4YG1A

Hipb-o1-o2 complex/p21212 crystal form
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
72
structure length
72
Chain Sequence
MMSFQKIYSPTQLANAMKLVRQQNGWTQSELAKKIGIKQATISNFENNPDNTTLTTFFKILQSLELSMTLCD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title HipBA-promoter structures reveal the basis of heritable multidrug tolerance.
pubmed doi rcsb
source organism Escherichia coli (strain k12)
molecule tags Transcription/dna
molecule keywords Antitoxin HipB
total genus 21
structure length 72
sequence length 72
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 4yg1A00
3QWGA 2KEJA 2PIJA 4PU8A 1ZZCA 3QF3A 1YSEA 3R1FA 1VPWA 2OFYA 4X4BA 2A6CA 1GT0C 1X57A 3D1NI 3F6WA 2AXZA 2B5AA 2GRLA 3MLFA 1UXDA 1LCDA 3SCHA 1LQCA 3G5GA 3HZIB 1ADRA 2CSFA 2LYPA 1LLIA 3PXPA 3QYXA 1L1MA 3FMYA 3ZKCA 1ZZ9A 1OCTC 2XCJA 1ZZ8A 2BNOA 4Z59A 1JFSA 3TRBA 1PNRA 1ZZBA 2MEZA 3SCGA 3KJXA 3F52A 2D5VA 3KZ3A 2WUSR 1PRUA 1OSLA 1QP4A 4YG1A 3EUSA 3CECA 2PE5A 2PUDA 2PUAA 2KPJA 4I6TA 2EF8A 1QPZA 2KZ8A 2ICTA 1Y9QA 4X4GA 4PU3C 1R63A 1ZZ7A 2EWTA 3OP9A 2H8RA 3KXAA 4X4IA 3G7DA 2GZUA 4X4HA 4Z5HA 3JXBC 2XSDC 1CJGA 2HSGA 1PERL 2IVQA 1NEQA 1AU7A 4I8TA 4NDWA 2JCGA 3FYMA 3SCFA 3ZHIA 1SQ8A 3BDNA 1RPEL 2O4AA 3LFPA 2XJ3A 1JFTA 3ZHMA 1S7EA 3L1PA 3BS3A 1X2LA 3OMTA 3B7HA 3S8QA 1CQTA 2PUBA 1POUA 3CLCA 4X4DA 2O49A 2AWIA 1DW9A 4IVZA 2AXUA 1QQBA 1ZZ6A 1IC8A 4YG7B 2JVLA 1BDIA 4J1WA 3GBFA 4IWRA 4PU7A 2AUWA 3FYAA 2HINA 1WIZA 2OR1L 3LISA 1QQAA 1ZUGA 1B0NA 1RZRD 3RZZA 2BNNA 4MCTA 2R1JL 3GN5B 1WH8A 4JQDA 4JCXA 2PUFA 1RIOA 4OB4A 2GRMA 4GHJA 1HF0A 3IVPA 2CROA 4X4FA 4Z58A 2LYJA 2IVBA 2PPXA 2PUEA 1O4XA 3GN5A 1WH6A 1Y7YA 2R63A 4MCXA 4Z5CA 2AXVA 4F8DA 1QP0A 2AW6A 5A7LA 3OQMA 3JXCL 3QQ6A 1LMB3 4X4EA 2BJCA 4Y42A 2XI8A 4PU4C 2PUGA 1ZPQA 2BNMA 4O8BA 1ZVVA 4JCYA 1R69A 2KEKA 4J1XA 4Z5DA 1JH9A 3H5TA 1EFAA 3BD1A 5K98B 2L49A 1PRAA 2LYSA 2EBYA 1QP7A 1UXCA 2ICPA 3VK0A 3OQNA 1LCCA 4YG4A 4X4CA 2LYLA 4FBIA 2FJRA 3O9XA 2MQKA 4YARA 3OQOA 2WIUB 2LCVA 4GQMA 4I6UA 2KEIA 2IUOA 2IV1A 2LYRA 1RZRA 1JWLA 1BDHA 2L8NA 3UFDA 1DWKA 3U3WA 2LYKA 1XWRA 3DNVB 2PUCA 1UTXA 1WETA 1PRVA 1NERA 2IU7A 2O38A 1ZS4A 4FN3A 2XIUA 1E3OC 2IVGA 2LYQA 4I6RA 1RZSA 3F51A 4YBAA 1ZAYA 3CROL 3JXDL 4IA8A
