2ICTA

Crystal structure of the bacterial antitoxin higa from escherichia coli at ph 8.5. northeast structural genomics target er390.
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
94
structure length
94
Chain Sequence
MKMANHPRPGDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQNAWSLAEAEKTVDVSRLRRLVTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Phd-Doc, HigA, and YeeU Establish Multiple Evolutionary Links between Microbial Growth-Regulating Toxin-Antitoxin Systems.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Dna binding protein
molecule keywords antitoxin higa
total genus 26
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2006-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2ictA01
3LFPA 4Z5DA 2O38A 2KEIA 3L1PA 3MLFA 4FBIA 2KEKA 2PUBA 3UFDA 2XIUA 1S7EA 2PUDA 1IC8A 1NERA 1RPEL 4Y42A 4I6UA 1QP0A 2GRLA 2GZUA 3QF3A 4J1WA 2PUAA 1ZZ9A 4JCXA 3F51A 1NEQA 3SCFA 2WUSR 1JFSA 4X4DA 1WH6A 2EF8A 3JXDL 4NDWA 2PUFA 2AWIA 2ICPA 2LYJA 3G7DA 3JXBC 4FN3A 2KEJA 1CQTA 4JQDA 4YBAA 4YG7B 2OR1L 4PU7A 3H5TA 1QPZA 2IV1A 1LQCA 3OMTA 2EBYA 3PXPA 4PU8A 1BDHA 2IUOA 4Z5HA 1POUA 2BNMA 3F52A 1QP7A 4Z5CA 3D1NI 3OQNA 3SCHA 1JH9A 1HF0A 1PERL 2PUEA 1QQBA 4Z58A 1DW9A 5A7LA 4J1XA 3BD1A 3EUSA 1ZZ7A 3O9XA 1OCTC 1UXDA 4X4HA 3CLCA 2LCVA 3SCGA 2IU7A 3QYXA 1EFAA 1WETA 2JCGA 2R63A 1WIZA 1OSLA 1ZUGA 2MEZA 1UXCA 1DWKA 3OQMA 1Y7YA 2B5AA 3KXAA 2AXUA 3FMYA 1CJGA 1ZPQA 3B7HA 2FJRA 2A6CA 2LYSA 1PRUA 1ZZ6A 3ZHIA 1LMB3 2D5VA 2KZ8A 2AUWA 1L1MA 1QQAA 4F8DA 3LISA 1LCDA 3CECA 4YG4A 3U3WA 4X4CA 3OP9A 2IVBA 1XWRA 1ZVVA 2GRMA 2XCJA 4OB4A 4JCYA 3HZIB 2BJCA 2JVLA 3JXCL 1UTXA 2IVQA 2OFYA 1JWLA 4YG1A 1ZS4A 1SQ8A 1PRVA 4GQMA 3RZZA 4X4EA 3DNVB 2O4AA 3GN5A 1RZRD 4IWRA 3FYMA 3BDNA 2PE5A 3G5GA 2L8NA 2H8RA 3F6WA 2PUGA 1YSEA 2EWTA 3QWGA 4YARA 4Z59A 4X4IA 1ZZCA 4GHJA 1RZSA 1WH8A 1X2LA 1ZZBA 3QQ6A 3ZKCA 3ZHMA 2LYLA 3TRBA 1LCCA 1GT0C 4MCTA 2HINA 2PUCA 4O8BA 2KPJA 3CROL 3KZ3A 1PRAA 4IVZA 2BNOA 2L49A 3FYAA 1E3OC 1VPWA 2LYRA 2WIUB 2HSGA 2BNNA 3GBFA 1O4XA 4I8TA 1QP4A 1B0NA 1JFTA 2XI8A 4I6TA 1RZRA 3GN5B 2XSDC 3S8QA 4X4FA 1PNRA 1ZAYA 2R1JL 1X57A 4PU3C 4PU4C 2AXZA 1ZZ8A 3KJXA 3OQOA 4IA8A 1BDIA 2AW6A 3BS3A 1LLIA 2LYKA 2PIJA 2MQKA 4I6RA 3VK0A 2XJ3A 4X4GA 1RIOA 2AXVA 5K98B 1R69A 2ICTA 1AU7A 1ADRA 1Y9QA 1R63A 2CSFA 2LYPA 4X4BA 2LYQA 2O49A 4MCXA 3R1FA 2IVGA 2CROA 2PPXA 3IVPA
