2D5VA

Crystal structure of hnf-6alpha dna-binding domain in complex with the ttr promoter
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
155
structure length
135
Chain Sequence
MEEINTKEVAQRITTELKRYSIPQAIFAQRVLCRSQGTLSDLLRNPKPWSKLKSGRETFRRMWKWLQEPEFQRMSALRLPRLVFTDVQRRTLHAIFKENKRPSKELQITISQQLGLELSTVSNFFMNARRRSLDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords 5'-D(*TP*CP*TP*AP*AP*GP*TP*CP*AP*AP*TP*AP*AP*T)-3'
publication title DNA recognition mechanism of the ONECUT homeodomain of transcription factor HNF-6
pubmed doi rcsb
source organism Rattus norvegicus
total genus 45
structure length 135
sequence length 155
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2d5vA02
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2d5vA01
2NVXJ 1ETOA 2K9NA 5EG0A 4IHXA 2L7MP 2ZB9A 2H8RA 2BNMA 3G1MA 4CYCA 2JA7J 2LYRA 1WI3A 1L1MA 3BR3A 3HGGA 2LP0A 2XGCA 4MIMA 5FJ8J 4YARA 2FJ1A 3IH4A 1TC3C 5IYBJ 4I6ZA 2E19A 5HODA 1ZK8A 2LCVA 5BNGA 4FTHA 1PRAA 3OQOA 3FIWA 1SQ8A 3MVPA 5JLWA 2LD5A 1IV6A 1YRNA 4D5FA 3UKGA 1LCDA 2XGDA 1PRUA 3ZQIA 3TEDA 1ZZ6A 5IOZA 1Y1WJ 3RZOJ 4FBIA 2LVSA 1F36A 2AHQA 1OFCX 2DA6A 1FTZA 2NOGA 1K83J 2MG4A 3BR6A 3G5GA 5K7FA 1ETVA 1RZSA 3F0CA 2FX0A 1VPWA 4D7NA 2B5AA 2IV1A 2CUFA 3S2DJ 2WAQN 4M3BA 3JRHA 1R9TJ 5FKKA 1B8IB 3O9XA 4A3JJ 4A3FJ 5J1RA 2R92J 1YSEA 2XCJA 3ZKCA 2MGQA 3IV5A 3SCHA 1WH8A 1WH5A 4Z5DA 2O7OA 4JQDA 5E3NA 4JX4A 4MLOA 4A3GJ 1JWLA 1MBFA 2O49A 2B63J 2QCOA 4GHJA 3PXPA 1BW5A 3IH2A 3A01B 3JRBA 1BA5A 4JX6A 2N8GA 4DZPA 3OSGA 1X2LA 3F51A 3GTKJ 1O4XA 2CSFA 2LYLA 3VK0A 4DZJA 1JFSA 3Q0UA 3G1OA 5M3FJ 3KZ3A 3SJMA 1JKPC 3HOZJ 3G7DA 3RZDJ 1ZVVA 1JKOC 2NVYJ 3RKQA 3BD1A 2CQQA 4IA8A 4YBAA 4X6AJ 4JP0A 1ZZ8A 1TWAJ 5FKMA 4XIDA 4C3JJ 1G2HA 3S8QA 3QPLA 1B72A 2HXOA 5IOYA 5FKLA 5E3MA 1HDPA 3CECA 3ZQHA 1JUSA 4Y7NJ 2AUWA 2E1OA 5IP6A 3U3WA 2HDDA 4XRMA 1LFUP 2XPWA 1T33A 3BG9A 3LSGA 3S15J 4I6UA 1TWFJ 3OIOA 2OF7A 2NVQJ 5IP9J 3B6AA 5E3OA 1FTTA 5EGOA 2ECBA 3F6WA 5F0CA 2GLOA 2LFBA 3LOCA 1U78A 1MSEC 1MNMC 3VPRA 4MCXA 3DNVB 1XC5A 4JCXA 1RZRA 4I76A 2BNNA 3HBLA 2R1JL 3GN5A 3LSPA 3BTIA 1LFBA 3SDGA 2CRGA 3BR1A 1QP4A 3JREA 2XSDC 1ZQ3P 3JRCA 4IVZA 3BG5A 2Y31A 2O9LA 4Y42A 4FCYA 3S16J 3O8GA 3QQAA 1LQCA 2K40A 5J1YA 3ZOBA 2PMZN 5J1UA 1X2MA 3GBFA 2XB0X 2JMWA 3BTJA 2BJCA 1QQAA 4B1RA 1ETYA 2JA6J 2DTZA 1MBHA 4GQMA 4QTRA 3HEFA 2AXZA 4D7MA 1GVDA 3HDDA 1QPIA 1RIOA 1AHDP 4X1EA 4C3HJ 3PO2J 4OB4A 4MFDA 1VFCA 1GDTA 3BR2A 2R5ZB 2PUBA 1IJWC 5F08A 1AKHA 1ETQA 3CQZJ 2P81A 5EYRA 1ZGWA 3BDNA 2X9DA 1A6IA 4HNVA 3RQIA 3UFDA 1IUFA 2MEZA 2ME0A 3FYAA 2IEKA 1ZKGA 2DMUA 3O8HA 4AC0A 1RR7A 2VKVA 2EZKA 5GP9A 1JTXA 1ETXA 2XI8A 3GTGJ 2PUDA 2EBIA 2CROA 1WH6A 2NVTJ 3RZZA 2EZHA 4Z5CA 3JRFA 1X2NA 5M5XJ 1XWRA 2XJ3A 1ETWA 1ZR2A 2JK3A 3ZQFA 2FQ4A 2O8KA 2OFYA 4BXXJ 3GTMJ 2HOAA 3D1NI 3HB9A 3JRIA 3GTJJ 4XICA 3W6VA 3A01A 1JT0A 1LE8A 1X57A 2KPJA 4PU7A 2L7ZA 3JRGA 1UG2A 4YG4A 1CJGA 5GPAA 5EZGA 1ZZCA 2JN6A 4W1UA 1JJ6C 3JRDA 4FISA 4C3IJ 3NAUA 3QQ6A 2PUCA 1LCCA 2I10A 1RPWA 2Y0SN 3MN2A 3S1MJ 4J1WA 3GTQJ 3BTCA 4I6TA 5A7LA 3WHBA 2AXUA 4O8BA 3FK6A 1MH4A 5M3MJ 3GTLJ 1PUFA 2H1KA 2L8NA 1MH3A 2XIUA 3DEWA 2YUSA 4GFBA 1EF4A 3BQYA 2VI6A 2L7FP 1MSFC 1QP0A 4IWRA 1GT0C 2KDZA 3WHCA 1D5YA 4A93J 2KEIA 1A5JA 1QPZA 1W0UA 4CYCB 2HINA 3HKZN 1JTYA 5F0HA 2JA5J 4PU3C 1ZUGA 4QIWN 2IBDA 2MSYA 1MBEA 3EUSA 1QVTA 1Q1VA 2LKXA 5C44J 1ZAYA 1YRNB 1F43A 4ABZA 2PUFA 4PU8A 3ZHMA 2IVBA 1FIPA 1MBJA 2VPRA 1IRZA 4S0HB 2K9QA 2XGEA 2M9HA 2O38A 1HDDC 2M0CA 2Y9YA 2TCTA 2HOSA 1RETA 3OQNA 2A6CA 2WUSR 1NTCA 1ORKA 1WETA 5C4JJ 1GUUA 2R63A 3PO3J 3IVPA 2DN0A 2HXIA 5JLXA 5M5WJ 1H88C 4Y52J 3OSFA 2GZUA 1JT6A 2ECCA 1VF9A 4A3LJ 1LMB3 4NDLA 4M3FA 4A3DJ 1ZS4A 1UMQA 1U8BA 2YU9J 4F8DA 1WCMJ 4A3MJ 3IH3A 1ZZ9A 4XK4A 2LLKA 5IYDJ 2M8GX 5DTDA 1ZR4A 1XS9A 4V2GA 3TW6A 4M6VA 3LISA 1ADRA 2CQXA 1K61A 1Y9QA 3R1FA 2R5ZA 4A3IJ 1JKQC 1GV2A 3JR9A 1ETKA 4V2FA 2VUMJ 2GRMA 2LTPA 1JH9A 2EH3A 2RAEA 4Z5HA 2XRLA 1FJLA 2Y30A 1HF0A 1GV5A 3CDLA 5K7HA 2MW8A 3BR0A 2BNOA 3LSJA 3JRAA 3I4NJ 1JGGA 1NK2P 3S1QJ 1OJLA 1MBGA 4B4CA 4IHYA 4A3BJ 3I4MJ 1QRYA 4X4DA 4DW6A 1R69A 2IVQA 3LFPA 3S2HJ 2OPTA 3QYXA 5FKOA 2DMTA 5EEAA 1B72B 1PNRA 1QQBA 3S1RJ 3CROL 4IHWA 4DYQA 2ID6A 3TRBA 2HYJA 2Y2ZA 3CLCA 2E2JJ 4EEFG 1UTXA 1P7IA 4A69C 4FE7A 5IP7J 3S14J 5F0FA 1DU0A 1LLIA 4QSHA 3C2BA 4X4BA 2TRTA 1H8AC 2DA7A 3CCYA 1ITYA 4JCYA 2PE5A 2COBA 1U9NA 3K7AJ 3JXBC 4L5EA 4Z59A 1HOMA 1U9OA 5E3LA 2ICPA 3G1LA 1I6HJ 5K7ZA 3FK7A 1B8IA 1I3QJ 5EZHA 3ZQGA 1Y7YA 2O4AA 1VI0A 2KT0A 1POUA 1X58A 2DJNA 2EZIA 3ZQCA 5F1JA 2KZ8A 1BDHA 2GM4A 1IDYA 3CMYA 3HM5A 1TWHJ 2R93J 3L1PA 4BBSJ 1NEQA 4W97A 1ZZ7A 1DWKA 3HGYA 2M2EA 1IC8A 1RPEL 5FLVA 1PRVA 3LSRA 2IUOA 1JJ8C 2QF7A 3HOVJ 4YG1A 1JUMA 1QP7A 2IAIA 2XPVA 1UXDA 2LR8A 2X6OA 2FJRA 2VKEA 5FKNA 3OP9A 4UUSB 2R5YB 4MFEA 3BTLA 2PIJA 1Y1VJ 1AKHB 2OR1L 2WB1N 2XPUA 3H3VK 4XRSA 1DU6A 4A3CJ 4B3AA 4X4HA 3LNQA 3Q0WA 4A3KJ 2CJJA 2DA2A 2D5VA 2W48A 5F27A 3KXAA 4XRSG 1RZRD 2G0EA 5J3LA 1T56A 4AUXA 2LYQA 5EG0B 4G12A 2HSGA 2LYPA 4X4IA 4FE4A 3FMYA 4DYCA 3OQMA 2GRLA 1TWGJ 2K9SA 4I8TA 1WIZA 4YG7B 2CUEA 2EQRA 4BY7J 5EF6A 3SCFA 1XG1A 3HOUJ 3B7HA 3OMTA 2ID3A 2L0KA 3KJXA 2M34A 1IG7A 2KEJA 2E2IJ 3GTPJ 1QVUA 1UXCA 1RKWA 2MQKA 1UHSA 2CU7A 4FN3A 1NERA 1OCTC 2EZLA 5C4XJ 4D5CA 1IDZA 1LE8B 1OCPA 4A3EJ 3M4OJ 3K2AA 2JCGA 2YS9A 2DA4A 4X4EA 1BJZA 2KEKA 3HOYJ 3H0GJ 4C2MJ 3GBGA 4MO7A 2FD5A 2R0QC 3B6CA 1B0NA 1Z77A 3ZHIA 1TWCJ 2AW6A 1WGXA 2JWTA 2EF8A 4Z58A 5EDNA 2LYSA 1JKRC 3JXCL 5K98B 5FLMJ 2PUEA 1JFTA 4IEJA 1WH7A 4JYKA 4AYBN 2AO9A 1H89C 1W0TA 1P7JA 2ELKA 2AXVA 3TP3A 2EWTA 1PUFB 2LYKA 2NS8A 3A03A 4PU4C 2DA5A 5IPAA 3E7LA 1CQTA 1SANA 1DW9A 4NDWA 1SFOJ 2WIUB 2JJ7A 3FYMA 1ZZBA 2NS7A 4M3GA 3TP0A 5GPCA 4I6RA 3ZQLA 1VNDA 2JVLA 1RKTA 5DS9A 1BW6A 2IU7A 3MKLA 3GTOJ 2GBYA 5M5YJ 4J1XA 3BG3A 4BBRJ 1R63A 2E2HJ 2Y9ZA 4UUTA 2EBYA 3SCGA 3FKIJ 9ANTA 2DA3A 2L9RA 3QPSA 3Q3SA 3BS3A 1FEXA 1WPKA 4IHVA 1MBKA 1ZTRA 2DA1A 1HLVA 2PUAA 4RDUA 1POGA 4LOCA 5IYCJ 3BT9A 1BDIA 1AU7A 2PPXA 2HQ5A 3H5TA 1S7EA 3PM1A 4X4CA 3SFIA 2R7ZJ 4X4GA 3BR5A 2XB5A 3M3YJ 4X4FA 3S17J 3HZIB 3A02A 2X48A 2LY9A 3TW7A 5EGOB 2HOTA 1PERL 1EFAA 4J19A 3DCFA 4RBOA 3F52A 2DMPA 2DMQA 3MLFA 1RESA 3FISA 1Z0XA 5C3EJ 2HI3A 1I50J 2ICTA 4M3DA 2IVGA 2L49A 4JX5A 1OSLA 3GN5B 2PUGA 2JA8J 3HOXJ 4UUSA 2R5YA 2AWIA 4MCTA 3Q0VA 2DMNA 2ME6A 1JUPA 4BY1J 2LK2A 1FIAA 3NARA 1IGNA 3HOWJ 3JXDL 2LYJA 5F04A 3S1NJ 3BQZA 2WV1A 4M3EA 4DYRA 1APLC 1ENHA 3OOUA 1HCRA 4BKXA 1E3OC 1ZPQA 3QWGA 1NK3P 1BL0A 3QF3A
