2D5VA

Crystal structure of hnf-6alpha dna-binding domain in complex with the ttr promoter
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
155
structure length
135
Chain Sequence
MEEINTKEVAQRITTELKRYSIPQAIFAQRVLCRSQGTLSDLLRNPKPWSKLKSGRETFRRMWKWLQEPEFQRMSALRLPRLVFTDVQRRTLHAIFKENKRPSKELQITISQQLGLELSTVSNFFMNARRRSLDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*TP*CP*TP*AP*AP*GP*TP*CP*AP*AP*TP*AP*AP*T)-3'
publication title DNA recognition mechanism of the ONECUT homeodomain of transcription factor HNF-6
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transcription/dna
total genus 45
structure length 135
sequence length 155
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2d5vA02
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2d5vA01
1T33A 4Y42A 2IVGA 2LYJA 3LSRA 2B63J 2MSYA 2B5AA 1POGA 3SDGA 3TW7A 4AYBN 2HOSA 5FJ8J 2KT0A 1ZZ9A 3SCHA 5GP9A 4NDWA 4MLOA 3R1FA 4Y7NJ 1ZR2A 1TWHJ 4MIMA 2EZLA 3Q0UA 5K7HA 4XRMA 1U78A 3JREA 3FYAA 2IU7A 4D7MA 1MBEA 2CUFA 5J1YA 3ZQHA 1GUUA 2Y9YA 1RESA 4O8BA 4D7NA 3FMYA 2EZKA 1BW5A 3S1NJ 3A01A 1Y9QA 1UXDA 4JCYA 1ZR4A 4YARA 2NVYJ 3H3VK 2K40A 3HBLA 1ETYA 4X1EA 1Z0XA 1FIPA 5J1RA 4IHYA 1UXCA 3B7HA 2MG4A 4M3BA 4JX6A 4X4BA 2K9QA 1PNRA 3MN2A 5F0HA 2LD5A 2AO9A 5DTDA 5K7FA 2XGCA 2PIJA 2CUEA 2ZB9A 3PXPA 2X9DA 1ITYA 1ORKA 4IHXA 3WHBA 1G2HA 3WHCA 1WH8A 3RZZA 2Y9ZA 3F52A 1JH9A 2CQQA 4MCTA 1B72A 4A3CJ 1EFAA 4PU8A 3KJXA 4M3EA 3HOZJ 2R1JL 1E3OC 2MW8A 2DMQA 1PRUA 1U9OA 2DTZA 1BW6A 4XK4A 1JKOC 2PUCA 2PUBA 2XSDC 2YS9A 2LKXA 1VNDA 4QSHA 2DA1A 2PUEA 2CQXA 5IP7J 5F04A 3A02A 4GHJA 2L8NA 4X4EA 2VI6A 2AXZA 2ICTA 3GTGJ 1A5JA 3QQ6A 2R5YB 2K9NA 4YG4A 2PUDA 1PRAA 3BS3A 4C3JJ 1X2NA 5EZHA 1RPEL 2PUAA 4JX4A 2M34A 2IUOA 3UFDA 2DA3A 1ZQ3P 4X4FA 1RKTA 2M0CA 2DMPA 3JRBA 3OQMA 5C44J 4D5CA 3PO2J 5EGOA 1ZZ6A 1ZGWA 1R63A 1QP0A 2AHQA 1JUMA 3ZQLA 3CLCA 2LLKA 1XS9A 1HDPA 1JUPA 4JQDA 1O4XA 1IRZA 2CROA 2QCOA 4I6ZA 2BNMA 1W0UA 3JRDA 2GRMA 4A3GJ 4FTHA 1ZVVA 4A3KJ 1Y7YA 1WIZA 1QP4A 1SQ8A 2HXOA 3BTCA 2EQRA 1TC3C 2OPTA 2XPVA 3E7LA 3Q0WA 4PU7A 3BR1A 1ETOA 2Y0SN 3BR2A 4A3MJ 1GT0C 4MFEA 2LYLA 4X4HA 2OF7A 1Q1VA 2M8GX 2I10A 5E3NA 1QPIA 2IVQA 5K98B 2LY9A 2VPRA 2IV1A 2WUSR 1MH4A 5E3MA 1JJ8C 3LISA 4DZJA 1RZSA 3HOUJ 1ETKA 1WI3A 3HKZN 5M5WJ 2LR8A 4DYRA 2KPJA 4YG1A 4A3EJ 2JA6J 2XI8A 4I6RA 2BJCA 2HOTA 4M6VA 2GBYA 1APLC 2FJRA 2AUWA 3D1NI 4V2GA 1ZZ8A 4IA8A 5JLWA 1FTZA 3GTLJ 2L9RA 3BR3A 2TCTA 3SFIA 1TWFJ 4GQMA 4A3JJ 2IBDA 1H8AC 3ZOBA 5IYBJ 4AUXA 1DU0A 2L0KA 3BQZA 3GTQJ 3PM1A 2W48A 2O4AA 1BDIA 2XJ3A 2AWIA 3BT9A 3HGYA 1JT0A 2NVXJ 4PU3C 3JRAA 1MBJA 2JK3A 2R5YA 1OCTC 3S2DJ 3BTIA 1IUFA 2X6OA 2DA4A 3Q0VA 4I76A 1QVTA 1XC5A 3GBGA 1RR7A 4L5EA 2R63A 2O38A 4X4IA 3OSFA 1A6IA 1GV2A 4AC0A 3HM5A 3OQNA 1F43A 3CROL 2Y31A 1ETWA 3RZDJ 3I4NJ 5C4XJ 1VFCA 1GDTA 5J3LA 3QWGA 2MEZA 4XICA 3NAUA 4M3GA 1X58A 2VKVA 2JMWA 2PMZN 1HCRA 4CYCB 2H1KA 2ECBA 1ZZCA 1I3QJ 3HOXJ 1YRNB 4JP0A 1LCDA 1LMB3 3BTJA 3BG5A 4C2MJ 1IDYA 1K61A 2E2JJ 3JXBC 5M5YJ 1FTTA 1WH6A 3NARA 2EZIA 3K2AA 4IWRA 2LYPA 5M3MJ 1OJLA 4BBRJ 3B6CA 2IVBA 5M3FJ 4DW6A 3VK0A 5IOYA 3GTOJ 4DZPA 1DU6A 5DS9A 1T56A 4JCXA 1JTYA 3FK7A 4GFBA 3ZQIA 3IH4A 2DA5A 4A3DJ 1JKPC 1HF0A 5IOZA 2O8KA 3VPRA 3GTKJ 1VI0A 3S17J 4FN3A 3BD1A 1PRVA 1VPWA 4BKXA 5EZGA 1AU7A 3GTPJ 2XGEA 4Z5CA 4S0HB 2KEIA 2R0QC 2EH3A 3BDNA 4EEFG 2EWTA 3GTJJ 3TRBA 2XIUA 5F0CA 3S1RJ 1B8IB 2NVQJ 3QF3A 4XRSG 3OSGA 1BJZA 1MH3A 1CQTA 3KXAA 3GTMJ 1ADRA 4M3FA 1PERL 1K83J 2YU9J 3G1MA 3SJMA 3IV5A 4DYQA 1ZS4A 2OFYA 2BNNA 3C2BA 4J19A 4A3IJ 4FBIA 2HQ5A 3B6AA 3RKQA 1WH7A 3GN5B 1TWCJ 2FQ4A 2FX0A 2XCJA 2HINA 1TWAJ 2ICPA 1MSEC 1ZAYA 2COBA 1FEXA 5A7LA 4X6AJ 3O9XA 2PUFA 2XGDA 2VKEA 5IPAA 2ME0A 3MKLA 3MVPA 3RQIA 1R69A 3ZHIA 4A3BJ 1JJ6C 1FIAA 4CYCA 4BBSJ 4BY7J 3I4MJ 3IVPA 4Z5HA 1XWRA 1YRNA 3DEWA 2LP0A 2MGQA 2NOGA 3G5GA 4X4DA 1OSLA 1POUA 1BDHA 1VF9A 2EBYA 3JXDL 2IAIA 3S15J 3TP3A 2PUGA 3S14J 2HXIA 2WV1A 4NDLA 3JRIA 4LOCA 1IV6A 2LTPA 2KEJA 3JRFA 4IHVA 4UUTA 4A3FJ 4ABZA 2JA5J 3OIOA 2E2IJ 1B0NA 2XB0X 5F08A 1IGNA 3JRHA 2R7ZJ 2LVSA 3CECA 1JKQC 5C3EJ 1IDZA 3BG3A 3SCGA 3U3WA 2IEKA 2GM4A 5FKOA 4Z5DA 1R9TJ 2KZ8A 4JYKA 2LYQA 1NK2P 4C3HJ 2E1OA 2DMNA 1W0TA 2D5VA 4A69C 3O8HA 1ZK8A 9ANTA 3BQYA 1B8IA 1MBKA 2WIUB 1Y1WJ 2DMUA 4RDUA 3L1PA 2E2HJ 3ZKCA 1AHDP 1EF4A 2FJ1A 1LE8B 5GPAA 4HNVA 2ME6A 1JFSA 1IC8A 4FCYA 1SANA 1D5YA 2CRGA 2O9LA 1I6HJ 4YBAA 2PE5A 1WETA 5FKLA 2XPWA 1H89C 1RKWA 5JLXA 1I50J 3FKIJ 1MSFC 3M4OJ 1IG7A 2H8RA 4YG7B 5F0FA 3GN5A 3HOWJ 1MBFA 3S1MJ 3QQAA 1ETVA 3LSJA 1MBGA 1ZTRA 3BG9A 3FYMA 3IH2A 5FKKA 1JUSA 4XRSA 1ZZBA 2NS8A 1SFOJ 2R92J 3OMTA 2X48A 4RBOA 3ZQFA 4Z59A 4Y52J 2LYSA 3OQOA 5GPCA 1JKRC 3BR6A 4I6TA 4MCXA 1WCMJ 4OB4A 4J1XA 1PUFB 1WH5A 1X2MA 3K7AJ 3F51A 3CQZJ 3FIWA 4D5FA 5IP9J 1FJLA 5E3OA 1QPZA 3A03A 1WPKA 4IHWA 2JA7J 2R5ZB 3S2HJ 2AXVA 5C4JJ 1YSEA 1LLIA 3BR0A 2L7ZA 3JXCL 2DA6A 3BR5A 3W6VA 5HODA 3O8GA 5EG0B 2VUMJ 2AW6A 3H5TA 3F6WA 3RZOJ 2DA2A 2O7OA 3QPLA 5IYCJ 3DCFA 1JT6A 2JA8J 2R93J 2HI3A 4V2FA 1JWLA 5EGOB 2MQKA 2ELKA 4W97A 4BY1J 4I8TA 2NVTJ 3ZQGA 4QIWN 1UHSA 1AKHB 1UTXA 3LFPA 1LFBA 4MO7A 2GZUA 2L7FP 2CU7A 2LYRA 2DA7A 3TP0A 1QP7A 4MFDA 4IEJA 2M2EA 1ENHA 3HOYJ 4UUSB 1RPWA 1QRYA 1LE8A 3KZ3A 1CJGA 3HDDA 2A6CA 1UG2A 3LOCA 4FE7A 3HGGA 2LYKA 2JWTA 1NTCA 3TW6A 3HB9A 1ETQA 2L7MP 3GBFA 4X4GA 3MLFA 2G0EA 5F27A 1OFCX 4G12A 2L49A 1H88C 2BNOA 1S7EA 2WAQN 3ZQCA 2DN0A 2HOAA 2LFBA 3LNQA 4J1WA 2Y30A 3OOUA 2K9SA 2JJ7A 2YUSA 4FISA 2EZHA 2Y2ZA 5EF6A 1TWGJ 3HEFA 2M9HA 2XPUA 1DW9A 3G7DA 2OR1L 3CMYA 4XIDA 1ZPQA 1RIOA 3S1QJ 1RETA 1ZUGA 4M3DA 2HYJA 1HLVA 1WGXA 5M5XJ 5K7ZA 2FD5A 1UMQA 3IH3A 3FK6A 2EBIA 1JTXA 2HSGA 3ZHMA 4QTRA 1GVDA 1PUFA 5FLMJ 2JVLA 2XB5A 4B3AA 1LCCA 2DMTA 5EYRA 3LSGA 2R5ZA 4IVZA 4B1RA 1L1MA 4C3IJ 4BXXJ 1ETXA 2ID3A 3BTLA 2HDDA 4JX5A 3EUSA 2E19A 3JRCA 3SCFA 2P81A 3H0GJ 3S16J 1LQCA 3G1OA 4W1UA 3QPSA 5EG0A 2GRLA 1HDDC 2RAEA 1MBHA 1U9NA 3M3YJ 1NERA 1ZZ7A 3F0CA 2AXUA 5EEAA 1XG1A 3TEDA 1U8BA 3FISA 3G1LA 1QVUA 5E3LA 2GLOA 4I6UA 1NK3P 4X4CA 2KEKA 1Z77A 3JRGA 1AKHA 2NS7A 1F36A 1X2LA 2LK2A 2XRLA 1P7IA 4Z58A 5F1JA 4PU4C 2O49A 2PPXA 1BA5A 5IP6A 2ID6A 2WB1N 5BNGA 3A01B 4F8DA 3HZIB 2LCVA 4UUSA 1P7JA 1RZRA 1Y1VJ 5J1UA 5EDNA 2TRTA 4A93J 2N8GA 2ECCA 3DNVB 1OCPA 1JFTA 4FE4A 2JCGA 5FKNA 2EF8A 4DYCA 1X57A 5FLVA 1LFUP 1QQBA 4A3LJ 1DWKA 3CCYA 1NEQA 3JR9A 1IJWC 3S8QA 1B72B 3Q3SA 5IYDJ 1BL0A 3QYXA 3HOVJ 3UKGA 3OP9A 1GV5A 1HOMA 2KDZA 2DJNA 2QF7A 1ZKGA 5FKMA 1MNMC 2CSFA 3PO3J 1QQAA 3LSPA 4B4CA 1JGGA 2CJJA 3CDLA 1RZRD 2JN6A
chains in the Genus database with same CATH superfamily
2QENA 1GLNA 4E7SA 2D1HA 2X85A 1UG0A 2Q1ZB 3DV8A 4R1HA 4EGZA 5LGNA 2MSYA 3NDBB 4B43A 1POGA 2HQAA 3HSFA 1T08B 1HKTA 3WGIA 5EEHA 4JK1X 2KT0A 5EEGA 1LQ1A 2VBXA 2BY0A 2E1MB 2XKPA 4Y7NJ 4EJTA 5J6XA 2QSHX 1BOAA 2BGCA 2VKHA 1NG7A 2FMYA 2DK8A 5GTIC 4E70A 1ON2A 3E5QA 2UV1A 3ZQHA 5J1YA 2VPLA 3L00A 2IA0A 3CCJI 4M6YA 4KN7X 3H35A 2X1DA 3D5SC 4O8BA 4O5VA 3H3UA 2VJ4A 1UXDA 2W7NA 3OOPA 3D5RC 3HPHA 4I99C 4LG0B 1LDDA 5DUKA 3OYCA 3QOWA 2K40A 1D5VA 2GZWA 4HA8A 4YRVA 4IHYA 3B7HA 1IXSB 2MG4A 1M1EB 1SFXA 1XMKA 4ER7A 5F0HA 2ESHA 2Z2SB 2AO9A 5K7FA 2ZB9A 3WE2A 4ZTFA 3PXPA 1ITYA 2FBHA 4KT5C 4KFCA 2PJPA 2DOEA 3BY6A 4L9VA 5L3EA 5IT3A 3OYLA 2OQRA 4XORA 4PU8A 3CJTB 4CZCA 1T8IA 3KJXA 3J81Z 3GZDA 2RGVA 2EV6A 4AYBA 4DE8A 3H9QA 2VJ5A 1TW2A 2MW8A 5B3SH 4XN3A 2FMLA 3HHGA 4HBLA 2LBFB 1JKOC 2OC6A 2PUBA 2YS9A 3KCCA 4ANJA 3OYKA 3X2QH 2L8NA 4Q5SF 1HW1A 4HRAA 2DFHA 5CYVA 4I2OA 2ICTA 1TZLA 2QA4I 1VZ0A 2CFOA 1K6YA 5D6EA 1A5JA 3A9YA 2R5YB 3Q9VA 4YFXF 2GA1A 2EWNA 5EZHA 1Z6RA 3OS0A 1RPEL 2M34A 3ZPLA 1R23A 3E97A 2M0CA 2H09A 4OINF 2IA1A 3OQMA 3SFZA 4D5CA 1GXQA 1R63A 1IO2A 1X3ZB 4N0BA 5GTHC 1R6RA 4E4HA 2GRMA 4ZDPA 4FTHA 4EKGA 2ESNA 1CF7A 2Q2EB 4J00A 2IW5A 3VOEA 5IT9K 2PXBA 3BTCA 1DDNA 1TC3C 2EA2A 3E6CC 2VQLA 3E7LA 4E7IA 2RQPA 4QPQA 1WFXA 5GAEJ 3BR2A 4MFEA 1Z3YA 4LG3A 2L9SA 4PDKA 2I10A 1FYMA 4MQ9F 2IVQA 5K98B 5IT9Z 4PUSA 4LLLA 1JJ8C 2BW3A 3E3VA 3MZ8A 1KQ9A 3PNVA 3QP5A 2V79A 4Y4RA 5M5WJ 3K1PA 1TQIA 2PEXA 4A3EJ 3ZCOA 2GBYA 1OCOH 1P6RA 2ZJPF 1RI7A 1XCVA 5E20A 1ZZ8A 3H36A 2L54A 4IA8A 2TCTA 2ZJRF 4IRGA 3SFIA 1TWFJ 3CDIA 4AUXA 5L3BA 2IJLA 2W48A 3BLYA 2XJ3A 2XV4S 2P5LC 2NVXJ 4PU3C 3F8NA 4DNCA 2CUJA 1X3WB 2BBYA 3PUFA 4I76A 3RPUD 1BJAA 3ZMVA 3R09A 4IKFA 5DM6F 2ZCWA 3A4CA 1W4MA 1GV2A 3LA2A 5FD6A 1R4MB 4ER6A 2L9VA 3RZDJ 4IQJA 2V9PA 2HVQA 5HDGA 2DFFA 3JTGA 3H0DA 2HVSA 1X58A 2PXLA 2V6EA 4ESJA 4CYCB 1TQPA 2QSFX 5DSXA 3VYRB 1FYKA 4MEXF 3HOXJ 1LCDA 3BG5A 2ZXIA 1MJAA 3K2AA 2HOEA 3MCZA 3OS1A 1MIJA 1XMAA 2HR3A 1K7AA 3F72A 2JVGA 5E18F 3B6CA 3KEYA 3VK0A 4DW6A 4XR6A 3K4JA 5HLGA 1PP7U 1QB2A 2KIFA 4DZPA 4U0VA 1T56A 2CS3A 2MH2A 4KYWA 4XBFA 4GFBA 4KDPA 2DA5A 3B73A 3CUQA 3FXLA 1HBXG 3GTKJ 4FN3A 5DRYA 1VPWA 5FO5A 1AU7A 2XGEA 3DKXA 4S0HB 5HS7A 2R0QC 5D6FA 2EH3A 3J80K 2EIJH 5BS6A 3DWLE 2IGKA 3GTJJ 4E7KA 3TRBA 1QHHD 3QPHA 2HCSA 3QF3A 4XRSG 2DYSH 5CJ9A 4XLAA 3ZRGA 1E3HA 3RDIA 1KA8A 3P9CA 3GTMJ 4K2EA 3PJRA 3KP7A 2Z1DA 2STWA 2QGUA 2DOAA 4NC8A 5D4SA 3DQVC 2YU9J 3J80Z 3IV5A 4DYQA 2HEOA 1ZARA 4MTEA 2OFYA 2BNNA 4J19A 3I54A 1EA3A 2E5ZA 3D5LA 3GF2A 1R1VA 1WH7A 2ZXJA 3GN5B 2FX0A 2VQHA 3TL4X 4DBRA 3GMEA 4G6QA 3G0TA 3ZP5A 3IAM2 6PAXA 2XGDA 3GCMA 1QZEA 3V4GA 5IPAA 3ZHIA 1W7PB 3RQIA 3QPTA 4HF2A 4A3BJ 4XOPA 2BHZA 1JJ6C 1G59A 1FIAA 4BY7J 4BXUA 3OYAA 2XAJA 1USSA 1YRNA 3GO5A 2NOGA 4I7HA 4YELA 1OSLA 1BDHA 3CCVI 2P0WA 2NXNB 2QKMB 3TP3A 2PUGA 3S14J 4NDLA 2GIZA 4LOCA 3K69A 4B3XA 3IRQA 2VJIA 1ZELA 2LTPA 2LLVA 4XKWA 1J09A 4ABZA 2JA5J 3R0JA 4I0AA 1V5EA 2ELJA 5F08A 5D5VB 1V5GA 2LVSA 3SR4A 4XLHA 3CECA 1AA7A 1F1ZA 4KMUX 1FOKA 2V26A 3BG3A 3FXKA 3U3WA 1D0XA 2LNMA 2A6TA 2A61A 3LSMA 2ZNYA 3T8TA 3EUHC 5DRTA 1K79A 2KZ8A 2NNYA 3DU6A 3AKZA 2YX7A 2QBYA 1F9NA 1DPUA 1Z67A 3BQYA 5L3CA 2CW8A 2OAZA 2C6YA 2WIUB 4RDUA 3L1PA 3ZKCA 3MMYB 1AHDP 2ACJA 2FJ1A 2BYVE 1LE8B 1OCRH 2QM3A 4PGGA 2OA4A 4GO1A 5E8IA 1IC8A 1WETA 2XXQA 3CJRB 3S8PA 1X1AA 1JE8A 1H89C 2M45A 2GXAA 3M4OJ 4PK4A 4RAYA 3BCBA 5TJJA 2IGOA 3V7RA 4KIGA 2VT2A 4XRSA 4PJJA 3FM3A 4G8XA 5KVRA 3TGNA 1QZYA 3CLOA 3T0YA 3CCLI 1QHGA 2BXYA 2X48A 4RBOA 5AIQA 4L18B 1JKRC 2PBIA 3I0TA 4CCJA 1JI8A 2NAZA 4OB4A 4J1XA 1HW5A 1WH5A 1X2MA 4D5FA 3OR2C 1FJLA 5E3OA 4YG1A 1HQ1A 2R5ZB 3DBLB 2AXVA 1ZH5A 2KZGA 1LLIA 1MMSA 3BR5A 2WB1A 1IV8A 2JZYA 2FE3A 5HODA 3ZN1A 5FRNA 5D5UB 3RZOJ 1BR4A 3PIOF 3DCFA 1K4TA 5FD5A 1JT6A 2KMUA 2HYGD 1W7PD 4V2FA 2DLLA 1U5TC 3CCQI 2X0LA 2NVTJ 3FMRA 1A36A 2G7UA 1LFBA 4ESBA 5K5QA 2PMUA 2GZUA 1WJFA 2L7FP 2LYRA 2PJRB 3TP0A 1ODDA 4BE0A 2VBWA 3KZZA 4P96A 1WZ2A 4MFDA 4IEJA 4IVNA 4UUSB 1LUJB 2KIMA 3KZ3A 1Z6TA 1XPXA 3HTSB 1LKXA 5DUIA 1FMWA 1WKMA 2K5CA 1I1SA 1ETQA 2L7MP 4X4GA 2L49A 4ER3A 1X4PA 3ZQCA 2HOAA 2LFBA 3BG6A 3N4MA 2JVHA 3OR1C 1KGSA 1KONA 2JSCA 4KNYA 4J1WA 2JJ7A 2XASA 2YUSA 4RB2C 1G3YA 2PXQA 2M9HA 2OR1L 4BQOA 4A12A 4XIDA 5AONA 1ZPQA 4R79A 5FFZA 3JTHA 3CLQA 4ENMA 3QYFA 1V3FA 2LH9A 4XKBA 1WI9A 2JQEA 3IC7A 4ZH4F 5FLMJ 2HNHA 4G94A 4B3AA 1I6XA 4Q2JA 4V19K 4IVZA 1U2WA 1EH8A 3DTEA 2HDDA 4JX5A 1IXRC 3EUSA 3G3ZA 2P81A 3H0GJ 2JQ7A 2GRLA 3CCUI 5JR3A 4ITVA 4BQAA 1HDDC 4LFUA 1MBHA 3M3YJ 2PX9A 1NERA 2LREA 1ZZ7A 3NEUA 4ZTJA 5EEAA 2ZKZA 4C2TA 3G1LA 3KP3A 3WE3A 2COMA 5HLIA 1AKHA 4A6EA 3HRTA 5LRRA 2NS7A 4EJOA 3GZNB 3ZXSA 3C1DA 3RSNA 2XAGA 1P2FA 4XL9A 3K10A 2ICWG 3JSPA 2PPXA 2GIVA 2ID6A 2E71A 2WB1N 3A01B 2H27A 1P7JA 2PXKA 2K4JA 3WTZA 4CDGA 3RCOA 2TRTA 4A5MA 1W1WE 5FGMA 3ERED 1X1PA 4NC7A 2N8GA 3SHFA 2ZC2A 1JFTA 1Y0NA 3IRRA 2CV1A 2VODA 2JCGA 5FKNA 3RYRA 3ZMDA 1IF1A 3I3LA 4MNUA 3G71I 4ER5A 4NNJA 2DQRA 5EJCA 4DE9A 2PXTA 4IOAF 1QQBA 1DWKA 2VC1A 1IJWC 3S8QA 3C18A 5IYDJ 3PQJA 1BL0A 3QYXA 2IP2A 3OP9A 1HOMA 4N4NB 2QF7A 1ZKGA 2A5YB 4NUBA 3VFZA 3T5XA 2JPCA 4HDUA 4G7ZF 1U9NA 2GQQA 1HKSA 2DI3A 4J01A 3PSIA 1PYVA 3LFUA 2RN7A 4RM3A 4S04A 3AG1H 3SDGA 3TW7A 2ZMEB 1Y0UA 1H0MA 2CYYA 1ZZ9A 3SCHA 2V1UA 2Y48A 3MKWB 3R1FA 2A07F 4NBQA 2Z9OA 2FSWA 3WU0A 4ER0A 2LRDA 4R8HA 3SZGA 1RNLA 4MIMA 4CXFA 1U8RA 4N9HA 5K7HA 4ZC3A 4XRMA 3JREA 1U78A 1MBEA 3SEQA 3N97A 2IS1A 2KJBA 1LEAA 1Z05A 1WRJA 3TMOA 1GUUA 2Y9YA 4JBAA 3FWEA 2PXDA 4OIQF 1IN4A 3DXJF 3S1NJ 1Y8QB 3DEUA 3ECOA 4EJUA 1UZCA 1PVEA 3VYSB 5LGUA 2E60A 3H3VK 4UY8I 3CP8A 1ETYA 4UNOA 4IJAA 4X1EA 4BNCA 1Z0XA 1UXCA 2IS2A 2DT7B 3MD2A 1S7AA 2H6CA 1FZPB 1PNRA 2LD5A 1FY7A 2PIJA 3GZDC 2XGCA 4ZYDA 1J0RA 3S32A 3HUGB 1ORKA 1FOYA 1G2HA 2PFBA 3RZZA 1T0FA 3IL2A 2M8EA 3F52A 3OYBA 1JH9A 1B72A 3QU6A 4RGXA 2W25A 3HOZJ 2HDWA 3K4KA 2IA2A 4G6DA 4ESFA 3CC4I 2GAUA 2ZFWA 2DMQA 3FXRA 3F8FA 5HS8A 3OYIA 1DUXC 2GXGA 4KIFA 3IKVA 2DTZA 4B8XA 2EFPA 3UWPA 3L7WA 1QQIA 1Y39A 2WC2A 1BC8C 5ED4A 2CQXA 5CVVA 4GHJA 4BXFA 4LK0F 4X4EA 4ASNA 2AXZA 1B59A 4CCMA 2L4AA 3WU2C 1BIBA 4CCOA 4Q47A 4EMSA 4YG4A 2PUDA 2NVUB 1HSJA 1XGNA 5DD4A 1PRAA 3K4MA 2PUAA 3FHNA 3OY9A 3HOTA 3UFDA 2GOXB 1HXDA 2HYFA 4HV5A 4PCQA 3LAJA 5LRSA 4HEA2 4ENJA 2UWMA 1KU7A 5C44J 2LKSA 4DOZA 1MJ9A 5EGOA 1ZGWA 2FXAA 1JUMA 3QOXA 2F6CA 3K4LA 1XS9A 2F5FA 1JUPA 2LY1A 2CROA 1QPMA 4LG0A 1K4SA 4A3KJ 1YW8A 1WIZA 3AG3H 5BOXA 1VQ9I 2EQRA 2OPTA 2XPVA 2BHYA 3Q0WA 2LMDA 2FUG2 4AWXB 5KNLA 2DTRA 3GFIA 2YX4A 3TDZC 1QPIA 2RNJA 2LY9A 4I0BA 3EUAA 2WUSR 5GAGJ 5E3MA 3RPUA 3OYGA 3FZVA 1WI3A 3HOUJ 2M4GA 2BY1A 3HKZN 3U21A 4F93B 2LR8A 3HTUA 2M87A 3V42A 5L3DA 2JA6J 2XI8A 2BJCA 4EK9A 4IQ4A 2AS5F 2AUWA 3D1NI 4V2GA 4RMNA 3K4BA 5F6FA 3C2HA 3VSKA 2XAUA 4RB0A 2HPIA 2YBDA 2F48A 2JT1A 2AQFA 3QP6A 2LBFA 3WU1B 1F5TA 4CYDA 2IBDA 1FOXA 4UVBA 3ESWB 1DGRM 5IYBJ 4IRHA 4BHPA 2A3SA 1S6LA 4IRIA 1TNSA 4M6XA 3GTQJ 1BDIA 3OYEA 3BT9A 3FHZA 3HGYA 3LMMA 3A2KA 2B0LA 1SFEA 2LF8A 3JRAA 2QQAA 1SD5A 2E36A 2JK3A 4WCGA 4XLPF 2R5YA 3V7SA 3HL2A 4OIPF 2A6EF 4QLCU 3GBGA 1RR7A 3I59B 4L5EA 4EV0A 1LPQA 2O38A 1XGMA 3CMMA 4I98B 4BQQA 3HM5A 2HCNA 3OQNA 3I71A 3CROL 2HWVA 3HIFA 3JAMZ 3H5NA 5C4XJ 1VFCA 1GDTA 5L3GA 5J3LA 3ZN0A 3NAUA 3QU3A 2VKVA 1KU2A 1SMTA 3K1MA 3WTYC 3IUOA 5K5RA 2CW0F 1FBSA 2DFIA 3AG4H 3SZTA 1ZZCA 2M7AA 3RKWA 2Q2EA 2PXEA 4LD5A 2WV0A 3BTJA 1IDYA 3JXBC 3MEXA 5JI6A 5M5YJ 4IWRA 1VQNI 4AVPA 1FMVA 3CUQC 4MEYF 1ZGAA 3S93A 4CZZA 1MKMA 5J40A 2K27A 5M3MJ 2VE9A 3DPLC 3DLAA 4IHSA 4BGDA 3GTOJ 5DS9A 4HF1A 5CVIA 5HLHA 1UCRA 3CO7C 3FXJA 1SVOA 3J81K 4E7HA 3ZQIA 1KU9A 1XGSA 1Z91A 5IOZA 2O8KA 4HYEA 3F6OA 5GADJ 5HS9A 1KU3A 3SYTA 5LHIA 3H1CA 3LSKA 3M9AA 4BKXA 3GTPJ 4IO9F 2L5QA 2LNBA 2EWTA 4WXDA 1B8IB 3JW4A 2NVQJ 3OSGA 1BJZA 1LDJA 2M3AA 1ADRA 2ETHA 1Z21A 2P5VA 4WXCA 2FA5A 3G1MA 3SJMA 3ME5A 3FMQA 1G3SA 4A0XA 4A3IJ 3HHHA 1IN5A 4IOCF 1G4DA 1QU3A 2K9MA 3I4PA 2EIMH 1WQ2A 1TWCJ 2OCCH 4CCKA 1MDMB 2DO7A 1ZAYA 1MSEC 1FEXA 2W85A 4XKCA 2X51A 2GOMA 4ZZDA 2NNNA 1Y8RB 2FU4A 3MKLA 3H5AA 3EQLF 1HQCA 2VBYA 4B47A 4CYCA 2DAOA 3I4MJ 1YIJI 1MW7A 1DGWY 3FXQA 2LG4A 2KQRA 3CD6I 4BYYA 4S05A 1QO0D 2EBYA 2O8XA 4L9TA 2CG4A 3W6KB 1SD4A 2L7KA 4A5NA 2KEJA 1EKEA 2XKOA 4IHVA 3FF5A 4E6KG 1ZREA 5DTRA 3OIOA 2A5WA 2E2IJ 4G7OF 2MD0A 1B0NA 5L3FA 3TO7A 2UUZA 2R7ZJ 5K5OA 2A69F 4GRIA 1FNNA 2YPRA 3D0SA 1IDZA 2R7UA 3KE2A 2Z16A 3T8RA 3TOAA 3DPUA 3I5UA 4U0WA 5DEQA 4ZYGA 3L2CA 2QEXI 5FLXZ 1B1BA 2LYQA 2W57A 3QODA 2DMNA 1W0TA 4A69C 1EJ9A 1E17A 4HX7A 3A0BC 4LJZF 2E2HJ 1SAXA 2VONA 1R5HA 2O0YA 4IF4A 5LFAA 2BY2A 4F52A 1UELB 4YBAA 2CRGA 2PE5A 3J7ZI 2DT6A 3F9KA 3M1EA 3BPXA 1FLIA 2WADA 1I50J 1LFPA 2P6TA 3TO6A 3GN5A 1U2ZA 5DTMA 1RUOA 1MBFA 3S1MJ 2HTSA 2DPDA 4FX4A 1T38A 1ETVA 3PNYA 1MBGA 4ETSA 3BG9A 3IH2A 3AL0B 1W7PA 4XM3A 3RKXA 2NS8A 1G8XA 2J5OA 2G7HA 3HRSA 3ZQFA 2B9SA 3BZCA 1MGTA 5GPCA 2IS6A 2IRFG 4I6TA 3DKYA 1USTA 1WCMJ 1X3UA 2XDVA 1ULYA 3J7YJ 3F51A 4EKIA 3CQZJ 3DTIA 3FIWA 3L2QA 5JVGF 1QPZA 1Z7LA 2UXXA 2NRAC 2OU2A 3J7AO 5C4JJ 2ZJQF 5JFRA 1SAUA 1W36C 3C7JA 1S8NA 5EG0B 5E8GA 4EZIA 2MC4A 3GZ5A 3ZPXA 3F6WA 3NROA 3OWQA 3MKZA 1WJDA 2JA8J 2KDOA 4N9IA 1I1GA 2EIKH 3M8FA 3L2WA 5CVUA 1FSEA 4W97A 2HVRA 4BY1J 2L9NA 4RAFA 1RUNA 1JWLA 4I8TA 1R7JA 1UTXA 2EINH 2FQ3A 4BHBA 2VXDA 3OYMA 4XLEA 3OYNA 2MC3A 3BPVA 3DF8A 2NS0A 1LE8A 1RPWA 1QRYA 1CJGA 4XOTA 4GCVA 3NXHA 2DBBA 2ZO4A 1TTYA 4FE7A 1QZXA 1LJ9A 3TW6A 3HB9A 1QGPA 2QQ9A 4M72A 4C30A 3MLFA 4A0YA 4BUPA 5F27A 4LLNA 3ZMSA 2WAQN 1EH6A 1NHAA 4HQMA 3ZMUA 3MQ0A 1OCCH 1S9HA 2Y30A 3CCEI 2K9SA 3MZHA 2PI0A 2Y2ZA 1TWGJ 1DW9A 3G7DA 2XPUA 2M4HA 4IL6C 3SXYA 3L2VA 2W24A 1B9NA 2G9WA 2HYJA 3P9IA 4M3DA 4XMYA 3T1BA 3ZQ7A 4X0GA 2ODRD 1P92A 2FD5A 2F5VA 3IH3A 2QVOA 4XSZF 5ICEA 1JTXA 4A2UA 1ACIA 5TISC 3WGHA 3W2VA 3FXOA 1ZGJA 4D9JA 4OIRF 4HOBA 5EYRA 2R5ZA 4C3IJ 1V5FA 1ETXA 2KL4A 4M74A 3JRCA 1WJBA 3S16J 3SCFA 2CQ7A 4W1UA 3BWGA 1KQ0A 4EJVA 4MGRA 2AXUA 3TEDA 2J7WA 2H1LA 1Z77A 3P7NA 4C2UA 2V4JC 5ICFA 3LQRA 4L0YB 4Y3OA 2LK2A 4WF2A 4G7HF 2XRLA 2PJRA 4XN0A 4CSWA 3VDXA 4PU4C 3GLLA 5IP6A 3VSLA 3CDHA 4UUSA 4LB6B 1Y1VJ 5HNHA 5J1UA 1A35A 3BP8A 3RIRA 4A93J 1A6QA 1YW7A 2ECCA 5JVTA 2A6HF 2CWEA 4JQFA 2FF4A 1QNTA 2KPMA 4B09A 5DT2A 4HSTA 1VQ4I 5FLVA 3DFGA 3COAC 2K4BA 1HA8A 3WTTC 1D1CA 1PP8F 3JR9A 2K85A 3RYPA 5J8FA 1VQLI 5DCMB 2Y75A 2KDZA 5JUWA 3KEOA 1UHMA 1MNMC 2HKXA 2HQNA 1D0ZA 3PO3J 5CVRA 1T2KA 3KP2A 2XXPA 3CDLA 4BH9A 1WWXA 3OYJA 1RZRD 4XONA 2JN6A 1T33A 4Y42A 4H0EA 1DP7P 4WX9A 1P4WA 3AFHA 2MLGA 2LYJA 2DQLA 3LSRA 3RI4A 3F23A 2Y69H 1I5ZA 3ASNH 4OBMA 4OWRB 2HOSA 4M9ZA 3GUDA 1JHHA 3E5XA 2E35A 4RAGA 3WODF 5GP9A 1ZLJA 1R58A 3G2BA 1ZR2A 1TWHJ 2EZLA 2M1BA 2PQ8A 1J7KA 1VQKI 2IU7A 3REOA 2EK5A 2CUFA 4BEHB 1R4NB 5LGTA 3OS2A 2P5KA 1W5SA 4RAZA 1GHCA 2VBZA 3HZJA 2YR2A 2XAQA 1RESA 3TBIA 3FMYA 2OV7A 1BW5A 5FB2A 2TDXA 2V1NA 3KYCB 3A01A 4HDVA 1Y9QA 4DJAA 2R3SA 3U1KA 1ZR4A 2VOPA 4NC6A 3HBLA 1J59A 4KMFA 2DXIA 1IZ1A 2YU3A 1MZBA 1T0FC 4HX4A 4UB8C 1FIPA 5J1RA 3J7AY 3CJQB 5GAHi 2UZKA 3OMYA 4M3BA 3ROUA 4Q48A 2KRHA 1ZRFA 1R5ID 2CUEA 2X9DA 3LQQA 2BOLA 2O3FA 3WHCA 1BI2A 2DT5A 4WVLA 2XF6A 4MCTA 5D5XB 5LEKA 1EFAA 3BG7A 1DULA 5AIPA 3F6VA 3KX2A 4M3EA 5DV5A 1VQ6I 5ICGA 1E3OC 1N25A 1YLFA 1U9OA 1BW6A 2DODA 2E1MC 1XX5A 4QPOA 3F22A 2PUCA 2XSDC 2LKXA 2XF5A 3ZGKA 2AXTC 2DA1A 2PUEA 1Z1DA 2DW4A 3JSOA 2ZMEA 2O61A 2IXSA 1XGOA 3QQ6A 3QOEA 1IN8A 1TQMA 1YHQI 4UV9A 1TL8A 1BR2A 1H9GA 3BS3A 2X6YA 4C3JJ 4EM2A 1VQ5I 4JX4A 2IUOA 4AIHA 2DA3A 4M73A 5B1BH 5KCMA 2DMPA 3F3XA 2E1NA 1SEUA 3JRBA 4F55A 4KN4X 4Y13A 1ZZ6A 1QP0A 2AHQA 3ZQLA 2LLKA 3OYFA 4II2A 3HRUA 1OYWA 2BNMA 2EV0A 1W0UA 3FDYA 3QOPA 1ZVVA 3GLXA 1QP4A 1O3SA 3IWFA 3RTRA 3PQKA 4MTDA 4PU7A 4ZYHA 2OTJI 1A31A 1FP1D 2Y0SN 4YFKF 5HVQC 4A3MJ 4XRFA 1GT0C 4EVIA 2KKOA 2LYLA 2OF7A 2M8GX 1SC7A 3GZCA 3TFLA 1MH4A 1T98A 2V7FA 2VIXA 1TNTA 4U88A 4DZJA 2V1XA 2ISYA 2MD5A 1OYYA 2KIUA 5ILSA 2HTJA 4DYRA 5DM7F 4OMYA 3M9LA 3SX0A 4PGHA 4AVZA 4ZDLA 1APLC 1ON1A 2FJRA 3OL4A 1T39A 5ILUA 2P4WA 5JLWA 2DFEA 1FTZA 2L9RA 1BI3A 4U0YA 2H94A 4GQMA 3CC2I 1H8AC 1P9QC 4PSWA 3ZOBA 3HPGA 1YG2A 3BQZA 4O6JA 2FBIA 3PM1A 2BXZA 5DTQA 3I53A 1IRXA 5JHFA 2OCEA 4FX0A 4Y33A 1MBJA 1OCTC 3S2DJ 2LKPA 4E7ZA 2I8DA 3BTIA 1IUFA 2DA4A 2GWRA 3CESA 3Q0VA 1QVTA 3VWBA 1BC7C 1FBUA 1STZA 1A6IA 2A05A 1OMIA 4AC0A 3OSFA 2IPQX 2R7FA 1I39A 3TO9A 2BEOA 3I4NJ 2QQ8A 3QWGA 4PJNA 2RDPA 3ZMZA 4DBQA 2MEZA 4XICA 4M3GA 2PMZN 3TELA 2DCEA 2ZBKA 4HNUA 2ECBA 1Z9CA 3U1DA 3U2RA 2DDBA 1LMB3 4ZYEA 1XCBA 2VQGA 4C2MJ 2P8TA 3HKZA 3S3OA 1FTTA 1ZYRF 3H9GA 1QZZA 4NQWB 1SVLA 4NB5A 2LYPA 2Q0OA 4PZJA 3VWSA 1OJLA 2BZTA 5HDKA 4HW0A 4B48A 3LSTA 4BBRJ 4FASD 1CGPA 1FSHA 3NRVA 2IVBA 3ABMH 5KAFC 4CICA 4M9SA 1DU6A 2WAFA 3LAPA 3KP4A 2RQQA 1QBJA 4OU0A 3WTUC 1SVMA 3ABTA 1JTYA 5CLSA 1XSVA 3IH4A 5KAIC 3ISPA 3I64A 1YJWI 4CCLA 3ZQQA 4F3QA 2K3FA 3VPRA 2E1CA 1VI0A 3S17J 4LLGF 4E7JA 3SQNA 3BD1A 1PRVA 3KZYA 5EZGA 5KHDA 2KEIA 2IT0A 4EEFG 1W5TA 4CA0A 2XIUA 1BBYA 3S1RJ 2M5WA 1ZG1A 2PXFA 5CPRB 3WGGA 2WWYA 2VJJA 3KXAA 4NHJA 1PERL 4BDYA 4O3MA 1YX5A 2FBKA 2OQGA 1OLTA 5J4YA 2IGMA 1MFQC 1ZS4A 2JPBA 3W6JB 2R7VA 3CF2A 1G3WA 2WY8Q 5D4RA 3C2BA 4KT6A 4JOMA 4FBIA 2HQ5A 3I59A 3B6AA 4AU7A 3C3WA 1MMAA 3CP2A 2KLOA 3PFYA 2XCJA 4EJWA 1TWAJ 4H4KC 3DBHB 2DPUA 4L5JA 2X6WA 4WXHA 5B5EC 2VLAA 3HXLA 2HQRA 3O9XA 1FP2A 1ERDA 3GFJA 1D3YA 5E1WA 2X1CA 3WTWC 2CFXA 1L3LA 4BBSJ 1MJBA 1REPC 2OJED 4HLYA 1E0EA 3IVPA 2CQKA 1ZRDA 1ZN2A 5A2QZ 1XWRA 2MFZA 3K70D 2LP0A 2L01A 3LSIA 4X4DA 3G4SI 1XD7A 4GYIA 3RPQA 1VF9A 2F4IA 3R4KA 4CUGA 1TBXA 3ML6A 2WV1A 4RLQA 1TP4A 2BY3A 2VXZA 3JRFA 2F5DA 4N4OB 4UUTA 4A3FJ 3HYIA 3F8BA 3LWFA 4UHTA 2XB0X 2CW7A 2HKOA 4IPAA 4UXNA 2HZDA 5C3EJ 3M1CA 3SCGA 1FPQA 3SEZA 5J8CA 4LIVA 3O2PE 2GM4A 4Z5DA 2CV2A 2M30A 1R9TJ 2Z3YA 1X4OA 1XDSA 4JYKA 1X19A 2E1OA 4C3HJ 2F4OB 1UHWA 2D5VA 2PXUA 1ZG3A 4E7LA 5E1XA 2VASA 1B8IA 1WSUA 2FOWA 5LD2C 1MBKA 4OMZA 2DMUA 1PJRA 1U5TB 1EF4A 2BV6A 2XF7A 3DBRB 5GPAA 3K0LA 1MNDA 4FCYA 2O9LA 5FKLA 3QFIA 2XPWA 2LYCA 1RKWA 5JLXA 1BI1A 2XIGA 3FKIJ 2AXLA 2E7WA 1IG7A 2W4SA 4U7BA 3JAMK 5HDNA 2V9VA 1MDMA 3QQAA 3NWSA 2IGNA 1MMNA 2JUGA 3OIPA 1O3TA 2PN6A 3ELKA 3E6BA 3LSJA 4U87A 3FYMA 3ECHA 3ZMTA 1JUSA 4AIDA 