chains in the Genus database with same CATH superfamily
4FBIA 2KEKA 1QB2A 1NERA 2PXTA 1QP0A 4J1WA 2PUAA 2EF8A 5DRYA 2PUFA 2KEJA 1CQTA 4YBAA 4YG7B 1QPZA 2ODRD 3OMTA 4DE8A 3F52A 1QP7A 3D1NI 3OQNA 1JH9A 3M9LA 5DTMA 3BD1A 1ZZ7A 3O9XA 3R09A 2LCVA 3TELA 1WETA 2R63A 1OSLA 1HQ1A 1DWKA 3OQMA 1Y7YA 1LMB3 2FJRA 3ZHIA 2LYSA 2KZ8A 2IVBA 4JCYA 2HCSA 2JVLA 2FFHA 2OFYA 4OBMA 3LQXA 1PRVA 4X4EA 4ER6A 2L8NA 2H8RA 1NW3A 4Z59A 4X4IA 1WH8A 2HFZA 2J7UA 3CROL 3KZ3A 2BNOA 2L49A 3FYAA 1E3OC 2BNNA 1JFTA 2XI8A 3GN5B 1ZAYA 2LLVA 2R1JL 3GZDC 3SR4A 1MFQC 2PIJA 2MQKA 4I6RA 5K98B 1AU7A 2CSFA 4X4CA 2CROA 2PPXA 3IVPA 3LFPA 4Z5DA 2PUBA 3UFDA 2J7WA 1RPEL 3QF3A 1NEQA 3SCFA 2WUSR 1WH6A 2LYJA 4JQDA 3H5TA 1LQCA 2MXDA 1BDHA 4ER3A 4Z5HA 4Z5CA 1PERL 4Q2JA 4Z58A 3EUSA 4EKIA 3QYXA 1ZUGA 1UXCA 2V3CC 2A6CA 1PRUA 1ZZ6A 2AUWA 1QQAA 4F8DA 3U3WA 1QZXA 3OP9A 1ZVVA 1XWRA 2GRMA 5GAGi 2BJCA 3NXHA 1UTXA 2IVQA 1JWLA 3PE5A 1ZS4A 3RZZA 2JQEA 3G5GA 2PXUA 3F6WA 3VWSA 4YARA 1ZZCA 1ZZBA 1LCCA 2LYRA 3GBFA 1O4XA 1QP4A 1B0NA 4I6TA 1RZRA 2XSDC 2IVGA 2L1PA 2AW6A 3BS3A 2LYKA 4ER0A 3QOWA 3A9YA 1RIOA 1R69A 2ICTA 4MCXA 2O38A 2XXQA 1S7EA 1IC8A 2XXPA 4Y42A 4I6UA 2GZUA 1ZZ9A 2VEOA 4X4DA 3G7DA 3KL4A 4PU7A 4EK9A 2PXKA 2IV1A 3ME5A 4PU8A 3A9XA 3OWQA 1POUA 2BNMA 3UWPA 1HF0A 2PUEA 1QQBA 3OKZA 1DW9A 3A9ZA 5A7LA 4J1XA 1OCTC 1UXDA 2PXPA 3SCGA 3MEJA 2MEZA 2XXAA 3KXAA 1ZPQA 1L1MA 3LISA 3CECA 2XCJA 4OB4A 4WVLA 3JXCL 4GQMA 3NROA 2O4AA 3TFLA 1RZRD 4IWRA 3FYMA 2PUGA 1YSEA 3QWGA 5DRTA 1DULA 1X2LA 3ZKCA 4ER7A 3GZDA 3TRBA 4MCTA 2HINA 2PXDA 2KPJA 1PRAA 3DM5A 1VPWA 4EQZA 2HSGA 4I8TA 4EKGA 4X4FA 2AXZA 1ZZ8A 3KJXA 1LLIA 3G0TA 5GAHi 2XJ3A 4X4GA 1ADRA 1Y9QA 2LYPA 2LYQA 2PXLA 2KEIA 3L1PA 3MLFA 2HCNA 2XIUA 2PUDA 2GRLA 4JCXA 3F51A 3GZCA 1JFSA 2PXQA 4EZIA 3JXDL 4NDWA 2AWIA 2ICPA 3JXBC 4FN3A 5JUWA 2OR1L 2EBYA 3PXPA 