chains in the Genus database with same CATH superfamily
2K86A 2BNMA 3LFUA 1I1GA 3B73A 2L01A 1BBYA 2FJ1A 3KIOA 5LBQA 1KQ8A 1HKTA 3DLAA 5BNGA 1LEBA 1PRAA 2CFOA 1BM9A 1SQ8A 3MVPA 2LD5A 2AQFA 2CUJA 5HDNA 2A61A 3ZN1A 4WVLA 1KA8A 3F3XA 2CYYA 3MAJA 3K1NA 1Y1WJ 1IXCA 3EQLF 4FBIA 5GAEJ 1F36A 2AHQA 4LG3A 1OFCX 4E6KG 4HZFA 3OIPA 1XSDA 3BR6A 3RJPA 4E7JA 2DODA 2YSRA 2FX0A 2X51A 4RM2A 3S2DJ 2LH9A 3PNTA 1MKMA 1OR7C 4E7LA 1B8IB 3QFIA 4OBMA 4F91B 3O9XA 3L2RA 3G0TA 3VYUB 3HRSA 4EVIA 4ENMA 3F72A 1YSEA 2XCJA 3ML6A 5DYMA 4BHPA 3SCHA 2Q8KA 4OIPF 5JI6A 4WXHA 4Q48A 3SEQA 5JHUA 4JX4A 3BOQA 4A3GJ 1JWLA 4N0BA 2WADA 1F5TA 3PXPA 4YIRX 2FRHA 6PAXA 2PXTA 3EDPA 2VKDA 1BA5A 4B48A 3FMRA 4RGUA 2N8GA 3LSIA 3MZHA 3OSGA 1GXQA 2XHKA 1QHGA 3GTKJ 3H9JA 1O4XA 2CSFA 3Q0UA 5DTMA 3KZ3A 2F5FA 1JKPC 3RZDJ 1OYWA 5HNFA 5JHFA 2CQQA 4YBAA 5JUWA 4X6AJ 4JP0A 1ZZ8A 4CZCA 1ZARA 4XIDA 1F4KA 5IT9K 4YFNF 3CO6C 4M74A 3VYRB 2DFIA 3OS2A 3X2QH 3WGGA 3K4BA 1GVJA 2AUWA 2E1OA 5IP6A 2NVUB 3QWLA 5J4YA 3TGNA 2LREA 1LFUP 4HRIA 1X3WB 1WJFA 1SAUA 2BY0A 4ZYAA 2P8TA 4I01A 4I6UA 2K3PA 1DGRM 1S7OA 1MJAA 4A2UA 4A6DA 2NVQJ 2JRMA 4LIUA 5IP9J 4KT5C 1H9TA 3K4JA 4XLAA 3PE5A 2QQ9A 1E17A 2X4HA 2GLOA 1KQ9A 1U78A 3ZXSA 2FXAA 4HX8A 4MCXA 1XC5A 1FBQA 4JCXA 1RR8C 4RB0A 3LSPA 3BTIA 1LFBA 4NNJA 3SDGA 2HNHA 3LQQA 5LFAA 1S9HA 2Z5UA 1DPRA 1PUEE 1BR4A 3ISPA 2O9LA 2CS3A 2LBFB 3S16J 3O8GA 4DOZA 1OYYA 5DRTA 3CCRI 5J8CA 3KZIC 4HSTA 3PNYA 2L7KA 1XB4A 1QQAA 4B1RA 1ETYA 4OIOF 5GAGJ 3WE3A 4GQMA 2CQKA 2V4JC 3TMOA 3OYMA 2C6YA 2PMUA 1BI1A 1IUYA 3CJQB 1DGWY 3I56I 4ER6A 5CQGA 4I09A 3S32A 3BR2A 2R5ZB 2EFOA 5F08A 2WY7Q 4LG0A 2H27A 2ISYA 1V54H 2E34A 2EA2A 3I59A 1ETQA 2ACJA 1ZGWA 4BE2A 1PP8F 4ZZLA 4MQVA 4RB2C 1IRFA 2QQ8A 2WC2A 3IAM2 2DMUA 3O8HA 4AC0A 2G9WA 4G6QA 1IAWA 1HQCA 5E1WA 1USSA 3T1BA 2JQEA 4U0VA 4N9IA 2PUDA 2VXZA 1IXSB 1O3SA 2NVTJ 4XONA 3RZZA 3FXOA 4AYBA 4LGWA 5HS9A 4BNCA 2ZFUA 3DLLF 1ERDA 2JK3A 3ZQFA 2FQ4A 3GTMJ 3W2AA 5J40A 2DT7B 3F8MA 4HF2A 4XICA 1D8KA 1LE8A 3D5RC 4KISA 2XF6A 3U9GA 3RKWA 3CD6I 1UG2A 4BHCA 2FSWA 1CJGA 1A35A 4P96A 5FO5A 3S3MA 2EJRA 2ISZA 1WSUA 4FISA 2LLWA 3MN2A 2Y0SN 3H5RA 1X1PA 4U88A 2W84A 3WHBA 1N78A 1VQ6I 4O8BA 1MH4A 2L8NA 2OD5A 1T95A 3EUHC 3LAPA 4EK9A 2OC6A 1MGTA 3DEWA 4HLYA 2VI6A 4HSRA 1HW5A 4FT8A 3W6KB 2W25A 1PP7U 5FRMA 1R36A 4E7SA 1CF7B 1A5JA 2FA5A 1PDNC 4PSWA 1QPZA 1YIOA 3ZQQA 3HKZN 1V5EA 1G3WA 2GIZA 2JA5J 3CMEI 1YE9A 3E3VA 4PU3C 3IP4B 2IBDA 4GXOA 1RRJA 2R7XA 3EUSA 5C44J 3DPTA 3AL0B 1EA3A 1FMVA 2F5DA 3LA7A 5FRNA 3ZHMA 1X1CA 3L2QA 1GHCA 1K79A 1G6NA 2M9HA 2VIXA 3G71I 3IKTA 4BE0A 2VT3A 2BY1A 1HDDC 2O38A 1RETA 1M1EB 1QBJA 1WETA 3PUBA 3JW4A 5C4JJ 2Y48A 3PO3J 5E1ZB 4F93B 2ZJPF 5M5WJ 1T8IA 4Y52J 3F8BA 3MCZA 2E7WA 4Z6YA 2O3FA 2ZXWH 3OSFA 2GZUA 1VF9A 3OYIA 4NDLA 2HCSA 1ZN2A 1ZS4A 4B3XA 1U8BA 2YU9J 1T6SA 4Y4RA 1ZZ9A 4XK4A 2LLKA 5IYDJ 5DTDA 5A2QK 3TW6A 3LISA 3DKXA 2QSGX 1HW1A 1GV2A 4ZYEA 3OY9A 4C2TA 5DTRA 2IRFG 3DTEA 1ETKA 4V2FA 3ZMVA 3S93A 3JR9A 1JH9A 4NBQA 3ZPLA 3AAFA 4RLQA 3MKZA 2HEOA 2HDWA 3CDLA 5D5UB 1W7PD 4AU7A 4BGDA 2VL8A 1Z7UA 2MW8A 1TNTA 1UHWA 2FU4A 2GA2A 2HVQA 2VT2A 5K7HA 2ZC2A 3JRAA 5KAFC 2JTVA 3K1PA 5CVVA 1OJLA 2HFHA 1HKSA 5FFXA 4IHYA 2WAQA 3P5JA 2K02A 4X4DA 4DW6A 3LFPA 1FP2A 3QYXA 2L02A 4IHWA 1U0JA 3AG3H 2ID6A 3M1EA 1JI8A 2Z2SB 4XLCA 3RPQA 3LSKA 3RPUA 4XOTA 2A6EF 4MGRA 2Y2ZA 3K70D 3CLCA 3DV8A 3GXOA 5L3CA 4BDYA 3S14J 5KVRA 4AWXB 4X4BA 1ZLJA 5ILVA 4UY8I 3GW2A 2DA7A 5B1BH 1X3ZB 3KP7A 1R1TA 1HOMA 2ICPA 4BU2A 1I6HJ 1OPCA 3ABKH 1FMWA 2PXPA 3GYHX 3BC8A 2KT0A 2CW0F 2OUMA 3ZPXA 3COAC 1F9NA 1SFEA 2JQ7A 2EZIA 1FYMA 4NHJA 1KONA 4PK4A 1TL8A 4KIFA 1O57A 4XM3A 4F7ZA 3CMYA 3CCSI 1X1BA 5D8LB 3BG7A 3GCMA 2CQNA 2R93J 5TRDA 2H8WA 4BBSJ 1NEQA 4W97A 4U7DA 4XKWA 1D8JA 3JAMZ 1W36C 1IC8A 2V1NA 5IT3A 3OYCA 1Z1DA 3K0LA 3QYFA 1JJ8C 3HOVJ 4YG1A 3WTVC 1N75A 1U3EM 2X6YA 3BCAA 2GOMA 3U21A 3OP9A 1D0XA 2R5YB 3HYIA 1AKHB 1U2ZA 2F5CA 4A3CJ 3FBIB 4B3AA 2GZWA 2HOEA 3Q0WA 2RREA 2MC3A 3N4MA 4FX4A 3PUFA 2XF7A 2AS5F 1RZRD 2LYPA 2YX7A 3HSFA 3U1DA 3FMYA 3OQMA 2K9SA 1S5LC 4RGSA 3FXUA 3DBLB 3HOUJ 3B7HA 1BR1A 2COMA 3OMTA 2ID3A 2L0KA 2MLGA 2FFHA 2OV7A 4BUPA 4P9FA 4CUGA 3OL3A 2MQKA 2W4SA 4OAYA 2VBZA 2W00A 5EEGA 2YS9A 1TLHB 2IS4A 2BW3A 3ZMSA 4FHTA 3H0GJ 1ZHFA 3RCOA 3GBGA 1BC7C 3A2KA 3PFYA 3DTIA 1Z77A 2RN7A 2PXFA 2HPMA 2EV6A 5AONA 2LYSA 4NC7A 1JKRC 3M9LA 1D0ZA 3G6EI 4DE8A 4IOCF 4NQWA 2PMHA 5CYVA 4AYBN 3OWTA 4GCVA 1P7JA 3LSHA 4BDZA 1HC8A 2Y0MA 1PUFB 2ZO4A 2EWTA 4BL0B 3KPHA 2QQBA 2KIUA 3E7LA 1CQTA 2EFNA 1IN5A 1A6QA 2VPLA 5H6RA 5GPCA 3OYKA 3FDYA 2JVLA 3DP7A 2OZUA 2H6BA 5L3DA 3GFIA 1YS6A 1G3SA 5J8FA 2CV1A 1YFHA 2Q0OA 4GDFA 3CCJI 2EBYA 1XDSA 4Z2YA 3OWQA 4B8XA 5BPDA 3SCGA 3FM3A 2L9RA 1ZG1A 3BS3A 3PL8A 1FEXA 3NWTA 3OYAA 4CH7A 5DUKA 3GFJA 4RDUA 1POGA 5IYCJ 1K78A 1WJBA 5ILUA 3ERMA 4UV9A 1S72I 3W6JB 5LEJA 1AU7A 2PPXA 4XLPF 4HAMA 2IGKA 4G94A 3ZMDA 1W5CC 2ETHA 1TW2A 3NROA 3SFIA 2PJRB 4NC8A 1R1UA 1A04A 3HSRA 3M3YJ 3TFLA 3CZ6A 4I0BA 5GADJ 4HBLA 2X48A 4HA8A 3OYGA 5BMZA 1FYLA 3UNGC 2V9KA 3H36A 3MD2A 1N77A 5KK1A 2K7LA 4RBOA 2DMPA 1RESA 3FISA 2L49A 2IVGA 3CJRB 1YJ9I 4HNUA 3C2GA 2ZSHB 4BACA 2PUGA 1MZBA 1LEAA 1UZCA 3HOXJ 1TQPA 5HLTA 1JUPA 3GUUA 2ELJA 4ZYDA 2FUG2 1YJWI 4F52A 3SX0A 2IA1A 3E5XA 1SFUA 3S1NJ 3CDHA 3ASNH 3NWSA 4DYRA 2XDVA 1ENHA 2K5CA 1E3OC 4O5VA 1ETOA 2K9NA 3BJAA 5EG0A 1K4TA 4IHXA 4J01A 2L7MP 2H8RA 4KYWA 4DE9A 3G1MA 3F9KA 1Z7LA 1VQOI 3BR3A 2P4WA 5FJ8J 2XGCA 3OS0A 2RQQA 5IYBJ 2E19A 3PIOF 4P9UA 1R49A 4FTHA 4IPAA 2DQLA 1IV6A 2IS1A 2LSOA 1S6LA 1WJCA 3VYTB 2XUBA 2IXSA 2MLKA 1LCDA 2VONA 2HFZA 3TEDA 2L9NA 5DD4A 3RZOJ 2JUGA 2OU2A 1XMXA 2WY8Q 2BXYA 1EH7A 3RSNA 1FTZA 2F2EA 5J47A 2NOGA 1NG6A 1IF1A 2QBYA 1VPWA 3F0CA 4C2UA 2CUFA 1IW7F 2WAQN 4M3BA 5FKKA 3NDBB 5EJCA 2QUFA 5J1RA 3L2VA 1X4OA 2R92J 3HTSB 1VQMI 3ZQ7A 2MGQA 4E7KA 2R7OA 2WV0A 5KHDA 1WH5A 1WH8A 3ME5A 2O7OA 4JQDA 4UNOA 1MDMA 1U5TB 4MLOA 1IXRC 2LKSA 5L3BA 3VB2A 2QCOA 2YBDA 1KYWA 4GHJA 4FX0A 3QODA 1Y8RB 2M87A 1BW5A 3IH2A 3RQ4A 4ER3A 2OCCH 1ZH5A 1SC7A 3DBRB 3BZ6A 3VK0A 4DZJA 3CCEI 5M3FJ 3WTYC 3DEUA 3GZDA 3HOZJ 3G7DA 1R71A 2E60A 5B1AH 3RKQA 1ZLKA 2JT1A 2LDUA 4WX9A 2HU9A 5FKMA 4AIHA 2X1EA 3RI4A 4M9ZA 1Z3XA 1B72A 1UJ8A 2HXOA 2FBHA 2FMLA 1R6RA 4I98B 5FKLA 4B43A 3DPLC 3V4GA 5E3MA 3N97A 3ZQHA 1WHUA 2CH0A 1MW7A 3U3WA 3ABTA 5J6XA 4AIKA 2JPBA 4KIGA 2KJCA 3E6MA 1QZEA 2D2WA 5B66C 3WTSC 1YHQI 1QGPA 5EGOA 4ASNA 4E7HA 4A12A 3FHNA 2QA4I 4BXUA 3VSLA 3LOCA 2A5WA 4DIQA 1MNMC 3VPRA 4RAZA 3IWZA 3HUGB 4IRHA 3K9TA 2XROA 2CRGA 2LF8A 3KZYA 1IN6A 1ZQ3P 4IVZA 2VBXA 4L5JA 1CGPA 