4Z5DA

Hipb-o4 21mer complex
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
71
structure length
71
Chain Sequence
FQKIYSPTQLANAMKLVRQQNGWTQSELAKKIGIKQATISNFENNPDNTTLTTFFKILQSLELSMTLCDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular mechanism on hipBA gene regulation.
rcsb
source organism Escherichia coli
molecule tags Transcription/dna
molecule keywords Antitoxin HipB
total genus 23
structure length 71
sequence length 71
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 4z5dA00
1LMB3 3GN5A 1ZZBA 3L1PA 2L8NA 3H5TA 4X4EA 3EUSA 1ZZ7A 2AXVA 3QWGA 2BNMA 2XJ3A 3ZKCA 3G5GA 2PE5A 1ZVVA 3OP9A 1UXDA 3MLFA 4X4IA 2CROA 2IVQA 1ZZ9A 1NEQA 2WUSR 1PNRA 4PU7A 2O38A 2WIUB 4Z59A 3UFDA 2EF8A 4IA8A 4OB4A 3B7HA 4I8TA 4YG7B 2IVGA 2MQKA 4I6UA 3OMTA 2HSGA 3SCHA 3IVPA 1ZPQA 2GRMA 3CROL 2GRLA 2JVLA 1R63A 2IU7A 2LYPA 4Z5DA 4YG4A 3OQNA 2KEIA 5A7LA 1HF0A 3QQ6A 1QQAA 4GHJA 1NERA 4X4FA 3PXPA 1XWRA 1ADRA 1X2LA 3ZHIA 2KEJA 2LCVA 3BS3A 1O4XA 1OCTC 3FMYA 1QP4A 2KZ8A 2JCGA 4FN3A 1ZZ8A 1X57A 3CLCA 1PERL 4MCXA 1LQCA 4X4CA 3DNVB 1BDHA 1ZZ6A 2CSFA 3FYMA 1VPWA 4Z58A 3O9XA 2OFYA 1R69A 1QP0A 2LYSA 2LYKA 3TRBA 4PU8A 1IC8A 4JCXA 1RZRD 1RIOA 2H8RA 2PUBA 3OQMA 2KPJA 3JXDL 3SCFA 2ICTA 4NDWA 3QYXA 1AU7A 3BDNA 2GZUA 1ZAYA 1DW9A 1JFSA 2PUFA 1PRUA 1QP7A 3U3WA 4YARA 4X4DA 2LYQA 4YBAA 3GBFA 4Y42A 4Z5HA 3GN5B 1CJGA 1L1MA 1QQBA 1LCCA 2ICPA 1POUA 3F6WA 4YG1A 1QPZA 1WH6A 3QF3A 1UXCA 1B0NA 1WIZA 4MCTA 2MEZA 3VK0A 3D1NI 1JH9A 1Y7YA 2PUDA 4JCYA 2BNNA 4X4GA 1WETA 1RZRA 1S7EA 2LYJA 2IV1A 2PUGA 1UTXA 1PRVA 4X4BA 3OQOA 1DWKA 2PPXA 3KJXA 2EBYA 1OSLA 2XCJA 4I6RA 4IVZA 2HINA 2IUOA 1ZZCA 1Y9QA 4J1WA 1JWLA 3JXCL 3LFPA 2R1JL 3BD1A 2AW6A 3RZZA 4PU3C 1SQ8A 2AUWA 1CQTA 4X4HA 2A6CA 3KZ3A 2IVBA 2LYRA 4GQMA 4F8DA 1GT0C 2BJCA 2AXZA 1YSEA 2L49A 3CECA 5K98B 3S8QA 4JQDA 4J1XA 3FYAA 1PRAA 4I6TA 2PIJA 3JXBC 2OR1L 2FJRA 2D5VA 3LISA 3F51A 1ZUGA 2LYLA 3F52A 2B5AA 2XSDC 3KXAA 3HZIB 2EWTA 1EFAA 2AWIA 4FBIA 1LLIA 3SCGA 2XIUA 2O4AA 1ZS4A 1JFTA 2R63A 1BDIA 3G7DA 1RZSA 4O8BA 2PUCA 1WH8A 3ZHMA 1E3OC 1RPEL 3R1FA 4PU4C 2PUEA 4Z5CA 2BNOA 4IWRA 2AXUA 2O49A 2XI8A 2KEKA 1LCDA 2PUAA