chains in the Genus database with same CATH superfamily
2KEJA 3R1FA 2LLWA 2OFYA 4X4BA 2GRLA 1QZXA 3MLFA 3SCHA 5DTRA 3G5GA 1ADRA 1L1MA 5GAGi 1ZZ8A 4Z59A 1JFSA 3TRBA 1PNRA 3KZ3A 2WUSR 2PUDA 2VEOA 2EF8A 1QPZA 1Y9QA 2PXTA 1ZZ7A 2EWTA 3G7DA 2IVQA 4EK9A 2HFZA 3BDNA 3LFPA 2XJ3A 3ZHMA 1S7EA 3OMTA 3S8QA 2PUBA 4X4DA 2M4HA 1ZZ6A 4IWRA 2AUWA 1RZRD 2BNNA 4MCTA 4JQDA 3GN5B 1WH8A 4OB4A 1HF0A 3A9YA 4X4FA 4Z58A 4HRAA 2PUEA 2PXDA 1QB2A 2BJCA 2XI8A 4O8BA 4JCYA 1QP7A 3OQNA 3OKZA 4EKGA 4FBIA 2PXUA 4ER0A 4EZIA 4I6UA 1JWLA 5DSXA 2L8NA 3UFDA 2LYKA 2HCSA 1NW3A 2PUCA 2L1PA 1WETA 1PRVA 2IU7A 3UWPA 2LYQA 3F51A 2PXBA 4DE9A 3D1NI 3F6WA 2PXPA 1LLIA 3PXPA 3QYXA 4ER5A 2ODRD 3DM5A 2XXQA 3MEJA 3TEPA 3SCGA 2D5VA 1HQ1A 1OSLA 3EUSA 2PUAA 2KPJA 2KZ8A 2ICTA 4X4IA 2GZUA 2FFHA 2XSDC 4ER7A 1PERL 2J7WA 2JQEA 2JCGA 3FYMA 3ME5A 2O4AA 3A9XA 3L1PA 1X2LA 3NROA 3TELA 1DW9A 3FYAA 3LISA 1ZUGA 2R1JL 4JCXA 3IVPA 2LYJA 1DULA 2PPXA 1O4XA 3GN5A 3QFIA 1Y7YA 2XXAA 1QP0A 2AW6A 4X4EA 2BNMA 1JH9A 1EFAA 2L49A 3NZLA 1UXCA 2MQKA 3OQOA 3SR4A 2LYRA 2MXDA 1XWRA 3DNVB 1ZS4A 2XIUA 5DT2A 2IVGA 1E3OC 3SX0A 3JXDL 2J7UA 2PIJA 4PU8A 1ZZCA 3QF3A 3A9ZA 1VPWA 2A6CA 2B5AA 2YBDA 1UXDA 1LQCA 2CSFA 2LYPA 3G0TA 4EQZA 3FMYA 4WVLA 5DTMA 3ZPXA 2XCJA 2XXPA 1ZZBA 2MEZA 2HCNA 3KJXA 4ER3A 4X4GA 3OP9A 1CJGA 2PXQA 1NEQA 1AU7A 2V3CC 3SCFA 3ZHIA 1RPEL 5DRYA 1POUA 3CLCA 2AWIA 2AXUA 4YG7B 3GBFA 2HINA 1WIZA 2LLVA 1QQAA 1B0NA 1RIOA 2GRMA 4GHJA 2CROA 2PXKA 3QOXA 2IVBA 3KL4A 1WH6A 2R63A 4MCXA 4Z5CA 3GZCA 5A7LA 3OQMA 3QQ6A 1LMB3 4Y42A 4PU4C 2PUGA 1ZPQA 1ZVVA 1R69A 3BD1A 2EBYA 2ICPA 3VK0A 4Q2JA 2LYLA 3O9XA 2WIUB 2LCVA 4GQMA 2KEIA 1DWKA 1UTXA 4I6RA 1ZAYA 4YBAA 3PE5A 4IA8A 3QWGA 1YSEA 4ER6A 1GT0C 1X57A 2AXZA 1LCDA 3HZIB 3ZKCA 1ZZ9A 3LQXA 1OCTC 1U2ZA 2BNOA 3F52A 1QP4A 1PRUA 4YG1A 2PE5A 3CECA 4I6TA 4PU3C 1R63A 2H8RA 3KXAA 3NDBB 4X4HA 4Z5HA 3JXBC 2HSGA 5GAHi 4I8TA 4NDWA 4EKIA 1SQ8A 1JFTA 3BS3A 3B7HA 2PXLA 1CQTA 2O49A 