2WB1A 1P4XA 4Y42A 4LIVA 3SZPA 2DDAA 4FCYA 3QQAA 1MD0A 2K40A 2RDPA 5J1UA 3KLOA 1U6GA 2XB0X 4DBQA 4KUMA 3ABMH 3BTJA 2BJCA 2GOXB 4LITA 1MBHA 2ZMEA 1D1AA 3HRTA 3T0YA 1QPIA 4EMSA 4HQEA 4X1EA 4C3HJ 4OB4A 1FBUA 1KGSA 1WJ5A 4ZYGA 1QNTA 2A6HF 3C3WA 4PJJA 3W2VA 2PFBA 3BDNA 4PCQA 1A6IA 4AVZA 1UELB 2VJ4A 3HSEA 2M45A 2BXZA 3UFDA 1J75A 2IPQX 5KCMA 2IEKA 2MEZA 1UFMA 1TP4A 2F48A 4XSZF 5GP9A 1YW8A 4CCMA 1AOYA 3W2WA 5EEHA 3GTGJ 1WZ2A 3BPXA 1FY7A 3AG1H 3F6VA 1WH6A 3OL4A 1R5ID 1YO5C 4CCNA 1LFPA 3GLXA 4EJTA 1BOAA 1JHHA 2XKPA 4ITVA 4R79A 1VQ5I 3BROA 4Z5CA 3JRFA 2EV5A 3C2HA 1ETWA 2NOJB 3I64A 5BPIA 4IQ4A 4M73A 1B9MA 3CUQC 2XASA 3HB9A 4BYYA 2LC2A 4JOMA 3JRIA 2XAFA 3G73A 3W6VA 4O3MA 2R7UA 1ZG3A 2GXAA 4ZZDA 2OQGA 3JRGA 4YG4A 1K7AA 4BQNA 1X4PA 5GPAA 3FMSA 1ZZCA 4ZTFA 3NQOA 2JN6A 4TV7A 2KIFA 3QYBA 2V6CA 4W1UA 4IZZA 4C3IJ 2I10A 4JQFA 3K6GA 3BDDA 3CTAA 4XLHA 3IL2A 1SAXA 2RV8A 4L0YB 4I6TA 2AXUA 1BJAA 5F6FA 1R1VA 3E5UA 4MTEA 2VBYA 2XIUA 4E4HA 2YUSA 5E79C 4GFBA 1MSFC 3LSTA 4IWRA 2HTJA 1U5TC 3CJTB 4D0PA 1GT0C 4IOAF 3WHCA 3C7JA 4AVPA 2A68F 5F0HA 1WJAA 1ZUGA 1ZREA 4QIWN 2MSYA 1I6XA 3ROUA 3CJNA 2WTEA 3TOAA 1F43A 2FF4A 4B09A 2PUFA 1X1AA 4BHBA 3IUOA 4S0HB 3E1SA 1SFKA 1E3HA 2KFDA 2GAUA 4RM3A 1K6YA 1T0FA 3JTGA 1FOKA 3OQNA 2A6CA 1XN7A 1NTCA 3P9IA 3FKJA 5E8GA 4EM2A 3OYJA 2R63A 4LB6B 1BR2A 2Q2EB 1I5ZA 5ERIA 2M3AA 3H92A 5JLXA 2F4IA 1W4MA 1DPUA 5HLIA 5LLQA 1JT6A 3MEXA 2PJPA 5LHHA 2ADUA 4M3FA 4HPQA 3F23A 2ZJQF 1ZYRF 1D5VA 1BI0A 3KEQA 2K3FA 2XAUA 3DXJF 1ADRA 1ZR4A 4V2GA 2G7HA 4M6VA 1HXDA 1ON2A 1K61A 2R5ZA 4AIJA 4XORA 4P55A 2HVSA 2IT0A 4N9HA 4RMNA 2RAEA 3BG6A 5IT9Z 2QKMB 3HPHA 1FJLA 1HF0A 4OAZA 3MKYB 1GV5A 3F8CA 3JTHA 1IO2A 4HEA2 2V9PA 1WWXA 2E5NA 1D1CA 1IV8A 5HDGA 3S1QJ 4G8XA 2JA2A 1BI2A 1MBGA 1USTA 1XMAA 3I4MJ 2XKOA 1JHFA 1QRYA 5LGUA 1R69A 2VOOA 1FWZA 1HSTA 4I99C 3L2WA 1P4AA 3CROL 2JPCA 5GTHC 1QHHD 1ZRCA 3TRBA 4CCKA 2KP6A 3KE2A 4LLLA 3KP4A 1NH3A 3H35A 2E2JJ 2NRAC 5IP7J 1FOXA 5F0FA 1DU0A 3C2BA 1H8AC 3TELA 2V9VA 1LKXA 1E0EA 2DT5A 3JSOA 5DM7F 4JCYA 2COBA 3JXBC 4WK8F 4WWCA 1FPQA 3FXLA 2O4AA 3TDUC 3L2UA 3F8NA 1A31A 1HW2A 1KU9A 2EFQA 2DJNA 4UXNA 3CMAI 2EIMH 5H2FC 2V79A 2DFEA 4DJAA 1IDYA 3L1PA 1XSVA 4KT6A 2OCEA 1ZZ7A 2IW5A 4II2A 4EKGA 4OMZA 3IAS2 2HWVA 2M2EA 5HDKA 4ANJA 2M4HA 2DK8A 1RPEL 3LAJA 1RI7A 2AXTC 5AIQA 4A5NA 1PRVA 1JUMA 1MNEA 2IAIA 2XPVA 3OR2C 4UB8C 2LR8A 2X6OA 3MKWB 1KU2A 3J7AO 1UXDA 2CG4A 2PEXA 2ICWG 2VKEA 2EB7A 4UUSB 4LG0B 2H09A 4MFEA 2PIJA 2WB1N 1ZRFA 3H3VK 4XRSA 4KMUX 1DU6A 1Z91A 2CJJA 3GMEA 2W48A 5F27A 3KXAA 5LRRA 3A9ZA 2ELHA 4HF1A 2PMZA 2LYQA 3EPZA 4G12A 4X4IA 3K2ZA 3FM5A 2GRLA 1TWGJ 3SEZA 1WIZA 2CUEA 2H6CA 2EQRA 5EF6A 3I54A 2DJIA 3IHUA 4HF0A 1O3RA 1PVEA 2V7FA 3KJXA 4L5IA 2E2IJ 3WGIA 2HYGD 2Y75A 1QVUA 2HQNA 3D0SA 1RKWA 1UHSA 1WI9A 3EYIA 2CU7A 3WU2C 2K9LA 2A69F 5K5RA 4D5CA 3U2RA 1IDZA 2VQHA 2HZTA 4CO8A 3BZCA 2CO5A 5GAHJ 3HHGA 3QU3A 4A3EJ 3PNVA 1LE8B 3UR3C 3KYDB 5E18F 4U0YA 2B9SA 1GXPA 1ULYA 2EF8A 2JWTA 4XN3A 4Z58A 5EDNA 1TQIA 4CXFA 1YJNI 2KQRA 5K98B 1YQAA 2YX4A 4YG2F 4IEJA 1Q1HA 1WH7A 2VB6A 3AG4H 1H89C 4BEHA 3VOEA 3QP6A 2AXVA 3ABLH 4PU4C 2NS8A 3WU0A 3R0JA 2CV0A 2DA5A 5IPAA 3QP5A 4DQ2A 3DFGA 3QPTA 1YITI 2Z16A 2VOPA 1B6AA 1Y0UA 1X1DA 3MMYB 1DQUA 1LPQA 2P5VA 3MKLA 5M5YJ 1P9QC 2X85A 4L9TA 1R63A 2E2HJ 3OMYA 5LGTA 3LFKA 5E20A 1XCBA 3QPSA 4AIDA 3Q3SA 3CCLI 4G6TB 3IRQA 4IHVA 5GAGi 1ZTRA 1LB2A 3HOTA 3OYHA 3BT9A 2E71A 4RGXA 4ZC3A 4LFUA 5HS7A 5ICGA 3PM1A 4KJZA 5A2QZ 2R7ZJ 4LK0F 5H6QA 5ILSA 3BR5A 2XB5A 2PI0A 2K27A 3WU1B 2L54A 3TO9A 1MIJA 3S17J 4ZDPA 3KP6A 2R7SA 2CUZA 1Y6IA 2NNNA 2KIMA 3H9QA 1PERL 4XLFA 1E3PA 3DCFA 3J80K 3MLFA 4IJAA 5D8KB 2JSCA 5C3EJ 2ICTA 2O5RA 1OSLA 3GN5B 5L3FA 4KA4A 1R58A 3S2WA 2JA8J 1XGMA 4MCTA 5TISC 2R5YA 2AWIA 2DFHA 3V8KA 1YW7A 2LK2A 3AG2H 2OTLI 4HNTA 1OCRH 3BQZA 1APLC 2D45A 1EJ9A 1ZRDA 1HCRA 3RYPA 4BKXA 1NK3P 3LQXA 1BL0A 3GEZA 2NVXJ 4M6YA 5DCMB 4CICA 5D4RA 3KP5A 2XXQA 2ZB9A 1B59A 4CYCA 3H0DA 1I39A 3ULQB 1WI3A 5CKTA 3VWBA 2LYRA 2UXNA 3HGGA 3R09A 1L1MA 1LLIA 3KEYA 4RB1A 5HODA 4CDGA 2EILH 2OBPA 2O03A 1AWCA 4ESJA 3OQOA 3FIWA 1W7PA 5JLWA 3J81K 1WJEA 2LKPA 2ZXJA 3P9CA 1YRNA 3UKGA 2R7VA 4E7ZA 3LSMA 4IXAA 3I3LA 4RLFA 2XGDA 3ZQIA 1ZZ6A 3TEPA 4YFXF 5IOZA 2X6XA 3CCMI 2DA6A 3BLYA 1I27A 4CA0A 4XRFA 5GTIC 1ETVA 1RZSA 3HOSA 2DOEA 4HX4A 3GWZA 2VBWA 4PZJA 2IA0A 2QSHX 1BOBA 3M8FA 3PFIA 2F5EA 2GQQA 1Z3YA 2M0MA 4JBAA 4A3JJ 4A3FJ 4ZDLA 2BGCA 5IY5H 4IKFA 4PJLA 4RS8A 4ON0A 2JVGA 1SD6A 3IV5A 2E35A 3OYEA 5E3NA 2KRFA 2VJJA 2O49A 2L9VA 1MBFA 3SYTA 3LMMA 3V8LA 2OJED 2BOLA 2RNJA 1V4RA 3A01B 3FWEA 4QWQA 3JRBA 2ZKZA 2DYSH 5LD2C 5FLXK 4DZPA 3F51A 1J59A 3A4CA 3QRFF 2HQRA 3HXLA 2LYLA 1JFSA 1SEUA 3CUOA 4IF4A 4EM1A 3G1OA 3KL4A 2MA3A 3R60A 5L3EA 1VQ9I 1ZVVA 1JKOC 2KKOA 4EATA 3V7SA 1V5GA 3R6SA 4RB3C 2A07F 4GRIA 2VC1A 2W24A 3SZGA 3QPLA 5HLHA 1XGSA 3CC7I 4PFOA 2KRHA 1HDPA 3CECA 3RKYA 3J7YJ 4RAGA 1G3YA 4Y7NJ 4I7HA 2WA0A 3CP8A 2RKHA 2FOKA 2M7BA 3K10A 3SQNA 4XRMA 2IS6A 1T33A 4MTDA 2VLAA 3BG9A 2IS2A 4G9YA 1ODDA 2LNBA 3V8JA 5E3OA 1R5GA 3F6WA 1VQ4I 3H9GA 4LK1F 2QYOA 3K1MA 1MSEC 2FNAA 1U8RA 5HVQC 1XGNA 2BNNA 1RZRA 4UUVA 2DT6A 1OKRA 4V19K 4WF2A 5D4SA 1LNWA 3ELKA 4WCGA 2PXBA 3JREA 2XSDC 2P6TA 1P2FA 2RNGA 4OOIA 2FEZA 2K9MA 2MH2A 2LY1A 1VQ7I 4Q4ZF 2L4MA 4R1HA 3ZOBA 2PMZN 3GBFA 3DBHB 3TBIA 4ZH4F 1RIOH 2JA6J 1XTAA 2M30A 2DTZA 4UVCA 2MC4A 3GUDA 4XQFA 3HEFA 4D7MA 5FB2A 4LJZF 4M72A 1ACIA 3FF5A 4OMYA 3I58A 2PQ8A 2DU9A 2UXXA 1VFCA 2DO7A 1GDTA 1QZYA 4DGWB 3WTWC 1IJWC 4XOPA 4OIQF 3K4CA 3ZMZA 2P81A 2R7FA 5EYRA 2X9DA 4HNVA 5JFRA 2ME0A 4KMFA 2ZXHA 1ZKGA 3NEUA 4PJNA 1OR7A 1RR7A 2VKVA 2QGUA 2KL4A 2XAHA 3L9FA 1JTXA 4M9XA 4BQOA 4D1QA 2F4MB 1Z6TA 3OIQA 1T39A 2EBIA 1V55H 2ZXIA 5DUIA 3BPVA 1D0YA 2V6EA 1VQPI 2FMYA 1XMKA 2EZHA 3CUQB 4ESBA 3S3NA 3FMQA 5M5XJ 2XJ3A 4ETSA 1ZR2A 2Z9OA 2V3CC 4BXXJ 2HGCA 3DQVC 2NNYA 3FHZA 1YX5A 1TNSA 4PU7A 4CGZA 1JT0A 2KPJA 2BHZA 2L7ZA 1LDDA 2E1MB 1WJDA 5DM6F 3I55I 1KZHA 2GXGA 3HC7A 2DI3A 2R7DA 3BP8A 3NAUA 3QQ6A 1LCCA 1RPWA 2HR3A 3S1MJ 3GTQJ 2PLYA 2M1BA 4CYDA 4XR6A 4O6JA 2QLZA 2J7UA 2IA2A 2L9SA 2H1KA 3GTLJ 4PGGA 4A0XA 1MH3A 3HHHA 2BVMA 2CMPA 3BJOA 3BQYA 2L7FP 2A6TA 2PG4A 2UUZA 1KYZA 1W5SA 4KICA 5K5OA 2KDZA 2LYCA 1QO0D 1D5YA 1TTYA 3L7WA 2HINA 4BS9A 3ZRGA 1G4DA 4HDUA 1VQ8I 4U87A 1Q1VA 4NUBA 3SXYA 3C18A 2HTSA 3SFZA 3V42A 2LG4A 1FSHA 2JVHA 4ABZA 4KIBA 4Y33A 1JE8A 1FIPA 4EZIA 2STWA 1MBJA 5LRSA 4L0ZB 2O8XA 4ER0A 2K9QA 2TCTA 3CCUI 3RDIA 2D1HA 3CCVI 2VASA 4EQQA 2WUSR 1ORKA 4R8HA 2HQAA 5CVJA 4YEJA 4CZZA 2B7EA 2QBYB 3IVPA 