  1R63 A;  2BNN A;  4I6T A;  2ICT A;  1AU7 A;  1JWL A;  1MFQ C;  3G5G A;  1RZR D;  1IC8 A;  1Y9Q A;  3ME5 A;  3TEL A;  1PNR A;  2LYL A;  2LYP A;  2MXD A;  2EBY A;  5DRT A;  1QQB A;  1LCC A;  2XIU A;  2LYQ A;  4NDW A;  3IVP A;  2R1J L;  2JCG A;  2R63 A;  2PXV A;  3CLC A;  1DW9 A;  1QZX A;  1DWK A;  4PU7 A;  1JFS A;  4F8D A;  4ER5 A;  3GUU A;  1Y7Y A;  1ZZB A;  1QP7 A;  3F52 A;  1ZZ9 A;  4IWR A;  3BDN A;  3KL4 A;  2AW6 A;  3LIS A;  3RZZ A;  3G7D A;  1YSE A;  4JCY A;  1CQT A;  1UXD A;  2IUO A;  3KXA A;  3CEC A;  4X4F A;  3QFI A;  4I6R A;  2LYS A;  2OR1 L;  3ZHM A;  3R1F A;  2BJC A;  1LMB 3;  5DT2 A;  1WH8 A;  4WVL A;  1ZPQ A;  4MCT A;  3GBF A;  3SCG A;  1CJG A;  4ER7 A;  4DE9 A;  4JCX A;  2IVQ A;  1RZR A;  5DSX A;  3QOX A;  4PU4 C;  2LLV A;  5A7L A;  2PUC A;  4JQD A;  2D5V A;  2IU7 A;  5DTM A;  4I6U A;  3OQN A;  3OWQ A;  2L49 A;  1QP4 A;  4Z5D A;  1GT0 C;  1ADR A;  2A6C A;  2PXQ A;  1ZVV A;  3HZI B;  3SCF A;  2WUS R;  3OKZ A;  4X4C A;  2KZ8 A;  1ZAY A;  1PRU A;  1RPE L;  4EKG A;  1ZZ8 A;  3U3W A;  3LQX A;  4ER0 A;  1WIZ A;  2XXP A;  3EUS A;  2XI8 A;  2PIJ A;  4ER3 A;  1ZZC A;  3FYA A;  3QQ6 A;  2KPJ A;  3GZD C;  4Z5H A;  2KEI A;  1NEQ A;  2GRL A;  3VWS A;  2PUG A;  1PRV A;  2XJ3 A;  4X4G A;  1POU A;  4X4H A;  3UWP A;  2PXD A;  3DM5 A;  1UTX A;  3SCH A;  2PXB A;  1LLI A;  2JVL A;  4DE8 A;  1ZS4 A;  3FMY A;  2V3C C;  4J1X A;  1BDI A;  2BNM A;  3PXP A;  2PXE A;  1RIO A;  1VPW A;  1EFA A;  3TEP A;  5GAG i;  2XXQ A;  3F6W A;  1PER L;  3B7H A;  1SQ8 A;  4YAR A;  1ZUG A;  1OSL A;  3A9Y A;  3ZHI A;  1QQA A;  1BDH A;  2O49 A;  3JXC L;  1JH9 A;  2PXT A;  3D1N I;  2GZU A;  1PRA A;  4PU8 A;  1L1M A;  1QB2 A;  5DTR A;  4X4D A;  1O4X A;  1NER A;  3O9X A;  2J7W A;  4Q2J A;  3TRB A;  4EZI A;  2FJR A;  1U2Z A;  1HQ1 A;  3JXD L;  1R69 A;  4GQM A;  4MCX A;  2XSD C;  3OQM A;  3TFL A;  4YG4 A;  2ICP A;  2CSF A;  4EK9 A;  2L1P A; 
#chains in the Genus database with same CATH homology