4IVZA 1QQBA 1IC8A 3GZDA 2JVLA 1BDIA 4J1WA 2PXEA 4DE8A 4PU7A 2OR1L 3QOWA 3NXHA 3RZZA 2PUFA 5DTQA 3GUUA 3TFLA 2PXVA 5DRTA 2PXFA 2AXVA 5JUWA 3VWSA 4F8DA 3JXCL 2KEKA 4J1XA 4Z5DA 3H5TA 3GZDC 5K98B 1PRAA 2LYSA 1LCCA 3M9LA 4OBMA 4YG4A 4X4CA 2FJRA 4YARA 1RZRA 2IUOA 2IV1A 3R09A 1BDHA 3U3WA 3OWQA 2LNMA 1NERA 2O38A 4FN3A 1MFQC 1RZSA 3CROL
chains in the Genus database with same CATH topology
3QWGA 2KEJA 2PIJA 4PU8A 1ZZCA 3QF3A 1YSEA 3R1FA 1VPWA 2OFYA 4X4BA 2A6CA 1GT0C 1X57A 3D1NI 3F6WA 2AXZA 2B5AA 2GRLA 3MLFA 1UXDA 1LCDA 3SCHA 1LQCA 3G5GA 3HZIB 1ADRA 2CSFA 2LYPA 1LLIA 3PXPA 3QYXA 1L1MA 3FMYA 3ZKCA 1ZZ9A 1OCTC 2XCJA 1ZZ8A 2BNOA 4Z59A 1JFSA 3TRBA 1PNRA 1ZZBA 2MEZA 3SCGA 3KJXA 3F52A 2D5VA 3KZ3A 2WUSR 1PRUA 1OSLA 1QP4A 4YG1A 3EUSA 3CECA 2PE5A 2PUDA 2PUAA 2KPJA 4I6TA 2EF8A 1QPZA 2KZ8A 2ICTA 1Y9QA 4X4GA 4PU3C 1R63A 1ZZ7A 2EWTA 3OP9A 2H8RA 3KXAA 4X4IA 3G7DA 2GZUA 4X4HA 4Z5HA 3JXBC 2XSDC 1CJGA 2HSGA 1PERL 2IVQA 1NEQA 1AU7A 4I8TA 4NDWA 2JCGA 3FYMA 3SCFA 3ZHIA 1SQ8A 3BDNA 1RPEL 2O4AA 3LFPA 2XJ3A 1JFTA 3ZHMA 1S7EA 3L1PA 3BS3A 1X2LA 3OMTA 3B7HA 3S8QA 1CQTA 2PUBA 1POUA 3CLCA 4X4DA 2O49A 2AWIA 1DW9A 4IVZA 2AXUA 1QQBA 1ZZ6A 1IC8A 4YG7B 2JVLA 1BDIA 4J1WA 3GBFA 4IWRA 4PU7A 2AUWA 3FYAA 2HINA 1WIZA 2OR1L 3LISA 1QQAA 1ZUGA 1B0NA 1RZRD 3RZZA 2BNNA 4MCTA 2R1JL 3GN5B 1WH8A 4JQDA 4JCXA 2PUFA 1RIOA 4OB4A 2GRMA 4GHJA 1HF0A 3IVPA 2CROA 4X4FA 4Z58A 2LYJA 2IVBA 2PPXA 2PUEA 1O4XA 3GN5A 1WH6A 1Y7YA 2R63A 4MCXA 4Z5CA 2AXVA 4F8DA 1QP0A 2AW6A 5A7LA 3OQMA 3JXCL 3QQ6A 1LMB3 4X4EA 2BJCA 4Y42A 2XI8A 4PU4C 2PUGA 1ZPQA 2BNMA 4O8BA 1ZVVA 4JCYA 1R69A 2KEKA 4J1XA 4Z5DA 1JH9A 3H5TA 1EFAA 3BD1A 5K98B 2L49A 1PRAA 2LYSA 2EBYA 1QP7A 1UXCA 2ICPA 3VK0A 3OQNA 1LCCA 4YG4A 4X4CA 2LYLA 4FBIA 2FJRA 3O9XA 2MQKA 4YARA 3OQOA 2WIUB 2LCVA 4GQMA 4I6UA 2KEIA 2IUOA 2IV1A 2LYRA 1RZRA 1JWLA 1BDHA 2L8NA 3UFDA 1DWKA 3U3WA 2LYKA 1XWRA 3DNVB 2PUCA 1UTXA 1WETA 1PRVA 1NERA 2IU7A 2O38A 1ZS4A 4FN3A 2XIUA 1E3OC 2IVGA 2LYQA 4I6RA 1RZSA 3F51A 4YBAA 1ZAYA 3CROL 3JXDL 4IA8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QWG A;  2KEJ A;  2PIJ A;  4PU8 A;  1ZZC A;  3QF3 A;  1YSE A;  3R1F A;  1VPW A;  2OFY A;  4X4B A;  2A6C A;  1GT0 C;  1X57 A;  3D1N I;  3F6W A;  2AXZ A;  2B5A A;  2GRL A;  3MLF A;  1UXD A;  1LCD A;  3SCH A;  1LQC A;  3G5G A;  3HZI B;  1ADR A;  2CSF A;  2LYP A;  1LLI A;  3PXP A;  3QYX A;  1L1M A;  3FMY A;  3ZKC A;  1ZZ9 A;  1OCT C;  2XCJ A;  1ZZ8 A;  2BNO A;  4Z59 A;  1JFS A;  3TRB A;  1PNR A;  1ZZB A;  2MEZ A;  3SCG A;  3KJX A;  3F52 A;  2D5V A;  3KZ3 A;  2WUS R;  1PRU A;  1OSL A;  1QP4 A;  4YG1 A;  3EUS A;  3CEC A;  2PE5 A;  2PUD A;  2PUA A;  2KPJ A;  4I6T A;  2EF8 A;  1QPZ A;  2KZ8 A;  2ICT A;  1Y9Q A;  4X4G A;  4PU3 C;  1R63 A;  1ZZ7 A;  2EWT A;  3OP9 A;  2H8R A;  3KXA A;  4X4I A;  3G7D A;  2GZU A;  4X4H A;  4Z5H A;  3JXB C;  2XSD C;  1CJG A;  2HSG A;  1PER L;  2IVQ A;  1NEQ A;  1AU7 A;  4I8T A;  4NDW A;  2JCG A;  3FYM A;  3SCF A;  3ZHI A;  1SQ8 A;  3BDN A;  1RPE L;  2O4A A;  3LFP A;  2XJ3 A;  1JFT A;  3ZHM A;  1S7E A;  3L1P A;  3BS3 A;  1X2L A;  3OMT A;  3B7H A;  3S8Q A;  1CQT A;  2PUB A;  1POU A;  3CLC A;  4X4D A;  2O49 A;  2AWI A;  1DW9 A;  4IVZ A;  2AXU A;  1QQB A;  1ZZ6 A;  1IC8 A;  4YG7 B;  2JVL A;  1BDI A;  4J1W A;  3GBF A;  4IWR A;  4PU7 A;  2AUW A;  3FYA A;  2HIN A;  1WIZ A;  2OR1 L;  3LIS A;  1QQA A;  1ZUG A;  1B0N A;  1RZR D;  3RZZ A;  2BNN A;  4MCT A;  2R1J L;  3GN5 B;  1WH8 A;  4JQD A;  4JCX A;  2PUF A;  1RIO A;  4OB4 A;  2GRM A;  4GHJ A;  1HF0 A;  3IVP A;  2CRO A;  4X4F A;  4Z58 A;  2LYJ A;  2IVB A;  2PPX A;  2PUE A;  1O4X A;  3GN5 A;  1WH6 A;  1Y7Y A;  2R63 A;  4MCX A;  4Z5C A;  2AXV A;  4F8D A;  1QP0 A;  2AW6 A;  5A7L A;  3OQM A;  3JXC L;  3QQ6 A;  1LMB 3;  4X4E A;  2BJC A;  4Y42 A;  2XI8 A;  4PU4 C;  2PUG A;  1ZPQ A;  2BNM A;  4O8B A;  1ZVV A;  4JCY A;  1R69 A;  2KEK A;  4J1X A;  4Z5D A;  1JH9 A;  3H5T A;  1EFA A;  3BD1 A;  5K98 B;  2L49 A;  1PRA A;  2LYS A;  2EBY A;  1QP7 A;  1UXC A;  2ICP A;  3VK0 A;  3OQN A;  1LCC A;  4YG4 A;  4X4C A;  2LYL A;  4FBI A;  2FJR A;  3O9X A;  2MQK A;  4YAR A;  3OQO A;  2WIU B;  2LCV A;  4GQM A;  4I6U A;  2KEI