4BAYA 3FXMA 2HXIA 3A0HC 3A9XA 1LMB3 1B4AA 4A3DJ 2BVLA 4EJOA 1UMQA 1TZLA 3IH3A 2GXBA 1IRXA 2NS0A 2V1XA 3K70C 2M8GX 3RIRA 2JRTA 1MDMB 1BI3A 4B44A 2VC0A 2CQXA 3I4PA 1Y9QA 3EYYA 4A3IJ 3AKZA 2GRMA 2HCNA 2EH3A 4Z5HA 3HIFA 2QEXI 4X0GA 1B9NA 1N25A 2Q1ZB 4QPQA 5ICCA 5CQEA 1MJ9A 3TKYA 1XCVA 3I4NJ 1NK2P 1KQ0A 4A3BJ 2MH9A 2XAJA 3WTXC 1FBSA 2A3SA 2IVQA 1ZAOA 3S2HJ 2OPTA 2KPMA 4LMYA 5FKOA 1B72B 2PXDA 4DYQA 3FXRA 4E70A 3M1CA 2LNMA 1OLTA 2ZFWA 4K2EA 5F1RA 2ESHA 4EM0B 5D5WB 2DW4A 4II3A 4XL9A 5FROA 4EEFG 1UTXA 1P7IA 4FE7A 5B5EC 2W57A 1QA6A 3D5SC 4QSHA 2TRTA 3QF3A 2RVCA 3E6CC 3CCYA 1LJ9A 5KNLA 4L5EA 1VQKI 3EUKL 4Z59A 4PUSA 1U9OA 4N4NB 3TL4X 5E3LA 3G1LA 5DDGA 3U1KA 3MZYA 3CC4I 3FK7A 1B8IA 5EZHA 1YX3A 4IRGA 3MFKA 1Y7YA 1VI0A 3ZMUA 2NYXA 3EUHA 1POUA 3ZQCA 2VODA 5DD8A 1OQYA 5DTQA 1OCOH 2KDOA 2KZ8A 1RNLA 1R22A 3HM5A 5B3SH 4EJUA 5DSXA 3K4KA 3GO5A 3T8TA 2P7VB 3SZTA 4PSXA 3JCUC 3ERED 5D6FA 1DWKA 2EIJH 3LWFA 2ZMEB 3HGYA 4IRIA 2XAQA 1SD4A 1XPXA 3GX4X 3LSRA 4YELA 2LLVA 2HKOA 2E1MC 2QF7A 3ZN0A 3G4SI 3ESWB 2XXPA 3MEJA 1QP7A 3CP2A 2VKHA 3E6DA 2X0LA 1VZ0A 1YG2A 3K4NA 4I0AA 4B47A 3E5QA 1T2KA 2BEOA 1Y1VJ 1UHMA 4U0WA 5LHGA 3OYNA 3H5NA 2RC4A 4A3KJ 1DP7P 2DA2A 1TT5B 4UVAA 2VEOA 2GA1A 4YRVA 5TGTA 1FP1D 3GFMA 3I5UA 4XRSG 5J4VA 2Q2EA 4AUXA 1MMSA 1T56A 3KYCB 2JSPA 3WTTC 2HPIA 4DYCA 2XV4S 1SD7A 4YG7B 5ED4A 3QOWA 4BY7J 1XG1A 4PJMA 3LA3A 2ZNYA 4G7OF 2ZSIB 5E17F 2HKXA 3VEPA 2Z99A 3GTPJ 1SMYF 1I3AA 4EGYA 1QPMA 5TJJA 1W36D 2B0LA 3KETA 4F55A 2DLLA 1O7FA 3SR4A 4FN3A 3KZZA 3ECOA 5C4XJ 4RAFA 4D9JA 1R00A 1R7JA 3K2AA 1BIAA 2KJBA 2LBFA 3QOEA 3TO7A 1FLIA 2JCGA 4Q2JA 3CMMA 4DBRA 2DA4A 3S3OA 3F22A 1BN5A 1I1SA 4C2MJ 4MO7A 4G6DA 2R0QC 1B0NA 3P9KA 4M6XA 3J7AY 3ZHIA 2AW6A 2LRDA 3A9YA 1REPC 1T98A 5FLMJ 1WFXA 3CC2I 1EKEA 3QYEA 2PUEA 3FBNB 4JYKA 2IVMA 2AO9A 3A1YA 4E7IA 1W0TA 3OOPA 3OR1C 2ELKA 3OYDA 1ON1A 1YOVB 3F8FA 3TP3A 1G8XA 1OCCH 4ESFA 2LYKA 3IRRA 2MYSA 2X1CA 1QZZA 1SANA 1R4NB 2F5VA 2JJ7A 3J7ZI 1ZZBA 3FYMA 2PXQA 2NS7A 3TP0A 3BY6A 3ONQA 2M4GA 4I6RA 3I9V2 1O3TA 2L3DA 3R0AA 1RKTA 3FXKA 4XNFA 1JGSA 1MMNA 4KITB 3GTOJ 1Z67A 2GBYA 3DEEA 2IU7A 4J1XA 4BBRJ 1ZGJA 1L0OC 2QZ8A 4OIRF 2Y9ZA 1E2XA 1W1WE 2R7QA 4UUTA 1LDJA 2OTJI 3FKIJ 4YFKF 2DA3A 4YIFA 1DP3A 3QOXA 3GZDC 1TT0A 2DA1A 3OYFA 4IO9F 1HLVA 1AA7A 4HG2A 4P1WA 4OINF 3L09A 1BDIA 3H5TA 2HQ5A 4UVBA 3WGHA 2OAZA 3WTZA 1S7EA 2YR2A 2XXAA 2UV1A 4X4CA 2CSOA 3DWLE 4X4GA 4KN7X 1P92A 4X4FA 3HZIB 4UHTA 3CO7C 3DPUA 2J5PA 2LY9A 1SMTA 4MEXF 1OMIA 3I0TA 3C1DA 2R7WA 1EFAA 2DMQA 1V3FA 3N05A 4A6EA 4IQJA 4L18B 1Z0XA 2HI3A 1I50J 1GLNA 2WAFA 1QZXA 4NB5A 4JX5A 1Z05A 4C30A 4XBFA 1LQ1A 2ZNZA 1S7AA 2GWRA 2KMUA 3DKYA 4UUSA 2VJIA 2O61A 2P6SA 2DMNA 3Q9VA 1EV7A 4BY1J 3NARA 3PQKA 3JXDL 3SHFA 3D5LA 1R5HA 1WVRA 2JUCA 2QENA 4M3EA 2DYRH 3RKXA 3OOUA 2W82A 3M9AA 3PQJA 3F52A 3QWGA 1YYVA 1CF7A 4ENNA 3QOPA 2JA7J 2K85A 4MIMA 2LP0A 1PJRA 4YARA 3IH4A 1BDHA 1TC3C 4YIIA 4I6ZA 1ZK8A 2LCVA 1SVOA 2ZMEC 2QSFX 1R4MB 3P7NA 5BQTA 2I5UA 4IX7A 3HPGA 1MJBA 1NG7A 4D5FA 5DT2A 2EINH 3BCBA 4BQAA 4J00A 1FYKA 2HVRA 3I59B 2KIQA 3VDXA 4F3QA 1PRUA 1LVAA 2KLOA 2VQLA 3E0JB 1SD5A 2LVSA 2FE3A 3O6BB 3DKWA 4XKVA 1WRJA 1K83J 2MG4A 3G5GA 2K4JA 5K7FA 1KU7A 4D7NA 2B5AA 3HL2A 2IV1A 1R9TJ 3JRHA 3L00A 2IGNA 2VE9A 2W1OA 3KYLA 3CF2A 5H20A 4BJ6C 1Y39A 3ZKCA 4Z5DA 2QVOA 3CCQI 3G2BA 2KZGA 2P5KA 1QB2A 2PXLA 1WQ2A 2QWWA 2B63J 3H1CA 1U2WA 1D1BA 3GZCA 2E1CA 1IZ1A 1FC3A 2M7AA 1XGOA 1H0MA 2RGVA 3H3ZA 1IN8A 2CW8A 2DTRA 2MFZA 3DTKA 1SVLA 2KHMA 4JX6A 5ICFA 2VE8A 4G7ZF 2BYVE 1X2LA 2BZTA 5FD6A 2EV0A 4HV6A 2ESNA 3DU6A 3RPUD 3SJMA 2NVYJ 1Z21A 3BD1A 4IA8A 2XAGA 1FT9A 3FZVA 4L9NA 1TWAJ 1IRGA 2E36A 4C3JJ 3PSIA 2PXEA 4UV8A 1G2HA 3UWPA 3S8QA 2BY2A 2AXLA 4FQGA 2H1LA 5IOYA 3KEOA 1W5TA 1EH6A 2DOAA 2XVCA 1JUSA 1F1ZA 1FSEA 5F64A 2CWEA 3L2CA 2HDDA 2UWMA 2Z3YA 1MMGA 2XPWA 3HTUA 3LSGA 2XC7A 3S15J 2XGXA 1TWFJ 3OIOA 2OF7A 1J2XA 4S05A 2BHYA 2E7XA 3HZJA 3B6AA 3DU5A 5ICEA 1FTTA 2ECBA 4XLNF 5F0CA 1DDNA 5LEKA 4IHSA 2LFBA 4RAYA 5CPRB 3VYSB 3DNVB 4I76A 2XRNA 2M4KA 3HBLA 4MEYF 3GN5A 2R1JL 4BXFA 4P5OA 4Q47A 2HZDA 3BR1A 1YIJI 3TO6A 4HYEA 1L3LA 1QP4A 2DXIA 1K4SA 2L2OA 3JRCA 3BG5A 2Y31A 3RYRA 2I8DA 4M71A 2GIVA 1LQCA 4PDKA 5J1YA 3REOA 3FXJA 2NAZA 1X2MA 1T0FC 2W85A 3MWMA 2FQ3A 2LMDA 2JMWA 1WKMA 5KAIC 1JXSA 5HNHA 2R3SA 4KDPA 5DCMA 3DM5A 1J0RA 1FX7A 4HLXA 4QTRA 1J7KA 4CHUA 2AXZA 4A0YA 5D6EA 1GVDA 4BEHB 3HDDA 5K1YA 3PSFA 1RIOA 2CFXA 1AHDP 2DDBA 2RQPA 3GLLA 5FGMA 3VODA 1PYVA 5CVUA 2VQGA 3PO2J 4MFDA 3K4LA 4M9SA 3HG9A 2PUBA 2DK5A 2H94A 3M8JA 3KLNA 1AKHA 4AD9A 3GVAA 3CQZJ 3JAMK 2DQRA 5E8IA 4FASD 3GF2A 3RQIA 1KU3A 3RTRA 1EH8A 2DBBA 4H4KC 1IUFA 3FYAA 2F6CA 3BWGA 2BBYA 2EFPA 2EZKA 1ETXA 2P0WA 2XI8A 2FBIA 2CROA 3T8RA 3IKVA 5D5XB 2X6WA 3E6BA 1FZPB 5JVTA 3CLQA 2DAOA 2LF7A 3J80Z 4H0EA 1X2NA 3R4KA 1XWRA 5DRYA 2HYFA 1O3QA 2LOOA 3GZNB 2O8KA 2OFYA 5HS8A 2WWYA 2HOAA 4FETA 1YW9A 4Y3OA 3S8PA 3D1NI 3GTJJ 1X57A 4BJ5C 4MHGA 4CCJA 3A01A 2MD5A 4GYIA 2W7NA 3VWSA 2O0YA 5HLGA 2EIKH 3NRVA 3CESA 3ASOH 5EZGA 3WG7H 3ZCOA 1BC8C 3WE2A 1JJ6C 3JRDA 4IHTA 2PUCA 4J1WA 1YI2I 5JVGF 3BTCA 1O7LA 4MNUA 5A7LA 4EJVA 3HRMA 2MBFA 2BY3A 3FK6A 5M3MJ 2QM3A 2PX9A 1UCRA 4MQ9F 3KFWX 4HX7A 1PUFA 3R61A 3J81Z 1EF4A 1T08B 4S04A 5DV5A 2WAEA 1QP0A 3F21A 3BJ6A 4IL6C 5L3GA 4ZYHA 4A93J 2KEIA 1B1BA 1Y56A 1J5YA 1W0UA 1Y0NA 3LQRA 4CYCB 1JTYA 2KZVA 3F6OA 5GAHi 3CDIA 2DOFA 1MBEA 1QVTA 3H5AA 2LKXA 1ZAYA 1W7PB 4BE1A 3MZ8A 1YRNB 3LA2A 4CCOA 3A0BC 4PU8A 1UG0A 2IVBA 4F92B 3AL0C 2VPRA 1QU3A 1IRZA 2XGEA 2M8EA 3I53A 2M0CA 2Y9YA 3M07A 2HOSA 1X3UA 3EUAA 3ABUA 1GUUA 2A05A 1S3JA 4RGRA 2CGPA 2PJRA 3GZ5A 4Y15A 2DN0A 5FFZA 1NW3A 1H88C 2DFFA 2XF5A 2IJLA 2ECCA 4A3LJ 4PFPA 1RUNA 2ZCWA 2FBKA 5FLXZ 4EJWA 4F8DA 1WCMJ 4A3MJ 3NZLA 2FOWA 2L5QA 4L9JA 2QQAA 4ZJZA 4LLNA 3ZGKA 1XS9A 2K4BA 2E1NA 3R1FA 1P6RA 1JKQC 2NXNB 2VUMJ 2LTPA 4XSXF 3DF8A 2IP2A 2L4AA 2XRLA 4QPOA 1HKQA 1STZA 1TBXA 2Y30A 4U7BA 4OWRB 3VFZA 3VSKA 1R23A 3V7CA 1XX5A 4Y13A 2BW3B 3G3ZA 2P5LC 2V1UA 2BNOA 3BR0A 3WTUC 1DUXC 3LSJA 5HOOA 2MD0A 1SFXA 2R4GA 3O2PE 1LVKA 1X19A 1JGGA 3ZMTA 3OKZA 4B4CA 4NQWB 5LGNA 3JSPA 2TDXA 2VQCA 2ZJRF 1RUOA 4LB5A 2XIGA 4I02A 1T38A 1P4WA 3QPHA 1MMDA 2DMTA 4A5MA 5EEAA 1PNRA 1QQBA 3S1RJ 2CQ7A 1YTYA 3CUQA 1J09A 2VJ5A 4GYGA 2PBIA 2HYJA 1MNDA 1OCZH 2DPUA 3CLOA 4HDVA 2R7RA 1HBXG 4EQZA 1LUJB 4A69C 2Z33A 2Z1DA 3WODF 1ZGAA 2HS5A 3CF5F 1ITYA 2PXVA 2PE5A 1VQLI 4GGGA 2X1DA 1U9NA 3K7AJ 4GO1A 4XN0A 1ONVA 4BH9A 3GFLA 1ZELA 2ZBKA 1MMAA 1Z6RA 5K7ZA 1FOWA 1I3QJ 3ZQGA 2J7WA 2PXUA 4PGHA 5DEQA 4BJTA 3Q5FA 