2IUOA 3SCHA 5DTRA 2PXEA 3CLCA 4X4HA 1U2ZA 2IU7A 1EFAA 2JCGA 5DT2A 1WIZA 2B5AA 2AXUA 3FMYA 1CJGA 3B7HA 2D5VA 3NZLA 1LCDA 4YG4A 3HZIB 3GUUA 2PXFA 4YG1A 1SQ8A 3DNVB 3GN5A 3NDBB 4ER5A 3BDNA 2PE5A 2EWTA 4GHJA 1RZSA 3QQ6A 3ZHMA 2LYLA 1GT0C 2LLWA 2PUCA 4O8BA 4IVZA 2WIUB 2PXVA 2PXBA 2M4HA 1PNRA 3S8QA 5DSXA 2LNMA 1X57A 4PU3C 4PU4C 4DE9A 5DTQA 3OQOA 4IA8A 1BDIA 3ZPXA 3QOXA 3VK0A 2AXVA 2YBDA 3TEPA 3QFIA 1R63A 4X4BA 2O49A 3R1FA 4HRAA 3SX0A
chains in the Genus database with same CATH topology
3LFPA 4Z5DA 2O38A 2KEIA 3L1PA 3MLFA 4FBIA 2KEKA 2PUBA 3UFDA 2XIUA 1S7EA 2PUDA 1IC8A 1NERA 1RPEL 4Y42A 4I6UA 1QP0A 2GRLA 2GZUA 3QF3A 4J1WA 2PUAA 1ZZ9A 4JCXA 3F51A 1NEQA 3SCFA 2WUSR 1JFSA 4X4DA 1WH6A 2EF8A 3JXDL 4NDWA 2PUFA 2AWIA 2ICPA 2LYJA 3G7DA 3JXBC 4FN3A 2KEJA 1CQTA 4JQDA 4YBAA 4YG7B 2OR1L 4PU7A 3H5TA 1QPZA 2IV1A 1LQCA 3OMTA 2EBYA 3PXPA 4PU8A 1BDHA 2IUOA 4Z5HA 1POUA 2BNMA 3F52A 1QP7A 4Z5CA 3D1NI 3OQNA 3SCHA 1JH9A 1HF0A 1PERL 2PUEA 1QQBA 4Z58A 1DW9A 5A7LA 4J1XA 3BD1A 3EUSA 1ZZ7A 3O9XA 1OCTC 1UXDA 4X4HA 3CLCA 2LCVA 3SCGA 2IU7A 3QYXA 1EFAA 1WETA 2JCGA 2R63A 1WIZA 1OSLA 1ZUGA 2MEZA 1UXCA 1DWKA 3OQMA 1Y7YA 2B5AA 3KXAA 2AXUA 3FMYA 1CJGA 1ZPQA 3B7HA 2FJRA 2A6CA 2LYSA 1PRUA 1ZZ6A 3ZHIA 1LMB3 2D5VA 2KZ8A 2AUWA 1L1MA 1QQAA 4F8DA 3LISA 1LCDA 3CECA 4YG4A 3U3WA 4X4CA 3OP9A 2IVBA 1XWRA 1ZVVA 2GRMA 2XCJA 4OB4A 4JCYA 3HZIB 2BJCA 2JVLA 3JXCL 1UTXA 2IVQA 2OFYA 1JWLA 4YG1A 1ZS4A 1SQ8A 1PRVA 4GQMA 3RZZA 4X4EA 3DNVB 2O4AA 3GN5A 1RZRD 4IWRA 3FYMA 3BDNA 2PE5A 3G5GA 2L8NA 2H8RA 3F6WA 2PUGA 1YSEA 2EWTA 3QWGA 4YARA 4Z59A 4X4IA 1ZZCA 4GHJA 1RZSA 1WH8A 1X2LA 1ZZBA 3QQ6A 3ZKCA 3ZHMA 2LYLA 3TRBA 1LCCA 1GT0C 4MCTA 2HINA 2PUCA 4O8BA 2KPJA 3CROL 3KZ3A 1PRAA 4IVZA 2BNOA 2L49A 3FYAA 1E3OC 1VPWA 2LYRA 2WIUB 2HSGA 2BNNA 3GBFA 1O4XA 4I8TA 1QP4A 1B0NA 1JFTA 2XI8A 4I6TA 1RZRA 3GN5B 2XSDC 3S8QA 4X4FA 1PNRA 1ZAYA 2R1JL 1X57A 4PU3C 4PU4C 2AXZA 1ZZ8A 3KJXA 3OQOA 4IA8A 1BDIA 2AW6A 3BS3A 1LLIA 2LYKA 2PIJA 2MQKA 4I6RA 3VK0A 2XJ3A 4X4GA 1RIOA 2AXVA 5K98B 1R69A 2ICTA 1AU7A 1ADRA 1Y9QA 1R63A 2CSFA 2LYPA 4X4BA 2LYQA 2O49A 4MCXA 3R1FA 2IVGA 