A;  2IUO A;  2IV1 A;  2LYR A;  1RZR A;  1JWL A;  1BDH A;  2L8N A;  3UFD A;  1DWK A;  3U3W A;  2LYK A;  1XWR A;  3DNV B;  2PUC A;  1UTX A;  1WET A;  1PRV A;  1NER A;  2IU7 A;  2O38 A;  1ZS4 A;  4FN3 A;  2XIU A;  1E3O C;  2IVG A;  2LYQ A;  4I6R A;  1RZS A;  3F51 A;  4YBA A;  1ZAY A;  3CRO L;  3JXD L;  4IA8 A; 
#chains in the Genus database with same CATH topology
 2KEJ A;  3R1F A;  2LLW A;  2OFY A;  4X4B A;  2GRL A;  1QZX A;  3MLF A;  3SCH A;  5DTR A;  3G5G A;  1ADR A;  1L1M A;  5GAG i;  1ZZ8 A;  4Z59 A;  1JFS A;  3TRB A;  1PNR A;  3KZ3 A;  2WUS R;  2PUD A;  2VEO A;  2EF8 A;  1QPZ A;  1Y9Q A;  2PXT A;  1ZZ7 A;  2EWT A;  3G7D A;  2IVQ A;  4EK9 A;  2HFZ A;  3BDN A;  3LFP A;  2XJ3 A;  3ZHM A;  1S7E A;  3OMT A;  3S8Q A;  2PUB A;  4X4D A;  2M4H A;  1ZZ6 A;  4IWR A;  2AUW A;  1RZR D;  2BNN A;  4MCT A;  4JQD A;  3GN5 B;  1WH8 A;  4OB4 A;  1HF0 A;  3A9Y A;  4X4F A;  4Z58 A;  4HRA A;  2PUE A;  2PXD A;  1QB2 A;  2BJC A;  2XI8 A;  4O8B A;  4JCY A;  1QP7 A;  3OQN A;  3OKZ A;  4EKG A;  4FBI A;  2PXU A;  4ER0 A;  4EZI A;  4I6U A;  1JWL A;  5DSX A;  2L8N A;  3UFD A;  2LYK A;  2HCS A;  1NW3 A;  2PUC A;  2L1P A;  1WET A;  1PRV A;  2IU7 A;  3UWP A;  2LYQ A;  3F51 A;  2PXB A;  4DE9 A;  3D1N I;  3F6W A;  2PXP A;  1LLI A;  3PXP A;  3QYX A;  4ER5 A;  2ODR D;  3DM5 A;  2XXQ A;  3MEJ A;  3TEP A;  3SCG A;  2D5V A;  1HQ1 A;  1OSL A;  3EUS A;  2PUA A;  2KPJ A;  2KZ8 A;  2ICT A;  4X4I A;  2GZU A;  2FFH A;  2XSD C;  4ER7 A;  1PER L;  2J7W A;  2JQE A;  2JCG A;  3FYM A;  3ME5 A;  2O4A A;  3A9X A;  3L1P A;  1X2L A;  3NRO A;  3TEL A;  1DW9 A;  3FYA A;  3LIS A;  1ZUG A;  2R1J L;  4JCX A;  3IVP A;  2LYJ A;  1DUL A;  2PPX A;  1O4X A;  3GN5 A;  3QFI A;  1Y7Y A;  2XXA A;  1QP0 A;  2AW6 A;  4X4E A;  2BNM A;  1JH9 A;  1EFA A;  2L49 A;  3NZL A;  1UXC A;  2MQK A;  3OQO A;  3SR4 A;  2LYR A;  2MXD A;  1XWR A;  3DNV B;  1ZS4 A;  2XIU A;  5DT2 A;  2IVG A;  1E3O C;  3SX0 A;  3JXD L;  2J7U A;  2PIJ A;  4PU8 A;  1ZZC A;  3QF3 A;  3A9Z A;  1VPW A;  2A6C A;  2B5A A;  2YBD A;  1UXD A;  1LQC A;  2CSF A;  