1XSXA 2E5ZA 1MFQC 1X58A 2VXDA 3E97A 1K78B 5F1JA 2BV6A 3LL7A 5CVIA 2M5WA 1U5TA 4HW0A 2GM4A 2EPFA 5FD5A 1RC9A 4UB6C 3OS1A 4AM3A 1LDKB 2EWNA 5CJ9A 1TWHJ 2F4OB 2PN6A 4QLCU 2OA4A 1Y8QB 3AFHA 2QKLB 1UAAA 1TW3A 2CV2A 3ECHA 3M8EA 4KNYA 2AQEA 4ER5A 3FX3A 4LLGF 5FLVA 2IUOA 2ZJ2A 3T5XA 1Z9CA 1ZG5A 4PJ0C 1XDUA 2FJRA 3OYLA 5FKNA 3BTLA 2OR1L 2XPUA 4X4HA 3LNQA 4NC6A 2HDCA 3OV8A 4Y17A 4XKBA 2D5VA 2KISA 1G59A 1UB9A 2DPDA 3QU6A 2G0EA 4N4OB 5J3LA 2MXDA 2EFWA 2EK5A 5EG0B 5BOXA 4I2OA 2HSGA 4FE4A 3QAHA 2VN2A 3M7GA 4G7HF 2PXKA 5CLSA 1IN7A 4I8TA 3SCFA 3KP2A 3KP3A 4BQQA 2M34A 1IG7A 2KEJA 3NXHA 4WXCA 5JR3A 3PIPF 3HUGA 1UXCA 4HRAA 2P7CB 1IN4A 3SDBA 1OCTC 2EZLA 1NERA 2O6GE 1K6OA 4JK1X 1OCPA 3M4OJ 2ODRD 4X4EA 1BJZA 2XSJC 3B02A 3HOYJ 3TOBA 2KEKA 3Q9SA 2FD5A 3B6CA 1TWCJ 2L1PA 1WGXA 3W3CA 3JXCL 2LY2A 2YU3A 3EETA 2EA4A 2A5YB 1JFTA 3PJRA 3O3KA 4ENJA 3FXQA 2STTA 1G3TA 2WBMA 4ENKA 1YLFA 2IGOA 3ZR8X 3KX2A 3A03A 2BE5F 2MABA 4XKCA 4CSWA 1DW9A 4NDWA 1SFOJ 4DNCA 5E1XA 3K4MA 4M3GA 5LHIA 3ZQLA 1VNDA 4EV0A 3MQ0A 5DS9A 1BW6A 5D5VB 5CVRA 2G7UA 2IGMA 3GZ6A 3BG3A 1VQNI 3IC7A 2JZYA 4EGZA 1C0WA 2OZ6A 3I71A 1OYIA 1FNNA 2DCEA 1YS7A 3WG9A 3HRUA 1XD7A 1H9GA 4HQMA 9ANTA 1RZ4A 2Y69H 4HV5A 5AIPA 1WPKA 4ZDOA 4L9VA 1MBKA 1VTNC 3TQNA 1TQMA 2FNPA 2V1DA 1QQIA 3K69A 2Y0SA 3KCCA 2UZKA 2PUAA 1SVMA 4CCLA 4LOCA 1S29A 2CW7A 1D3YA 4EKIA 5BS6A 2OQRA 1FOYA 3OYBA 4KN4X 1J9IA 1HA8A 3HJEA 1NHAA 3TDZC 4IVNA 3H3UA 3A02A 1DULA 3TW7A 5EGOB 2D1VA 5DCFA 4ZTJA 2HOTA 4J19A 3HKZA 2V26A 4RA2A 3IWFA 4KFCA 4M3DA 1HQ1A 4XMYA 4LD5A 4Q5SF 4ER7A 1OISA 4A0ZA 4HOBA 2J5OA 1BIBA 4OU0A 4XLEA 3Q0VA 3BZKA 2ME6A 5K5QA 4WXDA 1A36A 1FIAA 1IGNA 3HOWJ 2R7TA 5F04A 2LYJA 3V7RA 3ZP5A 1HSJA 1S8NA 1V5FA 2WV1A 2YPRA 1ZPQA 2KRCA 2WIUB 4C9YA
chains in the Genus database with same CATH topology
2NVXJ 1ETOA 2K9NA 5EG0A 4IHXA 2L7MP 2ZB9A 2H8RA 2BNMA 3G1MA 4CYCA 2JA7J 2LYRA 1WI3A 1L1MA 3BR3A 3HGGA 2LP0A 2XGCA 4MIMA 5FJ8J 4YARA 2FJ1A 3IH4A 1TC3C 5IYBJ 4I6ZA 2E19A 5HODA 1ZK8A 2LCVA 5BNGA 4FTHA 1PRAA 3OQOA 3FIWA 1SQ8A 3MVPA 5JLWA 2LD5A 1IV6A 1YRNA 4D5FA 3UKGA 1LCDA 2XGDA 1PRUA 3ZQIA 3TEDA 1ZZ6A 5IOZA 1Y1WJ 3RZOJ 4FBIA 2LVSA 1F36A 2AHQA 1OFCX 2DA6A 1FTZA 2NOGA 1K83J 2MG4A 3BR6A 3G5GA 5K7FA 1ETVA 1RZSA 3F0CA 2FX0A 1VPWA 4D7NA 2B5AA 2IV1A 2CUFA 3S2DJ 2WAQN 4M3BA 3JRHA 1R9TJ 5FKKA 1B8IB 3O9XA 4A3JJ 4A3FJ 5J1RA 2R92J 1YSEA 2XCJA 3ZKCA 2MGQA 3IV5A 3SCHA 1WH8A 1WH5A 4Z5DA 2O7OA 4JQDA 5E3NA 4JX4A 4MLOA 4A3GJ 1JWLA 1MBFA 2O49A 2B63J 2QCOA 4GHJA 3PXPA 1BW5A 3IH2A 3A01B 3JRBA 1BA5A 4JX6A 2N8GA 4DZPA 3OSGA 1X2LA 3F51A 3GTKJ 1O4XA 2CSFA 2LYLA 3VK0A 4DZJA 1JFSA 3Q0UA 3G1OA 5M3FJ 3KZ3A 3SJMA 1JKPC 3HOZJ 3G7DA 3RZDJ 1ZVVA 1JKOC 2NVYJ 3RKQA 3BD1A 2CQQA 4IA8A 4YBAA 4X6AJ 4JP0A 1ZZ8A 1TWAJ 5FKMA 4XIDA 4C3JJ 1G2HA 3S8QA 3QPLA 1B72A 2HXOA 5IOYA 5FKLA 5E3MA 1HDPA 3CECA 3ZQHA 1JUSA 4Y7NJ 2AUWA 2E1OA 5IP6A 3U3WA 2HDDA 4XRMA 1LFUP 2XPWA 1T33A 3BG9A 3LSGA 3S15J 4I6UA 1TWFJ 3OIOA 2OF7A 2NVQJ 5IP9J 3B6AA 5E3OA 1FTTA 5EGOA 2ECBA 3F6WA 5F0CA 2GLOA 2LFBA 3LOCA 1U78A 1MSEC 1MNMC 3VPRA 4MCXA 3DNVB 1XC5A 4JCXA 1RZRA 4I76A 2BNNA 3HBLA 2R1JL 3GN5A 3LSPA 3BTIA 1LFBA 3SDGA 2CRGA 3BR1A 1QP4A 3JREA 2XSDC 1ZQ3P 3JRCA 4IVZA 3BG5A 2Y31A 2O9LA 4Y42A 4FCYA 3S16J 3O8GA 3QQAA 1LQCA 2K40A 5J1YA 3ZOBA 2PMZN 5J1UA 1X2MA 3GBFA 2XB0X 2JMWA 3BTJA 2BJCA 1QQAA 4B1RA 1ETYA 2JA6J 2DTZA 1MBHA 4GQMA 4QTRA 3HEFA 2AXZA 4D7MA 1GVDA 3HDDA 1QPIA 1RIOA 1AHDP 4X1EA 4C3HJ 3PO2J 4OB4A 4MFDA 1VFCA 1GDTA 3BR2A 2R5ZB 2PUBA 1IJWC 5F08A 1AKHA 1ETQA 3CQZJ 2P81A 5EYRA 1ZGWA 3BDNA 2X9DA 1A6IA 4HNVA 3RQIA 3UFDA 1IUFA 2MEZA 2ME0A 3FYAA 2IEKA 1ZKGA 2DMUA 3O8HA 4AC0A 1RR7A 2VKVA 2EZKA 5GP9A 1JTXA 1ETXA 2XI8A 3GTGJ 2PUDA 2EBIA 2CROA 1WH6A 2NVTJ 3RZZA 2EZHA 4Z5CA 3JRFA 1X2NA 5M5XJ 1XWRA 2XJ3A 1ETWA 1ZR2A 2JK3A 3ZQFA 2FQ4A 2O8KA 2OFYA 4BXXJ 3GTMJ 2HOAA 3D1NI 3HB9A 3JRIA 3GTJJ 4XICA 3W6VA 3A01A 1JT0A 1LE8A 1X57A 2KPJA 4PU7A 2L7ZA 3JRGA 1UG2A 4YG4A 1CJGA 5GPAA 5EZGA 1ZZCA 2JN6A 4W1UA 1JJ6C 3JRDA 4FISA 4C3IJ 3NAUA 3QQ6A 2PUCA 1LCCA 2I10A 1RPWA 2Y0SN 3MN2A 3S1MJ 4J1WA 3GTQJ 3BTCA 4I6TA 5A7LA 3WHBA 2AXUA 4O8BA 3FK6A 1MH4A 5M3MJ 3GTLJ 1PUFA 2H1KA 2L8NA 1MH3A 2XIUA 3DEWA 2YUSA 4GFBA 1EF4A 3BQYA 2VI6A 2L7FP 1MSFC 1QP0A 4IWRA 1GT0C 2KDZA 3WHCA 1D5YA 4A93J 2KEIA 1A5JA 1QPZA 1W0UA 4CYCB 2HINA 3HKZN 1JTYA 5F0HA 2JA5J 4PU3C 1ZUGA 4QIWN 2IBDA 2MSYA 1MBEA 3EUSA 1QVTA 1Q1VA 2LKXA 5C44J 1ZAYA 1YRNB 1F43A 4ABZA 2PUFA 4PU8A 3ZHMA 2IVBA 1FIPA 1MBJA 2VPRA 1IRZA 4S0HB 2K9QA 2XGEA 2M9HA 2O38A 1HDDC 2M0CA 2Y9YA 2TCTA 2HOSA 1RETA 3OQNA 2A6CA 2WUSR 1NTCA 1ORKA 1WETA 5C4JJ 1GUUA 2R63A 3PO3J 3IVPA 2DN0A 2HXIA 5JLXA 5M5WJ 1H88C 4Y52J 3OSFA 2GZUA 1JT6A 2ECCA 1VF9A 4A3LJ 1LMB3 4NDLA 4M3FA 4A3DJ 1ZS4A 1UMQA 1U8BA 2YU9J 4F8DA 1WCMJ 4A3MJ 3IH3A 1ZZ9A 4XK4A 2LLKA 5IYDJ 2M8GX 5DTDA 1ZR4A 1XS9A 4V2GA 3TW6A 4M6VA 3LISA 1ADRA 2CQXA 1K61A 1Y9QA 3R1FA 2R5ZA 4A3IJ 1JKQC 1GV2A 3JR9A 1ETKA 4V2FA 2VUMJ 2GRMA 2LTPA 1JH9A 2EH3A 2RAEA 4Z5HA 2XRLA 1FJLA 2Y30A 1HF0A 1GV5A 3CDLA 5K7HA 2MW8A 3BR0A 2BNOA 3LSJA 3JRAA 3I4NJ 1JGGA 1NK2P 3S1QJ 1OJLA 1MBGA 4B4CA 4IHYA 4A3BJ 3I4MJ 1QRYA 4X4DA 4DW6A 1R69A 2IVQA 3LFPA 3S2HJ 2OPTA 3QYXA 5FKOA 2DMTA 5EEAA 1B72B 1PNRA 1QQBA 3S1RJ 3CROL 4IHWA 4DYQA 2ID6A 3TRBA 2HYJA 2Y2ZA 3CLCA 2E2JJ 4EEFG 1UTXA 1P7IA 4A69C 4FE7A 5IP7J 3S14J 5F0FA 1DU0A 1LLIA 4QSHA 3C2BA 4X4BA 2TRTA 1H8AC 2DA7A 3CCYA 1ITYA 4JCYA 2PE5A 2COBA 1U9NA 3K7AJ 3JXBC 4L5EA 4Z59A 1HOMA 1U9OA 5E3LA 2ICPA 3G1LA 1I6HJ 5K7ZA 3FK7A 1B8IA 1I3QJ 5EZHA 3ZQGA 1Y7YA 2O4AA 1VI0A 2KT0A 1POUA 1X58A 2DJNA 2EZIA 3ZQCA 5F1JA 2KZ8A 1BDHA 2GM4A 1IDYA 3CMYA 3HM5A 1TWHJ 2R93J 3L1PA 4BBSJ 1NEQA 4W97A 1ZZ7A 1DWKA 3HGYA 2M2EA 1IC8A 1RPEL 5FLVA 1PRVA 3LSRA 2IUOA 1JJ8C 2QF7A 3HOVJ 4YG1A 1JUMA 1QP7A 2IAIA 2XPVA 1UXDA 2LR8A 2X6OA 2FJRA 2VKEA 5FKNA 3OP9A 4UUSB 2R5YB 4MFEA 3BTLA 2PIJA 1Y1VJ 1AKHB 2OR1L 2WB1N 2XPUA 3H3VK 4XRSA 1DU6A 4A3CJ 4B3AA 4X4HA 3LNQA 3Q0WA 4A3KJ 2CJJA 2DA2A 2D5VA 2W48A 5F27A 3KXAA 4XRSG 1RZRD 2G0EA 5J3LA 1T56A 4AUXA 2LYQA 5EG0B 4G12A 2HSGA 2LYPA 4X4IA 4FE4A 3FMYA 4DYCA 3OQMA 2GRLA 1TWGJ 2K9SA 4I8TA 1WIZA 4YG7B 2CUEA 2EQRA 4BY7J 5EF6A 3SCFA 1XG1A 3HOUJ 3B7HA 3OMTA 2ID3A 2L0KA 3KJXA 2M34A 1IG7A 2KEJA 2E2IJ 3GTPJ 1QVUA 1UXCA 1RKWA 2MQKA 1UHSA 2CU7A 4FN3A 1NERA 1OCTC 2EZLA 5C4XJ 4D5CA 1IDZA 1LE8B 1OCPA 4A3EJ 3M4OJ 3K2AA 2JCGA 2YS9A 2DA4A 4X4EA 1BJZA 2KEKA 3HOYJ 3H0GJ 4C2MJ 3GBGA 4MO7A 2FD5A 2R0QC 3B6CA 1B0NA 1Z77A 3ZHIA 1TWCJ 2AW6A 1WGXA 2JWTA 2EF8A 4Z58A 5EDNA 2LYSA 1JKRC 3JXCL 5K98B 5FLMJ 2PUEA 