chains in the Genus database with same CATH superfamily
3TEPA 3L1PA 3H5TA 3EUSA 1ZVVA 3G5GA 2J7WA 3MLFA 2CROA 4EKGA 1NEQA 1PNRA 2WIUB 4EZIA 4ER3A 2MXDA 3IVPA 1ZPQA 3CROL 2JVLA 1R63A 4IWRA 2KEIA 1NERA 3PXPA 1XWRA 3ZHIA 3FMYA 1QP4A 2YBDA 1ZZ8A 1X57A 3A9YA 3DNVB 4DE8A 3FYMA 1U2ZA 3ME5A 2LYSA 1RIOA 2XXPA 4ER6A 2GZUA 1JFSA 1PRUA 2ODRD 4DE9A 4X4DA 2LYQA 1L1MA 1QPZA 3NROA 3QF3A 1B0NA 1WIZA 2HCNA 1JH9A 4JCYA 1UTXA 5DSXA 2IUOA 1ZZCA 1Y9QA 5DT2A 3A9ZA 2J7UA 1SQ8A 2A6CA 2LYRA 2BJCA 4I6TA 2PIJA 2FJRA 5GAHi 3F51A 2LYLA 3F52A 2B5AA 2XSDC 2L1PA 2PXEA 2R63A 1RZSA 3R1FA 4PU4C 2O49A 2KEKA 1LCDA 3PE5A 2PUAA 1LMB3 1ZZBA 4X4EA 3QWGA 1ZZ7A 2AXVA 2BNMA 2XJ3A 2PE5A 1ZZ9A 4PU7A 2O38A 4IA8A 4OB4A 2HSGA 4Q2JA 1HQ1A 3SCHA 3MEJA 3OQNA 2LNMA 2IU7A 4YG4A 5A7LA 3QQ6A 3NZLA 2V3CC 1ADRA 3A9XA 3BS3A 4FN3A 3TFLA 1PERL 1LQCA 4X4CA 2CSFA 4Z58A 3M9LA 3QFIA 1QP0A 2LYKA 3TRBA 4EQZA 3JXDL 2ICTA 3QYXA 1DW9A 2PUFA 4YARA 3GBFA 3GN5B 1QQBA 2ICPA 2XXQA 1WH6A 4MCTA 3VK0A 2BNNA 4X4GA 2IV1A 5GAGi 1PRVA 3KJXA 2XCJA 2R1JL 1MFQC 3NDBB 2IVBA 4GQMA 4F8DA 1GT0C 3CECA 2PXFA 4JQDA 2OR1L 1ZUGA 1QZXA 5DRYA 3HZIB 1EFAA 2AWIA 4FBIA 3SCGA 2O4AA 1BDIA 3ZHMA 1RPEL 4Z5CA 3GZDC 2BNOA 3G0TA 5DTMA 1UXDA 2PXKA 3QOXA 2IVQA 2PXPA 2LLVA 3SR4A 3B7HA 4YG7B 4I6UA 3OMTA 2LYPA 4Z5DA 2XXAA 4X4FA 1X2LA 1NW3A 2LCVA 3KL4A 1O4XA 3NXHA 3CLCA 1ZZ6A 1DULA 1VPWA 1R69A 4PU8A 2PUBA 3OQMA 3DM5A 2LLWA 3SCFA 3BDNA 4EKIA 5DTRA 1QP7A 3OWQA 4YBAA 4Z5HA 1CJGA 2PXUA 3F6WA 4YG1A 1UXCA 2MEZA 3D1NI 2PUDA 1WETA 1S7EA 2LYJA 2PUGA 1QB2A 4HRAA 5JUWA 4X4BA 3OQOA 1DWKA 2EBYA 4I6RA 2HINA 3GZCA 3BD1A 3QOWA 1CQTA 2PXQA 3KZ3A 2AXZA 2L49A 3S8QA 2HCSA 3ZPXA 3JXBC 4OBMA 4ER7A 3UWPA 3KXAA 2EWTA 2XIUA 1ZS4A 2FFHA 3G7DA 2PUCA 1WH8A 1E3OC 3LQXA 3GZDA 2AXUA 2XI8A 2PUEA 3GN5A 2L8NA 3ZKCA 3OP9A 4X4IA 2WUSR 4Z59A 3UFDA 2EF8A 4I8TA 2IVGA 2MQKA 2JQEA 2GRMA 2HFZA 2GRLA 3TELA 1QQAA 1HF0A 2PXLA 4GHJA 2KEJA 1OCTC 2KZ8A 2JCGA 3OKZA 4MCXA 1BDHA 3O9XA 3GUUA 2OFYA 2PXDA 4EK9A 4JCXA 1IC8A 1RZRD 2H8RA 4ER0A 2KPJA 2PXVA 4NDWA 1AU7A 1ZAYA 5DRTA 3U3WA 4Y42A 2M4HA 1LCCA 1POUA 3R09A 1Y7YA 3SX0A 1RZRA 2PPXA 4ER5A 1OSLA 4IVZA 4J1WA 1JWLA 3JXCL 3LFPA 2AW6A 3RZZA 2PXBA 4PU3C 4WVLA 2AUWA 2PXTA 4X4HA 1YSEA 5K98B 4J1XA 3FYAA 1PRAA 2D5VA 3LISA 1LLIA 1JFTA 4O8BA 5DTQA 2VEOA 3VWSA