2CROA 2PPXA 3IVPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LFP A;  4Z5D A;  2O38 A;  2KEI A;  3L1P A;  3MLF A;  4FBI A;  2KEK A;  2PUB A;  3UFD A;  2XIU A;  1S7E A;  2PUD A;  1IC8 A;  1NER A;  1RPE L;  4Y42 A;  4I6U A;  1QP0 A;  2GRL A;  2GZU A;  3QF3 A;  4J1W A;  2PUA A;  1ZZ9 A;  4JCX A;  3F51 A;  1NEQ A;  3SCF A;  2WUS R;  1JFS A;  4X4D A;  1WH6 A;  2EF8 A;  3JXD L;  4NDW A;  2PUF A;  2AWI A;  2ICP A;  2LYJ A;  3G7D A;  3JXB C;  4FN3 A;  2KEJ A;  1CQT A;  4JQD A;  4YBA A;  4YG7 B;  2OR1 L;  4PU7 A;  3H5T A;  1QPZ A;  2IV1 A;  1LQC A;  3OMT A;  2EBY A;  3PXP A;  4PU8 A;  1BDH A;  2IUO A;  4Z5H A;  1POU A;  2BNM A;  3F52 A;  1QP7 A;  4Z5C A;  3D1N I;  3OQN A;  3SCH A;  1JH9 A;  1HF0 A;  1PER L;  2PUE A;  1QQB A;  4Z58 A;  1DW9 A;  5A7L A;  4J1X A;  3BD1 A;  3EUS A;  1ZZ7 A;  3O9X A;  1OCT C;  1UXD A;  4X4H A;  3CLC A;  2LCV A;  3SCG A;  2IU7 A;  3QYX A;  1EFA A;  1WET A;  2JCG A;  2R63 A;  1WIZ A;  1OSL A;  1ZUG A;  2MEZ A;  1UXC A;  1DWK A;  3OQM A;  1Y7Y A;  2B5A A;  3KXA A;  2AXU A;  3FMY A;  1CJG A;  1ZPQ A;  3B7H A;  2FJR A;  2A6C A;  2LYS A;  1PRU A;  1ZZ6 A;  3ZHI A;  1LMB 3;  2D5V A;  2KZ8 A;  2AUW A;  1L1M A;  1QQA A;  4F8D A;  3LIS A;  1LCD A;  3CEC A;  4YG4 A;  3U3W A;  4X4C A;  3OP9 A;  2IVB A;  1XWR A;  1ZVV A;  2GRM A;  2XCJ A;  4OB4 A;  4JCY A;  3HZI B;  2BJC A;  2JVL A;  3JXC L;  1UTX A;  2IVQ A;  2OFY A;  1JWL A;  4YG1 A;  1ZS4 A;  1SQ8 A;  1PRV A;  4GQM A;  3RZZ A;  4X4E A;  3DNV B;  2O4A A;  3GN5 A;  1RZR D;  4IWR A;  3FYM A;  3BDN A;  2PE5 A;  3G5G A;  2L8N A;  2H8R A;  3F6W A;  2PUG A;  1YSE A;  2EWT A;  3QWG A;  4YAR A;  4Z59 A;  4X4I A;  1ZZC A;  4GHJ A;  1RZS A;  1WH8 A;  1X2L A;  1ZZB A;  3QQ6 A;  3ZKC A;  3ZHM A;  2LYL A;  3TRB A;  1LCC A;  1GT0 C;  4MCT A;  2HIN A;  2PUC A;  4O8B A;  2KPJ A;  3CRO L;  3KZ3 A;  1PRA A;  4IVZ A;  2BNO A;  2L49 A;  3FYA A;  1E3O C;  1VPW A;  2LYR A;  2WIU B;  2HSG A;  2BNN A;  3GBF A;  1O4X A;  4I8T A;  1QP4 A;  1B0N A;  1JFT A;  2XI8 A;  4I6T A;  1RZR A;  3GN5 B;  2XSD C;  3S8Q A;  4X4F A;  1PNR A;  