1JFTA 4IEJA 1WH7A 4JYKA 4AYBN 2AO9A 1H89C 1W0TA 1P7JA 2ELKA 2AXVA 3TP3A 2EWTA 1PUFB 2LYKA 2NS8A 3A03A 4PU4C 2DA5A 5IPAA 3E7LA 1CQTA 1SANA 1DW9A 4NDWA 1SFOJ 2WIUB 2JJ7A 3FYMA 1ZZBA 2NS7A 4M3GA 3TP0A 5GPCA 4I6RA 3ZQLA 1VNDA 2JVLA 1RKTA 5DS9A 1BW6A 2IU7A 3MKLA 3GTOJ 2GBYA 5M5YJ 4J1XA 3BG3A 4BBRJ 1R63A 2E2HJ 2Y9ZA 4UUTA 2EBYA 3SCGA 3FKIJ 9ANTA 2DA3A 2L9RA 3QPSA 3Q3SA 3BS3A 1FEXA 1WPKA 4IHVA 1MBKA 1ZTRA 2DA1A 1HLVA 2PUAA 4RDUA 1POGA 4LOCA 5IYCJ 3BT9A 1BDIA 1AU7A 2PPXA 2HQ5A 3H5TA 1S7EA 3PM1A 4X4CA 3SFIA 2R7ZJ 4X4GA 3BR5A 2XB5A 3M3YJ 4X4FA 3S17J 3HZIB 3A02A 2X48A 2LY9A 3TW7A 5EGOB 2HOTA 1PERL 1EFAA 4J19A 3DCFA 4RBOA 3F52A 2DMPA 2DMQA 3MLFA 1RESA 3FISA 1Z0XA 5C3EJ 2HI3A 1I50J 2ICTA 4M3DA 2IVGA 2L49A 4JX5A 1OSLA 3GN5B 2PUGA 2JA8J 3HOXJ 4UUSA 2R5YA 2AWIA 4MCTA 3Q0VA 2DMNA 2ME6A 1JUPA 4BY1J 2LK2A 1FIAA 3NARA 1IGNA 3HOWJ 3JXDL 2LYJA 5F04A 3S1NJ 3BQZA 2WV1A 4M3EA 4DYRA 1APLC 1ENHA 3OOUA 1HCRA 4BKXA 1E3OC 1ZPQA 3QWGA 1NK3P 1BL0A 3QF3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NVX J;  1ETO A;  2K9N A;  5EG0 A;  4IHX A;  2L7M P;  2ZB9 A;  2H8R A;  2BNM A;  3G1M A;  4CYC A;  2JA7 J;  2LYR A;  1WI3 A;  1L1M A;  3BR3 A;  3HGG A;  2LP0 A;  2XGC A;  4MIM A;  5FJ8 J;  4YAR A;  2FJ1 A;  3IH4 A;  1TC3 C;  5IYB J;  4I6Z A;  2E19 A;  5HOD A;  1ZK8 A;  2LCV A;  5BNG A;  4FTH A;  1PRA A;  3OQO A;  3FIW A;  1SQ8 A;  3MVP A;  5JLW A;  2LD5 A;  1IV6 A;  1YRN A;  4D5F A;  3UKG A;  1LCD A;  2XGD A;  1PRU A;  3ZQI A;  3TED A;  1ZZ6 A;  5IOZ A;  1Y1W J;  3RZO J;  4FBI A;  2LVS A;  1F36 A;  2AHQ A;  1OFC X;  2DA6 A;  1FTZ A;  2NOG A;  1K83 J;  2MG4 A;  3BR6 A;  3G5G A;  5K7F A;  1ETV A;  1RZS A;  3F0C A;  2FX0 A;  1VPW A;  4D7N A;  2B5A A;  2IV1 A;  2CUF A;  3S2D J;  2WAQ N;  4M3B A;  3JRH A;  1R9T J;  5FKK A;  1B8I B;  3O9X A;  4A3J J;  4A3F J;  5J1R A;  2R92 J;  1YSE A;  2XCJ A;  3ZKC A;  2MGQ A;  3IV5 A;  3SCH A;  1WH8 A;  1WH5 A;  4Z5D A;  2O7O A;  4JQD A;  5E3N A;  4JX4 A;  4MLO A;  4A3G J;  1JWL A;  1MBF A;  2O49 A;  2B63 J;  2QCO A;  4GHJ A;  3PXP A;  1BW5 A;  3IH2 A;  3A01 B;  3JRB A;  1BA5 A;  4JX6 A;  2N8G A;  4DZP A;  3OSG A;  1X2L A;  3F51 A;  3GTK J;  1O4X A;  2CSF A;  2LYL A;  3VK0 A;  4DZJ A;  1JFS A;  3Q0U A;  3G1O A;  5M3F J;  3KZ3 A;  3SJM A;  1JKP C;  3HOZ J;  3G7D A;  3RZD J;  1ZVV A;  1JKO C;  2NVY J;  3RKQ A;  3BD1 A;  2CQQ A;  4IA8 A;  4YBA A;  4X6A J;  4JP0 A;  1ZZ8 A;  1TWA J;  5FKM A;  4XID A;  4C3J J;  1G2H A;  3S8Q A;  3QPL A;  1B72 A;  2HXO A;  5IOY A;  5FKL A;  5E3M A;  1HDP A;  3CEC A;  3ZQH A;  1JUS A;  4Y7N J;  2AUW A;  2E1O A;  5IP6 A;  3U3W A;  2HDD A;  4XRM A;  1LFU P;  2XPW A;  1T33 A;  3BG9 A;  3LSG A;  3S15 J;  4I6U A;  1TWF J;  3OIO A;  2OF7 A;  2NVQ J;  5IP9 J;  3B6A A;  5E3O A;  1FTT A;  5EGO A;  2ECB A;  3F6W A;  5F0C A;  2GLO A;  2LFB A;  3LOC A;  1U78 A;  1MSE C;  1MNM C;  3VPR A;  4MCX A;  3DNV B;  1XC5 A;  4JCX A;  1RZR A;  4I76 A;  2BNN A;  3HBL A;  2R1J L;  3GN5 A;  3LSP A;  3BTI A;  1LFB A;  3SDG A;  2CRG A;  3BR1 A;  1QP4 A;  3JRE A;  2XSD C;  1ZQ3 P;  3JRC A;  4IVZ A;  3BG5 A;  2Y31 A;  2O9L A;  4Y42 A;  4FCY A;  3S16 J;  3O8G A;  3QQA A;  1LQC A;  2K40 A;  5J1Y A;  3ZOB A;  2PMZ N;  5J1U A;  1X2M A;  3GBF A;  2XB0 X;  2JMW A;  3BTJ A;  2BJC A;  1QQA A;  4B1R A;  1ETY A;  2JA6 J;  2DTZ A;  1MBH A;  4GQM A;  4QTR A;  3HEF A;  2AXZ A;  4D7M A;  1GVD A;  3HDD A;  1QPI A;  1RIO A;  1AHD P;  4X1E A;  4C3H J;  3PO2 J;  4OB4 A;  4MFD A;  1VFC A;  1GDT A;  3BR2 A;  2R5Z B;  2PUB A;  1IJW C;  5F08 A;  1AKH A;  1ETQ A;  3CQZ J;  2P81 A;  5EYR A;  1ZGW A;  3BDN A;  2X9D A;  1A6I A;  4HNV A;  3RQI A;  3UFD A;  1IUF A;  2MEZ A;  2ME0 A;  3FYA A;  2IEK A;  1ZKG A;  2DMU A;  3O8H A;  4AC0 A;  1RR7 A;  2VKV A;  2EZK A;  5GP9 A;  1JTX A;  1ETX A;  2XI8 A;  3GTG J;  2PUD A;  2EBI A;  2CRO A;  1WH6 A;  2NVT J;  3RZZ A;  2EZH A;  4Z5C A;  3JRF A;  1X2N A;  5M5X J;  1XWR A;  2XJ3 A;  1ETW A;  1ZR2 A;  2JK3 A;  3ZQF A;  2FQ4 A;  2O8K A;  2OFY A;  4BXX J;  3GTM J;  2HOA A;  3D1N I;  3HB9 A;  3JRI A;  3GTJ J;  4XIC A;  3W6V A;  3A01 A;  1JT0 A;  1LE8 A;  1X57 A;  2KPJ A;  4PU7 A;  2L7Z A;  3JRG A;  1UG2 A;  4YG4 A;  1CJG A;  5GPA A;  5EZG A;  1ZZC A;  2JN6 A;  4W1U A;  1JJ6 C;  3JRD A;  4FIS A;  4C3I J;  3NAU A;  3QQ6 A;  2PUC A;  1LCC A;  2I10 A;  1RPW A;  2Y0S N;  3MN2 A;  3S1M J;  4J1W A;  3GTQ J;  3BTC A;  4I6T A;  5A7L A;  3WHB A;  2AXU A;  4O8B A;  3FK6 A;  1MH4 A;  5M3M J;  3GTL J;  1PUF A;  2H1K A;  2L8N A;  1MH3 A;  2XIU A;  3DEW A;  2YUS A;  4GFB A;  1EF4 A;  3BQY A;  2VI6 A;  2L7F P;  1MSF C;  1QP0 A;  4IWR A;  1GT0 C;  2KDZ A;  3WHC A;  1D5Y A;  4A93 J;  2KEI A;  1A5J A;  1QPZ A;  1W0U A;  4CYC B;  2HIN A;  3HKZ N;  1JTY A;  5F0H A;  2JA5 J;  4PU3 C;  1ZUG A;  4QIW N;  2IBD A;  2MSY A;  1MBE A;  3EUS A;  1QVT A;  1Q1V A;  2LKX A;  5C44 J;  1ZAY A;  1YRN B;  1F43 A;  4ABZ A;  2PUF A;  4PU8 A;  3ZHM A;  2IVB A;  1FIP A;  1MBJ A;  2VPR A;  1IRZ A;  4S0H B;  2K9Q A;  2XGE A;  2M9H A;  2O38 A;  1HDD C;  2M0C A;  2Y9Y A;  2TCT A;  2HOS A;  1RET A;  3OQN A;  2A6C A;  2WUS R;  1NTC A;  1ORK A;  1WET A;  5C4J J;  1GUU A;  2R63 A;  3PO3 J;  3IVP A;  2DN0 A;  2HXI A;  5JLX A;  5M5W J;  1H88 C;  4Y52 J;  3OSF A;  2GZU A;  1JT6 A;  2ECC A;  1VF9 A;  4A3L J;  1LMB 3;  4NDL A;  4M3F A;  4A3D J;  1ZS4 A;  1UMQ A;  1U8B A;  2YU9 J;  4F8D A;  1WCM J;  4A3M J;  3IH3 A;  1ZZ9 A;  4XK4 A;  2LLK A;  5IYD J;  2M8G X;  5DTD A;  1ZR4 A;  1XS9 A;  4V2G A;  3TW6 A;  4M6V A;  3LIS A;  1ADR A;  2CQX A;  1K61 A;  1Y9Q A;  3R1F A;  2R5Z A;  4A3I J;  1JKQ C;  1GV2 A;  3JR9 A;  1ETK A;  4V2F A;  2VUM J;  2GRM A;  2LTP A;  1JH9 A;  2EH3 A;  2RAE A;  4Z5H A;  2XRL A;  1FJL A;  2Y30 A;  1HF0 A;  1GV5 A;  3CDL A;  5K7H A;  2MW8 A;  3BR0 A;  2BNO A;  3LSJ A;  3JRA A;  3I4N J;  1JGG A;  1NK2 P;  3S1Q J;  1OJL A;  1MBG A;  4B4C A;  4IHY A;  4A3B J;  3I4M J;  1QRY A;  4X4D A;  4DW6 A;  1R69 A;  2IVQ A;  3LFP A;  3S2H J;  2OPT A;  3QYX A;  5FKO A;  2DMT A;  5EEA A;  1B72 B;  1PNR A;  1QQB A;  3S1R J;  3CRO L;  4IHW A;  4DYQ A;  2ID6 A;  3TRB A;  2HYJ A;  2Y2Z A;  3CLC A;  2E2J J;  4EEF G;  1UTX A;  1P7I A;  4A69 C;  4FE7 A;  5IP7 J;  3S14 J;  5F0F A;  1DU0 A;  1LLI A;  4QSH A;  3C2B A;  4X4B A;  2TRT A;  1H8A C;  2DA7 A;  3CCY A;  1ITY A;  4JCY A;  2PE5 A;  2COB A;  1U9N A;  3K7A J;  3JXB C;  4L5E A;  4Z59 A;  1HOM A;  1U9O A;  5E3L A;  2ICP A;  3G1L A;  1I6H J;  5K7Z