2ICTA

Crystal structure of the bacterial antitoxin higa from escherichia coli at ph 8.5. northeast structural genomics target er390.
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
94
structure length
94
Chain Sequence
MKMANHPRPGDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQNAWSLAEAEKTVDVSRLRRLVTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords antitoxin higa
publication title Crystal Structures of Phd-Doc, HigA, and YeeU Establish Multiple Evolutionary Links between Microbial Growth-Regulating Toxin-Antitoxin Systems.
pubmed doi rcsb
source organism Escherichia coli
total genus 26
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2006-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2ictA01
1ZZ6A 2ICTA 3FMYA 3HZIB 4OB4A 4X4BA 3MLFA 3F51A 4PU8A 2LYRA 1B0NA 2IVBA 4YARA 2BJCA 4J1XA 3LFPA 4FBIA 2XJ3A 4X4HA 2ICPA 1POUA 1L1MA 3UFDA 2KZ8A 1PRAA 3TRBA 2IVGA 5K98B 2PUEA 4JCYA 3G5GA 2XCJA 4X4EA 1Y7YA 1ZPQA 2B5AA 3QF3A 3QQ6A 2LYKA 3OQNA 3D1NI 1SQ8A 2AWIA 2HINA 2FJRA 1ZAYA 2BNMA 3S8QA 2AXZA 2PPXA 4Z59A 3JXCL 3CLCA 2MEZA 1PRUA 2XIUA 4YBAA 1JFTA 1LCCA 1WIZA 4IWRA 3OP9A 2MQKA 2KEJA 1BDHA 3SCFA 1PERL 4JCXA 1OCTC 3FYMA 2PUFA 1NEQA 4IVZA 2PUCA 4Y42A 4X4CA 3OQOA 2LYSA 3KXAA 2PUGA 4PU3C 4Z5CA 2JVLA 1AU7A 4F8DA 3SCHA 4O8BA 3OQMA 1DW9A 1JWLA 3B7HA 2BNOA 3GN5B 1X57A 1BDIA 3BD1A 5A7LA 4FN3A 1RPEL 1NERA 1CJGA 1XWRA 1ZZ7A 1RIOA 1DWKA 1PNRA 1ZUGA 2AUWA 2AXUA 2IUOA 2LYJA 2KEKA 1IC8A 1ZS4A 2CSFA 4X4DA 4IA8A 1WH8A 2GRLA 2IV1A 3CROL 2LYLA 3OMTA 4YG7B 1RZRA 2O49A 3PXPA 4MCXA 3F52A 1ZZ8A 4I6UA 4X4IA 1QP0A 2EWTA 4NDWA 1RZRD 1VPWA 1UXDA 2LYQA 2PE5A 1UXCA 4Z58A 2WUSR 4X4GA 2BNNA 1QP4A 3KZ3A 3G7DA 1Y9QA 3GN5A 3SCGA 1JFSA 3JXDL 3EUSA 2GRMA 3CECA 2PIJA 3LISA 3VK0A 4Z5DA 2KEIA 3DNVB 3QYXA 2L49A 4MCTA 4PU7A 4I6TA 4YG1A 2H8RA 1RZSA 1WETA 1LMB3 4GQMA 4YG4A 2PUDA 2IU7A 2WIUB 1LCDA 3JXBC 1QQBA 2PUBA 2PUAA 2AW6A 1LQCA 1UTXA 3RZZA 2A6CA 1R69A 1EFAA 1YSEA 2O38A 3ZHIA 1E3OC 2XI8A 1R63A 4I6RA 1OSLA 1QPZA 1ZVVA 4JQDA 2EF8A 2LYPA 3R1FA 2OFYA 4Z5HA 2KPJA 3O9XA 1LLIA 3IVPA 2LCVA 4I8TA 1QP7A 2EBYA 2GZUA 1ZZ9A 2IVQA 1ZZCA 2R1JL 1HF0A 1CQTA 2L8NA 2O4AA 1S7EA 2OR1L 2D5VA 4PU4C 3ZHMA 2JCGA 3BDNA 3U3WA 3QWGA 3BS3A 3GBFA 2CROA 3FYAA 1PRVA 3F6WA 1QQAA 3ZKCA 4GHJA 2HSGA 2R63A 3L1PA 2AXVA 3H5TA 4J1WA 3KJXA 1X2LA 2XSDC 1O4XA 1GT0C 4X4FA 1ADRA 1ZZBA 1JH9A 1WH6A