1ZZBA 4KICA 1SFOJ 3MEJA 3OMTA 4MCXA 2RKHA 1YI2I 1Z3XA 2EPFA 4FHTA 1IW7F 3BOQA 3K7AJ 1PUFB 2Z33A 5IP9J 3CZ6A 4P55A 3VODA 2P6SA 3CCRI 1BN5A 5D5WB 2ZFUA 1K78B 3H5RA 2HDCA 3HJEA 2V3CC 5LEJA 1ZRCA 1HW2A 2L1PA 3JXCL 3P5JA 3QAHA 4P9FA 3KLNA 3O8GA 2VUMJ 3R61A 4RGUA 2R7DA 4RB1A 3QPLA 2XVCA 3W3CA 1BR1A 2LSOA 2HI3A 2KP6A 4UVCA 1N75A 5EGOB 4LGWA 3CCSI 2MQKA 3E5UA 3ZQGA 3L9FA 4QIWN 1DP3A 3LFPA 1O57A 4MO7A 2DK5A 2V1DA 2XXAA 2FNAA 5LBQA 4XLCA 1YOVB 4HSRA 5IY5H 4ENKA 1ENHA 3HOYJ 4RGSA 1GVJA 2W84A 3MKYB 2DYRH 2R7XA 3HDDA 4F92B 1OKRA 1YJ9I 5H6QA 2JWTA 4AM3A 3PFIA 3PE5A 4G12A 2VL8A 2CO5A 1H88C 1YJNI 2BNOA 1S7EA 3DEEA 2DN0A 2P7CB 2EJRA 1TLHB 4II3A 4ZDOA 3OOUA 4PJ0C 3WG9A 3GFLA 4XSXF 4FISA 4G9YA 1G6NA 3CMYA 3E0JB 1RIOA 1RETA 2RV8A 4HF0A 1ZUGA 3CC7I 5KK1A 5K7ZA 1XDUA 2OUMA 1J9IA 2CSOA 5BQTA 3O6BB 4YFNF 3BJAA 2HPMA 2HSGA 4CCNA 1SFKA 4U7DA 2JVLA 1YIOA 2DMTA 4M71A 1YITI 4Q4ZF 3LSGA 3I55I 1L1MA 4B1RA 2FEZA 2QWWA 3RQ4A 3BTLA 2IVMA 2E19A 3KYDB 2DOFA 3S3MA 2LY2A 1Q1HA 5EG0A 1J2XA 5BMZA 2WY7Q 1WJEA 3IP4B 2RAEA 3K6GA 1SD6A 2D1VA 4AD9A 2LOOA 4BQNA 5FLXK 3F0CA 4YIIA 3GEZA 3I9V2 1XG1A 2E7XA 3FISA 1QVUA 2M0MA 5E3LA 4I6UA 1NK3P 2KEKA 3JRGA 4BACA 3GX4X 2ISZA 1V54H 1F36A 3F8MA 1X2LA 3HG9A 1OISA 1P7IA 3N05A 4FT8A 3QYEA 1MNEA 2O49A 2WAQA 3QRFF 1B6AA 1BA5A 5BNGA 3EYIA 4GYGA 3HZIB 2LCVA 1RZRA 3F21A 4L5IA 2XHKA 2MABA 4RA2A 4C9YA 3NWTA 4BJ5C 4ZYAA 2M4KA 4XLNF 3DNVB 4BJ6C 1P4XA 2ZJ2A 4IHTA 4FE4A 1RC9A 1YO5C 2LDUA 3H9JA 2JRMA 1B4AA 1FX7A 4P1WA 4DYCA 2GXBA 1X57A 4PJLA 2F5EA 4F91B 4CH7A 1D1AA 1FOWA 4A3LJ 3CCYA 1NEQA 1AWCA 1XSDA 3Q3SA 3A9ZA 4GDFA 3M8JA 3HOVJ 3PNTA 2E5NA 3NZLA 2K86A 1EV7A 5FKMA 5FFXA 2VEOA 1LVKA 1QQAA 4B4CA 4QWQA 1JGGA 3K1NA 4BAYA 4KUMA 2LF7A 1R5GA 2MBFA 2MLKA 2IVGA 4BL0B 1OR7A 4Z2YA 3UR3C 1YS6A 3V8JA 5BPDA 2B63J 2B5AA 1IN7A 2VE8A 4AYBN 2PLYA 5DCFA 5FJ8J 4TV7A 5FRMA 4NDWA 4MLOA 2OTLI 3Q0UA 1WJCA 4YIRX 3OKZA 2K02A 3FYAA 2QLZA 2R7RA 3ULQB 3Q5FA 3R0AA 4D7MA 1R00A 2OBPA 3EETA 5H6RA 3AAFA 3KZIC 1N77A 3FMSA 4LMYA 2PG4A 4KJZA 3GWZA 4ZJZA 4D7NA 4HZFA 2EZKA 2XRNA 2MYSA 4JCYA 3KIOA 4YARA 2F2EA 2NVYJ 2ZXHA 3ABUA 5FROA 1VTNC 1CF7B 1GXPA 3M7GA 1IUYA 1R22A 1R1TA 1S29A 3KFWX 1IRGA 1VQMI 3C2GA 5CVJA 4JX6A 4X4BA 2K9QA 2ZXWH 3MN2A 5DTDA 1TW3A 3LFKA 2XUBA 4IHXA 3WHBA 3IHUA 3LA3A 3WTVC 1WH8A 2BW3B 2Y9ZA 1FWZA 2CQQA 3K70C 3EYYA 5DCMA 4A3CJ 2Q8KA 2OZUA 3DKWA 3TDUC 2CUZA 2WAEA 2JUCA 5CQGA 3PIPF 2R1JL 5LHHA 4HV6A 4UVAA 4YIFA 2ZMEC 1KZHA 1PRUA 4I09A 2K7LA 4XK4A 1J75A 3K4NA 4M9XA 5H20A 1JXSA 2XAHA 2DDAA 1VNDA 2JSPA 1I27A 3PSFA 4QSHA 4CHUA 5IP7J 5F04A 2CGPA 3A02A 2NYXA 3AG2H 1C0WA 5E17F 2VI6A 4LB5A 3GTGJ 1HC8A 2HS5A 3F8CA 1SD7A 4Z6YA 2K9NA 1XMXA 3H92A 4Y17A 1SMYF 4EM0B 2WTEA 5ERIA 1KQ8A 4RB3C 1X2NA 2JRTA 2KJCA 1ZQ3P 2CQNA 4X4FA 1RKTA 4BEHA 2O5RA 3CTAA 3PO2J 4XNFA 3KLOA 2X4HA 2QZ8A 3BZ6A 3CO6C 2IS4A 3CF5F 2XROA 3LA7A 3CLCA 1HDPA 4JQDA 2AQEA 1O4XA 1IRZA 2ZSHB 3E6DA 2QCOA 4I6ZA 3GUUA 5CKTA 3JRDA 1FYLA 5F64A 4A3GJ 2XSJC 3S3NA 5BPIA 1Y7YA 3GXOA 2CV0A 1SQ8A 2HXOA 2X6XA 1RRJA 1X1BA 3BR1A 1ETOA 3ERMA 5CQEA 5B1AH 3QWLA 4ON0A 4X4HA 4GGGA 1Q1VA 2H8WA 5E3NA 1UJ8A 2VPRA 1VQ8I 2IV1A 1JHFA 3M07A 1S72I 1RZ4A 1MMGA 3LISA 1XTAA 1RZSA 1ETKA 1XN7A 1R71A 3IAS2 2KPJA 2VQCA 3CUQB 2K9LA 4I6RA 2HOTA 1TT5B 4M6VA 1BIAA 2H6BA 1HKQA 1Y6IA 3VEPA 2R7WA 3DM5A 3WG7H 4CO8A 3GTLJ 3KL4A 3BR3A 3V8LA 1WHUA 4DQ2A 4A3JJ 1I3AA 2R7QA 2ADUA 1EH7A 1MD0A 2RVCA 4RLFA 1DU0A 2L0KA 2QQBA 2X1EA 5TRDA 2EILH 1J5YA 1VQOI 4DGWB 3O3KA 2O4AA 2AWIA 2UXNA 4KIBA 1JT0A 1YW9A 3HC7A 2BE5F 3K9TA 4UV8A 1LVAA 3KYLA 1YFHA 1D0YA 3LL7A 4KITB 2X6OA 1AOYA 1XC5A 2R63A 2KHMA 4X4IA 1YE9A 3E1SA 4ENNA 1ZHFA 1U3EM 1F43A 2Y31A 3R60A 1ETWA 1R36A 2A68F 4EQZA 1B9MA 5B66C 2MA3A 3LQXA 2KISA 2Y0SA 1UB9A 2JMWA 1HCRA 1Y56A 2H1KA 1I3QJ 1V4RA 4MQVA 1YRNB 1S5LC 4JP0A 4A0ZA 1NW3A 1K61A 4HQEA 3FXUA 2E2JJ 4BU2A 4BE2A 1WH6A 3NARA 2EZIA 2VKDA 3GZ6A 2Z99A 1ZLKA 2EFWA 5M3FJ 2PXPA 5IOYA 4IXAA 4L9NA 2MXDA 2E34A 4JCXA 1FT9A 4OAZA 1V55H 2Z5UA 3RJPA 2J5PA 1O3RA 3DLLF 1FC3A 3FK7A 3GVAA 3I58A 2NOJB 3GW2A 4A3DJ 2VT3A 1JKPC 3FBIB 4BE1A 1HF0A 4HX8A 1D8JA 2J7UA 3EDPA 1LB2A 1IXCA 4Z5CA 4IZZA 2QBYB 1D8KA 3BDNA 2RNGA 5J47A 2LLWA 3L2RA 1WJAA 5F0CA 5E79C 1O7LA 5J4VA 3TEPA 1MH3A 5LHGA 1CQTA 4FETA 4M3FA 3WTXC 3MAJA 3IKTA 1K83J 2QKLB 3S2WA 2F4MB 1OPCA 2L4MA 2PMZA 4LIUA 1O3QA 2EV5A 2EB7A 3QYBA 3VYUB 3RKQA 1OYIA 3ZR8X 2FQ4A 3PL8A 5LLQA 2HINA 4Y15A 2ICPA 4HLXA 2COBA 2P7VB 5A7LA 4X6AJ 3OYHA 2PUFA 3VYTB 1LEBA 2VKEA 4YEJA 3W2WA 1VQPI 2ME0A 3MVPA 1R69A 4Z5HA 3KP6A 3TQNA 3OYDA 4LK1F 1YS7A 2CMPA 2KIQA 3FM5A 4BHCA 1QA6A 4OOIA 4PJMA 2ELHA 2VOOA 3DEWA 2MGQA 2Y0MA 1N78A 3G5GA 1POUA 2R4GA 1KYWA 4NQWA 3JXDL 2HZTA 2ZNZA 2IAIA 3S15J 2HXIA 1S7OA 3A1YA 3JRIA 3BZKA 4YG2F 1IV6A 3Q9SA 4RS8A 5E1ZB 2K3PA 2QUFA 2R7OA 4P9UA 1XSXA 3A0HC 1IGNA 3JRHA 1IN6A 3HUGA 4PSXA 1JKQC 1YQAA 2IEKA 5FKOA 5F1RA 2V9KA 3ABKH 2GA2A 2HFZA 3K2ZA 2JTVA 3DTKA 1NK2P 1ZG5A 1L0OC 3M8EA 3P9KA 2XC7A 2O6GE 2PXVA 2HGCA 3I56I 4D1QA 1X1DA 3G6EI 1H9TA 3O8HA 1ZK8A 9ANTA 5DDGA 4EATA 3WTSC 5HLTA 1Y1WJ 2ZSIB 4I01A 3EUHA 1OQYA 4ZZLA 2B7EA 4HNVA 2ME6A 1JFSA 4G6TB 3GYHX 1ONVA 1SANA 1P4AA 1D5YA 1I6HJ 2V6CA 3H3ZA 3E6MA 3GFMA 3KP5A 4OAYA 4EGYA 3OL3A 1DQUA 1MSFC 2H8RA 4YG7B 3ABLH 5F0FA 1XB4A 3HRMA 2W00A 4GXOA 3HOWJ 2CH0A 3CUOA 1RIOH 1PDNC 2W82A 4HPQA 1ZTRA 5GAHJ 2EA4A 3ASOH 5FKKA 2XAFA 5DYMA 2BVLA 4F7ZA 4XLFA 2R92J 4Z59A 5H2FC 3EUKL 4RM2A 4Y52J 2LYSA 3OQOA 3HSRA 3BR6A 5GAGi 5ILVA 1R49A 1RR8C 3KPHA 1D1BA 2FRHA 3UNGC 3BC8A 2M7BA 4XKVA 3A03A 1WPKA 1U0JA 2XGXA 4IHWA 3FXMA 2JA7J 1E2XA 3S2HJ 5ICCA 1YSEA 3BR0A 1T6SA 2L7ZA 3CMEI 3FKJA 1DPRA 2DA6A 3W6VA 3CMAI 2L02A 2AW6A 1JGSA 2LC2A 3MFKA 3VB2A 3H5TA 2DA2A 2O7OA 2DU9A 4BJTA 5IYCJ 5HNFA 2VN2A 5JHUA 2R93J 2L3DA 3JCUC 4IX7A 1NG6A 2PMHA 2ELKA 3KEQA 1UHSA 1AKHB 1O7FA 4A6DA 3G73A 4BS9A 1G3TA 2CU7A 3BJOA 2DA7A 1SFUA 1W5CC 1QP7A 4L9JA 1BOBA 2M2EA 2WA0A 2OZ6A 1U5TA 3KETA 3V8KA 1VQ7I 3CJNA 2A6CA 1UG2A 2I5UA 3R6SA 3LOCA 5D8KB 1R1UA 3HGGA 2LYKA 4P5OA 3CCMI 1NTCA 3IWZA 3AL0C 4I02A 3GBFA 1YYVA 2G0EA 2OD5A 1OFCX 3OIQA 3LNQA 2W1OA 1IAWA 5HOOA 3FBNB 4UUVA 2WBMA 1BI0A 5EF6A 2EZHA 4BDZA 3LSHA 3PUBA 3HEFA 1W36D 3W2AA 4HRIA 3SDBA 5A2QK 1S3JA 3S1QJ 2EFQA 1HSTA 4PFOA 1YTYA 1HLVA 1A04A 1WGXA 5M5XJ 4HG2A 1UMQA 3K4CA 1IRFA 3FK6A 3TKYA 1ZAOA 2EBIA 3OV8A 4WWCA 2O03A 3ZHMA 2RC4A 4QTRA 4WK8F 3RKYA 4AIKA 1GVDA 1PUFA 1LCCA 2XB5A 2KRFA 4AIJA 2KZVA 1WJ5A 2KFDA 4MHGA 3NQOA 1E3PA 1K78A 4BXXJ 2R7SA 4L0ZB 2EFNA 2ID3A 3L2UA 1LQCA 2YSRA 3G1OA 3QPSA 4B44A 3SZPA 5D8LB 1NH3A 1T95A 2KRCA 2R7TA 1FBQA 3BROA 2FOKA 4FQGA 4KISA 3V7CA 3FX3A 2D2WA 1U8BA 1TT0A 2L2OA 4LITA 2GLOA 1PUEE 4X4CA 1LNWA 1KYZA 3MZYA 1F4KA 2DJIA 3A9XA 4Z58A 5F1JA 3BCAA 4HNTA 1OCZH 4F8DA 4EM1A 2MH9A 2JA2A 3OWTA 1YX3A 5TGTA 4XQFA 4EQQA 3L09A 3U9GA 2STTA 5EDNA 2VB6A 2QYOA 2VC0A 4D0PA 1OCPA 3HSEA 3B02A 4DIQA 2FFHA 2F5CA 3EPZA 1X1CA 3TOBA 2EF8A 4RGRA 4PFPA 5DD8A 4OIOF 4KA4A 2HU9A 3ONQA 1LFUP 2D45A 1K6OA 1WVRA 2RREA 1U6GA 2EFOA 1MMDA 2HFHA 1B72B 3BJ6A 3DPTA 1LDKB 3BDDA 1UFMA 3UKGA 1GV5A 1OR7C 2DJNA 4HAMA 4CGZA 4UB6C 2CSFA 2BVMA 1BM9A 3HOSA 3LSPA 3DP7A 1UAAA 2QSGX 2FNPA 3DU5A 2CJJA 1Z7UA 3MWMA 5K1YA
chains in the Genus database with same CATH topology
1T33A 4Y42A 2IVGA 2LYJA 3LSRA 2B63J 2MSYA 2B5AA 1POGA 3SDGA 3TW7A 4AYBN 2HOSA 5FJ8J 2KT0A 1ZZ9A 3SCHA 5GP9A 4NDWA 4MLOA 3R1FA 4Y7NJ 1ZR2A 1TWHJ 4MIMA 2EZLA 3Q0UA 5K7HA 4XRMA 1U78A 3JREA 3FYAA 2IU7A 4D7MA 1MBEA 2CUFA 5J1YA 3ZQHA 1GUUA 2Y9YA 1RESA 4O8BA 4D7NA 3FMYA 2EZKA 1BW5A 3S1NJ 3A01A 1Y9QA 1UXDA 4JCYA 1ZR4A 4YARA 2NVYJ 3H3VK 2K40A 3HBLA 1ETYA 4X1EA 1Z0XA 1FIPA 5J1RA 4IHYA 1UXCA 3B7HA 2MG4A 4M3BA 4JX6A 4X4BA 2K9QA 1PNRA 3MN2A 5F0HA 2LD5A 2AO9A 5DTDA 5K7FA 2XGCA 2PIJA 2CUEA 2ZB9A 3PXPA 2X9DA 1ITYA 1ORKA 4IHXA 3WHBA 1G2HA 3WHCA 1WH8A 3RZZA 2Y9ZA 3F52A 1JH9A 2CQQA 4MCTA 1B72A 4A3CJ 1EFAA 4PU8A 3KJXA 4M3EA 3HOZJ 2R1JL 1E3OC 2MW8A 2DMQA 1PRUA 1U9OA 2DTZA 1BW6A 4XK4A 1JKOC 2PUCA 2PUBA 2XSDC 2YS9A 2LKXA 1VNDA 4QSHA 2DA1A 2PUEA 2CQXA 5IP7J 5F04A 3A02A 4GHJA 2L8NA 4X4EA 2VI6A 2AXZA 2ICTA 3GTGJ 1A5JA 3QQ6A 2R5YB 2K9NA 4YG4A 2PUDA 1PRAA 3BS3A 4C3JJ 1X2NA 5EZHA 1RPEL 2PUAA 4JX4A 2M34A 2IUOA 3UFDA 2DA3A 1ZQ3P 4X4FA 1RKTA 2M0CA 2DMPA 3JRBA 3OQMA 5C44J 4D5CA 3PO2J 5EGOA 1ZZ6A 1ZGWA 1R63A 1QP0A 2AHQA 1JUMA 3ZQLA 3CLCA 2LLKA 1XS9A 1HDPA 1JUPA 4JQDA 1O4XA 1IRZA 2CROA 2QCOA 4I6ZA 2BNMA 1W0UA 3JRDA 2GRMA 4A3GJ 4FTHA 1ZVVA 4A3KJ 1Y7YA 1WIZA 1QP4A 1SQ8A 2HXOA 3BTCA 2EQRA 1TC3C 2OPTA 2XPVA 3E7LA 3Q0WA 4PU7A 3BR1A 1ETOA 2Y0SN 3BR2A 4A3MJ 1GT0C 4MFEA 2LYLA 4X4HA 2OF7A 1Q1VA 2M8GX 2I10A 5E3NA 1QPIA 2IVQA 5K98B 2LY9A 2VPRA 2IV1A 2WUSR 1MH4A 5E3MA 1JJ8C 3LISA 4DZJA 1RZSA 3HOUJ 1ETKA 1WI3A 3HKZN 5M5WJ 2LR8A 4DYRA 2KPJA 4YG1A 4A3EJ 2JA6J 2XI8A 4I6RA 2BJCA 2HOTA 4M6VA 2GBYA 1APLC 2FJRA 2AUWA 3D1NI 4V2GA 1ZZ8A 4IA8A 5JLWA 1FTZA 3GTLJ 2L9RA 3BR3A 2TCTA 3SFIA 1TWFJ 4GQMA 4A3JJ 2IBDA 1H8AC 3ZOBA 5IYBJ 4AUXA 1DU0A 2L0KA 3BQZA 3GTQJ 3PM1A 2W48A 2O4AA 1BDIA 2XJ3A 2AWIA 3BT9A 3HGYA 1JT0A 2NVXJ 4PU3C 3JRAA 1MBJA 2JK3A 2R5YA 1OCTC 3S2DJ 3BTIA 1IUFA 2X6OA 2DA4A 3Q0VA 4I76A 1QVTA 1XC5A 3GBGA 1RR7A 4L5EA 2R63A 2O38A 4X4IA 3OSFA 1A6IA 1GV2A 4AC0A 3HM5A 3OQNA 1F43A 3CROL 2Y31A 1ETWA 3RZDJ 3I4NJ 5C4XJ 1VFCA 1GDTA 5J3LA 3QWGA 2MEZA 4XICA 3NAUA 4M3GA 1X58A 2VKVA 2JMWA 2PMZN 1HCRA 4CYCB 2H1KA 2ECBA 1ZZCA 1I3QJ 3HOXJ 1YRNB 4JP0A 1LCDA 1LMB3 3BTJA 3BG5A 4C2MJ 1IDYA 1K61A 2E2JJ 3JXBC 5M5YJ 1FTTA 1WH6A 3NARA 2EZIA 3K2AA 4IWRA 2LYPA 5M3MJ 1OJLA 4BBRJ 3B6CA 2IVBA 5M3FJ 4DW6A 3VK0A 5IOYA 3GTOJ 4DZPA 1DU6A 5DS9A 1T56A 4JCXA 1JTYA 3FK7A 4GFBA 3ZQIA 3IH4A 2DA5A 4A3DJ 1JKPC 1HF0A 5IOZA 2O8KA 3VPRA 3GTKJ 1VI0A 3S17J 4FN3A 3BD1A 1PRVA 1VPWA 4BKXA 5EZGA 1AU7A 3GTPJ 2XGEA 4Z5CA 4S0HB 2KEIA 2R0QC 2EH3A 3BDNA 4EEFG 2EWTA 3GTJJ 3TRBA 2XIUA 5F0CA 3S1RJ 1B8IB 2NVQJ 3QF3A 4XRSG 3OSGA 1BJZA 1MH3A 1CQTA 3KXAA 3GTMJ 1ADRA 4M3FA 1PERL 1K83J 2YU9J 3G1MA 3SJMA 3IV5A 4DYQA 1ZS4A 2OFYA 2BNNA 3C2BA 4J19A 4A3IJ 4FBIA 2HQ5A 3B6AA 3RKQA 1WH7A 3GN5B 1TWCJ 2FQ4A 2FX0A 2XCJA 2HINA 1TWAJ 2ICPA 1MSEC 1ZAYA 2COBA 1FEXA 5A7LA 4X6AJ 3O9XA 2PUFA 2XGDA 2VKEA 5IPAA 2ME0A 3MKLA 3MVPA 3RQIA 1R69A 3ZHIA 4A3BJ 1JJ6C 1FIAA 4CYCA 4BBSJ 4BY7J 3I4MJ 3IVPA 4Z5HA 1XWRA 1YRNA 3DEWA 2LP0A 2MGQA 2NOGA 3G5GA 4X4DA 1OSLA 1POUA 1BDHA 1VF9A 2EBYA 3JXDL 2IAIA 3S15J 3TP3A 2PUGA 3S14J 2HXIA 2WV1A 4NDLA 3JRIA 4LOCA 1IV6A 2LTPA 2KEJA 