1ZAY A;  2R1J L;  1X57 A;  4PU3 C;  4PU4 C;  2AXZ A;  1ZZ8 A;  3KJX A;  3OQO A;  4IA8 A;  1BDI A;  2AW6 A;  3BS3 A;  1LLI A;  2LYK A;  2PIJ A;  2MQK A;  4I6R A;  3VK0 A;  2XJ3 A;  4X4G A;  1RIO A;  2AXV A;  5K98 B;  1R69 A;  2ICT A;  1AU7 A;  1ADR A;  1Y9Q A;  1R63 A;  2CSF A;  2LYP A;  4X4B A;  2LYQ A;  2O49 A;  4MCX A;  3R1F A;  2IVG A;  2CRO A;  2PPX A;  3IVP A; 
#chains in the Genus database with same CATH topology
 4FBI A;  2KEK A;  1QB2 A;  1NER A;  2PXT A;  1QP0 A;  4J1W A;  2PUA A;  2EF8 A;  5DRY A;  2PUF A;  2KEJ A;  1CQT A;  4YBA A;  4YG7 B;  1QPZ A;  2ODR D;  3OMT A;  4DE8 A;  3F52 A;  1QP7 A;  3D1N I;  3OQN A;  1JH9 A;  3M9L A;  5DTM A;  3BD1 A;  1ZZ7 A;  3O9X A;  3R09 A;  2LCV A;  3TEL A;  1WET A;  2R63 A;  1OSL A;  1HQ1 A;  1DWK A;  3OQM A;  1Y7Y A;  1LMB 3;  2FJR A;  3ZHI A;  2LYS A;  2KZ8 A;  2IVB A;  4JCY A;  2HCS A;  2JVL A;  2FFH A;  2OFY A;  4OBM A;  3LQX A;  1PRV A;  4X4E A;  4ER6 A;  2L8N A;  2H8R A;  1NW3 A;  4Z59 A;  4X4I A;  1WH8 A;  2HFZ A;  2J7U A;  3CRO L;  3KZ3 A;  2BNO A;  2L49 A;  3FYA A;  1E3O C;  2BNN A;  1JFT A;  2XI8 A;  3GN5 B;  1ZAY A;  2LLV A;  2R1J L;  3GZD C;  3SR4 A;  1MFQ C;  2PIJ A;  2MQK A;  4I6R A;  5K98 B;  1AU7 A;  2CSF A;  4X4C A;  2CRO A;  2PPX A;  3IVP A;  3LFP A;  4Z5D A;  2PUB A;  3UFD A;  2J7W A;  1RPE L;  3QF3 A;  1NEQ A;  3SCF A;  2WUS R;  1WH6 A;  2LYJ A;  4JQD A;  3H5T A;  1LQC A;  2MXD A;  1BDH A;  4ER3 A;  4Z5H A;  4Z5C A;  1PER L;  4Q2J A;  4Z58 A;  3EUS A;  4EKI A;  3QYX A;  1ZUG A;  1UXC A;  2V3C C;  2A6C A;  1PRU A;  1ZZ6 A;  2AUW A;  1QQA A;  4F8D A;  3U3W A;  1QZX A;  3OP9 A;  1ZVV A;  1XWR A;  2GRM A;  5GAG i;  2BJC A;  3NXH A;  1UTX A;  2IVQ A;  1JWL A;  3PE5 A;  1ZS4 A;  3RZZ A;  2JQE A;  3G5G A;  2PXU A;  3F6W A;  3VWS A;  4YAR A;  1ZZC A;  1ZZB A;  1LCC A;  2LYR A;  3GBF A;  1O4X A;  1QP4 A;  1B0N A;  4I6T A;  1RZR A;  2XSD C;  2IVG A;  2L1P A;  2AW6 A;  3BS3 A;  2LYK A;  4ER0 A;  3QOW A;  3A9Y A;  1RIO A;  1R69 A;  2ICT A;  4MCX A;  2O38 A;  2XXQ A;  1S7E A;  1IC8 A;  2XXP A;  4Y42 A;  4I6U A;  2GZU