2LYP A;  3G0T A;  4EQZ A;  3FMY A;  4WVL A;  5DTM A;  3ZPX A;  2XCJ A;  2XXP A;  1ZZB A;  2MEZ A;  2HCN A;  3KJX A;  4ER3 A;  4X4G A;  3OP9 A;  1CJG A;  2PXQ A;  1NEQ A;  1AU7 A;  2V3C C;  3SCF A;  3ZHI A;  1RPE L;  5DRY A;  1POU A;  3CLC A;  2AWI A;  2AXU A;  4YG7 B;  3GBF A;  2HIN A;  1WIZ A;  2LLV A;  1QQA A;  1B0N A;  1RIO A;  2GRM A;  4GHJ A;  2CRO A;  2PXK A;  3QOX A;  2IVB A;  3KL4 A;  1WH6 A;  2R63 A;  4MCX A;  4Z5C A;  3GZC A;  5A7L A;  3OQM A;  3QQ6 A;  1LMB 3;  4Y42 A;  4PU4 C;  2PUG A;  1ZPQ A;  1ZVV A;  1R69 A;  3BD1 A;  2EBY A;  2ICP A;  3VK0 A;  4Q2J A;  2LYL A;  3O9X A;  2WIU B;  2LCV A;  4GQM A;  2KEI A;  1DWK A;  1UTX A;  4I6R A;  1ZAY A;  4YBA A;  3PE5 A;  4IA8 A;  3QWG A;  1YSE A;  4ER6 A;  1GT0 C;  1X57 A;  2AXZ A;  1LCD A;  3HZI B;  3ZKC A;  1ZZ9 A;  3LQX A;  1OCT C;  1U2Z A;  2BNO A;  3F52 A;  1QP4 A;  1PRU A;  4YG1 A;  2PE5 A;  3CEC A;  4I6T A;  4PU3 C;  1R63 A;  2H8R A;  3KXA A;  3NDB B;  4X4H A;  4Z5H A;  3JXB C;  2HSG A;  5GAH i;  4I8T A;  4NDW A;  4EKI A;  1SQ8 A;  1JFT A;  3BS3 A;  3B7H A;  2PXL A;  1CQT A;  2O49 A;  4IVZ A;  1QQB A;  1IC8 A;  3GZD A;  2JVL A;  1BDI A;  4J1W A;  2PXE A;  4DE8 A;  4PU7 A;  2OR1 L;  3QOW A;  3NXH A;  3RZZ A;  2PUF A;  5DTQ A;  3GUU A;  3TFL A;  2PXV A;  5DRT A;  2PXF A;  2AXV A;  5JUW A;  3VWS A;  4F8D A;  3JXC L;  2KEK A;  4J1X A;  4Z5D A;  3H5T A;  3GZD C;  5K98 B;  1PRA A;  2LYS A;  1LCC A;  3M9L A;  4OBM A;  4YG4 A;  4X4C A;  2FJR A;  4YAR A;  1RZR A;  2IUO A;  2IV1 A;  3R09 A;  1BDH A;  3U3W A;  3OWQ A;  2LNM A;  1NER A;  2O38 A;  4FN3 A;  1MFQ C;  1RZS A;  3CRO L; 
#chains in the Genus database with same CATH homology
 3QWG A;  2KEJ A;  2PIJ A;  4PU8 A;  1ZZC A;  3QF3 A;  1YSE A;  3R1F A;  1VPW A;  2OFY A;  4X4B A;  2A6C A;  1GT0 C;  1X57 A;  3D1N I;  3F6W A;  2AXZ A;  2B5A A;  2GRL A;  3MLF A;  1UXD A;  1LCD A;  3SCH A;  1LQC A;  3G5G A;  3HZI B;  1ADR A;  2CSF A;  2LYP A;  1LLI A;  3PXP A;  3QYX A;  1L1M A;  3FMY A;  3ZKC A;  1ZZ9 A;  1OCT C;  2XCJ A;  1ZZ8 A;  2BNO A;  4Z59 A;  1JFS