3JRFA 4IHVA 4UUTA 4A3FJ 4ABZA 2JA5J 3OIOA 2E2IJ 1B0NA 2XB0X 5F08A 1IGNA 3JRHA 2R7ZJ 2LVSA 3CECA 1JKQC 5C3EJ 1IDZA 3BG3A 3SCGA 3U3WA 2IEKA 2GM4A 5FKOA 4Z5DA 1R9TJ 2KZ8A 4JYKA 2LYQA 1NK2P 4C3HJ 2E1OA 2DMNA 1W0TA 2D5VA 4A69C 3O8HA 1ZK8A 9ANTA 3BQYA 1B8IA 1MBKA 2WIUB 1Y1WJ 2DMUA 4RDUA 3L1PA 2E2HJ 3ZKCA 1AHDP 1EF4A 2FJ1A 1LE8B 5GPAA 4HNVA 2ME6A 1JFSA 1IC8A 4FCYA 1SANA 1D5YA 2CRGA 2O9LA 1I6HJ 4YBAA 2PE5A 1WETA 5FKLA 2XPWA 1H89C 1RKWA 5JLXA 1I50J 3FKIJ 1MSFC 3M4OJ 1IG7A 2H8RA 4YG7B 5F0FA 3GN5A 3HOWJ 1MBFA 3S1MJ 3QQAA 1ETVA 3LSJA 1MBGA 1ZTRA 3BG9A 3FYMA 3IH2A 5FKKA 1JUSA 4XRSA 1ZZBA 2NS8A 1SFOJ 2R92J 3OMTA 2X48A 4RBOA 3ZQFA 4Z59A 4Y52J 2LYSA 3OQOA 5GPCA 1JKRC 3BR6A 4I6TA 4MCXA 1WCMJ 4OB4A 4J1XA 1PUFB 1WH5A 1X2MA 3K7AJ 3F51A 3CQZJ 3FIWA 4D5FA 5IP9J 1FJLA 5E3OA 1QPZA 3A03A 1WPKA 4IHWA 2JA7J 2R5ZB 3S2HJ 2AXVA 5C4JJ 1YSEA 1LLIA 3BR0A 2L7ZA 3JXCL 2DA6A 3BR5A 3W6VA 5HODA 3O8GA 5EG0B 2VUMJ 2AW6A 3H5TA 3F6WA 3RZOJ 2DA2A 2O7OA 3QPLA 5IYCJ 3DCFA 1JT6A 2JA8J 2R93J 2HI3A 4V2FA 1JWLA 5EGOB 2MQKA 2ELKA 4W97A 4BY1J 4I8TA 2NVTJ 3ZQGA 4QIWN 1UHSA 1AKHB 1UTXA 3LFPA 1LFBA 4MO7A 2GZUA 2L7FP 2CU7A 2LYRA 2DA7A 3TP0A 1QP7A 4MFDA 4IEJA 2M2EA 1ENHA 3HOYJ 4UUSB 1RPWA 1QRYA 1LE8A 3KZ3A 1CJGA 3HDDA 2A6CA 1UG2A 3LOCA 4FE7A 3HGGA 2LYKA 2JWTA 1NTCA 3TW6A 3HB9A 1ETQA 2L7MP 3GBFA 4X4GA 3MLFA 2G0EA 5F27A 1OFCX 4G12A 2L49A 1H88C 2BNOA 1S7EA 2WAQN 3ZQCA 2DN0A 2HOAA 2LFBA 3LNQA 4J1WA 2Y30A 3OOUA 2K9SA 2JJ7A 2YUSA 4FISA 2EZHA 2Y2ZA 5EF6A 1TWGJ 3HEFA 2M9HA 2XPUA 1DW9A 3G7DA 2OR1L 3CMYA 4XIDA 1ZPQA 1RIOA 3S1QJ 1RETA 1ZUGA 4M3DA 2HYJA 1HLVA 1WGXA 5M5XJ 5K7ZA 2FD5A 1UMQA 3IH3A 3FK6A 2EBIA 1JTXA 2HSGA 3ZHMA 4QTRA 1GVDA 1PUFA 5FLMJ 2JVLA 2XB5A 4B3AA 1LCCA 2DMTA 5EYRA 3LSGA 2R5ZA 4IVZA 4B1RA 1L1MA 4C3IJ 4BXXJ 1ETXA 2ID3A 3BTLA 2HDDA 4JX5A 3EUSA 2E19A 3JRCA 3SCFA 2P81A 3H0GJ 3S16J 1LQCA 3G1OA 4W1UA 3QPSA 5EG0A 2GRLA 1HDDC 2RAEA 1MBHA 1U9NA 3M3YJ 1NERA 1ZZ7A 3F0CA 2AXUA 5EEAA 1XG1A 3TEDA 1U8BA 3FISA 3G1LA 1QVUA 5E3LA 2GLOA 4I6UA 1NK3P 4X4CA 2KEKA 1Z77A 3JRGA 1AKHA 2NS7A 1F36A 1X2LA 2LK2A 2XRLA 1P7IA 4Z58A 5F1JA 4PU4C 2O49A 2PPXA 1BA5A 5IP6A 2ID6A 2WB1N 5BNGA 3A01B 4F8DA 3HZIB 2LCVA 4UUSA 1P7JA 1RZRA 1Y1VJ 5J1UA 5EDNA 2TRTA 4A93J 2N8GA 2ECCA 3DNVB 1OCPA 1JFTA 4FE4A 2JCGA 5FKNA 2EF8A 4DYCA 1X57A 5FLVA 1LFUP 1QQBA 4A3LJ 1DWKA 3CCYA 1NEQA 3JR9A 1IJWC 3S8QA 1B72B 3Q3SA 5IYDJ 1BL0A 3QYXA 3HOVJ 3UKGA 3OP9A 1GV5A 1HOMA 2KDZA 2DJNA 2QF7A 1ZKGA 5FKMA 1MNMC 2CSFA 3PO3J 1QQAA 3LSPA 4B4CA 1JGGA 2CJJA 3CDLA 1RZRD 2JN6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T33 A;  4Y42 A;  2IVG A;  2LYJ A;  3LSR A;  2B63 J;  2MSY A;  2B5A A;  1POG A;  3SDG A;  3TW7 A;  4AYB N;  2HOS A;  5FJ8 J;  2KT0 A;  1ZZ9 A;  3SCH A;  5GP9 A;  4NDW A;  4MLO A;  3R1F A;  4Y7N J;  1ZR2 A;  1TWH J;  4MIM A;  2EZL A;  3Q0U A;  5K7H A;  4XRM A;  1U78 A;  3JRE A;  3FYA A;  2IU7 A;  4D7M A;  1MBE A;  2CUF A;  5J1Y A;  3ZQH A;  1GUU A;  2Y9Y A;  1RES A;  4O8B A;  4D7N A;  3FMY A;  2EZK A;  1BW5 A;  3S1N J;  3A01 A;  1Y9Q A;  1UXD A;  4JCY A;  1ZR4 A;  4YAR A;  2NVY J;  3H3V K;  2K40 A;  3HBL A;  1ETY A;  4X1E A;  1Z0X A;  1FIP A;  5J1R A;  4IHY A;  1UXC A;  3B7H A;  2MG4 A;  4M3B A;  4JX6 A;  4X4B A;  2K9Q A;  1PNR A;  3MN2 A;  5F0H A;  2LD5 A;  2AO9 A;  5DTD A;  5K7F A;  2XGC A;  2PIJ A;  2CUE A;  2ZB9 A;  3PXP A;  2X9D A;  1ITY A;  1ORK A;  4IHX A;  3WHB A;  1G2H A;  3WHC A;  1WH8 A;  3RZZ A;  2Y9Z A;  3F52 A;  1JH9 A;  2CQQ A;  4MCT A;  1B72 A;  4A3C J;  1EFA A;  4PU8 A;  3KJX A;  4M3E A;  3HOZ J;  2R1J L;  1E3O C;  2MW8 A;  2DMQ A;  1PRU A;  1U9O A;  2DTZ A;  1BW6 A;  4XK4 A;  1JKO C;  2PUC A;  2PUB A;  2XSD C;  2YS9 A;  2LKX A;  1VND A;  4QSH A;  2DA1 A;  2PUE A;  2CQX A;  5IP7 J;  5F04 A;  3A02 A;  4GHJ A;  2L8N A;  4X4E A;  2VI6 A;  2AXZ A;  2ICT A;  3GTG J;  1A5J A;  3QQ6 A;  2R5Y B;  2K9N A;  4YG4 A;  2PUD A;  1PRA A;  3BS3 A;  4C3J J;  1X2N A;  5EZH A;  1RPE L;  2PUA A;  4JX4 A;  2M34 A;  2IUO A;  3UFD A;  2DA3 A;  1ZQ3 P;  4X4F A;  1RKT A;  2M0C A;  2DMP A;  3JRB A;  3OQM A;  5C44 J;  4D5C A;  3PO2 J;  5EGO A;  1ZZ6 A;  1ZGW A;  1R63 A;  1QP0 A;  2AHQ A;  1JUM A;  3ZQL A;  3CLC A;  2LLK A;  1XS9 A;  1HDP A;  1JUP A;  4JQD A;  1O4X A;  1IRZ A;  2CRO A;  2QCO A;  4I6Z A;  2BNM A;  1W0U A;  3JRD A;  2GRM A;  4A3G J;  4FTH A;  1ZVV A;  4A3K J;  1Y7Y A;  1WIZ A;  1QP4 A;  1SQ8 A;  2HXO A;  3BTC A;  2EQR A;  1TC3 C;  2OPT A;  2XPV A;  3E7L A;  3Q0W A;  4PU7 A;  3BR1 A;  1ETO A;  2Y0S N;  3BR2 A;  4A3M J;  1GT0 C;  4MFE A;  2LYL A;  4X4H A;  2OF7 A;  1Q1V A;  2M8G X;  2I10 A;  5E3N A;  1QPI A;  2IVQ A;  5K98 B;  2LY9 A;  2VPR A;  2IV1 A;  2WUS R;  1MH4 A;  5E3M A;  1JJ8 C;  3LIS A;  4DZJ A;  1RZS A;  3HOU J;  1ETK A;  1WI3 A;  3HKZ N;  5M5W J;  2LR8 A;  4DYR A;  2KPJ A;  4YG1 A;  4A3E J;  2JA6 J;  2XI8 A;  4I6R A;  2BJC A;  2HOT A;  4M6V A;  2GBY A;  1APL C;  2FJR A;  2AUW A;  3D1N I;  4V2G A;  1ZZ8 A;  4IA8 A;  5JLW A;  1FTZ A;  3GTL J;  2L9R A;  3BR3 A;  2TCT A;  3SFI A;  1TWF J;  4GQM A;  4A3J J;  2IBD A;  1H8A C;  3ZOB A;  5IYB J;  4AUX A;  1DU0 A;  2L0K A;  3BQZ A;  3GTQ J;  3PM1 A;  2W48 A;  2O4A A;  1BDI A;  2XJ3 A;  2AWI A;  3BT9 A;  3HGY A;  1JT0 A;  2NVX J;  4PU3 C;  3JRA A;  1MBJ A;  2JK3 A;  2R5Y A;  1OCT C;  3S2D J;  3BTI A;  1IUF A;  2X6O A;  2DA4 A;  3Q0V A;  4I76 A;  1QVT A;  1XC5 A;  3GBG A;  1RR7 A;  4L5E A;  2R63 A;  2O38 A;  4X4I A;  3OSF A;  1A6I A;  1GV2 A;  4AC0 A;  3HM5 A;  3OQN A;  1F43 A;  3CRO L;  2Y31 A;  1ETW A;  3RZD J;  3I4N J;  5C4X J;  1VFC A;  1GDT A;  5J3L A;  3QWG A;  2MEZ A;  4XIC A;  3NAU A;  4M3G A;  1X58 A;  2VKV A;  2JMW A;  2PMZ N;  1HCR A;  4CYC B;  2H1K A;  2ECB A;  1ZZC A;  1I3Q J;  3HOX J;  1YRN B;  4JP0 A;  1LCD A;  1LMB 3;  3BTJ A;  3BG5 A;  4C2M J;  1IDY A;  1K61 A;  2E2J J;  3JXB C;  5M5Y J;  1FTT A;  1WH6 A;  3NAR A;  2EZI A;  3K2A A;  4IWR A;  2LYP A;  5M3M J;  1OJL A;  4BBR J;  3B6C A;  2IVB A;  5M3F J;  4DW6 A;  3VK0 A;  5IOY A;  3GTO J;  4DZP A;  1DU6 A;  5DS9 A;  1T56 A;  4JCX A;  1JTY A;  3FK7 A;  4GFB A;  3ZQI A;  3IH4 A;  2DA5 A;  4A3D J;  1JKP C;  1HF0 A;  5IOZ A;  2O8K A;  3VPR A;  3GTK J;  1VI0 A;  3S17 J;  4FN3 A;  3BD1 A;  1PRV A;  1VPW A;  4BKX A;  5EZG A;  1AU7 A;  3GTP J;  2XGE A;  4Z5C A;  4S0H B;  2KEI A;  2R0Q C;  2EH3 A;  3BDN A;  4EEF G;  2EWT A;  3GTJ J;  3TRB A;  2XIU A;  5F0C A;  3S1R J;  1B8I B;  2NVQ J;  3QF3 A;  4XRS G;  3OSG A;  1BJZ A;  1MH3 A;  1CQT A;  3KXA A;  3GTM J;  1ADR A;  4M3F A;  1PER L;  1K83 J;  2YU9 J;  3G1M A;  3SJM A;  3IV5 A;  4DYQ A;  1ZS4 A;  2OFY A;  2BNN A;  3C2B A;  4J19 A;  4A3I J;  4FBI A;  2HQ5 A;  3B6A A;  3RKQ A;  1WH7 A;  3GN5 B;  1TWC J;  2FQ4 A;  2FX0 A;  2XCJ A;  2HIN A;  1TWA J;  2ICP A;  1MSE C;  1ZAY A;  2COB A;  1FEX A;  5A7L A;  4X6A J;  3O9X A;  2PUF A;  2XGD A;  2VKE A;  5IPA A;  2ME0 A;  3MKL A;  3MVP A;  3RQI A;  1R69 A;  3ZHI A;  4A3B J;  1JJ6 C;  1FIA A;  4CYC A;  4BBS J;  4BY7 J;  3I4M J;  3IVP A;  4Z5H A;  1XWR A;  1YRN A;  3DEW A;  2LP0 A;  2MGQ A;  2NOG A;  3G5G A;  4X4D A;  1OSL A;  1POU A;  1BDH A;  1VF9 A;  2EBY A;  3JXD L;  2IAI A;  3S15 J;  3TP3 A;  2PUG A;  3S14 J;  2HXI A;  2WV1 A;  4NDL A;  3JRI A;  4LOC A;  1IV6 A;  2LTP A;  2KEJ A;  3JRF A;  4IHV A;  4UUT A;  4A3F J;  4ABZ A;  2JA5 J;  3OIO A;  2E2I J;  1B0N A;  2XB0 X;  5F08 A;  1IGN A;  3JRH A;  2R7Z J;  2LVS A;  3CEC A;  1JKQ C;  5C3E J;  1IDZ A;  3BG3 A;  3SCG A;  3U3W A;  2IEK A;  2GM4 A;  5FKO A;  4Z5D A;  1R9T J;  2KZ8 A;  4JYK A;  2LYQ A;  1NK2 P;  4C3H J;  2E1O A;  2DMN A;  1W0T A;  2D5V A;  4A69 C;  3O8H A;  1ZK8 A;  9ANT A;  3BQY A;  1B8I A;  1MBK A;  2WIU B;  1Y1W J;  2DMU A;  4RDU A;  3L1P A;  2E2H J;  3ZKC A;  1AHD P;  1EF4 A;  2FJ1 A;  1LE8 B;  5GPA A;  4HNV A;  2ME6 A;  1JFS A;  1IC8 A;  4FCY A;  1SAN A;  1D5Y A;  2CRG A;  2O9L A;  1I6H J;  4YBA A;  2PE5 A;  1WET A;  5FKL A;  2XPW A;  1H89 C;  1RKW A;  5JLX A;  1I50 J;  3FKI J;  1MSF C;  3M4O J;  1IG7 A;  2H8R A;  4YG7 B;  5F0F A;  3GN5 A;  3HOW J;  1MBF A;  3S1M J;  3QQA A;  1ETV A;  3LSJ A;  1MBG A;  1ZTR A;  3BG9 A;  3FYM A;  3IH2 A;  5FKK A;  1JUS A;  4XRS A;  1ZZB A;  2NS8 A;  1SFO J;  2R92 J;  3OMT A;  2X48 A;  4RBO A;  3ZQF A;  4Z59 A;  4Y52 J;  2LYS A;  3OQO A;  5GPC A;  1JKR C;  3BR6 A;  4I6T A;  4MCX A;  1WCM J;  4OB4 A;  4J1X A;  1PUF B;  1WH5 A;  1X2M A;  3K7A J;  3F51 A;  3CQZ J;  3FIW A;  4D5F A;  5IP9 J;  1FJL A;  5E3O A;  1QPZ A;  3A03 A;  1WPK A;  4IHW A;  2JA7 J;  2R5Z B;  3S2H J;  2AXV A;  5C4J J;  1YSE A;  1LLI A;  3BR0 A;  2L7Z A;  3JXC L;  2DA6 A;  3BR5 A;  3W6V A;  5HOD A;  3O8G A;  5EG0 B;  2VUM J;  2AW6 A;  3H5T A;  3F6W A;  3RZO J;  2DA2 A;  2O7O A;  3QPL A;  5IYC J;  3DCF A;  1JT6 A;  2JA8 J;  2R93 J;  2HI3 A;  4V2F A;  1JWL A;  5EGO B;  2MQK A;  2ELK A;  4W97 A;  4BY1 J;  4I8T A;  2NVT J;  3ZQG A;  4QIW N;  1UHS A;  1AKH B;  1UTX A;  3LFP A;  1LFB A;  4MO7 A;  2GZU A;  2L7F P;  2CU7 A;  2LYR A;  2DA7 A;  3TP0 A;  1QP7 A;  4MFD A;  4IEJ A;  2M2E A;  1ENH A;  3HOY J;  4UUS B;  1RPW A;  1QRY A;  1LE8 A;  3KZ3 A;  1CJG A;  3HDD A;  2A6C A;  1UG2 A;  3LOC A;  4FE7 A;  3HGG A;  2LYK A;  2JWT A;  1NTC A;  3TW6 A;  3HB9 A;  1ETQ A;  2L7M P;  3GBF A;  4X4G A;  3MLF A;  2G0E A;  5F27 A;  1OFC X;  4G12 A;  2L49 A;  1H88 C;  2BNO A;  1S7E A;  2WAQ N;  3ZQC A;  2DN0 A;  2HOA A;  2LFB A;  3LNQ A;  4J1W A;  2Y30 A;  3OOU A;  2K9S A;  2JJ7 A;  2YUS A;  4FIS A;  2EZH A;  2Y2Z A;  5EF6 A;  1TWG J;  3HEF A;  2M9H A;  2XPU A;  1DW9 A;  3G7D A;  2OR1 L;  3CMY A;  4XID A;  1ZPQ A;  1RIO A;  3S1Q J;  1RET A;  1ZUG A;  4M3D A;  2HYJ A;  1HLV A;  1WGX A;  5M5X J;  5K7Z A;  2FD5 A;  1UMQ A;  3IH3 A;  3FK6 A;  2EBI A;  1JTX A;  2HSG A;  3ZHM A;  4QTR A;  1GVD A;  1PUF A;  5FLM J;  2JVL A;  2XB5 A;  4B3A A;  1LCC A;  2DMT A;  5EYR A;  3LSG A;  2R5Z A;  4IVZ A;  4B1R A;  1L1M A;  4C3I J;  4BXX J;  1ETX A;  2ID3 A;  3BTL A;  2HDD A;  4JX5 A;  3EUS A;  2E19 A;  3JRC A;  3SCF A;  2P81 A;  3H0G J;  3S16 J;  1LQC A;  3G1O A;  4W1U A;  3QPS A;  5EG0 A;  2GRL A;  1HDD C;  2RAE A;  1MBH A;  1U9N A;  3M3Y J;  1NER A;  1ZZ7 A;  3F0C A;  2AXU A;  5EEA A;  1XG1 A;  3TED A;  1U8B A;  3FIS A;  3G1L A;  1QVU A;  5E3L A;  2GLO A;  4I6U A;  1NK3 P;  4X4C A;  2KEK A;  1Z77 A;  3JRG A;  1AKH A;  2NS7 A;  1F36 A;  1X2L A;  2LK2 A;  2XRL A;  1P7I A;  4Z58 A;  5F1J A;  4PU4 C;  2O49 A;  2PPX A;  1BA5 A;  5IP6 A;  2ID6 A;  2WB1 N;  5BNG A;  3A01 B;  4F8D A;  3HZI B;  2LCV A;  4UUS A;  1P7J A;  1RZR A;  1Y1V J;  5J1U A;  5EDN A;  2TRT A;  4A93 J;  2N8G A;  2ECC A;  3DNV B;  1OCP A;  1JFT A;  4FE4 A;  2JCG A;  5FKN A;  2EF8 A;  4DYC A;  1X57 A;  5FLV A;  1LFU P;  1QQB A;  4A3L J;  1DWK A;  3CCY A;  1NEQ A;  3JR9 A;  1IJW C;  3S8Q A;  1B72 B;  3Q3S A;  5IYD J;  1BL0 A;  3QYX A;  3HOV J;  3UKG A;  3OP9 A;  1GV5 A;  1HOM A;  2KDZ A;  2DJN A;  2QF7 A;  1ZKG A;  5FKM A;  1MNM C;  2CSF A;  3PO3 J;  1QQA A;  3LSP A;  4B4C A;  1JGG A;  2CJJ A;  3CDL A;  1RZR D;  2JN6 A; 