chains in the Genus database with same CATH topology
1LMB3 3GN5A 1ZZBA 3L1PA 2L8NA 3H5TA 4X4EA 3EUSA 1ZZ7A 2AXVA 3QWGA 2BNMA 2XJ3A 3ZKCA 3G5GA 2PE5A 1ZVVA 3OP9A 1UXDA 3MLFA 4X4IA 2CROA 2IVQA 1ZZ9A 1NEQA 2WUSR 1PNRA 4PU7A 2O38A 2WIUB 4Z59A 3UFDA 2EF8A 4IA8A 4OB4A 3B7HA 4I8TA 4YG7B 2IVGA 2MQKA 4I6UA 3OMTA 2HSGA 3SCHA 3IVPA 1ZPQA 2GRMA 3CROL 2GRLA 2JVLA 1R63A 2IU7A 2LYPA 4Z5DA 4YG4A 3OQNA 2KEIA 5A7LA 1HF0A 3QQ6A 1QQAA 4GHJA 1NERA 4X4FA 3PXPA 1XWRA 1ADRA 1X2LA 3ZHIA 2KEJA 2LCVA 3BS3A 1O4XA 1OCTC 3FMYA 1QP4A 2KZ8A 2JCGA 4FN3A 1ZZ8A 1X57A 3CLCA 1PERL 4MCXA 1LQCA 4X4CA 3DNVB 1BDHA 1ZZ6A 2CSFA 3FYMA 1VPWA 4Z58A 3O9XA 2OFYA 1R69A 1QP0A 2LYSA 2LYKA 3TRBA 4PU8A 1IC8A 4JCXA 1RZRD 1RIOA 2H8RA 2PUBA 3OQMA 2KPJA 3JXDL 3SCFA 2ICTA 4NDWA 3QYXA 1AU7A 3BDNA 2GZUA 1ZAYA 1DW9A 1JFSA 2PUFA 1PRUA 1QP7A 3U3WA 4YARA 4X4DA 2LYQA 4YBAA 3GBFA 4Y42A 4Z5HA 3GN5B 1CJGA 1L1MA 1QQBA 1LCCA 2ICPA 1POUA 3F6WA 4YG1A 1QPZA 1WH6A 3QF3A 1UXCA 1B0NA 1WIZA 4MCTA 2MEZA 3VK0A 3D1NI 1JH9A 1Y7YA 2PUDA 4JCYA 2BNNA 4X4GA 1WETA 1RZRA 1S7EA 2LYJA 2IV1A 2PUGA 1UTXA 1PRVA 4X4BA 3OQOA 1DWKA 2PPXA 3KJXA 2EBYA 1OSLA 2XCJA 4I6RA 4IVZA 2HINA 2IUOA 1ZZCA 1Y9QA 4J1WA 1JWLA 3JXCL 3LFPA 2R1JL 3BD1A 2AW6A 3RZZA 4PU3C 1SQ8A 2AUWA 1CQTA 4X4HA 2A6CA 3KZ3A 2IVBA 2LYRA 4GQMA 4F8DA 1GT0C 2BJCA 2AXZA 1YSEA 2L49A 3CECA 5K98B 3S8QA 4JQDA 4J1XA 3FYAA 1PRAA 4I6TA 2PIJA 3JXBC 2OR1L 2FJRA 2D5VA 3LISA 3F51A 1ZUGA 2LYLA 3F52A 2B5AA 2XSDC 3KXAA 3HZIB 2EWTA 1EFAA 2AWIA 4FBIA 1LLIA 3SCGA 2XIUA 2O4AA 1ZS4A 1JFTA 2R63A 1BDIA 3G7DA 1RZSA 4O8BA 2PUCA 1WH8A 3ZHMA 1E3OC 1RPEL 3R1FA 4PU4C 2PUEA 4Z5CA 2BNOA 4IWRA 2AXUA 2O49A 2XI8A 2KEKA 1LCDA 2PUAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LMB 3;  3GN5 A;  1ZZB A;  3L1P A;  2L8N A;  3H5T A;  4X4E A;  