A;  3TRB A;  1PNR A;  1ZZB A;  2MEZ A;  3SCG A;  3KJX A;  3F52 A;  2D5V A;  3KZ3 A;  2WUS R;  1PRU A;  1OSL A;  1QP4 A;  4YG1 A;  3EUS A;  3CEC A;  2PE5 A;  2PUD A;  2PUA A;  2KPJ A;  4I6T A;  2EF8 A;  1QPZ A;  2KZ8 A;  2ICT A;  1Y9Q A;  4X4G A;  4PU3 C;  1R63 A;  1ZZ7 A;  2EWT A;  3OP9 A;  2H8R A;  3KXA A;  4X4I A;  3G7D A;  2GZU A;  4X4H A;  4Z5H A;  3JXB C;  2XSD C;  1CJG A;  2HSG A;  1PER L;  2IVQ A;  1NEQ A;  1AU7 A;  4I8T A;  4NDW A;  2JCG A;  3FYM A;  3SCF A;  3ZHI A;  1SQ8 A;  3BDN A;  1RPE L;  2O4A A;  3LFP A;  2XJ3 A;  1JFT A;  3ZHM A;  1S7E A;  3L1P A;  3BS3 A;  1X2L A;  3OMT A;  3B7H A;  3S8Q A;  1CQT A;  2PUB A;  1POU A;  3CLC A;  4X4D A;  2O49 A;  2AWI A;  1DW9 A;  4IVZ A;  2AXU A;  1QQB A;  1ZZ6 A;  1IC8 A;  4YG7 B;  2JVL A;  1BDI A;  4J1W A;  3GBF A;  4IWR A;  4PU7 A;  2AUW A;  3FYA A;  2HIN A;  1WIZ A;  2OR1 L;  3LIS A;  1QQA A;  1ZUG A;  1B0N A;  1RZR D;  3RZZ A;  2BNN A;  4MCT A;  2R1J L;  3GN5 B;  1WH8 A;  4JQD A;  4JCX A;  2PUF A;  1RIO A;  4OB4 A;  2GRM A;  4GHJ A;  1HF0 A;  3IVP A;  2CRO A;  4X4F A;  4Z58 A;  2LYJ A;  2IVB A;  2PPX A;  2PUE A;  1O4X A;  3GN5 A;  1WH6 A;  1Y7Y A;  2R63 A;  4MCX A;  4Z5C A;  2AXV A;  4F8D A;  1QP0 A;  2AW6 A;  5A7L A;  3OQM A;  3JXC L;  3QQ6 A;  1LMB 3;  4X4E A;  2BJC A;  4Y42 A;  2XI8 A;  4PU4 C;  2PUG A;  1ZPQ A;  2BNM A;  4O8B A;  1ZVV A;  4JCY A;  1R69 A;  2KEK A;  4J1X A;  4Z5D A;  1JH9 A;  3H5T A;  1EFA A;  3BD1 A;  5K98 B;  2L49 A;  1PRA A;  2LYS A;  2EBY A;  1QP7 A;  1UXC A;  2ICP A;  3VK0 A;  3OQN A;  1LCC A;  4YG4 A;  4X4C A;  2LYL A;  4FBI A;  2FJR A;  3O9X A;  2MQK A;  4YAR A;  3OQO A;  2WIU B;  2LCV A;  4GQM A;  4I6U A;  2KEI A;  2IUO A;  2IV1 A;  2LYR A;  1RZR A;  1JWL A;  1BDH A;  2L8N A;  3UFD A;  1DWK A;  3U3W A;  2LYK A;  1XWR A;  3DNV B;  2PUC A;  1UTX A;  1WET A;  1PRV A;  1NER A;  2IU7 A;  2O38 A;  1ZS4 A;  4FN3 A;  2XIU A;  1E3O C;  2IVG A;  2LYQ A;  4I6R A;  1RZS A;  3F51 A;  4YBA A;  1ZAY A;  3CRO L;  3JXD L;  4IA8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...