#chains in the Genus database with same CATH topology
 2QEN A;  1GLN A;  4E7S A;  2D1H A;  2X85 A;  1UG0 A;  2Q1Z B;  3DV8 A;  4R1H A;  4EGZ A;  5LGN A;  2MSY A;  3NDB B;  4B43 A;  1POG A;  2HQA A;  3HSF A;  1T08 B;  1HKT A;  3WGI A;  5EEH A;  4JK1 X;  2KT0 A;  5EEG A;  1LQ1 A;  2VBX A;  2BY0 A;  2E1M B;  2XKP A;  4Y7N J;  4EJT A;  5J6X A;  2QSH X;  1BOA A;  2BGC A;  2VKH A;  1NG7 A;  2FMY A;  2DK8 A;  5GTI C;  4E70 A;  1ON2 A;  3E5Q A;  2UV1 A;  3ZQH A;  5J1Y A;  2VPL A;  3L00 A;  2IA0 A;  3CCJ I;  4M6Y A;  4KN7 X;  3H35 A;  2X1D A;  3D5S C;  4O8B A;  4O5V A;  3H3U A;  2VJ4 A;  1UXD A;  2W7N A;  3OOP A;  3D5R C;  3HPH A;  4I99 C;  4LG0 B;  1LDD A;  5DUK A;  3OYC A;  3QOW A;  2K40 A;  1D5V A;  2GZW A;  4HA8 A;  4YRV A;  4IHY A;  3B7H A;  1IXS B;  2MG4 A;  1M1E B;  1SFX A;  1XMK A;  4ER7 A;  5F0H A;  2ESH A;  2Z2S B;  2AO9 A;  5K7F A;  2ZB9 A;  3WE2 A;  4ZTF A;  3PXP A;  1ITY A;  2FBH A;  4KT5 C;  4KFC A;  2PJP A;  2DOE A;  3BY6 A;  4L9V A;  5L3E A;  5IT3 A;  3OYL A;  2OQR A;  4XOR A;  4PU8 A;  3CJT B;  4CZC A;  1T8I A;  3KJX A;  3J81 Z;  3GZD A;  2RGV A;  2EV6 A;  4AYB A;  4DE8 A;  3H9Q A;  2VJ5 A;  1TW2 A;  2MW8 A;  5B3S H;  4XN3 A;  2FML A;  3HHG A;  4HBL A;  2LBF B;  1JKO C;  2OC6 A;  2PUB A;  2YS9 A;  3KCC A;  4ANJ A;  3OYK A;  3X2Q H;  2L8N A;  4Q5S F;  1HW1 A;  4HRA A;  2DFH A;  5CYV A;  4I2O A;  2ICT A;  1TZL A;  2QA4 I;  1VZ0 A;  2CFO A;  1K6Y A;  5D6E A;  1A5J A;  3A9Y A;  2R5Y B;  3Q9V A;  4YFX F;  2GA1 A;  2EWN A;  5EZH A;  1Z6R A;  3OS0 A;  1RPE L;  2M34 A;  3ZPL A;  1R23 A;  3E97 A;  2M0C A;  2H09 A;  4OIN F;  2IA1 A;  3OQM A;  3SFZ A;  4D5C A;  1GXQ A;  1R63 A;  1IO2 A;  1X3Z B;  4N0B A;  5GTH C;  1R6R A;  4E4H A;  2GRM A;  4ZDP A;  4FTH A;  4EKG A;  2ESN A;  1CF7 A;  2Q2E B;  4J00 A;  2IW5 A;  3VOE A;  5IT9 K;  2PXB A;  3BTC A;  1DDN A;  1TC3 C;  2EA2 A;  3E6C C;  2VQL A;  3E7L A;  4E7I A;  2RQP A;  4QPQ A;  1WFX A;  5GAE J;  3BR2 A;  4MFE A;  1Z3Y A;  4LG3 A;  2L9S A;  4PDK A;  2I10 A;  1FYM A;  4MQ9 F;  2IVQ A;  5K98 B;  5IT9 Z;  4PUS A;  4LLL A;  1JJ8 C;  2BW3 A;  3E3V A;  3MZ8 A;  1KQ9 A;  3PNV A;  3QP5 A;  2V79 A;  4Y4R A;  5M5W J;  3K1P A;  1TQI A;  2PEX A;  4A3E J;  3ZCO A;  2GBY A;  1OCO H;  1P6R A;  2ZJP F;  1RI7 A;  1XCV A;  5E20 A;  1ZZ8 A;  3H36 A;  2L54 A;  4IA8 A;  2TCT A;  2ZJR F;  4IRG A;  3SFI A;  1TWF J;  3CDI A;  4AUX A;  5L3B A;  2IJL A;  2W48 A;  3BLY A;  2XJ3 A;  2XV4 S;  2P5L C;  2NVX J;  4PU3 C;  3F8N A;  4DNC A;  2CUJ A;  1X3W B;  2BBY A;  3PUF A;  4I76 A;  3RPU D;  1BJA A;  3ZMV A;  3R09 A;  4IKF A;  5DM6 F;  2ZCW A;  3A4C A;  1W4M A;  1GV2 A;  3LA2 A;  5FD6 A;  1R4M B;  4ER6 A;  2L9V A;  3RZD J;  4IQJ A;  2V9P A;  2HVQ A;  5HDG A;  2DFF A;  3JTG A;  3H0D A;  2HVS A;  1X58 A;  2PXL A;  2V6E A;  4ESJ A;  4CYC B;  1TQP A;  2QSF X;  5DSX A;  3VYR B;  1FYK A;  4MEX F;  3HOX J;  1LCD A;  3BG5 A;  2ZXI A;  1MJA A;  3K2A A;  2HOE A;  3MCZ A;  3OS1 A;  1MIJ A;  1XMA A;  2HR3 A;  1K7A A;  3F72 A;  2JVG A;  5E18 F;  3B6C A;  3KEY A;  3VK0 A;  4DW6 A;  4XR6 A;  3K4J A;  5HLG A;  1PP7 U;  1QB2 A;  2KIF A;  4DZP A;  4U0V A;  1T56 A;  2CS3 A;  2MH2 A;  4KYW A;  4XBF A;  4GFB A;  4KDP A;  2DA5 A;  3B73 A;  3CUQ A;  3FXL A;  1HBX G;  3GTK J;  4FN3 A;  5DRY A;  1VPW A;  5FO5 A;  1AU7 A;  2XGE A;  3DKX A;  4S0H B;  5HS7 A;  2R0Q C;  5D6F A;  2EH3 A;  3J80 K;  2EIJ H;  5BS6 A;  3DWL E;  2IGK A;  3GTJ J;  4E7K A;  3TRB A;  1QHH D;  3QPH A;  2HCS A;  3QF3 A;  4XRS G;  2DYS H;  5CJ9 A;  4XLA A;  3ZRG A;  1E3H A;  3RDI A;  1KA8 A;  3P9C A;  3GTM J;  4K2E A;  3PJR A;  3KP7 A;  2Z1D A;  2STW A;  2QGU A;  2DOA A;  4NC8 A;  5D4S A;  3DQV C;  2YU9 J;  3J80 Z;  3IV5 A;  4DYQ A;  2HEO A;  1ZAR A;  4MTE A;  2OFY A;  2BNN A;  4J19 A;  3I54 A;  1EA3 A;  2E5Z A;  3D5L A;  3GF2 A;  1R1V A;  1WH7 A;  2ZXJ A;  3GN5 B;  2FX0 A;  2VQH A;  3TL4 X;  4DBR A;  3GME A;  4G6Q A;  3G0T A;  3ZP5 A;  3IAM 2;  6PAX A;  2XGD A;  3GCM A;  1QZE A;  3V4G A;  5IPA A;  3ZHI A;  1W7P B;  3RQI A;  3QPT A;  4HF2 A;  4A3B J;  4XOP A;  2BHZ A;  1JJ6 C;  1G59 A;  1FIA A;  4BY7 J;  4BXU A;  3OYA A;  2XAJ A;  1USS A;  1YRN A;  3GO5 A;  2NOG A;  4I7H A;  4YEL A;  1OSL A;  1BDH A;  3CCV I;  2P0W A;  2NXN B;  2QKM B;  3TP3 A;  2PUG A;  3S14 J;  4NDL A;  2GIZ A;  4LOC A;  3K69 A;  4B3X A;  3IRQ A;  2VJI A;  1ZEL A;  2LTP A;  2LLV A;  4XKW A;  1J09 A;  4ABZ A;  2JA5 J;  3R0J A;  4I0A A;  1V5E A;  2ELJ A;  5F08 A;  5D5V B;  1V5G A;  2LVS A;  3SR4 A;  4XLH A;  3CEC A;  1AA7 A;  1F1Z A;  4KMU X;  1FOK A;  2V26 A;  3BG3 A;  3FXK A;  3U3W A;  1D0X A;  2LNM A;  2A6T A;  2A61 A;  3LSM A;  2ZNY A;  3T8T A;  3EUH C;  5DRT A;  1K79 A;  2KZ8 A;  2NNY A;  3DU6 A;  3AKZ A;  2YX7 A;  2QBY A;  1F9N A;  1DPU A;  1Z67 A;  3BQY A;  5L3C A;  2CW8 A;  2OAZ A;  2C6Y A;  2WIU B;  4RDU A;  3L1P A;  3ZKC A;  3MMY B;  1AHD P;  2ACJ A;  2FJ1 A;  2BYV E;  1LE8 B;  1OCR H;  2QM3 A;  4PGG A;  2OA4 A;  4GO1 A;  5E8I A;  1IC8 A;  1WET A;  2XXQ A;  3CJR B;  3S8P A;  1X1A A;  1JE8 A;  1H89 C;  2M45 A;  2GXA A;  3M4O J;  4PK4 A;  4RAY A;  3BCB A;  5TJJ A;  2IGO A;  3V7R A;  4KIG A;  2VT2 A;  4XRS A;  4PJJ A;  3FM3 A;  4G8X A;  5KVR A;  3TGN A;  1QZY A;  3CLO A;  3T0Y A;  3CCL I;  1QHG A;  2BXY A;  2X48 A;  4RBO A;  5AIQ A;  4L18 B;  1JKR C;  2PBI A;  3I0T A;  4CCJ A;  1JI8 A;  2NAZ A;  4OB4 A;  4J1X A;  1HW5 A;  1WH5 A;  1X2M A;  4D5F A;  3OR2 C;  1FJL A;  5E3O A;  4YG1 A;  1HQ1 A;  2R5Z B;  3DBL B;  2AXV A;  1ZH5 A;  2KZG A;  1LLI A;  1MMS A;  3BR5 A;  2WB1 A;  1IV8 A;  2JZY A;  2FE3 A;  5HOD A;  3ZN1 A;  5FRN A;  5D5U B;  3RZO J;  1BR4 A;  3PIO F;  3DCF A;  1K4T A;  5FD5 A;  1JT6 A;  2KMU A;  2HYG D;  1W7P D;  4V2F A;  2DLL A;  1U5T C;  3CCQ I;  2X0L A;  2NVT J;  3FMR A;  1A36 A;  2G7U A;  1LFB A;  4ESB A;  5K5Q A;  2PMU A;  2GZU A;  1WJF A;  2L7F P;  2LYR A;  2PJR B;  3TP0 A;  1ODD A;  4BE0 A;  2VBW A;  3KZZ A;  4P96 A;  1WZ2 A;  4MFD A;  4IEJ A;  4IVN A;  4UUS B;  1LUJ B;  2KIM A;  3KZ3 A;  1Z6T A;  1XPX A;  3HTS B;  1LKX A;  5DUI A;  1FMW A;  1WKM A;  2K5C A;  1I1S A;  1ETQ A;  2L7M P;  4X4G A;  2L49 A;  4ER3 A;  1X4P A;  3ZQC A;  2HOA A;  2LFB A;  3BG6 A;  3N4M A;  2JVH A;  3OR1 C;  1KGS A;  1KON A;  2JSC A;  4KNY A;  4J1W A;  2JJ7 A;  2XAS A;  2YUS A;  4RB2 C;  1G3Y A;  2PXQ A;  2M9H A;  2OR1 L;  4BQO A;  4A12 A;  4XID A;  5AON A;  1ZPQ A;  4R79 A;  5FFZ A;  3JTH A;  3CLQ A;  4ENM A;  3QYF A;  1V3F A;  2LH9 A;  4XKB A;  1WI9 A;  2JQE A;  3IC7 A;  4ZH4 F;  5FLM J;  2HNH A;  4G94 A;  4B3A A;  1I6X A;  4Q2J A;  4V19 K;  4IVZ A;  1U2W A;  1EH8 A;  3DTE A;  2HDD A;  4JX5 A;  1IXR C;  3EUS A;  3G3Z A;  2P81 A;  3H0G J;  2JQ7 A;  2GRL A;  3CCU I;  5JR3 A;  4ITV A;  4BQA A;  1HDD C;  4LFU A;  1MBH A;  3M3Y J;  2PX9 A;  1NER A;  2LRE A;  1ZZ7 A;  3NEU A;  4ZTJ A;  5EEA A;  2ZKZ A;  4C2T A;  3G1L A;  3KP3 A;  3WE3 A;  2COM A;  5HLI A;  1AKH A;  4A6E A;  3HRT A;  5LRR A;  2NS7 A;  4EJO A;  3GZN B;  3ZXS A;  3C1D A;  3RSN A;  2XAG A;  1P2F A;  4XL9 A;  3K10 A;  2ICW G;  3JSP A;  2PPX A;  2GIV A;  2ID6 A;  2E71 A;  2WB1 N;  3A01 B;  2H27 A;  1P7J A;  2PXK A;  2K4J A;  3WTZ A;  4CDG A;  3RCO A;  2TRT A;  4A5M A;  1W1W E;  5FGM A;  3ERE D;  1X1P A;  4NC7 A;  2N8G A;  3SHF A;  2ZC2 A;  1JFT A;  1Y0N A;  3IRR A;  2CV1 A;  2VOD A;  2JCG A;  5FKN A;  3RYR A;  3ZMD A;  1IF1 A;  3I3L A;  4MNU A;  3G71 I;  4ER5 A;  4NNJ A;  2DQR A;  5EJC A;  4DE9 A;  2PXT A;  4IOA F;  1QQB A;  1DWK A;  2VC1 A;  1IJW C;  3S8Q A;  3C18 A;  5IYD J;  3PQJ A;  1BL0 A;  3QYX A;  2IP2 A;  3OP9 A;  1HOM A;  4N4N B;  2QF7 A;  1ZKG A;  2A5Y B;  4NUB A;  3VFZ A;  3T5X A;  2JPC A;  4HDU A;  4G7Z F;  1U9N A;  2GQQ A;  1HKS A;  2DI3 A;  4J01 A;  3PSI A;  1PYV A;  3LFU A;  2RN7 A;  4RM3 A;  4S04 A;  3AG1 H;  3SDG A;  3TW7 A;  2ZME B;  1Y0U A;  1H0M A;  2CYY A;  1ZZ9 A;  3SCH A;  2V1U A;  2Y48 A;  3MKW B;  3R1F A;  2A07 F;  4NBQ A;  2Z9O A;  2FSW A;  3WU0 A;  4ER0 A;  2LRD A;  4R8H A;  3SZG A;  1RNL A;  4MIM A;  4CXF A;  1U8R A;  4N9H A;  5K7H A;  4ZC3 A;  4XRM A;  3JRE A;  1U78 A;  1MBE A;  3SEQ A;  3N97 A;  2IS1 A;  2KJB A;  1LEA A;  1Z05 A;  1WRJ A;  3TMO A;  1GUU A;  2Y9Y A;  4JBA A;  3FWE A;  2PXD A;  4OIQ F;  1IN4 A;  3DXJ F;  3S1N J;  1Y8Q B;  3DEU A;  3ECO A;  4EJU A;  1UZC A;  1PVE A;  3VYS B;  5LGU A;  2E60 A;  3H3V K;  4UY8 I;  3CP8 A;  1ETY A;  4UNO A;  4IJA A;  4X1E A;  4BNC A;  1Z0X A;  1UXC A;  2IS2 A;  2DT7 B;  3MD2 A;  1S7A A;  2H6C A;  1FZP B;  1PNR A;  2LD5 A;  1FY7 A;  2PIJ A;  3GZD C;  2XGC A;  4ZYD A;  1J0R A;  3S32 A;  3HUG B;  1ORK A;  1FOY A;  1G2H A;  2PFB A;  3RZZ A;  1T0F A;  3IL2 A;  2M8E A;  3F52 A;  3OYB A;  1JH9 A;  1B72 A;  3QU6 A;  4RGX A;  2W25 A;  3HOZ J;  2HDW A;  3K4K A;  2IA2 A;  4G6D A;  4ESF A;  3CC4 I;  2GAU A;  2ZFW A;  2DMQ A;  3FXR A;  3F8F A;  5HS8 A;  3OYI A;  1DUX C;  2GXG A;  4KIF A;  3IKV A;  2DTZ A;  4B8X A;  2EFP A;  3UWP A;  3L7W A;  1QQI A;  1Y39 A;  2WC2 A;  1BC8 C;  5ED4 A;  2CQX A;  5CVV A;  4GHJ A;  4BXF A;  4LK0 F;  4X4E A;  4ASN A;  2AXZ A;  1B59 A;  4CCM A;  2L4A A;  3WU2 C;  1BIB A;  4CCO A;  4Q47 A;  4EMS A;  4YG4 A;  2PUD A;  2NVU B;  1HSJ A;  1XGN A;  5DD4 A;  1PRA A;  3K4M A;  2PUA A;  3FHN A;  3OY9 A;  3HOT A;  3UFD A;  2GOX B;  1HXD A;  2HYF A;  4HV5 A;  4PCQ A;  3LAJ A;  5LRS A;  4HEA 2;  4ENJ A;  2UWM A;  1KU7 A;  5C44 J;  2LKS A;  4DOZ A;  1MJ9 A;  5EGO A;  1ZGW A;  2FXA A;  1JUM A;  3QOX A;  2F6C A;  