A;  1ZZ9 A;  2VEO A;  4X4D A;  3G7D A;  3KL4 A;  4PU7 A;  4EK9 A;  2PXK A;  2IV1 A;  3ME5 A;  4PU8 A;  3A9X A;  3OWQ A;  1POU A;  2BNM A;  3UWP A;  1HF0 A;  2PUE A;  1QQB A;  3OKZ A;  1DW9 A;  3A9Z A;  5A7L A;  4J1X A;  1OCT C;  1UXD A;  2PXP A;  3SCG A;  3MEJ A;  2MEZ A;  2XXA A;  3KXA A;  1ZPQ A;  1L1M A;  3LIS A;  3CEC A;  2XCJ A;  4OB4 A;  4WVL A;  3JXC L;  4GQM A;  3NRO A;  2O4A A;  3TFL A;  1RZR D;  4IWR A;  3FYM A;  2PUG A;  1YSE A;  3QWG A;  5DRT A;  1DUL A;  1X2L A;  3ZKC A;  4ER7 A;  3GZD A;  3TRB A;  4MCT A;  2HIN A;  2PXD A;  2KPJ A;  1PRA A;  3DM5 A;  1VPW A;  4EQZ A;  2HSG A;  4I8T A;  4EKG A;  4X4F A;  2AXZ A;  1ZZ8 A;  3KJX A;  1LLI A;  3G0T A;  5GAH i;  2XJ3 A;  4X4G A;  1ADR A;  1Y9Q A;  2LYP A;  2LYQ A;  2PXL A;  2KEI A;  3L1P A;  3MLF A;  2HCN A;  2XIU A;  2PUD A;  2GRL A;  4JCX A;  3F51 A;  3GZC A;  1JFS A;  2PXQ A;  4EZI A;  3JXD L;  4NDW A;  2AWI A;  2ICP A;  3JXB C;  4FN3 A;  5JUW A;  2OR1 L;  2EBY A;  3PXP A;  2IUO A;  3SCH A;  5DTR A;  2PXE A;  3CLC A;  4X4H A;  1U2Z A;  2IU7 A;  1EFA A;  2JCG A;  5DT2 A;  1WIZ A;  2B5A A;  2AXU A;  3FMY A;  1CJG A;  3B7H A;  2D5V A;  3NZL A;  1LCD A;  4YG4 A;  3HZI B;  3GUU A;  2PXF A;  4YG1 A;  1SQ8 A;  3DNV B;  3GN5 A;  3NDB B;  4ER5 A;  3BDN A;  2PE5 A;  2EWT A;  4GHJ A;  1RZS A;  3QQ6 A;  3ZHM A;  2LYL A;  1GT0 C;  2LLW A;  2PUC A;  4O8B A;  4IVZ A;  2WIU B;  2PXV A;  2PXB A;  2M4H A;  1PNR A;  3S8Q A;  5DSX A;  2LNM A;  1X57 A;  4PU3 C;  4PU4 C;  4DE9 A;  5DTQ A;  3OQO A;  4IA8 A;  1BDI A;  3ZPX A;  3QOX A;  3VK0 A;  2AXV A;  2YBD A;  3TEP A;  3QFI A;  1R63 A;  4X4B A;  2O49 A;  3R1F A;  4HRA A;  3SX0 A; 
#chains in the Genus database with same CATH homology
 3LFP A;  4Z5D A;  2O38 A;  2KEI A;  3L1P A;  3MLF A;  4FBI A;  2KEK A;  2PUB A;  3UFD A;  2XIU A;  1S7E A;  2PUD A;  1IC8 A;  1NER A;  1RPE L;  4Y42 A;  4I6U A;  1QP0 A;  2GRL A;  2GZU A;  3QF3 A;  4J1W A;  2PUA A;  1ZZ9 A;  4JCX A;  3F51 A;  1NEQ A;  3SCF A;  2WUS R;  1JFS A;  4X4D A;  1WH6 A;  2EF8 A;  3JXD L;  4NDW A;  2PUF A;  2AWI A;  2ICP A;  