chains in the Genus database with same CATH superfamily
3HZIB 4OB4A 3F51A 3A9YA 3SX0A 3UFDA 2PUEA 3G5GA 1ZPQA 3QQ6A 3NDBB 2LYKA 1SQ8A 3UWPA 2HINA 1ZAYA 3CLCA 2MEZA 3SCFA 4JCXA 3MEJA 2PUCA 2PUGA 1AU7A 3LQXA 1RPEL 1NERA 2LLVA 1RIOA 2PXDA 1IC8A 2KEKA 1WH8A 2GRLA 2LYLA 3OMTA 1RZRA 2O49A 3G0TA 2EWTA 1UXDA 5GAGi 2PXLA 4Z58A 3KZ3A 2J7WA 3SCGA 3LISA 2PIJA 3DNVB 4PU7A 4YG1A 1LMB3 4GQMA 2IU7A 2WIUB 2HCNA 3JXBC 2PUAA 2AW6A 2A6CA 3ZHIA 1E3OC 2XI8A 3R1FA 2OFYA 2KPJA 4Q2JA 2LCVA 2EBYA 1ZZ9A 2IVQA 1ZZCA 2YBDA 2D5VA 4DE9A 5DTRA 2CROA 3F6WA 4EKIA 4HRAA 3H5TA 4J1WA 2XSDC 1X2LA 1ADRA 4PU8A 2LYRA 1B0NA 4YARA 2PXKA 3LFPA 4X4HA 1POUA 1L1MA 3TRBA 5K98B 1Y7YA 3QF3A 3D1NI 2BNMA 3S8QA 2AXZA 2M4HA 1PRUA 4YBAA 1JFTA 1WIZA 3OP9A 2MQKA 1NEQA 4IVZA 4X4CA 3OQOA 2LYSA 3KXAA 5JUWA 2XXQA 3B7HA 3BD1A 1U2ZA 2AXUA 1ZS4A 4IA8A 1NW3A 4YG7B 4MCXA 2PE5A 1UXCA 1Y9QA 3JXDL 2GRMA 3VK0A 2PXEA 2KEIA 3QYXA 4MCTA 2PXVA 4EZIA 4I6TA 4ER3A 1WETA 1LCDA 1QQBA 2J7UA 1LQCA 3PE5A 1QB2A 2O38A 1R63A 1OSLA 1QPZA 1ZVVA 1MFQC 2FFHA 2LLWA 2L8NA 2OR1L 3GBFA 3FYAA 4GHJA 2AXVA 3KJXA 1GT0C 4X4FA 1ZZ6A 2ICTA 3FMYA 4EQZA 3MLFA 5GAHi 2BJCA 4J1XA 4FBIA 2XJ3A 2ICPA 2HFZA 3ME5A 2KZ8A 2IVGA 2XXAA 3TELA 2HCSA 4X4EA 2AWIA 2FJRA 2PPXA 3JXCL 2XIUA 2PXUA 1OCTC 3FYMA 3GZDA 5DRTA 4Y42A 4Z5CA 2JVLA 4O8BA 2XXPA 1JWLA 3GN5B 1BDIA 4FN3A 1CJGA 1PNRA 1XWRA 3DM5A 1ZUGA 2AUWA 2IUOA 2LYJA 4OBMA 5DT2A 3CROL 3PXPA 1ZZ8A 4I6UA 4NDWA 1VPWA 2LYQA 2PXBA 4EKGA 4X4GA 2L1PA 3G7DA 3GN5A 3EUSA 2PXPA 4Z5DA 4ER5A 4ER7A 1UTXA 3RZZA 4ER0A 3OKZA 1R69A 1EFAA 4I6RA 2EF8A 2LYPA 1LLIA 4Z5HA 3GZDC 4I8TA 2GZUA 4DE8A 1HF0A 4WVLA 1S7EA 3BDNA 3R09A 3U3WA 2HSGA 3A9XA 1O4XA 2V3CC 1JH9A 1WH6A 2LNMA 2ODRD 1HQ1A 4X4BA 2IVBA 1PRAA 3VWSA 3NZLA 3A9ZA 4JCYA 2XCJA 2B5AA 2PXTA 3OQNA 1DULA 4Z59A 5DRYA 1LCCA 4IWRA 2KEJA 5DTMA 1BDHA 1PERL 