3K4L A;  1XS9 A;  2F5F A;  1JUP A;  2LY1 A;  2CRO A;  1QPM A;  4LG0 A;  1K4S A;  4A3K J;  1YW8 A;  1WIZ A;  3AG3 H;  5BOX A;  1VQ9 I;  2EQR A;  2OPT A;  2XPV A;  2BHY A;  3Q0W A;  2LMD A;  2FUG 2;  4AWX B;  5KNL A;  2DTR A;  3GFI A;  2YX4 A;  3TDZ C;  1QPI A;  2RNJ A;  2LY9 A;  4I0B A;  3EUA A;  2WUS R;  5GAG J;  5E3M A;  3RPU A;  3OYG A;  3FZV A;  1WI3 A;  3HOU J;  2M4G A;  2BY1 A;  3HKZ N;  3U21 A;  4F93 B;  2LR8 A;  3HTU A;  2M87 A;  3V42 A;  5L3D A;  2JA6 J;  2XI8 A;  2BJC A;  4EK9 A;  4IQ4 A;  2AS5 F;  2AUW A;  3D1N I;  4V2G A;  4RMN A;  3K4B A;  5F6F A;  3C2H A;  3VSK A;  2XAU A;  4RB0 A;  2HPI A;  2YBD A;  2F48 A;  2JT1 A;  2AQF A;  3QP6 A;  2LBF A;  3WU1 B;  1F5T A;  4CYD A;  2IBD A;  1FOX A;  4UVB A;  3ESW B;  1DGR M;  5IYB J;  4IRH A;  4BHP A;  2A3S A;  1S6L A;  4IRI A;  1TNS A;  4M6X A;  3GTQ J;  1BDI A;  3OYE A;  3BT9 A;  3FHZ A;  3HGY A;  3LMM A;  3A2K A;  2B0L A;  1SFE A;  2LF8 A;  3JRA A;  2QQA A;  1SD5 A;  2E36 A;  2JK3 A;  4WCG A;  4XLP F;  2R5Y A;  3V7S A;  3HL2 A;  4OIP F;  2A6E F;  4QLC U;  3GBG A;  1RR7 A;  3I59 B;  4L5E A;  4EV0 A;  1LPQ A;  2O38 A;  1XGM A;  3CMM A;  4I98 B;  4BQQ A;  3HM5 A;  2HCN A;  3OQN A;  3I71 A;  3CRO L;  2HWV A;  3HIF A;  3JAM Z;  3H5N A;  5C4X J;  1VFC A;  1GDT A;  5L3G A;  5J3L A;  3ZN0 A;  3NAU A;  3QU3 A;  2VKV A;  1KU2 A;  1SMT A;  3K1M A;  3WTY C;  3IUO A;  5K5R A;  2CW0 F;  1FBS A;  2DFI A;  3AG4 H;  3SZT A;  1ZZC A;  2M7A A;  3RKW A;  2Q2E A;  2PXE A;  4LD5 A;  2WV0 A;  3BTJ A;  1IDY A;  3JXB C;  3MEX A;  5JI6 A;  5M5Y J;  4IWR A;  1VQN I;  4AVP A;  1FMV A;  3CUQ C;  4MEY F;  1ZGA A;  3S93 A;  4CZZ A;  1MKM A;  5J40 A;  2K27 A;  5M3M J;  2VE9 A;  3DPL C;  3DLA A;  4IHS A;  4BGD A;  3GTO J;  5DS9 A;  4HF1 A;  5CVI A;  5HLH A;  1UCR A;  3CO7 C;  3FXJ A;  1SVO A;  3J81 K;  4E7H A;  3ZQI A;  1KU9 A;  1XGS A;  1Z91 A;  5IOZ A;  2O8K A;  4HYE A;  3F6O A;  5GAD J;  5HS9 A;  1KU3 A;  3SYT A;  5LHI A;  3H1C A;  3LSK A;  3M9A A;  4BKX A;  3GTP J;  4IO9 F;  2L5Q A;  2LNB A;  2EWT A;  4WXD A;  1B8I B;  3JW4 A;  2NVQ J;  3OSG A;  1BJZ A;  1LDJ A;  2M3A A;  1ADR A;  2ETH A;  1Z21 A;  2P5V A;  4WXC A;  2FA5 A;  3G1M A;  3SJM A;  3ME5 A;  3FMQ A;  1G3S A;  4A0X A;  4A3I J;  3HHH A;  1IN5 A;  4IOC F;  1G4D A;  1QU3 A;  2K9M A;  3I4P A;  2EIM H;  1WQ2 A;  1TWC J;  2OCC H;  4CCK A;  1MDM B;  2DO7 A;  1ZAY A;  1MSE C;  1FEX A;  2W85 A;  4XKC A;  2X51 A;  2GOM A;  4ZZD A;  2NNN A;  1Y8R B;  2FU4 A;  3MKL A;  3H5A A;  3EQL F;  1HQC A;  2VBY A;  4B47 A;  4CYC A;  2DAO A;  3I4M J;  1YIJ I;  1MW7 A;  1DGW Y;  3FXQ A;  2LG4 A;  2KQR A;  3CD6 I;  4BYY A;  4S05 A;  1QO0 D;  2EBY A;  2O8X A;  4L9T A;  2CG4 A;  3W6K B;  1SD4 A;  2L7K A;  4A5N A;  2KEJ A;  1EKE A;  2XKO A;  4IHV A;  3FF5 A;  4E6K G;  1ZRE A;  5DTR A;  3OIO A;  2A5W A;  2E2I J;  4G7O F;  2MD0 A;  1B0N A;  5L3F A;  3TO7 A;  2UUZ A;  2R7Z J;  5K5O A;  2A69 F;  4GRI A;  1FNN A;  2YPR A;  3D0S A;  1IDZ A;  2R7U A;  3KE2 A;  2Z16 A;  3T8R A;  3TOA A;  3DPU A;  3I5U A;  4U0W A;  5DEQ A;  4ZYG A;  3L2C A;  2QEX I;  5FLX Z;  1B1B A;  2LYQ A;  2W57 A;  3QOD A;  2DMN A;  1W0T A;  4A69 C;  1EJ9 A;  1E17 A;  4HX7 A;  3A0B C;  4LJZ F;  2E2H J;  1SAX A;  2VON A;  1R5H A;  2O0Y A;  4IF4 A;  5LFA A;  2BY2 A;  4F52 A;  1UEL B;  4YBA A;  2CRG A;  2PE5 A;  3J7Z I;  2DT6 A;  3F9K A;  3M1E A;  3BPX A;  1FLI A;  2WAD A;  1I50 J;  1LFP A;  2P6T A;  3TO6 A;  3GN5 A;  1U2Z A;  5DTM A;  1RUO A;  1MBF A;  3S1M J;  2HTS A;  2DPD A;  4FX4 A;  1T38 A;  1ETV A;  3PNY A;  1MBG A;  4ETS A;  3BG9 A;  3IH2 A;  3AL0 B;  1W7P A;  4XM3 A;  3RKX A;  2NS8 A;  1G8X A;  2J5O A;  2G7H A;  3HRS A;  3ZQF A;  2B9S A;  3BZC A;  1MGT A;  5GPC A;  2IS6 A;  2IRF G;  4I6T A;  3DKY A;  1UST A;  1WCM J;  1X3U A;  2XDV A;  1ULY A;  3J7Y J;  3F51 A;  4EKI A;  3CQZ J;  3DTI A;  3FIW A;  3L2Q A;  5JVG F;  1QPZ A;  1Z7L A;  2UXX A;  2NRA C;  2OU2 A;  3J7A O;  5C4J J;  2ZJQ F;  5JFR A;  1SAU A;  1W36 C;  3C7J A;  1S8N A;  5EG0 B;  5E8G A;  4EZI A;  2MC4 A;  3GZ5 A;  3ZPX A;  3F6W A;  3NRO A;  3OWQ A;  3MKZ A;  1WJD A;  2JA8 J;  2KDO A;  4N9I A;  1I1G A;  2EIK H;  3M8F A;  3L2W A;  5CVU A;  1FSE A;  4W97 A;  2HVR A;  4BY1 J;  2L9N A;  4RAF A;  1RUN A;  1JWL A;  4I8T A;  1R7J A;  1UTX A;  2EIN H;  2FQ3 A;  4BHB A;  2VXD A;  3OYM A;  4XLE A;  3OYN A;  2MC3 A;  3BPV A;  3DF8 A;  2NS0 A;  1LE8 A;  1RPW A;  1QRY A;  1CJG A;  4XOT A;  4GCV A;  3NXH A;  2DBB A;  2ZO4 A;  1TTY A;  4FE7 A;  1QZX A;  1LJ9 A;  3TW6 A;  3HB9 A;  1QGP A;  2QQ9 A;  4M72 A;  4C30 A;  3MLF A;  4A0Y A;  4BUP A;  5F27 A;  4LLN A;  3ZMS A;  2WAQ N;  1EH6 A;  1NHA A;  4HQM A;  3ZMU A;  3MQ0 A;  1OCC H;  1S9H A;  2Y30 A;  3CCE I;  2K9S A;  3MZH A;  2PI0 A;  2Y2Z A;  1TWG J;  1DW9 A;  3G7D A;  2XPU A;  2M4H A;  4IL6 C;  3SXY A;  3L2V A;  2W24 A;  1B9N A;  2G9W A;  2HYJ A;  3P9I A;  4M3D A;  4XMY A;  3T1B A;  3ZQ7 A;  4X0G A;  2ODR D;  1P92 A;  2FD5 A;  2F5V A;  3IH3 A;  2QVO A;  4XSZ F;  5ICE A;  1JTX A;  4A2U A;  1ACI A;  5TIS C;  3WGH A;  3W2V A;  3FXO A;  1ZGJ A;  4D9J A;  4OIR F;  4HOB A;  5EYR A;  2R5Z A;  4C3I J;  1V5F A;  1ETX A;  2KL4 A;  4M74 A;  3JRC A;  1WJB A;  3S16 J;  3SCF A;  2CQ7 A;  4W1U A;  3BWG A;  1KQ0 A;  4EJV A;  4MGR A;  2AXU A;  3TED A;  2J7W A;  2H1L A;  1Z77 A;  3P7N A;  4C2U A;  2V4J C;  5ICF A;  3LQR A;  4L0Y B;  4Y3O A;  2LK2 A;  4WF2 A;  4G7H F;  2XRL A;  2PJR A;  4XN0 A;  4CSW A;  3VDX A;  4PU4 C;  3GLL A;  5IP6 A;  3VSL A;  3CDH A;  4UUS A;  4LB6 B;  1Y1V J;  5HNH A;  5J1U A;  1A35 A;  3BP8 A;  3RIR A;  4A93 J;  1A6Q A;  1YW7 A;  2ECC A;  5JVT A;  2A6H F;  2CWE A;  4JQF A;  2FF4 A;  1QNT A;  2KPM A;  4B09 A;  5DT2 A;  4HST A;  1VQ4 I;  5FLV A;  3DFG A;  3COA C;  2K4B A;  1HA8 A;  3WTT C;  1D1C A;  1PP8 F;  3JR9 A;  2K85 A;  3RYP A;  5J8F A;  1VQL I;  5DCM B;  2Y75 A;  2KDZ A;  5JUW A;  3KEO A;  1UHM A;  1MNM C;  2HKX A;  2HQN A;  1D0Z A;  3PO3 J;  5CVR A;  1T2K A;  3KP2 A;  2XXP A;  3CDL A;  4BH9 A;  1WWX A;  3OYJ A;  1RZR D;  4XON A;  2JN6 A;  1T33 A;  4Y42 A;  4H0E A;  1DP7 P;  4WX9 A;  1P4W A;  3AFH A;  2MLG A;  2LYJ A;  2DQL A;  3LSR A;  3RI4 A;  3F23 A;  2Y69 H;  1I5Z A;  3ASN H;  4OBM A;  4OWR B;  2HOS A;  4M9Z A;  3GUD A;  1JHH A;  3E5X A;  2E35 A;  4RAG A;  3WOD F;  5GP9 A;  1ZLJ A;  1R58 A;  3G2B A;  1ZR2 A;  1TWH J;  2EZL A;  2M1B A;  2PQ8 A;  1J7K A;  1VQK I;  2IU7 A;  3REO A;  2EK5 A;  2CUF A;  4BEH B;  1R4N B;  5LGT A;  3OS2 A;  2P5K A;  1W5S A;  4RAZ A;  1GHC A;  2VBZ A;  3HZJ A;  2YR2 A;  2XAQ A;  1RES A;  3TBI A;  3FMY A;  2OV7 A;  1BW5 A;  5FB2 A;  2TDX A;  2V1N A;  3KYC B;  3A01 A;  4HDV A;  1Y9Q A;  4DJA A;  2R3S A;  3U1K A;  1ZR4 A;  2VOP A;  4NC6 A;  3HBL A;  1J59 A;  4KMF A;  2DXI A;  1IZ1 A;  2YU3 A;  1MZB A;  1T0F C;  4HX4 A;  4UB8 C;  1FIP A;  5J1R A;  3J7A Y;  3CJQ B;  5GAH i;  2UZK A;  3OMY A;  4M3B A;  3ROU A;  4Q48 A;  2KRH A;  1ZRF A;  1R5I D;  2CUE A;  2X9D A;  3LQQ A;  2BOL A;  2O3F A;  3WHC A;  1BI2 A;  2DT5 A;  4WVL A;  2XF6 A;  4MCT A;  5D5X B;  5LEK A;  1EFA A;  3BG7 A;  1DUL A;  5AIP A;  3F6V A;  3KX2 A;  4M3E A;  5DV5 A;  1VQ6 I;  5ICG A;  1E3O C;  1N25 A;  1YLF A;  1U9O A;  1BW6 A;  2DOD A;  2E1M C;  1XX5 A;  4QPO A;  3F22 A;  2PUC A;  2XSD C;  2LKX A;  2XF5 A;  3ZGK A;  2AXT C;  2DA1 A;  2PUE A;  1Z1D A;  2DW4 A;  3JSO A;  2ZME A;  2O61 A;  2IXS A;  1XGO A;  3QQ6 A;  3QOE A;  1IN8 A;  1TQM A;  1YHQ I;  4UV9 A;  1TL8 A;  1BR2 A;  1H9G A;  3BS3 A;  2X6Y A;  4C3J J;  4EM2 A;  1VQ5 I;  4JX4 A;  2IUO A;  4AIH A;  2DA3 A;  4M73 A;  5B1B H;  5KCM A;  2DMP A;  3F3X A;  2E1N A;  1SEU A;  3JRB A;  4F55 A;  4KN4 X;  4Y13 A;  1ZZ6 A;  1QP0 A;  2AHQ A;  3ZQL A;  2LLK A;  3OYF A;  4II2 A;  3HRU A;  1OYW A;  2BNM A;  2EV0 A;  1W0U A;  3FDY A;  3QOP A;  1ZVV A;  3GLX A;  1QP4 A;  1O3S A;  3IWF A;  3RTR A;  3PQK A;  4MTD A;  4PU7 A;  4ZYH A;  2OTJ I;  1A31 A;  1FP1 D;  2Y0S N;  4YFK F;  5HVQ C;  4A3M J;  4XRF A;  1GT0 C;  4EVI A;  2KKO A;  2LYL A;  2OF7 A;  2M8G X;  1SC7 A;  3GZC A;  3TFL A;  1MH4 A;  1T98 A;  2V7F A;  2VIX A;  1TNT A;  4U88 A;  4DZJ A;  2V1X A;  2ISY A;  2MD5 A;  1OYY A;  2KIU A;  5ILS A;  2HTJ A;  4DYR A;  5DM7 F;  4OMY A;  3M9L A;  3SX0 A;  4PGH A;  4AVZ A;  4ZDL A;  1APL C;  1ON1 A;  2FJR A;  3OL4 A;  1T39 A;  5ILU A;  2P4W A;  5JLW A;  2DFE A;  1FTZ A;  2L9R A;  1BI3 A;  4U0Y A;  2H94 A;  4GQM A;  3CC2 I;  1H8A C;  1P9Q C;  4PSW A;  3ZOB A;  3HPG A;  1YG2 A;  3BQZ A;  4O6J A;  2FBI A;  3PM1 A;  2BXZ A;  5DTQ A;  3I53 A;  1IRX A;  5JHF A;  2OCE A;  4FX0 A;  4Y33 A;  1MBJ A;  1OCT C;  3S2D J;  2LKP A;  4E7Z A;  2I8D A;  3BTI A;  1IUF A;  2DA4 A;  2GWR A;  3CES A;  3Q0V A;  1QVT A;  3VWB A;  1BC7 C;  1FBU A;  1STZ A;  1A6I A;  2A05 A;  1OMI A;  4AC0 A;  3OSF A;  2IPQ X;  2R7F A;  1I39 A;  3TO9 A;  2BEO A;  3I4N J;  2QQ8 A;  3QWG A;  4PJN A;  2RDP A;  3ZMZ A;  4DBQ A;  2MEZ A;  4XIC A;  4M3G A;  2PMZ N;  3TEL A;  2DCE A;  2ZBK A;  4HNU A;  2ECB A;  1Z9C A;  3U1D A;  3U2R A;  2DDB A;  1LMB 3;  4ZYE A;  1XCB A;  2VQG A;  4C2M J;  2P8T A;  3HKZ A;  3S3O A;  1FTT A;  1ZYR F;  3H9G A;  1QZZ A;  4NQW B;  1SVL A;  4NB5 A;  2LYP A;  2Q0O A;  4PZJ A;  3VWS A;  1OJL A;  2BZT A;  5HDK A;  4HW0 A;  4B48 A;  3LST A;  4BBR J;  4FAS D;  1CGP A;  1FSH A;  3NRV A;  2IVB A;  3ABM H;  5KAF C;  4CIC A;  4M9S A;  1DU6 A;  2WAF A;  3LAP A;  3KP4 A;  2RQQ A;  1QBJ A;  4OU0 A;  3WTU C;  1SVM A;  3ABT A;  1JTY A;  5CLS A;  1XSV A;  3IH4 A;  5KAI C;  3ISP A;  3I64 A;  1YJW I;  4CCL A;  3ZQQ A;  4F3Q A;  2K3F A;  3VPR A;  2E1C A;  1VI0 A;  3S17 J;  4LLG F;  4E7J A;  3SQN A;  3BD1 A;  1PRV A;  3KZY A;  5EZG A;  5KHD A;  2KEI A;  2IT0 A;  4EEF G;  1W5T A;  4CA0 A;  2XIU A;  1BBY A;  3S1R J;  2M5W A;  1ZG1 A;  2PXF A;  5CPR B;  3WGG A;  2WWY A;  2VJJ A;  3KXA A;  4NHJ A;  1PER L;  4BDY A;  4O3M A;  1YX5 A;  2FBK A;  2OQG A;  1OLT A;  5J4Y A;  2IGM A;  1MFQ C;  1ZS4 A;  2JPB A;  3W6J B;  2R7V A;  3CF2 A;  1G3W A;  2WY8 Q;  5D4R A;  3C2B A;  4KT6 A;  4JOM A;  4FBI A;  2HQ5 A;  3I59 A;  3B6A A;  4AU7 A;  3C3W A;  1MMA A;  3CP2 A;  2KLO A;  3PFY A;  2XCJ A;  4EJW A;  1TWA J;  4H4K C;  3DBH B;  2DPU A;  4L5J A;  2X6W A;  4WXH A;  5B5E C;  2VLA A;  3HXL