3EUS A;  1ZZ7 A;  2AXV A;  3QWG A;  2BNM A;  2XJ3 A;  3ZKC A;  3G5G A;  2PE5 A;  1ZVV A;  3OP9 A;  1UXD A;  3MLF A;  4X4I A;  2CRO A;  2IVQ A;  1ZZ9 A;  1NEQ A;  2WUS R;  1PNR A;  4PU7 A;  2O38 A;  2WIU B;  4Z59 A;  3UFD A;  2EF8 A;  4IA8 A;  4OB4 A;  3B7H A;  4I8T A;  4YG7 B;  2IVG A;  2MQK A;  4I6U A;  3OMT A;  2HSG A;  3SCH A;  3IVP A;  1ZPQ A;  2GRM A;  3CRO L;  2GRL A;  2JVL A;  1R63 A;  2IU7 A;  2LYP A;  4Z5D A;  4YG4 A;  3OQN A;  2KEI A;  5A7L A;  1HF0 A;  3QQ6 A;  1QQA A;  4GHJ A;  1NER A;  4X4F A;  3PXP A;  1XWR A;  1ADR A;  1X2L A;  3ZHI A;  2KEJ A;  2LCV A;  3BS3 A;  1O4X A;  1OCT C;  3FMY A;  1QP4 A;  2KZ8 A;  2JCG A;  4FN3 A;  1ZZ8 A;  1X57 A;  3CLC A;  1PER L;  4MCX A;  1LQC A;  4X4C A;  3DNV B;  1BDH A;  1ZZ6 A;  2CSF A;  3FYM A;  1VPW A;  4Z58 A;  3O9X A;  2OFY A;  1R69 A;  1QP0 A;  2LYS A;  2LYK A;  3TRB A;  4PU8 A;  1IC8 A;  4JCX A;  1RZR D;  1RIO A;  2H8R A;  2PUB A;  3OQM A;  2KPJ A;  3JXD L;  3SCF A;  2ICT A;  4NDW A;  3QYX A;  1AU7 A;  3BDN A;  2GZU A;  1ZAY A;  1DW9 A;  1JFS A;  2PUF A;  1PRU A;  1QP7 A;  3U3W A;  4YAR A;  4X4D A;  2LYQ A;  4YBA A;  3GBF A;  4Y42 A;  4Z5H A;  3GN5 B;  1CJG A;  1L1M A;  1QQB A;  1LCC A;  2ICP A;  1POU A;  3F6W A;  4YG1 A;  1QPZ A;  1WH6 A;  3QF3 A;  1UXC A;  1B0N A;  1WIZ A;  4MCT A;  2MEZ A;  3VK0 A;  3D1N I;  1JH9 A;  1Y7Y A;  2PUD A;  4JCY A;  2BNN A;  4X4G A;  1WET A;  1RZR A;  1S7E A;  2LYJ A;  2IV1 A;  2PUG A;  1UTX A;  1PRV A;  4X4B A;  3OQO A;  1DWK A;  2PPX A;  3KJX A;  2EBY A;  1OSL A;  2XCJ A;  4I6R A;  4IVZ A;  2HIN A;  2IUO A;  1ZZC A;  1Y9Q A;  4J1W A;  1JWL A;  3JXC L;  3LFP A;  2R1J L;  3BD1 A;  2AW6 A;  3RZZ A;  4PU3 C;  1SQ8 A;  2AUW A;  1CQT A;  4X4H A;  2A6C A;  3KZ3 A;  2IVB A;  2LYR A;  4GQM A;  4F8D A;  1GT0 C;  2BJC A;  2AXZ A;  1YSE A;  2L49 A;  3CEC A;  5K98 B;  3S8Q A;  4JQD A;  4J1X A;  3FYA A;  1PRA A;  4I6T A;  2PIJ A;  3JXB C;  2OR1 L;  2FJR A;  2D5V A;  3LIS A;  3F51 A;  1ZUG A;  2LYL A;  3F52 A;  2B5A A;  2XSD C;  3KXA A;  3HZI B;  2EWT A;  1EFA A;  2AWI A;  4FBI A;  1LLI A;  3SCG A;  2XIU A;  2O4A A;  1ZS4 A;  1JFT A;  2R63 A;  1BDI A;  3G7D A;  1RZS A;  4O8B A;  2PUC A;  1WH8 A;  3ZHM A;  1E3O C;  1RPE L;  3R1F A;  4PU4 C;  2PUE A;  4Z5C A;  2BNO A;  4IWR A;  2AXU A;  2O49 A;  2XI8 A;  2KEK A;  1LCD A;  2PUA A; 