2VEOA 2PUFA 3SR4A 3M9LA 4PU3C 3QOWA 4F8DA 3SCHA 3OQMA 1DW9A 3TFLA 2PXFA 3TEPA 2BNOA 1X57A 5A7LA 1ZZ7A 1DWKA 2CSFA 4X4DA 2IV1A 4ER6A 3NXHA 3GZCA 3F52A 4X4IA 1QZXA 1QP0A 1RZRD 3KL4A 2WUSR 2BNNA 1QP4A 4EK9A 3OWQA 1JFSA 5DSXA 3GUUA 3CECA 2L49A 2H8RA 1RZSA 4YG4A 2PUDA 2PUBA 2PXQA 5DTQA 1YSEA 3ZPXA 4JQDA 3NROA 3O9XA 3IVPA 3QOXA 1QP7A 3QFIA 2R1JL 1CQTA 2O4AA 4PU4C 3ZHMA 2JCGA 2MXDA 3QWGA 3BS3A 1QQAA 1PRVA 3ZKCA 2R63A 3L1PA 2JQEA 1ZZBA
chains in the Genus database with same CATH topology
1ZZ6A 2ICTA 3FMYA 3HZIB 4OB4A 4X4BA 3MLFA 3F51A 4PU8A 2LYRA 1B0NA 2IVBA 4YARA 2BJCA 4J1XA 3LFPA 4FBIA 2XJ3A 4X4HA 2ICPA 1POUA 1L1MA 3UFDA 2KZ8A 1PRAA 3TRBA 2IVGA 5K98B 2PUEA 4JCYA 3G5GA 2XCJA 4X4EA 1Y7YA 1ZPQA 2B5AA 3QF3A 3QQ6A 2LYKA 3OQNA 3D1NI 1SQ8A 2AWIA 2HINA 2FJRA 1ZAYA 2BNMA 3S8QA 2AXZA 2PPXA 4Z59A 3JXCL 3CLCA 2MEZA 1PRUA 2XIUA 4YBAA 1JFTA 1LCCA 1WIZA 4IWRA 3OP9A 2MQKA 2KEJA 1BDHA 3SCFA 1PERL 4JCXA 1OCTC 3FYMA 2PUFA 1NEQA 4IVZA 2PUCA 4Y42A 4X4CA 3OQOA 2LYSA 3KXAA 2PUGA 4PU3C 4Z5CA 2JVLA 1AU7A 4F8DA 3SCHA 4O8BA 3OQMA 1DW9A 1JWLA 3B7HA 2BNOA 3GN5B 1X57A 1BDIA 3BD1A 5A7LA 4FN3A 1RPEL 1NERA 1CJGA 1XWRA 1ZZ7A 1RIOA 1DWKA 1PNRA 1ZUGA 2AUWA 2AXUA 2IUOA 2LYJA 2KEKA 1IC8A 1ZS4A 2CSFA 4X4DA 4IA8A 1WH8A 2GRLA 2IV1A 3CROL 2LYLA 3OMTA 4YG7B 1RZRA 2O49A 3PXPA 4MCXA 3F52A 1ZZ8A 4I6UA 4X4IA 1QP0A 2EWTA 4NDWA 1RZRD 1VPWA 1UXDA 2LYQA 2PE5A 1UXCA 4Z58A 2WUSR 4X4GA 2BNNA 1QP4A 3KZ3A 3G7DA 1Y9QA 3GN5A 3SCGA 1JFSA 3JXDL 3EUSA 2GRMA 3CECA 2PIJA 3LISA 3VK0A 4Z5DA 2KEIA 3DNVB 3QYXA 2L49A 4MCTA 4PU7A 4I6TA 4YG1A 2H8RA 1RZSA 1WETA 1LMB3 4GQMA 4YG4A 2PUDA 2IU7A 2WIUB 1LCDA 3JXBC 1QQBA 2PUBA 2PUAA 2AW6A 1LQCA 1UTXA 3RZZA 2A6CA 1R69A 1EFAA 1YSEA 2O38A 3ZHIA 1E3OC 2XI8A 1R63A 4I6RA 1OSLA 1QPZA 1ZVVA 4JQDA 2EF8A 2LYPA 3R1FA 2OFYA 4Z5HA 2KPJA 3O9XA 1LLIA 3IVPA 2LCVA 4I8TA 1QP7A 2EBYA 2GZUA 1ZZ9A 2IVQA 1ZZCA 2R1JL 1HF0A 1CQTA 2L8NA 2O4AA 1S7EA 2OR1L 2D5VA 4PU4C 3ZHMA 2JCGA 3BDNA 3U3WA 3QWGA 3BS3A 3GBFA 2CROA 3FYAA 1PRVA 3F6WA 1QQAA 3ZKCA 4GHJA 2HSGA 2R63A 3L1PA 2AXVA 3H5TA 4J1WA 3KJXA 1X2LA 2XSDC 1O4XA 1GT0C 4X4FA 1ADRA 