A;  2HQR A;  3O9X A;  1FP2 A;  1ERD A;  3GFJ A;  1D3Y A;  5E1W A;  2X1C A;  3WTW C;  2CFX A;  1L3L A;  4BBS J;  1MJB A;  1REP C;  2OJE D;  4HLY A;  1E0E A;  3IVP A;  2CQK A;  1ZRD A;  1ZN2 A;  5A2Q Z;  1XWR A;  2MFZ A;  3K70 D;  2LP0 A;  2L01 A;  3LSI A;  4X4D A;  3G4S I;  1XD7 A;  4GYI A;  3RPQ A;  1VF9 A;  2F4I A;  3R4K A;  4CUG A;  1TBX A;  3ML6 A;  2WV1 A;  4RLQ A;  1TP4 A;  2BY3 A;  2VXZ A;  3JRF A;  2F5D A;  4N4O B;  4UUT A;  4A3F J;  3HYI A;  3F8B A;  3LWF A;  4UHT A;  2XB0 X;  2CW7 A;  2HKO A;  4IPA A;  4UXN A;  2HZD A;  5C3E J;  3M1C A;  3SCG A;  1FPQ A;  3SEZ A;  5J8C A;  4LIV A;  3O2P E;  2GM4 A;  4Z5D A;  2CV2 A;  2M30 A;  1R9T J;  2Z3Y A;  1X4O A;  1XDS A;  4JYK A;  1X19 A;  2E1O A;  4C3H J;  2F4O B;  1UHW A;  2D5V A;  2PXU A;  1ZG3 A;  4E7L A;  5E1X A;  2VAS A;  1B8I A;  1WSU A;  2FOW A;  5LD2 C;  1MBK A;  4OMZ A;  2DMU A;  1PJR A;  1U5T B;  1EF4 A;  2BV6 A;  2XF7 A;  3DBR B;  5GPA A;  3K0L A;  1MND A;  4FCY A;  2O9L A;  5FKL A;  3QFI A;  2XPW A;  2LYC A;  1RKW A;  5JLX A;  1BI1 A;  2XIG A;  3FKI J;  2AXL A;  2E7W A;  1IG7 A;  2W4S A;  4U7B A;  3JAM K;  5HDN A;  2V9V A;  1MDM A;  3QQA A;  3NWS A;  2IGN A;  1MMN A;  2JUG A;  3OIP A;  1O3T A;  2PN6 A;  3ELK A;  3E6B A;  3LSJ A;  4U87 A;  3FYM A;  3ECH A;  3ZMT A;  1JUS A;  4AID A;  1ZZB A;  4KIC A;  1SFO J;  3MEJ A;  3OMT A;  4MCX A;  2RKH A;  1YI2 I;  1Z3X A;  2EPF A;  4FHT A;  1IW7 F;  3BOQ A;  3K7A J;  1PUF B;  2Z33 A;  5IP9 J;  3CZ6 A;  4P55 A;  3VOD A;  2P6S A;  3CCR I;  1BN5 A;  5D5W B;  2ZFU A;  1K78 B;  3H5R A;  2HDC A;  3HJE A;  2V3C C;  5LEJ A;  1ZRC A;  1HW2 A;  2L1P A;  3JXC L;  3P5J A;  3QAH A;  4P9F A;  3KLN A;  3O8G A;  2VUM J;  3R61 A;  4RGU A;  2R7D A;  4RB1 A;  3QPL A;  2XVC A;  3W3C A;  1BR1 A;  2LSO A;  2HI3 A;  2KP6 A;  4UVC A;  1N75 A;  5EGO B;  4LGW A;  3CCS I;  2MQK A;  3E5U A;  3ZQG A;  3L9F A;  4QIW N;  1DP3 A;  3LFP A;  1O57 A;  4MO7 A;  2DK5 A;  2V1D A;  2XXA A;  2FNA A;  5LBQ A;  4XLC A;  1YOV B;  4HSR A;  5IY5 H;  4ENK A;  1ENH A;  3HOY J;  4RGS A;  1GVJ A;  2W84 A;  3MKY B;  2DYR H;  2R7X A;  3HDD A;  4F92 B;  1OKR A;  1YJ9 I;  5H6Q A;  2JWT A;  4AM3 A;  3PFI A;  3PE5 A;  4G12 A;  2VL8 A;  2CO5 A;  1H88 C;  1YJN I;  2BNO A;  1S7E A;  3DEE A;  2DN0 A;  2P7C B;  2EJR A;  1TLH B;  4II3 A;  4ZDO A;  3OOU A;  4PJ0 C;  3WG9 A;  3GFL A;  4XSX F;  4FIS A;  4G9Y A;  1G6N A;  3CMY A;  3E0J B;  1RIO A;  1RET A;  2RV8 A;  4HF0 A;  1ZUG A;  3CC7 I;  5KK1 A;  5K7Z A;  1XDU A;  2OUM A;  1J9I A;  2CSO A;  5BQT A;  3O6B B;  4YFN F;  3BJA A;  2HPM A;  2HSG A;  4CCN A;  1SFK A;  4U7D A;  2JVL A;  1YIO A;  2DMT A;  4M71 A;  1YIT I;  4Q4Z F;  3LSG A;  3I55 I;  1L1M A;  4B1R A;  2FEZ A;  2QWW A;  3RQ4 A;  3BTL A;  2IVM A;  2E19 A;  3KYD B;  2DOF A;  3S3M A;  2LY2 A;  1Q1H A;  5EG0 A;  1J2X A;  5BMZ A;  2WY7 Q;  1WJE A;  3IP4 B;  2RAE A;  3K6G A;  1SD6 A;  2D1V A;  4AD9 A;  2LOO A;  4BQN A;  5FLX K;  3F0C A;  4YII A;  3GEZ A;  3I9V 2;  1XG1 A;  2E7X A;  3FIS A;  1QVU A;  2M0M A;  5E3L A;  4I6U A;  1NK3 P;  2KEK A;  3JRG A;  4BAC A;  3GX4 X;  2ISZ A;  1V54 H;  1F36 A;  3F8M A;  1X2L A;  3HG9 A;  1OIS A;  1P7I A;  3N05 A;  4FT8 A;  3QYE A;  1MNE A;  2O49 A;  2WAQ A;  3QRF F;  1B6A A;  1BA5 A;  5BNG A;  3EYI A;  4GYG A;  3HZI B;  2LCV A;  1RZR A;  3F21 A;  4L5I A;  2XHK A;  2MAB A;  4RA2 A;  4C9Y A;  3NWT A;  4BJ5 C;  4ZYA A;  2M4K A;  4XLN F;  3DNV B;  4BJ6 C;  1P4X A;  2ZJ2 A;  4IHT A;  4FE4 A;  1RC9 A;  1YO5 C;  2LDU A;  3H9J A;  2JRM A;  1B4A A;  1FX7 A;  4P1W A;  4DYC A;  2GXB A;  1X57 A;  4PJL A;  2F5E A;  4F91 B;  4CH7 A;  1D1A A;  1FOW A;  4A3L J;  3CCY A;  1NEQ A;  1AWC A;  1XSD A;  3Q3S A;  3A9Z A;  4GDF A;  3M8J A;  3HOV J;  3PNT A;  2E5N A;  3NZL A;  2K86 A;  1EV7 A;  5FKM A;  5FFX A;  2VEO A;  1LVK A;  1QQA A;  4B4C A;  4QWQ A;  1JGG A;  3K1N A;  4BAY A;  4KUM A;  2LF7 A;  1R5G A;  2MBF A;  2MLK A;  2IVG A;  4BL0 B;  1OR7 A;  4Z2Y A;  3UR3 C;  1YS6 A;  3V8J A;  5BPD A;  2B63 J;  2B5A A;  1IN7 A;  2VE8 A;  4AYB N;  2PLY A;  5DCF A;  5FJ8 J;  4TV7 A;  5FRM A;  4NDW A;  4MLO A;  2OTL I;  3Q0U A;  1WJC A;  4YIR X;  3OKZ A;  2K02 A;  3FYA A;  2QLZ A;  2R7R A;  3ULQ B;  3Q5F A;  3R0A A;  4D7M A;  1R00 A;  2OBP A;  3EET A;  5H6R A;  3AAF A;  3KZI C;  1N77 A;  3FMS A;  4LMY A;  2PG4 A;  4KJZ A;  3GWZ A;  4ZJZ A;  4D7N A;  4HZF A;  2EZK A;  2XRN A;  2MYS A;  4JCY A;  3KIO A;  4YAR A;  2F2E A;  2NVY J;  2ZXH A;  3ABU A;  5FRO A;  1VTN C;  1CF7 B;  1GXP A;  3M7G A;  1IUY A;  1R22 A;  1R1T A;  1S29 A;  3KFW X;  1IRG A;  1VQM I;  3C2G A;  5CVJ A;  4JX6 A;  4X4B A;  2K9Q A;  2ZXW H;  3MN2 A;  5DTD A;  1TW3 A;  3LFK A;  2XUB A;  4IHX A;  3WHB A;  3IHU A;  3LA3 A;  3WTV C;  1WH8 A;  2BW3 B;  2Y9Z A;  1FWZ A;  2CQQ A;  3K70 C;  3EYY A;  5DCM A;  4A3C J;  2Q8K A;  2OZU A;  3DKW A;  3TDU C;  2CUZ A;  2WAE A;  2JUC A;  5CQG A;  3PIP F;  2R1J L;  5LHH A;  4HV6 A;  4UVA A;  4YIF A;  2ZME C;  1KZH A;  1PRU A;  4I09 A;  2K7L A;  4XK4 A;  1J75 A;  3K4N A;  4M9X A;  5H20 A;  1JXS A;  2XAH A;  2DDA A;  1VND A;  2JSP A;  1I27 A;  3PSF A;  4QSH A;  4CHU A;  5IP7 J;  5F04 A;  2CGP A;  3A02 A;  2NYX A;  3AG2 H;  1C0W A;  5E17 F;  2VI6 A;  4LB5 A;  3GTG J;  1HC8 A;  2HS5 A;  3F8C A;  1SD7 A;  4Z6Y A;  2K9N A;  1XMX A;  3H92 A;  4Y17 A;  1SMY F;  4EM0 B;  2WTE A;  5ERI A;  1KQ8 A;  4RB3 C;  1X2N A;  2JRT A;  2KJC A;  1ZQ3 P;  2CQN A;  4X4F A;  1RKT A;  4BEH A;  2O5R A;  3CTA A;  3PO2 J;  4XNF A;  3KLO A;  2X4H A;  2QZ8 A;  3BZ6 A;  3CO6 C;  2IS4 A;  3CF5 F;  2XRO A;  3LA7 A;  3CLC A;  1HDP A;  4JQD A;  2AQE A;  1O4X A;  1IRZ A;  2ZSH B;  3E6D A;  2QCO A;  4I6Z A;  3GUU A;  5CKT A;  3JRD A;  1FYL A;  5F64 A;  4A3G J;  2XSJ C;  3S3N A;  5BPI A;  1Y7Y A;  3GXO A;  2CV0 A;  1SQ8 A;  2HXO A;  2X6X A;  1RRJ A;  1X1B A;  3BR1 A;  1ETO A;  3ERM A;  5CQE A;  5B1A H;  3QWL A;  4ON0 A;  4X4H A;  4GGG A;  1Q1V A;  2H8W A;  5E3N A;  1UJ8 A;  2VPR A;  1VQ8 I;  2IV1 A;  1JHF A;  3M07 A;  1S72 I;  1RZ4 A;  1MMG A;  3LIS A;  1XTA A;  1RZS A;  1ETK A;  1XN7 A;  1R71 A;  3IAS 2;  2KPJ A;  2VQC A;  3CUQ B;  2K9L A;  4I6R A;  2HOT A;  1TT5 B;  4M6V A;  1BIA A;  2H6B A;  1HKQ A;  1Y6I A;  3VEP A;  2R7W A;  3DM5 A;  3WG7 H;  4CO8 A;  3GTL J;  3KL4 A;  3BR3 A;  3V8L A;  1WHU A;  4DQ2 A;  4A3J J;  1I3A A;  2R7Q A;  2ADU A;  1EH7 A;  1MD0 A;  2RVC A;  4RLF A;  1DU0 A;  2L0K A;  2QQB A;  2X1E A;  5TRD A;  2EIL H;  1J5Y A;  1VQO I;  4DGW B;  3O3K A;  2O4A A;  2AWI A;  2UXN A;  4KIB A;  1JT0 A;  1YW9 A;  3HC7 A;  2BE5 F;  3K9T A;  4UV8 A;  1LVA A;  3KYL A;  1YFH A;  1D0Y A;  3LL7 A;  4KIT B;  2X6O A;  1AOY A;  1XC5 A;  2R63 A;  2KHM A;  4X4I A;  1YE9 A;  3E1S A;  4ENN A;  1ZHF A;  1U3E M;  1F43 A;  2Y31 A;  3R60 A;  1ETW A;  1R36 A;  2A68 F;  4EQZ A;  1B9M A;  5B66 C;  2MA3 A;  3LQX A;  2KIS A;  2Y0S A;  1UB9 A;  2JMW A;  1HCR A;  1Y56 A;  2H1K A;  1I3Q J;  1V4R A;  4MQV A;  1YRN B;  1S5L C;  4JP0 A;  4A0Z A;  1NW3 A;  1K61 A;  4HQE A;  3FXU A;  2E2J J;  4BU2 A;  4BE2 A;  1WH6 A;  3NAR A;  2EZI A;  2VKD A;  3GZ6 A;  2Z99 A;  1ZLK A;  2EFW A;  5M3F J;  2PXP A;  5IOY A;  4IXA A;  4L9N A;  2MXD A;  2E34 A;  4JCX A;  1FT9 A;  4OAZ A;  1V55 H;  2Z5U A;  3RJP A;  2J5P A;  1O3R A;  3DLL F;  1FC3 A;  3FK7 A;  3GVA A;  3I58 A;  2NOJ B;  3GW2 A;  4A3D J;  2VT3 A;  1JKP C;  3FBI B;  4BE1 A;  1HF0 A;  4HX8 A;  1D8J A;  2J7U A;  3EDP A;  1LB2 A;  1IXC A;  4Z5C A;  4IZZ A;  2QBY B;  1D8K A;  3BDN A;  2RNG A;  5J47 A;  2LLW A;  3L2R A;  1WJA A;  5F0C A;  5E79 C;  1O7L A;  5J4V A;  3TEP A;  1MH3 A;  5LHG A;  1CQT A;  4FET A;  4M3F A;  3WTX C;  3MAJ A;  3IKT A;  1K83 J;  2QKL B;  3S2W A;  2F4M B;  1OPC A;  2L4M A;  2PMZ A;  4LIU A;  1O3Q A;  2EV5 A;  2EB7 A;  3QYB A;  3VYU B;  3RKQ A;  1OYI A;  3ZR8 X;  2FQ4 A;  3PL8 A;  5LLQ A;  2HIN A;  4Y15 A;  2ICP A;  4HLX A;  2COB A;  2P7V B;  5A7L A;  4X6A J;  3OYH A;  2PUF A;  3VYT B;  1LEB A;  2VKE A;  4YEJ A;  3W2W A;  1VQP I;  2ME0 A;  3MVP A;  1R69 A;  4Z5H A;  3KP6 A;  3TQN A;  3OYD A;  4LK1 F;  1YS7 A;  2CMP A;  2KIQ A;  3FM5 A;  4BHC A;  1QA6 A;  4OOI A;  4PJM A;  2ELH A;  2VOO A;  3DEW A;  2MGQ A;  2Y0M A;  1N78 A;  3G5G A;  1POU A;  2R4G A;  1KYW A;  4NQW A;  3JXD L;  2HZT A;  2ZNZ A;  2IAI A;  3S15 J;  2HXI A;  1S7O A;  3A1Y A;  3JRI A;  3BZK A;  4YG2 F;  1IV6 A;  3Q9S A;  4RS8 A;  5E1Z B;  2K3P A;  2QUF A;  2R7O A;  4P9U A;  1XSX A;  3A0H C;  1IGN A;  3JRH A;  1IN6 A;  3HUG A;  4PSX A;  1JKQ C;  1YQA A;  2IEK A;  5FKO A;  5F1R A;  2V9K A;  3ABK H;  2GA2 A;  2HFZ A;  3K2Z A;  2JTV A;  3DTK A;  1NK2 P;  1ZG5 A;  1L0O C;  3M8E A;  3P9K A;  2XC7 A;  2O6G E;  2PXV A;  2HGC A;  3I56 I;  4D1Q A;  1X1D A;  3G6E I;  1H9T A;  3O8H A;  1ZK8 A;  9ANT A;  5DDG A;  4EAT A;  3WTS C;  5HLT A;  1Y1W J;  2ZSI B;  4I01 A;  3EUH A;  1OQY A;  4ZZL A;  2B7E A;  4HNV A;  2ME6 A;  1JFS A;  4G6T B;  3GYH X;  1ONV A;  1SAN A;  1P4A A;  1D5Y A;  1I6H J;  2V6C A;  3H3Z A;  3E6M A;  3GFM A;  3KP5 A;  4OAY A;  4EGY A;  3OL3 A;  1DQU A;  1MSF C;  2H8R A;  4YG7 B;  3ABL H;  5F0F A;  1XB4 A;  3HRM A;  2W00 A;  4GXO A;  3HOW J;  2CH0 A;  3CUO A;  1RIO H;  1PDN C;  2W82 A;  4HPQ A;  1ZTR A;  5GAH J;  2EA4 A;  3ASO H;  5FKK A;  2XAF A;  5DYM A;  2BVL A;  4F7Z A;  4XLF A;  2R92 J;  4Z59 A;  5H2F C;  3EUK L;  4RM2 A;  4Y52 J;  2LYS A;  3OQO A;  3HSR A;  3BR6 A;  5GAG i;  5ILV A;  1R49 A;  1RR8 C;  3KPH A;  1D1B A;  2FRH A;  3UNG C;  3BC8 A;  2M7B A;  4XKV A;  3A03 A;  1WPK A;  1U0J A;  2XGX A;  4IHW A;  3FXM A;  2JA7 J;  1E2X A;  3S2H J;  5ICC A;  1YSE A;  3BR0 A;  1T6S A;  2L7Z A;  3CME I;  3FKJ A;  1DPR A;  2DA6 A;  3W6V A;  3CMA I;  2L02 A;  2AW6 A;  1JGS A;  2LC2 A;  3MFK A;  3VB2 A;  3H5T A;  2DA2 A;  2O7O A;  2DU9 A;  4BJT A;  5IYC J;  5HNF A;  2VN2 A;  5JHU A;  2R93 J;  2L3D A;  3JCU C;  4IX7 A;  1NG6 A;  2PMH A;  2ELK A;  3KEQ A;  1UHS A;  1AKH B;  1O7F A;  4A6D A;  3G73 A;  4BS9 A;  1G3T A;  2CU7 A;  3BJO A;  2DA7 A;  1SFU A;  1W5C C;  1QP7 A;  4L9J A;  1BOB A;  2M2E A;  2WA0 A;  2OZ6 A;  1U5T A;  3KET A;  3V8K A;  1VQ7 I;  3CJN A;  2A6C A;  1UG2 A;  2I5U A;  3R6S A;  3LOC A;  5D8K B;  1R1U A;  3HGG A;  2LYK A;  4P5O A;  3CCM I;  1NTC A;  3IWZ A;  3AL0 C;  