#chains in the Genus database with same CATH topology
 3TEP A;  3L1P A;  3H5T A;  3EUS A;  1ZVV A;  3G5G A;  2J7W A;  3MLF A;  2CRO A;  4EKG A;  1NEQ A;  1PNR A;  2WIU B;  4EZI A;  4ER3 A;  2MXD A;  3IVP A;  1ZPQ A;  3CRO L;  2JVL A;  1R63 A;  4IWR A;  2KEI A;  1NER A;  3PXP A;  1XWR A;  3ZHI A;  3FMY A;  1QP4 A;  2YBD A;  1ZZ8 A;  1X57 A;  3A9Y A;  3DNV B;  4DE8 A;  3FYM A;  1U2Z A;  3ME5 A;  2LYS A;  1RIO A;  2XXP A;  4ER6 A;  2GZU A;  1JFS A;  1PRU A;  2ODR D;  4DE9 A;  4X4D A;  2LYQ A;  1L1M A;  1QPZ A;  3NRO A;  3QF3 A;  1B0N A;  1WIZ A;  2HCN A;  1JH9 A;  4JCY A;  1UTX A;  5DSX A;  2IUO A;  1ZZC A;  1Y9Q A;  5DT2 A;  3A9Z A;  2J7U A;  1SQ8 A;  2A6C A;  2LYR A;  2BJC A;  4I6T A;  2PIJ A;  2FJR A;  5GAH i;  3F51 A;  2LYL A;  3F52 A;  2B5A A;  2XSD C;  2L1P A;  2PXE A;  2R63 A;  1RZS A;  3R1F A;  4PU4 C;  2O49 A;  2KEK A;  1LCD A;  3PE5 A;  2PUA A;  1LMB 3;  1ZZB A;  4X4E A;  3QWG A;  1ZZ7 A;  2AXV A;  2BNM A;  2XJ3 A;  2PE5 A;  1ZZ9 A;  4PU7 A;  2O38 A;  4IA8 A;  4OB4 A;  2HSG A;  4Q2J A;  1HQ1 A;  3SCH A;  3MEJ A;  3OQN A;  2LNM A;  2IU7 A;  4YG4 A;  5A7L A;  3QQ6 A;  3NZL A;  2V3C C;  1ADR A;  3A9X A;  3BS3 A;  4FN3 A;  3TFL A;  1PER L;  1LQC A;  4X4C A;  2CSF A;  4Z58 A;  3M9L A;  3QFI A;  1QP0 A;  2LYK A;  3TRB A;  4EQZ A;  3JXD L;  2ICT A;  3QYX A;  1DW9 A;  2PUF A;  4YAR A;  3GBF A;  3GN5 B;  1QQB A;  2ICP A;  2XXQ A;  1WH6 A;  4MCT A;  3VK0 A;  2BNN A;  4X4G A;  2IV1 A;  5GAG i;  1PRV A;  3KJX A;  2XCJ A;  2R1J L;  1MFQ C;  3NDB B;  2IVB A;  4GQM A;  4F8D A;  1GT0 C;  3CEC A;  2PXF A;  4JQD A;  2OR1 L;  1ZUG A;  1QZX A;  5DRY A;  3HZI B;  1EFA A;  2AWI A;  4FBI A;  3SCG A;  2O4A A;  1BDI A;  3ZHM A;  1RPE L;  4Z5C A;  3GZD C;  2BNO A;  3G0T A;  5DTM A;  1UXD