1ZZBA 1JH9A 1WH6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZZ6 A;  2ICT A;  3FMY A;  3HZI B;  4OB4 A;  4X4B A;  3MLF A;  3F51 A;  4PU8 A;  2LYR A;  1B0N A;  2IVB A;  4YAR A;  2BJC A;  4J1X A;  3LFP A;  4FBI A;  2XJ3 A;  4X4H A;  2ICP A;  1POU A;  1L1M A;  3UFD A;  2KZ8 A;  1PRA A;  3TRB A;  2IVG A;  5K98 B;  2PUE A;  4JCY A;  3G5G A;  2XCJ A;  4X4E A;  1Y7Y A;  1ZPQ A;  2B5A A;  3QF3 A;  3QQ6 A;  2LYK A;  3OQN A;  3D1N I;  1SQ8 A;  2AWI A;  2HIN A;  2FJR A;  1ZAY A;  2BNM A;  3S8Q A;  2AXZ A;  2PPX A;  4Z59 A;  3JXC L;  3CLC A;  2MEZ A;  1PRU A;  2XIU A;  4YBA A;  1JFT A;  1LCC A;  1WIZ A;  4IWR A;  3OP9 A;  2MQK A;  2KEJ A;  1BDH A;  3SCF A;  1PER L;  4JCX A;  1OCT C;  3FYM A;  2PUF A;  1NEQ A;  4IVZ A;  2PUC A;  4Y42 A;  4X4C A;  3OQO A;  2LYS A;  3KXA A;  2PUG A;  4PU3 C;  4Z5C A;  2JVL A;  1AU7 A;  4F8D A;  3SCH A;  4O8B A;  3OQM A;  1DW9 A;  1JWL A;  3B7H A;  2BNO A;  3GN5 B;  1X57 A;  1BDI A;  3BD1 A;  5A7L A;  4FN3 A;  1RPE L;  1NER A;  1CJG A;  1XWR A;  1ZZ7 A;  1RIO A;  1DWK A;  1PNR A;  1ZUG A;  2AUW A;  2AXU A;  2IUO A;  2LYJ A;  2KEK A;  1IC8 A;  1ZS4 A;  2CSF A;  4X4D A;  4IA8 A;  1WH8 A;  2GRL A;  2IV1 A;  3CRO L;  2LYL A;  3OMT A;  4YG7 B;  1RZR A;  2O49 A;  3PXP A;  4MCX A;  3F52 A;  1ZZ8 A;  4I6U A;  4X4I A;  1QP0 A;  2EWT A;  4NDW A;  1RZR D;  1VPW A;  1UXD A;  2LYQ A;  2PE5 A;  1UXC A;  4Z58 A;  2WUS R;  4X4G A;  2BNN A;  1QP4 A;  3KZ3 A;  3G7D A;  1Y9Q A;  3GN5 A;  3SCG A;  1JFS A;  3JXD L;  3EUS A;  2GRM A;  3CEC A;  2PIJ A;  3LIS A;  3VK0 A;  4Z5D A;  2KEI A;  3DNV B;  3QYX A;  2L49 A;  4MCT A;  4PU7 A;  4I6T A;  4YG1 A;  2H8R A;  1RZS A;  1WET A;  1LMB 3;  4GQM A;  4YG4 A;  2PUD A;  2IU7 A;  2WIU B;  1LCD A;  3JXB C;  1QQB A;  2PUB A;  2PUA A;  2AW6 A;  1LQC A;  1UTX A;  3RZZ A;  2A6C A;  1R69 A;  1EFA A;  1YSE A;  2O38 A;  3ZHI A;  1E3O C;  2XI8 A;  1R63 A;  4I6R A;  1OSL A;  1QPZ A;  1ZVV A;  4JQD A;  2EF8 A;  2LYP A;  3R1F A;  2OFY A;  4Z5H A;  2KPJ A;  3O9X A;  1LLI A;  3IVP A;  2LCV A;  4I8T A;  1QP7 A;  2EBY A;  2GZU A;  1ZZ9 A;  