4I02 A;  3GBF A;  1YYV A;  2G0E A;  2OD5 A;  1OFC X;  3OIQ A;  3LNQ A;  2W1O A;  1IAW A;  5HOO A;  3FBN B;  4UUV A;  2WBM A;  1BI0 A;  5EF6 A;  2EZH A;  4BDZ A;  3LSH A;  3PUB A;  3HEF A;  1W36 D;  3W2A A;  4HRI A;  3SDB A;  5A2Q K;  1S3J A;  3S1Q J;  2EFQ A;  1HST A;  4PFO A;  1YTY A;  1HLV A;  1A04 A;  1WGX A;  5M5X J;  4HG2 A;  1UMQ A;  3K4C A;  1IRF A;  3FK6 A;  3TKY A;  1ZAO A;  2EBI A;  3OV8 A;  4WWC A;  2O03 A;  3ZHM A;  2RC4 A;  4QTR A;  4WK8 F;  3RKY A;  4AIK A;  1GVD A;  1PUF A;  1LCC A;  2XB5 A;  2KRF A;  4AIJ A;  2KZV A;  1WJ5 A;  2KFD A;  4MHG A;  3NQO A;  1E3P A;  1K78 A;  4BXX J;  2R7S A;  4L0Z B;  2EFN A;  2ID3 A;  3L2U A;  1LQC A;  2YSR A;  3G1O A;  3QPS A;  4B44 A;  3SZP A;  5D8L B;  1NH3 A;  1T95 A;  2KRC A;  2R7T A;  1FBQ A;  3BRO A;  2FOK A;  4FQG A;  4KIS A;  3V7C A;  3FX3 A;  2D2W A;  1U8B A;  1TT0 A;  2L2O A;  4LIT A;  2GLO A;  1PUE E;  4X4C A;  1LNW A;  1KYZ A;  3MZY A;  1F4K A;  2DJI A;  3A9X A;  4Z58 A;  5F1J A;  3BCA A;  4HNT A;  1OCZ H;  4F8D A;  4EM1 A;  2MH9 A;  2JA2 A;  3OWT A;  1YX3 A;  5TGT A;  4XQF A;  4EQQ A;  3L09 A;  3U9G A;  2STT A;  5EDN A;  2VB6 A;  2QYO A;  2VC0 A;  4D0P A;  1OCP A;  3HSE A;  3B02 A;  4DIQ A;  2FFH A;  2F5C A;  3EPZ A;  1X1C A;  3TOB A;  2EF8 A;  4RGR A;  4PFP A;  5DD8 A;  4OIO F;  4KA4 A;  2HU9 A;  3ONQ A;  1LFU P;  2D45 A;  1K6O A;  1WVR A;  2RRE A;  1U6G A;  2EFO A;  1MMD A;  2HFH A;  1B72 B;  3BJ6 A;  3DPT A;  1LDK B;  3BDD A;  1UFM A;  3UKG A;  1GV5 A;  1OR7 C;  2DJN A;  4HAM A;  4CGZ A;  4UB6 C;  2CSF A;  2BVM A;  1BM9 A;  3HOS A;  3LSP A;  3DP7 A;  1UAA A;  2QSG X;  2FNP A;  3DU5 A;  2CJJ A;  1Z7U A;  3MWM A;  5K1Y A; 
#chains in the Genus database with same CATH homology
 1T33 A;  4Y42 A;  2IVG A;  2LYJ A;  3LSR A;  2B63 J;  2MSY A;  2B5A A;  1POG A;  3SDG A;  3TW7 A;  4AYB N;  2HOS A;  5FJ8 J;  2KT0 A;  1ZZ9 A;  3SCH A;  5GP9 A;  4NDW A;  4MLO A;  3R1F A;  4Y7N J;  1ZR2 A;  1TWH J;  4MIM A;  2EZL A;  3Q0U A;  5K7H A;  4XRM A;  1U78 A;  3JRE A;  3FYA A;  2IU7 A;  4D7M A;  1MBE A;  2CUF A;  5J1Y A;  3ZQH A;  1GUU A;  2Y9Y A;  1RES A;  4O8B A;  4D7N A;  3FMY A;  2EZK A;  1BW5 A;  3S1N J;  3A01 A;  1Y9Q A;  1UXD A;  4JCY A;  1ZR4 A;  4YAR A;  2NVY J;  3H3V K;  2K40 A;  3HBL A;  1ETY A;  4X1E A;  1Z0X A;  1FIP A;  5J1R A;  4IHY A;  1UXC A;  3B7H A;  2MG4 A;  4M3B A;  4JX6 A;  4X4B A;  2K9Q A;  1PNR A;  3MN2 A;  5F0H A;  2LD5 A;  2AO9 A;  5DTD A;  5K7F A;  2XGC A;  2PIJ A;  2CUE A;  2ZB9 A;  3PXP A;  2X9D A;  1ITY A;  1ORK A;  4IHX A;  3WHB A;  1G2H A;  3WHC A;  1WH8 A;  3RZZ A;  2Y9Z A;  3F52 A;  1JH9 A;  2CQQ A;  4MCT A;  1B72 A;  4A3C J;  1EFA A;  4PU8 A;  3KJX A;  4M3E A;  3HOZ J;  2R1J L;  1E3O C;  2MW8 A;  2DMQ A;  1PRU A;  1U9O A;  2DTZ A;  1BW6 A;  4XK4 A;  1JKO C;  2PUC A;  2PUB A;  2XSD C;  2YS9 A;  2LKX A;  1VND A;  4QSH A;  2DA1 A;  2PUE A;  2CQX A;  5IP7 J;  5F04 A;  3A02 A;  4GHJ A;  2L8N A;  4X4E A;  2VI6 A;  2AXZ A;  2ICT A;  3GTG J;  1A5J A;  3QQ6 A;  2R5Y B;  2K9N A;  4YG4 A;  2PUD A;  1PRA A;  3BS3 A;  4C3J J;  1X2N A;  5EZH A;  1RPE L;  2PUA A;  4JX4 A;  2M34 A;  2IUO A;  3UFD A;  2DA3 A;  1ZQ3 P;  4X4F A;  1RKT A;  2M0C A;  2DMP A;  3JRB A;  3OQM A;  5C44 J;  4D5C A;  3PO2 J;  5EGO A;  1ZZ6 A;  1ZGW A;  1R63 A;  1QP0 A;  2AHQ A;  1JUM A;  3ZQL A;  3CLC A;  2LLK A;  1XS9 A;  1HDP A;  1JUP A;  4JQD A;  1O4X A;  1IRZ A;  2CRO A;  2QCO A;  4I6Z A;  2BNM A;  1W0U A;  3JRD A;  2GRM A;  4A3G J;  4FTH A;  1ZVV A;  4A3K J;  1Y7Y A;  1WIZ A;  1QP4 A;  1SQ8 A;  2HXO A;  3BTC A;  2EQR A;  1TC3 C;  2OPT A;  2XPV A;  3E7L A;  3Q0W A;  4PU7 A;  3BR1 A;  1ETO A;  2Y0S N;  3BR2 A;  4A3M J;  1GT0 C;  4MFE A;  2LYL A;  4X4H A;  2OF7 A;  1Q1V A;  2M8G X;  2I10 A;  5E3N A;  1QPI A;  2IVQ A;  5K98 B;  2LY9 A;  2VPR A;  2IV1 A;  2WUS R;  1MH4 A;  5E3M A;  1JJ8 C;  3LIS A;  4DZJ A;  1RZS A;  3HOU J;  1ETK A;  1WI3 A;  3HKZ N;  5M5W J;  2LR8 A;  4DYR A;  2KPJ A;  4YG1 A;  4A3E J;  2JA6 J;  2XI8 A;  4I6R A;  2BJC A;  2HOT A;  4M6V A;  2GBY A;  1APL C;  2FJR A;  2AUW A;  3D1N I;  4V2G A;  1ZZ8 A;  4IA8 A;  5JLW A;  1FTZ A;  3GTL J;  2L9R A;  3BR3 A;  2TCT A;  3SFI A;  1TWF J;  4GQM A;  4A3J J;  2IBD A;  1H8A C;  3ZOB A;  5IYB J;  4AUX A;  1DU0 A;  2L0K A;  3BQZ A;  3GTQ J;  3PM1 A;  2W48 A;  2O4A A;  1BDI A;  2XJ3 A;  2AWI A;  3BT9 A;  3HGY A;  1JT0 A;  2NVX J;  4PU3 C;  3JRA A;  1MBJ A;  2JK3 A;  2R5Y A;  1OCT C;  3S2D J;  3BTI A;  1IUF A;  2X6O A;  2DA4 A;  3Q0V A;  4I76 A;  1QVT A;  1XC5 A;  3GBG A;  1RR7 A;  4L5E A;  2R63 A;  2O38 A;  4X4I A;  3OSF A;  1A6I A;  1GV2 A;  4AC0 A;  3HM5 A;  3OQN A;  1F43 A;  3CRO L;  2Y31 A;  1ETW A;  3RZD J;  3I4N J;  5C4X J;  1VFC A;  1GDT A;  5J3L A;  3QWG A;  2MEZ A;  4XIC A;  3NAU A;  4M3G A;  1X58 A;  2VKV A;  2JMW A;  2PMZ N;  1HCR A;  4CYC B;  2H1K A;  2ECB A;  1ZZC A;  1I3Q J;  3HOX J;  1YRN B;  4JP0 A;  1LCD A;  1LMB 3;  3BTJ A;  3BG5 A;  4C2M J;  1IDY A;  1K61 A;  2E2J J;  3JXB C;  5M5Y J;  1FTT A;  1WH6 A;  3NAR A;  2EZI A;  3K2A A;  4IWR A;  2LYP A;  5M3M J;  1OJL A;  4BBR J;  3B6C A;  2IVB A;  5M3F J;  4DW6 A;  3VK0 A;  5IOY A;  3GTO J;  4DZP A;  1DU6 A;  5DS9 A;  1T56 A;  4JCX A;  1JTY A;  3FK7 A;  4GFB A;  3ZQI A;  3IH4 A;  2DA5 A;  4A3D J;  1JKP C;  1HF0 A;  5IOZ A;  2O8K A;  3VPR A;  3GTK J;  1VI0 A;  3S17 J;  4FN3 A;  3BD1 A;  1PRV A;  1VPW A;  4BKX A;  5EZG A;  1AU7 A;  3GTP J;  2XGE A;  4Z5C A;  4S0H B;  2KEI A;  2R0Q C;  2EH3 A;  3BDN A;  4EEF G;  2EWT A;  3GTJ J;  3TRB A;  2XIU A;  5F0C A;  3S1R J;  1B8I B;  2NVQ J;  3QF3 A;  4XRS G;  3OSG A;  1BJZ A;  1MH3 A;  1CQT A;  3KXA A;  3GTM J;  1ADR A;  4M3F A;  1PER L;  1K83 J;  2YU9 J;  3G1M A;  3SJM A;  3IV5 A;  4DYQ A;  1ZS4 A;  2OFY A;  2BNN A;  3C2B A;  4J19 A;  4A3I J;  4FBI A;  2HQ5 A;  3B6A A;  3RKQ A;  1WH7 A;  3GN5 B;  1TWC J;  2FQ4 A;  2FX0 A;  2XCJ A;  2HIN A;  1TWA J;  2ICP A;  1MSE C;  1ZAY A;  2COB A;  1FEX A;  5A7L A;  4X6A J;  3O9X A;  2PUF A;  2XGD A;  2VKE A;  5IPA A;  2ME0 A;  3MKL A;  3MVP A;  3RQI A;  1R69 A;  3ZHI A;  4A3B J;  1JJ6 C;  1FIA A;  4CYC A;  4BBS J;  4BY7 J;  3I4M J;  3IVP A;  4Z5H A;  1XWR A;  1YRN A;  3DEW A;  2LP0 A;  2MGQ A;  2NOG A;  3G5G A;  4X4D A;  1OSL A;  1POU A;  1BDH A;  1VF9 A;  2EBY A;  3JXD L;  2IAI A;  3S15 J;  3TP3 A;  2PUG A;  3S14 J;  2HXI A;  2WV1 A;  4NDL A;  3JRI A;  4LOC A;  1IV6 A;  2LTP A;  2KEJ A;  3JRF A;  4IHV A;  4UUT A;  4A3F J;  4ABZ A;  2JA5 J;  3OIO A;  2E2I J;  1B0N A;  2XB0 X;  5F08 A;  1IGN A;  3JRH A;  2R7Z J;  2LVS A;  3CEC A;  1JKQ C;  5C3E J;  1IDZ A;  3BG3 A;  3SCG A;  3U3W A;  2IEK A;  2GM4 A;  5FKO A;  4Z5D A;  1R9T J;  2KZ8 A;  4JYK A;  2LYQ A;  1NK2 P;  4C3H J;  2E1O A;  2DMN A;  1W0T A;  2D5V A;  4A69 C;  3O8H A;  1ZK8 A;  9ANT A;  3BQY A;  1B8I A;  1MBK A;  2WIU B;  1Y1W J;  2DMU A;  4RDU A;  3L1P A;  2E2H J;  3ZKC A;  1AHD P;  1EF4 A;  2FJ1 A;  1LE8 B;  5GPA A;  4HNV A;  2ME6 A;  1JFS A;  1IC8 A;  4FCY A;  1SAN A;  1D5Y A;  2CRG A;  2O9L A;  1I6H J;  4YBA A;  2PE5 A;  1WET A;  5FKL A;  2XPW A;  1H89 C;  1RKW A;  5JLX A;  1I50 J;  3FKI J;  1MSF C;  3M4O J;  1IG7 A;  2H8R A;  4YG7 B;  5F0F A;  3GN5 A;  3HOW J;  1MBF A;  3S1M J;  3QQA A;  1ETV A;  3LSJ A;  1MBG A;  1ZTR A;  3BG9 A;  3FYM A;  3IH2 A;  5FKK A;  1JUS A;  4XRS A;  1ZZB A;  2NS8 A;  1SFO J;  2R92 J;  3OMT A;  2X48 A;  4RBO A;  3ZQF A;  4Z59 A;  4Y52 J;  2LYS A;  3OQO A;  5GPC A;  1JKR C;  3BR6 A;  4I6T A;  4MCX A;  1WCM J;  4OB4 A;  4J1X A;  1PUF B;  1WH5 A;  1X2M A;  3K7A J;  3F51 A;  3CQZ J;  3FIW A;  4D5F A;  5IP9 J;  1FJL A;  5E3O A;  1QPZ A;  3A03 A;  1WPK A;  4IHW A;  2JA7 J;  2R5Z B;  3S2H J;  2AXV A;  5C4J J;  1YSE A;  1LLI A;  3BR0 A;  2L7Z A;  3JXC L;  2DA6 A;  3BR5 A;  3W6V A;  5HOD A;  3O8G A;  5EG0 B;  2VUM J;  2AW6 A;  3H5T A;  3F6W A;  3RZO J;  2DA2 A;  2O7O A;  3QPL A;  5IYC J;  3DCF A;  1JT6 A;  2JA8 J;  2R93 J;  2HI3 A;  4V2F A;  1JWL A;  5EGO B;  2MQK A;  2ELK A;  4W97 A;  4BY1 J;  4I8T A;  2NVT J;  3ZQG A;  4QIW N;  1UHS A;  1AKH B;  1UTX A;  3LFP A;  1LFB A;  4MO7 A;  2GZU A;  2L7F P;  2CU7 A;  2LYR A;  2DA7 A;  3TP0 A;  1QP7 A;  4MFD A;  4IEJ A;  2M2E A;  1ENH A;  3HOY J;  4UUS B;  1RPW A;  1QRY A;  1LE8 A;  3KZ3 A;  1CJG A;  3HDD A;  2A6C A;  1UG2 A;  3LOC A;  4FE7 A;  3HGG A;  2LYK A;  2JWT A;  1NTC A;  3TW6 A;  3HB9 A;  1ETQ A;  2L7M P;  3GBF A;  4X4G A;  3MLF A;  2G0E A;  5F27 A;  1OFC X;  4G12 A;  2L49 A;  1H88 C;  2BNO A;  1S7E A;  2WAQ N;  3ZQC A;  2DN0 A;  2HOA A;  2LFB A;  3LNQ A;  4J1W A;  2Y30 A;  3OOU A;  2K9S A;  2JJ7 A;  2YUS A;  4FIS A;  2EZH A;  2Y2Z A;  5EF6 A;  1TWG J;  3HEF A;  2M9H A;  2XPU A;  1DW9 A;  3G7D A;  2OR1 L;  3CMY A;  4XID A;  1ZPQ A;  1RIO A;  3S1Q J;  1RET A;  1ZUG A;  4M3D A;  2HYJ A;  1HLV A;  1WGX A;  5M5X J;  5K7Z A;  2FD5 A;  1UMQ A;  3IH3 A;  3FK6 A;  2EBI A;  1JTX A;  2HSG A;  3ZHM A;  4QTR A;  1GVD A;  1PUF A;  5FLM J;  2JVL A;  2XB5 A;  4B3A A;  1LCC A;  2DMT A;  5EYR A;  3LSG A;  2R5Z A;  4IVZ A;  4B1R A;  1L1M A;  4C3I J;  4BXX J;  1ETX A;  2ID3 A;  3BTL A;  2HDD A;  4JX5 A;  3EUS A;  2E19 A;  3JRC A;  3SCF A;  2P81 A;  3H0G J;  3S16 J;  1LQC A;  3G1O A;  4W1U A;  3QPS A;  5EG0 A;  2GRL A;  1HDD C;  2RAE A;  1MBH A;  1U9N A;  3M3Y J;  1NER A;  1ZZ7 A;  3F0C A;  2AXU A;  5EEA A;  1XG1 A;  3TED A;  1U8B A;  3FIS A;  3G1L A;  1QVU A;  5E3L A;  2GLO A;  4I6U A;  1NK3 P;  4X4C A;  2KEK A;  1Z77 A;  3JRG A;  1AKH A;  2NS7 A;  1F36 A;  1X2L A;  2LK2 A;  2XRL A;  1P7I A;  4Z58 A;  5F1J A;  4PU4 C;  2O49 A;  2PPX A;  1BA5 A;  5IP6 A;  2ID6 A;  2WB1 N;  5BNG A;  3A01 B;  4F8D A;  3HZI B;  2LCV A;  4UUS A;  1P7J A;  1RZR A;  1Y1V J;  5J1U A;  5EDN A;  2TRT A;  4A93 J;  2N8G A;  2ECC A;  3DNV B;  1OCP A;  1JFT A;  4FE4 A;  2JCG A;  5FKN A;  2EF8 A;  4DYC A;  1X57 A;  5FLV A;  1LFU P;  1QQB A;  4A3L J;  1DWK A;  3CCY A;  1NEQ A;  3JR9 A;  1IJW C;  3S8Q A;  1B72 B;  3Q3S A;  5IYD J;  1BL0 A;  3QYX A;  3HOV J;  3UKG A;  3OP9 A;  1GV5 A;  1HOM A;  2KDZ A;  2DJN A;  2QF7 A;  1ZKG A;  5FKM A;  1MNM C;  2CSF A;  3PO3 J;  1QQA A;  3LSP A;  4B4C A;  1JGG A;  2CJJ A;  3CDL A;  1RZR D;  2JN6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...