A;  2PXK A;  3QOX A;  2IVQ A;  2PXP A;  2LLV A;  3SR4 A;  3B7H A;  4YG7 B;  4I6U A;  3OMT A;  2LYP A;  4Z5D A;  2XXA A;  4X4F A;  1X2L A;  1NW3 A;  2LCV A;  3KL4 A;  1O4X A;  3NXH A;  3CLC A;  1ZZ6 A;  1DUL A;  1VPW A;  1R69 A;  4PU8 A;  2PUB A;  3OQM A;  3DM5 A;  2LLW A;  3SCF A;  3BDN A;  4EKI A;  5DTR A;  1QP7 A;  3OWQ A;  4YBA A;  4Z5H A;  1CJG A;  2PXU A;  3F6W A;  4YG1 A;  1UXC A;  2MEZ A;  3D1N I;  2PUD A;  1WET A;  1S7E A;  2LYJ A;  2PUG A;  1QB2 A;  4HRA A;  5JUW A;  4X4B A;  3OQO A;  1DWK A;  2EBY A;  4I6R A;  2HIN A;  3GZC A;  3BD1 A;  3QOW A;  1CQT A;  2PXQ A;  3KZ3 A;  2AXZ A;  2L49 A;  3S8Q A;  2HCS A;  3ZPX A;  3JXB C;  4OBM A;  4ER7 A;  3UWP A;  3KXA A;  2EWT A;  2XIU A;  1ZS4 A;  2FFH A;  3G7D A;  2PUC A;  1WH8 A;  1E3O C;  3LQX A;  3GZD A;  2AXU A;  2XI8 A;  2PUE A;  3GN5 A;  2L8N A;  3ZKC A;  3OP9 A;  4X4I A;  2WUS R;  4Z59 A;  3UFD A;  2EF8 A;  4I8T A;  2IVG A;  2MQK A;  2JQE A;  2GRM A;  2HFZ A;  2GRL A;  3TEL A;  1QQA A;  1HF0 A;  2PXL A;  4GHJ A;  2KEJ A;  1OCT C;  2KZ8 A;  2JCG A;  3OKZ A;  4MCX A;  1BDH A;  3O9X A;  3GUU A;  2OFY A;  2PXD A;  4EK9 A;  4JCX A;  1IC8 A;  1RZR D;  2H8R A;  4ER0 A;  2KPJ A;  2PXV A;  4NDW A;  1AU7 A;  1ZAY A;  5DRT A;  3U3W A;  4Y42 A;  2M4H A;  1LCC A;  1POU A;  3R09 A;  1Y7Y A;  3SX0 A;  1RZR A;  2PPX A;  4ER5 A;  1OSL A;  4IVZ A;  4J1W A;  1JWL A;  3JXC L;  3LFP A;  2AW6 A;  3RZZ A;  2PXB A;  4PU3 C;  4WVL A;  2AUW A;  2PXT A;  4X4H A;  1YSE A;  5K98 B;  4J1X A;  3FYA A;  1PRA A;  2D5V A;  3LIS A;  1LLI A;  1JFT A;  4O8B A;  5DTQ A;  2VEO A;  3VWS A; 
#chains in the Genus database with same CATH homology
 1LMB 3;  3GN5 A;  1ZZB A;  3L1P A;  2L8N A;  3H5T A;  4X4E A;  3EUS A;  1ZZ7 A;  2AXV A;  3QWG A;  2BNM A;  2XJ3 A;  3ZKC A;  3G5G A;  2PE5 A;  1ZVV A;  3OP9 A;  1UXD A;  3MLF A;  4X4I A;  2CRO A;  2IVQ A;  1ZZ9 A;  1NEQ A;  2WUS R;  1PNR A;  4PU7 A;  2O38 A;  2WIU B;  4Z59 A;  3UFD A;  2EF8 A;  4IA8 A;  4OB4 A;  3B7H A;  4I8T A;  4YG7 B;  2IVG A;  2MQK A;  4I6U A;  3OMT A;  2HSG