2IVQ A;  1ZZC A;  2R1J L;  1HF0 A;  1CQT A;  2L8N A;  2O4A A;  1S7E A;  2OR1 L;  2D5V A;  4PU4 C;  3ZHM A;  2JCG A;  3BDN A;  3U3W A;  3QWG A;  3BS3 A;  3GBF A;  2CRO A;  3FYA A;  1PRV A;  3F6W A;  1QQA A;  3ZKC A;  4GHJ A;  2HSG A;  2R63 A;  3L1P A;  2AXV A;  3H5T A;  4J1W A;  3KJX A;  1X2L A;  2XSD C;  1O4X A;  1GT0 C;  4X4F A;  1ADR A;  1ZZB A;  1JH9 A;  1WH6 A; 
#chains in the Genus database with same CATH topology
 3HZI B;  4OB4 A;  3F51 A;  3A9Y A;  3SX0 A;  3UFD A;  2PUE A;  3G5G A;  1ZPQ A;  3QQ6 A;  3NDB B;  2LYK A;  1SQ8 A;  3UWP A;  2HIN A;  1ZAY A;  3CLC A;  2MEZ A;  3SCF A;  4JCX A;  3MEJ A;  2PUC A;  2PUG A;  1AU7 A;  3LQX A;  1RPE L;  1NER A;  2LLV A;  1RIO A;  2PXD A;  1IC8 A;  2KEK A;  1WH8 A;  2GRL A;  2LYL A;  3OMT A;  1RZR A;  2O49 A;  3G0T A;  2EWT A;  1UXD A;  5GAG i;  2PXL A;  4Z58 A;  3KZ3 A;  2J7W A;  3SCG A;  3LIS A;  2PIJ A;  3DNV B;  4PU7 A;  4YG1 A;  1LMB 3;  4GQM A;  2IU7 A;  2WIU B;  2HCN A;  3JXB C;  2PUA A;  2AW6 A;  2A6C A;  3ZHI A;  1E3O C;  2XI8 A;  3R1F A;  2OFY A;  2KPJ A;  4Q2J A;  2LCV A;  2EBY A;  1ZZ9 A;  2IVQ A;  1ZZC A;  2YBD A;  2D5V A;  4DE9 A;  5DTR A;  2CRO A;  3F6W A;  4EKI A;  4HRA A;  3H5T A;  4J1W A;  2XSD C;  1X2L A;  1ADR A;  4PU8 A;  2LYR A;  1B0N A;  4YAR A;  2PXK A;  3LFP A;  4X4H A;  1POU A;  1L1M A;  3TRB A;  5K98 B;  1Y7Y A;  3QF3 A;  3D1N I;  2BNM A;  3S8Q A;  2AXZ A;  2M4H A;  1PRU A;  4YBA A;  1JFT A;  1WIZ A;  3OP9 A;  2MQK A;  1NEQ A;  4IVZ A;  4X4C A;  3OQO A;  2LYS A;  3KXA A;  5JUW A;  2XXQ A;  3B7H A;  3BD1 A;  1U2Z A;  2AXU A;  1ZS4 A;  4IA8 A;  1NW3 A;  4YG7 B;  4MCX A;  2PE5 A;  1UXC A;  1Y9Q A;  3JXD L;  2GRM A;  3VK0 A;  2PXE A;  2KEI A;  3QYX A;  4MCT A;  2PXV A;  4EZI A;  4I6T A;  4ER3 A;  1WET A;  1LCD A;  1QQB A;  2J7U A;  1LQC A;  3PE5 A;  1QB2 A;  2O38 A;  1R63 A;  1OSL A;  1QPZ A;  1ZVV A;  1MFQ C;  2FFH A;  2LLW A;  2L8N A;  2OR1 L;  3GBF A;  3FYA A;  4GHJ A;  2AXV A;  3KJX A;  1GT0 C;  4X4F A;  1ZZ6 A;  2ICT A;  3FMY A;  4EQZ A;  3MLF A;  5GAH i;  2BJC A;  4J1X A;  4FBI A;  2XJ3 A;  2ICP