A;  3FK7 A;  1B8I A;  1I3Q J;  5EZH A;  3ZQG A;  1Y7Y A;  2O4A A;  1VI0 A;  2KT0 A;  1POU A;  1X58 A;  2DJN A;  2EZI A;  3ZQC A;  5F1J A;  2KZ8 A;  1BDH A;  2GM4 A;  1IDY A;  3CMY A;  3HM5 A;  1TWH J;  2R93 J;  3L1P A;  4BBS J;  1NEQ A;  4W97 A;  1ZZ7 A;  1DWK A;  3HGY A;  2M2E A;  1IC8 A;  1RPE L;  5FLV A;  1PRV A;  3LSR A;  2IUO A;  1JJ8 C;  2QF7 A;  3HOV J;  4YG1 A;  1JUM A;  1QP7 A;  2IAI A;  2XPV A;  1UXD A;  2LR8 A;  2X6O A;  2FJR A;  2VKE A;  5FKN A;  3OP9 A;  4UUS B;  2R5Y B;  4MFE A;  3BTL A;  2PIJ A;  1Y1V J;  1AKH B;  2OR1 L;  2WB1 N;  2XPU A;  3H3V K;  4XRS A;  1DU6 A;  4A3C J;  4B3A A;  4X4H A;  3LNQ A;  3Q0W A;  4A3K J;  2CJJ A;  2DA2 A;  2D5V A;  2W48 A;  5F27 A;  3KXA A;  4XRS G;  1RZR D;  2G0E A;  5J3L A;  1T56 A;  4AUX A;  2LYQ A;  5EG0 B;  4G12 A;  2HSG A;  2LYP A;  4X4I A;  4FE4 A;  3FMY A;  4DYC A;  3OQM A;  2GRL A;  1TWG J;  2K9S A;  4I8T A;  1WIZ A;  4YG7 B;  2CUE A;  2EQR A;  4BY7 J;  5EF6 A;  3SCF A;  1XG1 A;  3HOU J;  3B7H A;  3OMT A;  2ID3 A;  2L0K A;  3KJX A;  2M34 A;  1IG7 A;  2KEJ A;  2E2I J;  3GTP J;  1QVU A;  1UXC A;  1RKW A;  2MQK A;  1UHS A;  2CU7 A;  4FN3 A;  1NER A;  1OCT C;  2EZL A;  5C4X J;  4D5C A;  1IDZ A;  1LE8 B;  1OCP A;  4A3E J;  3M4O J;  3K2A A;  2JCG A;  2YS9 A;  2DA4 A;  4X4E A;  1BJZ A;  2KEK A;  3HOY J;  3H0G J;  4C2M J;  3GBG A;  4MO7 A;  2FD5 A;  2R0Q C;  3B6C A;  1B0N A;  1Z77 A;  3ZHI A;  1TWC J;  2AW6 A;  1WGX A;  2JWT A;  2EF8 A;  4Z58 A;  5EDN A;  2LYS A;  1JKR C;  3JXC L;  5K98 B;  5FLM J;  2PUE A;  1JFT A;  4IEJ A;  1WH7 A;  4JYK A;  4AYB N;  2AO9 A;  1H89 C;  1W0T A;  1P7J A;  2ELK A;  2AXV A;  3TP3 A;  2EWT A;  1PUF B;  2LYK A;  2NS8 A;  3A03 A;  4PU4 C;  2DA5 A;  5IPA A;  3E7L A;  1CQT A;  1SAN A;  1DW9 A;  4NDW A;  1SFO J;  2WIU B;  2JJ7 A;  3FYM A;  1ZZB A;  2NS7 A;  4M3G A;  3TP0 A;  5GPC A;  4I6R A;  3ZQL A;  1VND A;  2JVL A;  1RKT A;  5DS9 A;  1BW6 A;  2IU7 A;  3MKL A;  3GTO J;  2GBY A;  5M5Y J;  4J1X A;  3BG3 A;  4BBR J;  1R63 A;  2E2H J;  2Y9Z A;  4UUT A;  2EBY A;  3SCG A;  3FKI J;  9ANT A;  2DA3 A;  2L9R A;  3QPS A;  3Q3S A;  3BS3 A;  1FEX A;  1WPK A;  4IHV A;  1MBK A;  1ZTR A;  2DA1 A;  1HLV A;  2PUA A;  4RDU A;  1POG A;  4LOC A;  5IYC J;  3BT9 A;  1BDI A;  1AU7 A;  2PPX A;  2HQ5 A;  3H5T A;  1S7E A;  3PM1 A;  4X4C A;  3SFI A;  2R7Z J;  4X4G A;  3BR5 A;  2XB5 A;  3M3Y J;  4X4F A;  3S17 J;  3HZI B;  3A02 A;  2X48 A;  2LY9 A;  3TW7 A;  5EGO B;  2HOT A;  1PER L;  1EFA A;  4J19 A;  3DCF A;  4RBO A;  3F52 A;  2DMP A;  2DMQ A;  3MLF A;  1RES A;  3FIS A;  1Z0X A;  5C3E J;  2HI3 A;  1I50 J;  2ICT A;  4M3D A;  2IVG A;  2L49 A;  4JX5 A;  1OSL A;  3GN5 B;  2PUG A;  2JA8 J;  3HOX J;  4UUS A;  2R5Y A;  2AWI A;  4MCT A;  3Q0V A;  2DMN A;  2ME6 A;  1JUP A;  4BY1 J;  2LK2 A;  1FIA A;  3NAR A;  1IGN A;  3HOW J;  3JXD L;  2LYJ A;  5F04 A;  3S1N J;  3BQZ A;  2WV1 A;  4M3E A;  4DYR A;  1APL C;  1ENH A;  3OOU A;  1HCR A;  4BKX A;  1E3O C;  1ZPQ A;  3QWG A;  1NK3 P;  1BL0 A;  3QF3 A; 
#chains in the Genus database with same CATH topology
 2K86 A;  2BNM A;  3LFU A;  1I1G A;  3B73 A;  2L01 A;  1BBY A;  2FJ1 A;  3KIO A;  5LBQ A;  1KQ8 A;  1HKT A;  3DLA A;  5BNG A;  1LEB A;  1PRA A;  2CFO A;  1BM9 A;  1SQ8 A;  3MVP A;  2LD5 A;  2AQF A;  2CUJ A;  5HDN A;  2A61 A;  3ZN1 A;  4WVL A;  1KA8 A;  3F3X A;  2CYY A;  3MAJ A;  3K1N A;  1Y1W J;  1IXC A;  3EQL F;  4FBI A;  5GAE J;  1F36 A;  2AHQ A;  4LG3 A;  1OFC X;  4E6K G;  4HZF A;  3OIP A;  1XSD A;  3BR6 A;  3RJP A;  4E7J A;  2DOD A;  2YSR A;  2FX0 A;  2X51 A;  4RM2 A;  3S2D J;  2LH9 A;  3PNT A;  1MKM A;  1OR7 C;  4E7L A;  1B8I B;  3QFI A;  4OBM A;  4F91 B;  3O9X A;  3L2R A;  3G0T A;  3VYU B;  3HRS A;  4EVI A;  4ENM A;  3F72 A;  1YSE A;  2XCJ A;  3ML6 A;  5DYM A;  4BHP A;  3SCH A;  2Q8K A;  4OIP F;  5JI6 A;  4WXH A;  4Q48 A;  3SEQ A;  5JHU A;  4JX4 A;  3BOQ A;  4A3G J;  1JWL A;  4N0B A;  2WAD A;  1F5T A;  3PXP A;  4YIR X;  2FRH A;  6PAX A;  2PXT A;  3EDP A;  2VKD A;  1BA5 A;  4B48 A;  3FMR A;  4RGU A;  2N8G A;  3LSI A;  3MZH A;  3OSG A;  1GXQ A;  2XHK A;  1QHG A;  3GTK J;  3H9J A;  1O4X A;  2CSF A;  3Q0U A;  5DTM A;  3KZ3 A;  2F5F A;  1JKP C;  3RZD J;  1OYW A;  5HNF A;  5JHF A;  2CQQ A;  4YBA A;  5JUW A;  4X6A J;  4JP0 A;  1ZZ8 A;  4CZC A;  1ZAR A;  4XID A;  1F4K A;  5IT9 K;  4YFN F;  3CO6 C;  4M74 A;  3VYR B;  2DFI A;  3OS2 A;  3X2Q H;  3WGG A;  3K4B A;  1GVJ A;  2AUW A;  2E1O A;  5IP6 A;  2NVU B;  3QWL A;  5J4Y A;  3TGN A;  2LRE A;  1LFU P;  4HRI A;  1X3W B;  1WJF A;  1SAU A;  2BY0 A;  4ZYA A;  2P8T A;  4I01 A;  4I6U A;  2K3P A;  1DGR M;  1S7O A;  1MJA A;  4A2U A;  4A6D A;  2NVQ J;  2JRM A;  4LIU A;  5IP9 J;  4KT5 C;  1H9T A;  3K4J A;  4XLA A;  3PE5 A;  2QQ9 A;  1E17 A;  2X4H A;  2GLO A;  1KQ9 A;  1U78 A;  3ZXS A;  2FXA A;  4HX8 A;  4MCX A;  1XC5 A;  1FBQ A;  4JCX A;  1RR8 C;  4RB0 A;  3LSP A;  3BTI A;  1LFB A;  4NNJ A;  3SDG A;  2HNH A;  3LQQ A;  5LFA A;  1S9H A;  2Z5U A;  1DPR A;  1PUE E;  1BR4 A;  3ISP A;  2O9L A;  2CS3 A;  2LBF B;  3S16 J;  3O8G A;  4DOZ A;  1OYY A;  5DRT A;  3CCR I;  5J8C A;  3KZI C;  4HST A;  3PNY A;  2L7K A;  1XB4 A;  1QQA A;  4B1R A;  1ETY A;  4OIO F;  5GAG J;  3WE3 A;  4GQM A;  2CQK A;  2V4J C;  3TMO A;  3OYM A;  2C6Y A;  2PMU A;  1BI1 A;  1IUY A;  3CJQ B;  1DGW Y;  3I56 I;  4ER6 A;  5CQG A;  4I09 A;  3S32 A;  3BR2 A;  2R5Z B;  2EFO A;  5F08 A;  2WY7 Q;  4LG0 A;  2H27 A;  2ISY A;  1V54 H;  2E34 A;  2EA2 A;  3I59 A;  1ETQ A;  2ACJ A;  1ZGW A;  4BE2 A;  1PP8 F;  4ZZL A;  4MQV A;  4RB2 C;  1IRF A;  2QQ8 A;  2WC2 A;  3IAM 2;  2DMU A;  3O8H A;  4AC0 A;  2G9W A;  4G6Q A;  1IAW A;  1HQC A;  5E1W A;  1USS A;  3T1B A;  2JQE A;  4U0V A;  4N9I A;  2PUD A;  2VXZ A;  1IXS B;  1O3S A;  2NVT J;  4XON A;  3RZZ A;  3FXO A;  4AYB A;  4LGW A;  5HS9 A;  4BNC A;  2ZFU A;  3DLL F;  1ERD A;  2JK3 A;  3ZQF A;  2FQ4 A;  3GTM J;  3W2A A;  5J40 A;  2DT7 B;  3F8M A;  4HF2 A;  4XIC A;  1D8K A;  1LE8 A;  3D5R C;  4KIS A;  2XF6 A;  3U9G A;  3RKW A;  3CD6 I;  1UG2 A;  4BHC A;  2FSW A;  1CJG A;  1A35 A;  4P96 A;  5FO5 A;  3S3M A;  2EJR A;  2ISZ A;  1WSU A;  4FIS A;  2LLW A;  3MN2 A;  2Y0S N;  3H5R A;  1X1P A;  4U88 A;  2W84 A;  3WHB A;  1N78 A;  1VQ6 I;  4O8B A;  1MH4 A;  2L8N A;  2OD5 A;  1T95 A;  3EUH C;  3LAP A;  4EK9 A;  2OC6 A;  1MGT A;  3DEW A;  4HLY A;  2VI6 A;  4HSR A;  1HW5 A;  4FT8 A;  3W6K B;  2W25 A;  1PP7 U;  5FRM A;  1R36 A;  4E7S A;  1CF7 