2LYJ A;  3G7D A;  3JXB C;  4FN3 A;  2KEJ A;  1CQT A;  4JQD A;  4YBA A;  4YG7 B;  2OR1 L;  4PU7 A;  3H5T A;  1QPZ A;  2IV1 A;  1LQC A;  3OMT A;  2EBY A;  3PXP A;  4PU8 A;  1BDH A;  2IUO A;  4Z5H A;  1POU A;  2BNM A;  3F52 A;  1QP7 A;  4Z5C A;  3D1N I;  3OQN A;  3SCH A;  1JH9 A;  1HF0 A;  1PER L;  2PUE A;  1QQB A;  4Z58 A;  1DW9 A;  5A7L A;  4J1X A;  3BD1 A;  3EUS A;  1ZZ7 A;  3O9X A;  1OCT C;  1UXD A;  4X4H A;  3CLC A;  2LCV A;  3SCG A;  2IU7 A;  3QYX A;  1EFA A;  1WET A;  2JCG A;  2R63 A;  1WIZ A;  1OSL A;  1ZUG A;  2MEZ A;  1UXC A;  1DWK A;  3OQM A;  1Y7Y A;  2B5A A;  3KXA A;  2AXU A;  3FMY A;  1CJG A;  1ZPQ A;  3B7H A;  2FJR A;  2A6C A;  2LYS A;  1PRU A;  1ZZ6 A;  3ZHI A;  1LMB 3;  2D5V A;  2KZ8 A;  2AUW A;  1L1M A;  1QQA A;  4F8D A;  3LIS A;  1LCD A;  3CEC A;  4YG4 A;  3U3W A;  4X4C A;  3OP9 A;  2IVB A;  1XWR A;  1ZVV A;  2GRM A;  2XCJ A;  4OB4 A;  4JCY A;  3HZI B;  2BJC A;  2JVL A;  3JXC L;  1UTX A;  2IVQ A;  2OFY A;  1JWL A;  4YG1 A;  1ZS4 A;  1SQ8 A;  1PRV A;  4GQM A;  3RZZ A;  4X4E A;  3DNV B;  2O4A A;  3GN5 A;  1RZR D;  4IWR A;  3FYM A;  3BDN A;  2PE5 A;  3G5G A;  2L8N A;  2H8R A;  3F6W A;  2PUG A;  1YSE A;  2EWT A;  3QWG A;  4YAR A;  4Z59 A;  4X4I A;  1ZZC A;  4GHJ A;  1RZS A;  1WH8 A;  1X2L A;  1ZZB A;  3QQ6 A;  3ZKC A;  3ZHM A;  2LYL A;  3TRB A;  1LCC A;  1GT0 C;  4MCT A;  2HIN A;  2PUC A;  4O8B A;  2KPJ A;  3CRO L;  3KZ3 A;  1PRA A;  4IVZ A;  2BNO A;  2L49 A;  3FYA A;  1E3O C;  1VPW A;  2LYR A;  2WIU B;  2HSG A;  2BNN A;  3GBF A;  1O4X A;  4I8T A;  1QP4 A;  1B0N A;  1JFT A;  2XI8 A;  4I6T A;  1RZR A;  3GN5 B;  2XSD C;  3S8Q A;  4X4F A;  1PNR A;  1ZAY A;  2R1J L;  1X57 A;  4PU3 C;  4PU4 C;  2AXZ A;  1ZZ8 A;  3KJX A;  3OQO A;  4IA8 A;  1BDI A;  2AW6 A;  3BS3 A;  1LLI A;  2LYK A;  2PIJ A;  2MQK A;  4I6R A;  3VK0 A;  2XJ3 A;  4X4G A;  1RIO A;  2AXV A;  5K98 B;  1R69 A;  2ICT A;  1AU7 A;  1ADR A;  1Y9Q A;  1R63 A;  2CSF A;  2LYP A;  4X4B A;  2LYQ A;  2O49 A;  4MCX A;  3R1F A;  2IVG A;  2CRO A;  2PPX A;  3IVP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...