 2KEK A;  3RZZ A;  1PRV A;  3G7D A;  4YG7 B;  3BD1 A;  1UXC A;  1YSE A;  2XJ3 A;  3GN5 A;  2MQK A;  3KZ3 A;  4JCY A;  4X4G A;  1CQT A;  5K98 B;  1LCD A;  1JFT A;  2AUW A;  1UXD A;  4X4E A;  2IUO A;  3KXA A;  3UFD A;  2CRO A;  3LFP A;  4PU3 C;  1POU A;  3CEC A;  2IVB A;  2PUA A;  4Y42 A;  4X4F A;  4X4H A;  4I6R A;  1HF0 A;  2PUE A;  3OMT A;  2LYJ A;  2LYS A;  1UTX A;  1ZZ7 A;  2OR1 L;  4O8B A;  3QF3 A;  2MEZ A;  3ZHM A;  2EF8 A;  2HIN A;  3SCH A;  1LLI A;  1S7E A;  3R1F A;  2LYK A;  2AWI A;  1X2L A;  2O38 A;  2XCJ A;  3QWG A;  2BJC A;  2JVL A;  1LMB 3;  4YBA A;  3BS3 A;  3FYM A;  4FN3 A;  4Z59 A;  4I8T A;  1ZS4 A;  4IWR A;  1WH8 A;  2AXU A;  4X4B A;  1XWR A;  1ZPQ A;  1QPZ A;  1WET A;  4MCT A;  3FMY A;  2PUG A;  2PE5 A;  4J1X A;  3GBF A;  3SCG A;  1CJG A;  2LCV A;  2HSG A;  1BDI A;  2BNM A;  2AXZ A;  3PXP A;  1RIO A;  4JCX A;  1QP7 A;  1X57 A;  4J1W A;  1VPW A;  2IVQ A;  4Z5C A;  3JXB C;  2OFY A;  3GN5 B;  1RZR A;  1EFA A;  2PUF A;  4PU4 C;  3F6W A;  1PER L;  3B7H A;  2BNO A;  1OCT C;  1SQ8 A;  3CRO L;  5A7L A;  4YAR A;  2PUC A;  4JQD A;  1ZUG A;  4GHJ A;  1OSL A;  2D5V A;  3KJX A;  1R63 A;  3ZHI A;  2BNN A;  1QQA A;  2IU7 A;  1BDH A;  4I6T A;  3S8Q A;  2O49 A;  2ICT A;  3MLF A;  1AU7 A;  1JWL A;  3G5G A;  4I6U A;  3OQN A;  3DNV B;  1RZR D;  2L49 A;  4X4I A;  4Z5D A;  3F51 A;  1QP4 A;  1IC8 A;  3VK0 A;  1GT0 C;  2PPX A;  3JXC L;  1Y9Q A;  3ZKC A;  4IVZ A;  2PUB A;  1JH9 A;  1ADR A;  1B0N A;  2A6C A;  2WIU B;  3D1N I;  2GZU A;  1PNR A;  1PRA A;  2IV1 A;  1ZVV A;  2LYL A;  2LYP A;  3L1P A;  3SCF A;  3HZI B;  4PU8 A;  1L1M A;  4IA8 A;  2B5A A;  2EBY A;  2H8R A;  2WUS R;  1QQB A;  1LCC A;  3OP9 A;  4FBI A;  4X4D A;  1LQC A;  1O4X A;  1NER A;  1WH6 A;  4X4C A;  2XIU A;  2KZ8 A;  2LYQ A;  2LYR A;  3O9X A;  1E3O C;  3TRB A;  4NDW A;  1ZAY A;  1PRU A;  2FJR A;  1RPE L;  3IVP A;  2R1J L;  2JCG A;  3QYX A;  2R63 A;  1ZZ8 A;  3CLC A;  3U3W A;  1DW9 A;  3OQO A;  2AXV A;  1DWK A;  4PU7 A;  3JXD L;  4Z58 A;  1JFS A;  2KEJ A;  1R69 A;  2PUD A;  4F8D A;  4GQM A;  2EWT A;  4MCX A;  1WIZ A;  1ZZ6 A;  3EUS A;  1Y7Y A;  1ZZB A;  2PIJ A;  2XI8 A;  1QP0 A;  2XSD C;  3H5T A;  1ZZC A;  3F52 A;  1ZZ9 A;  3FYA A;  4YG1 A;  3QQ6 A;  3OQM A;  2L8N A;  2IVG A;  2ICP A;  2KPJ A;  4Z5H A;  2CSF A;  4YG4 A;  1NEQ A;  2AW6 A;  2GRL A;  4OB4 A;  2KEI A;  1RZS A;  3BDN A;  3LIS A;  2O4A A;  2GRM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...