A;  3SCH A;  3IVP A;  1ZPQ A;  2GRM A;  3CRO L;  2GRL A;  2JVL A;  1R63 A;  2IU7 A;  2LYP A;  4Z5D A;  4YG4 A;  3OQN A;  2KEI A;  5A7L A;  1HF0 A;  3QQ6 A;  1QQA A;  4GHJ A;  1NER A;  4X4F A;  3PXP A;  1XWR A;  1ADR A;  1X2L A;  3ZHI A;  2KEJ A;  2LCV A;  3BS3 A;  1O4X A;  1OCT C;  3FMY A;  1QP4 A;  2KZ8 A;  2JCG A;  4FN3 A;  1ZZ8 A;  1X57 A;  3CLC A;  1PER L;  4MCX A;  1LQC A;  4X4C A;  3DNV B;  1BDH A;  1ZZ6 A;  2CSF A;  3FYM A;  1VPW A;  4Z58 A;  3O9X A;  2OFY A;  1R69 A;  1QP0 A;  2LYS A;  2LYK A;  3TRB A;  4PU8 A;  1IC8 A;  4JCX A;  1RZR D;  1RIO A;  2H8R A;  2PUB A;  3OQM A;  2KPJ A;  3JXD L;  3SCF A;  2ICT A;  4NDW A;  3QYX A;  1AU7 A;  3BDN A;  2GZU A;  1ZAY A;  1DW9 A;  1JFS A;  2PUF A;  1PRU A;  1QP7 A;  3U3W A;  4YAR A;  4X4D A;  2LYQ A;  4YBA A;  3GBF A;  4Y42 A;  4Z5H A;  3GN5 B;  1CJG A;  1L1M A;  1QQB A;  1LCC A;  2ICP A;  1POU A;  3F6W A;  4YG1 A;  1QPZ A;  1WH6 A;  3QF3 A;  1UXC A;  1B0N A;  1WIZ A;  4MCT A;  2MEZ A;  3VK0 A;  3D1N I;  1JH9 A;  1Y7Y A;  2PUD A;  4JCY A;  2BNN A;  4X4G A;  1WET A;  1RZR A;  1S7E A;  2LYJ A;  2IV1 A;  2PUG A;  1UTX A;  1PRV A;  4X4B A;  3OQO A;  1DWK A;  2PPX A;  3KJX A;  2EBY A;  1OSL A;  2XCJ A;  4I6R A;  4IVZ A;  2HIN A;  2IUO A;  1ZZC A;  1Y9Q A;  4J1W A;  1JWL A;  3JXC L;  3LFP A;  2R1J L;  3BD1 A;  2AW6 A;  3RZZ A;  4PU3 C;  1SQ8 A;  2AUW A;  1CQT A;  4X4H A;  2A6C A;  3KZ3 A;  2IVB A;  2LYR A;  4GQM A;  4F8D A;  1GT0 C;  2BJC A;  2AXZ A;  1YSE A;  2L49 A;  3CEC A;  5K98 B;  3S8Q A;  4JQD A;  4J1X A;  3FYA A;  1PRA A;  4I6T A;  2PIJ A;  3JXB C;  2OR1 L;  2FJR A;  2D5V A;  3LIS A;  3F51 A;  1ZUG A;  2LYL A;  3F52 A;  2B5A A;  2XSD C;  3KXA A;  3HZI B;  2EWT A;  1EFA A;  2AWI A;  4FBI A;  1LLI A;  3SCG A;  2XIU A;  2O4A A;  1ZS4 A;  1JFT A;  2R63 A;  1BDI A;  3G7D A;  1RZS A;  4O8B A;  2PUC A;  1WH8 A;  3ZHM A;  1E3O C;  1RPE L;  3R1F A;  4PU4 C;  2PUE A;  4Z5C A;  2BNO A;  4IWR A;  2AXU A;  2O49 A;  2XI8 A;  2KEK A;  1LCD A;  2PUA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...