A;  2HFZ A;  3ME5 A;  2KZ8 A;  2IVG A;  2XXA A;  3TEL A;  2HCS A;  4X4E A;  2AWI A;  2FJR A;  2PPX A;  3JXC L;  2XIU A;  2PXU A;  1OCT C;  3FYM A;  3GZD A;  5DRT A;  4Y42 A;  4Z5C A;  2JVL A;  4O8B A;  2XXP A;  1JWL A;  3GN5 B;  1BDI A;  4FN3 A;  1CJG A;  1PNR A;  1XWR A;  3DM5 A;  1ZUG A;  2AUW A;  2IUO A;  2LYJ A;  4OBM A;  5DT2 A;  3CRO L;  3PXP A;  1ZZ8 A;  4I6U A;  4NDW A;  1VPW A;  2LYQ A;  2PXB A;  4EKG A;  4X4G A;  2L1P A;  3G7D A;  3GN5 A;  3EUS A;  2PXP A;  4Z5D A;  4ER5 A;  4ER7 A;  1UTX A;  3RZZ A;  4ER0 A;  3OKZ A;  1R69 A;  1EFA A;  4I6R A;  2EF8 A;  2LYP A;  1LLI A;  4Z5H A;  3GZD C;  4I8T A;  2GZU A;  4DE8 A;  1HF0 A;  4WVL A;  1S7E A;  3BDN A;  3R09 A;  3U3W A;  2HSG A;  3A9X A;  1O4X A;  2V3C C;  1JH9 A;  1WH6 A;  2LNM A;  2ODR D;  1HQ1 A;  4X4B A;  2IVB A;  1PRA A;  3VWS A;  3NZL A;  3A9Z A;  4JCY A;  2XCJ A;  2B5A A;  2PXT A;  3OQN A;  1DUL A;  4Z59 A;  5DRY A;  1LCC A;  4IWR A;  2KEJ A;  5DTM A;  1BDH A;  1PER L;  2VEO A;  2PUF A;  3SR4 A;  3M9L A;  4PU3 C;  3QOW A;  4F8D A;  3SCH A;  3OQM A;  1DW9 A;  3TFL A;  2PXF A;  3TEP A;  2BNO A;  1X57 A;  5A7L A;  1ZZ7 A;  1DWK A;  2CSF A;  4X4D A;  2IV1 A;  4ER6 A;  3NXH A;  3GZC A;  3F52 A;  4X4I A;  1QZX A;  1QP0 A;  1RZR D;  3KL4 A;  2WUS R;  2BNN A;  1QP4 A;  4EK9 A;  3OWQ A;  1JFS A;  5DSX A;  3GUU A;  3CEC A;  2L49 A;  2H8R A;  1RZS A;  4YG4 A;  2PUD A;  2PUB A;  2PXQ A;  5DTQ A;  1YSE A;  3ZPX A;  4JQD A;  3NRO A;  3O9X A;  3IVP A;  3QOX A;  1QP7 A;  3QFI A;  2R1J L;  1CQT A;  2O4A A;  4PU4 C;  3ZHM A;  2JCG A;  2MXD A;  3QWG A;  3BS3 A;  1QQA A;  1PRV A;  3ZKC A;  2R63 A;  3L1P A;  2JQE A;  1ZZB A; 
#chains in the Genus database with same CATH homology
 1ZZ6 A;  2ICT A;  3FMY A;  3HZI B;  4OB4 A;  4X4B A;  3MLF A;  3F51 A;  4PU8 A;  2LYR A;  1B0N A;  2IVB A;  4YAR A;  2BJC A;  4J1X A;  3LFP A;  4FBI A;  2XJ3 A;  4X4H A;  2ICP A;  1POU A;  1L1M A;  3UFD A;  2KZ8 A;  1PRA A;  3TRB A;  2IVG A;  5K98 B;  2PUE A;  4JCY A;  3G5G A;  2XCJ A;  4X4E A;  1Y7Y A;  1ZPQ A;  2B5A A;  3QF3 A;  3QQ6 A;  2LYK A;  3OQN A;  3D1N I;  1SQ8 A;  2AWI A;  2HIN A;  2FJR A;  1ZAY A;  2BNM A;  3S8Q A;  2AXZ A;  2PPX A;  4Z59 A;  3JXC L;  3CLC A;  2MEZ A;  1PRU A;  2XIU A;  4YBA A;  1JFT A;  1LCC A;  1WIZ A;  4IWR A;  3OP9 A;  2MQK A;  2KEJ A;  1BDH A;  3SCF A;  1PER L;  4JCX A;  1OCT C;  3FYM A;  2PUF A;  1NEQ A;  4IVZ A;  2PUC A;  4Y42 A;  4X4C A;  3OQO A;  2LYS A;  3KXA A;  2PUG A;  4PU3 C;  4Z5C A;  2JVL A;  1AU7 A;  4F8D A;  3SCH A;  4O8B A;  3OQM A;  1DW9 A;  1JWL A;  3B7H A;  2BNO A;  3GN5 B;  1X57 A;  1BDI A;  3BD1 A;  5A7L A;  4FN3 A;  1RPE L;  1NER A;  1CJG A;  1XWR A;  1ZZ7 A;  1RIO A;  1DWK A;  1PNR A;  1ZUG A;  2AUW A;  2AXU A;  2IUO A;  2LYJ A;  2KEK A;  1IC8 A;  1ZS4 A;  2CSF A;  4X4D A;  4IA8 A;  1WH8 A;  2GRL A;  2IV1 A;  3CRO L;  2LYL A;  3OMT A;  4YG7 B;  1RZR A;  2O49 A;  3PXP A;  4MCX A;  3F52 A;  1ZZ8 A;  4I6U A;  4X4I A;  1QP0 A;  2EWT A;  4NDW A;  1RZR D;  1VPW A;  1UXD A;  2LYQ A;  2PE5 A;  1UXC A;  4Z58 A;  2WUS R;  4X4G A;  2BNN A;  1QP4 A;  3KZ3 A;  3G7D A;  1Y9Q A;  3GN5 A;  3SCG A;  1JFS A;  3JXD L;  3EUS A;  2GRM A;  3CEC A;  2PIJ A;  3LIS A;  3VK0 A;  4Z5D A;  2KEI A;  3DNV B;  3QYX A;  2L49 A;  4MCT A;  4PU7 A;  4I6T A;  4YG1 A;  2H8R A;  1RZS A;  1WET A;  1LMB 3;  4GQM A;  4YG4 A;  2PUD A;  2IU7 A;  2WIU B;  1LCD A;  3JXB C;  1QQB A;  2PUB A;  2PUA A;  2AW6 A;  1LQC A;  1UTX A;  3RZZ A;  2A6C A;  1R69 A;  1EFA A;  1YSE A;  2O38 A;  3ZHI A;  1E3O C;  2XI8 A;  1R63 A;  4I6R A;  1OSL A;  1QPZ A;  1ZVV A;  4JQD A;  2EF8 A;  2LYP A;  3R1F A;  2OFY A;  4Z5H A;  2KPJ A;  3O9X A;  1LLI A;  3IVP A;  2LCV A;  4I8T A;  1QP7 A;  2EBY A;  2GZU A;  1ZZ9 A;  2IVQ A;  1ZZC A;  2R1J L;  1HF0 A;  1CQT A;  2L8N A;  2O4A A;  1S7E A;  2OR1 L;  2D5V A;  4PU4 C;  3ZHM A;  2JCG A;  3BDN A;  3U3W A;  3QWG A;  3BS3 A;  3GBF A;  2CRO A;  3FYA A;  1PRV A;  3F6W A;  1QQA A;  3ZKC A;  4GHJ A;  2HSG A;  2R63 A;  3L1P A;  2AXV A;  3H5T A;  4J1W A;  3KJX A;  1X2L A;  2XSD C;  1O4X A;  1GT0 C;  4X4F A;  1ADR A;  1ZZB A;  1JH9 A;  1WH6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...