B;  1A5J A;  2FA5 A;  1PDN C;  4PSW A;  1QPZ A;  1YIO A;  3ZQQ A;  3HKZ N;  1V5E A;  1G3W A;  2GIZ A;  2JA5 J;  3CME I;  1YE9 A;  3E3V A;  4PU3 C;  3IP4 B;  2IBD A;  4GXO A;  1RRJ A;  2R7X A;  3EUS A;  5C44 J;  3DPT A;  3AL0 B;  1EA3 A;  1FMV A;  2F5D A;  3LA7 A;  5FRN A;  3ZHM A;  1X1C A;  3L2Q A;  1GHC A;  1K79 A;  1G6N A;  2M9H A;  2VIX A;  3G71 I;  3IKT A;  4BE0 A;  2VT3 A;  2BY1 A;  1HDD C;  2O38 A;  1RET A;  1M1E B;  1QBJ A;  1WET A;  3PUB A;  3JW4 A;  5C4J J;  2Y48 A;  3PO3 J;  5E1Z B;  4F93 B;  2ZJP F;  5M5W J;  1T8I A;  4Y52 J;  3F8B A;  3MCZ A;  2E7W A;  4Z6Y A;  2O3F A;  2ZXW H;  3OSF A;  2GZU A;  1VF9 A;  3OYI A;  4NDL A;  2HCS A;  1ZN2 A;  1ZS4 A;  4B3X A;  1U8B A;  2YU9 J;  1T6S A;  4Y4R A;  1ZZ9 A;  4XK4 A;  2LLK A;  5IYD J;  5DTD A;  5A2Q K;  3TW6 A;  3LIS A;  3DKX A;  2QSG X;  1HW1 A;  1GV2 A;  4ZYE A;  3OY9 A;  4C2T A;  5DTR A;  2IRF G;  3DTE A;  1ETK A;  4V2F A;  3ZMV A;  3S93 A;  3JR9 A;  1JH9 A;  4NBQ A;  3ZPL A;  3AAF A;  4RLQ A;  3MKZ A;  2HEO A;  2HDW A;  3CDL A;  5D5U B;  1W7P D;  4AU7 A;  4BGD A;  2VL8 A;  1Z7U A;  2MW8 A;  1TNT A;  1UHW A;  2FU4 A;  2GA2 A;  2HVQ A;  2VT2 A;  5K7H A;  2ZC2 A;  3JRA A;  5KAF C;  2JTV A;  3K1P A;  5CVV A;  1OJL A;  2HFH A;  1HKS A;  5FFX A;  4IHY A;  2WAQ A;  3P5J A;  2K02 A;  4X4D A;  4DW6 A;  3LFP A;  1FP2 A;  3QYX A;  2L02 A;  4IHW A;  1U0J A;  3AG3 H;  2ID6 A;  3M1E A;  1JI8 A;  2Z2S B;  4XLC A;  3RPQ A;  3LSK A;  3RPU A;  4XOT A;  2A6E F;  4MGR A;  2Y2Z A;  3K70 D;  3CLC A;  3DV8 A;  3GXO A;  5L3C A;  4BDY A;  3S14 J;  5KVR A;  4AWX B;  4X4B A;  1ZLJ A;  5ILV A;  4UY8 I;  3GW2 A;  2DA7 A;  5B1B H;  1X3Z B;  3KP7 A;  1R1T A;  1HOM A;  2ICP A;  4BU2 A;  1I6H J;  1OPC A;  3ABK H;  1FMW A;  2PXP A;  3GYH X;  3BC8 A;  2KT0 A;  2CW0 F;  2OUM A;  3ZPX A;  3COA C;  1F9N A;  1SFE A;  2JQ7 A;  2EZI A;  1FYM A;  4NHJ A;  1KON A;  4PK4 A;  1TL8 A;  4KIF A;  1O57 A;  4XM3 A;  4F7Z A;  3CMY A;  3CCS I;  1X1B A;  5D8L B;  3BG7 A;  3GCM A;  2CQN A;  2R93 J;  5TRD A;  2H8W A;  4BBS J;  1NEQ A;  4W97 A;  4U7D A;  4XKW A;  1D8J A;  3JAM Z;  1W36 C;  1IC8 A;  2V1N A;  5IT3 A;  3OYC A;  1Z1D A;  3K0L A;  3QYF A;  1JJ8 C;  3HOV J;  4YG1 A;  3WTV C;  1N75 A;  1U3E M;  2X6Y A;  3BCA A;  2GOM A;  3U21 A;  3OP9 A;  1D0X A;  2R5Y B;  3HYI A;  1AKH B;  1U2Z A;  2F5C A;  4A3C J;  3FBI B;  4B3A A;  2GZW A;  2HOE A;  3Q0W A;  2RRE A;  2MC3 A;  3N4M A;  4FX4 A;  3PUF A;  2XF7 A;  2AS5 F;  1RZR D;  2LYP A;  2YX7 A;  3HSF A;  3U1D A;  3FMY A;  3OQM A;  2K9S A;  1S5L C;  4RGS A;  3FXU A;  3DBL B;  3HOU J;  3B7H A;  1BR1 A;  2COM A;  3OMT A;  2ID3 A;  2L0K A;  2MLG A;  2FFH A;  2OV7 A;  4BUP A;  4P9F A;  4CUG A;  3OL3 A;  2MQK A;  2W4S A;  4OAY A;  2VBZ A;  2W00 A;  5EEG A;  2YS9 A;  1TLH B;  2IS4 A;  2BW3 A;  3ZMS A;  4FHT A;  3H0G J;  1ZHF A;  3RCO A;  3GBG A;  1BC7 C;  3A2K A;  3PFY A;  3DTI A;  1Z77 A;  2RN7 A;  2PXF A;  2HPM A;  2EV6 A;  5AON A;  2LYS A;  4NC7 A;  1JKR C;  3M9L A;  1D0Z A;  3G6E I;  4DE8 A;  4IOC F;  4NQW A;  2PMH A;  5CYV A;  4AYB N;  3OWT A;  4GCV A;  1P7J A;  3LSH A;  4BDZ A;  1HC8 A;  2Y0M A;  1PUF B;  2ZO4 A;  2EWT A;  4BL0 B;  3KPH A;  2QQB A;  2KIU A;  3E7L A;  1CQT A;  2EFN A;  1IN5 A;  1A6Q A;  2VPL A;  5H6R A;  5GPC A;  3OYK A;  3FDY A;  2JVL A;  3DP7 A;  2OZU A;  2H6B A;  5L3D A;  3GFI A;  1YS6 A;  1G3S A;  5J8F A;  2CV1 A;  1YFH A;  2Q0O A;  4GDF A;  3CCJ I;  2EBY A;  1XDS A;  4Z2Y A;  3OWQ A;  4B8X A;  5BPD A;  3SCG A;  3FM3 A;  2L9R A;  1ZG1 A;  3BS3 A;  3PL8 A;  1FEX A;  3NWT A;  3OYA A;  4CH7 A;  5DUK A;  3GFJ A;  4RDU A;  1POG A;  5IYC J;  1K78 A;  1WJB A;  5ILU A;  3ERM A;  4UV9 A;  1S72 I;  3W6J B;  5LEJ A;  1AU7 A;  2PPX A;  4XLP F;  4HAM A;  2IGK A;  4G94 A;  3ZMD A;  1W5C C;  2ETH A;  1TW2 A;  3NRO A;  3SFI A;  2PJR B;  4NC8 A;  1R1U A;  1A04 A;  3HSR A;  3M3Y J;  3TFL A;  3CZ6 A;  4I0B A;  5GAD J;  4HBL A;  2X48 A;  4HA8 A;  3OYG A;  5BMZ A;  1FYL A;  3UNG C;  2V9K A;  3H36 A;  3MD2 A;  1N77 A;  5KK1 A;  2K7L A;  4RBO A;  2DMP A;  1RES A;  3FIS A;  2L49 A;  2IVG A;  3CJR B;  1YJ9 I;  4HNU A;  3C2G A;  2ZSH B;  4BAC A;  2PUG A;  1MZB A;  1LEA A;  1UZC A;  3HOX J;  1TQP A;  5HLT A;  1JUP A;  3GUU A;  2ELJ A;  4ZYD A;  2FUG 2;  1YJW I;  4F52 A;  3SX0 A;  2IA1 A;  3E5X A;  1SFU A;  3S1N J;  3CDH A;  3ASN H;  3NWS A;  4DYR A;  2XDV A;  1ENH A;  2K5C A;  1E3O C;  4O5V A;  1ETO A;  2K9N A;  3BJA A;  5EG0 A;  1K4T A;  4IHX A;  4J01 A;  2L7M P;  2H8R A;  4KYW A;  4DE9 A;  3G1M A;  3F9K A;  1Z7L A;  1VQO I;  3BR3 A;  2P4W A;  5FJ8 J;  2XGC A;  3OS0 A;  2RQQ A;  5IYB J;  2E19 A;  3PIO F;  4P9U A;  1R49 A;  4FTH A;  4IPA A;  2DQL A;  1IV6 A;  2IS1 A;  2LSO A;  1S6L A;  1WJC A;  3VYT B;  2XUB A;  2IXS A;  2MLK A;  1LCD A;  2VON A;  2HFZ A;  3TED A;  2L9N A;  5DD4 A;  3RZO J;  2JUG A;  2OU2 A;  1XMX A;  2WY8 Q;  2BXY A;  1EH7 A;  3RSN A;  1FTZ A;  2F2E A;  5J47 A;  2NOG A;  1NG6 A;  1IF1 A;  2QBY A;  1VPW A;  3F0C A;  4C2U A;  2CUF A;  1IW7 F;  2WAQ N;  4M3B A;  5FKK A;  3NDB B;  5EJC A;  2QUF A;  5J1R A;  3L2V A;  1X4O A;  2R92 J;  3HTS B;  1VQM I;  3ZQ7 A;  2MGQ A;  4E7K A;  2R7O A;  2WV0 A;  5KHD A;  1WH5 A;  1WH8 A;  3ME5 A;  2O7O A;  4JQD A;  4UNO A;  1MDM A;  1U5T B;  4MLO A;  1IXR C;  2LKS A;  5L3B A;  3VB2 A;  2QCO A;  2YBD A;  1KYW A;  4GHJ A;  4FX0 A;  3QOD A;  1Y8R B;  2M87 A;  1BW5 A;  3IH2 A;  3RQ4 A;  4ER3 A;  2OCC H;  1ZH5 A;  1SC7 A;  3DBR B;  3BZ6 A;  3VK0 A;  4DZJ A;  3CCE I;  5M3F J;  3WTY C;  3DEU A;  3GZD A;  3HOZ J;  3G7D A;  1R71 A;  2E60 A;  5B1A H;  3RKQ A;  1ZLK A;  2JT1 A;  2LDU A;  4WX9 A;  2HU9 A;  5FKM A;  4AIH A;  2X1E A;  3RI4 A;  4M9Z A;  1Z3X A;  1B72 A;  1UJ8 A;  2HXO A;  2FBH A;  2FML A;  1R6R A;  4I98 B;  5FKL A;  4B43 A;  3DPL C;  3V4G A;  5E3M A;  3N97 A;  3ZQH A;  1WHU A;  2CH0 A;  1MW7 A;  3U3W A;  3ABT A;  5J6X A;  4AIK A;  2JPB A;  4KIG A;  2KJC A;  3E6M A;  1QZE A;  2D2W A;  5B66 C;  3WTS C;  1YHQ I;  1QGP A;  5EGO A;  4ASN A;  4E7H A;  4A12 A;  3FHN A;  2QA4 I;  4BXU A;  3VSL A;  3LOC A;  2A5W A;  4DIQ A;  1MNM C;  3VPR A;  4RAZ A;  3IWZ A;  3HUG B;  4IRH A;  3K9T A;  2XRO A;  2CRG A;  2LF8 A;  3KZY A;  1IN6 A;  1ZQ3 P;  4IVZ A;  2VBX A;  4L5J A;  1CGP A;  2WB1 A;  1P4X A;  4Y42 A;  4LIV A;  3SZP A;  2DDA A;  4FCY A;  3QQA A;  1MD0 A;  2K40 A;  2RDP A;  5J1U A;  3KLO A;  1U6G A;  2XB0 X;  4DBQ A;  4KUM A;  3ABM H;  3BTJ A;  2BJC A;  2GOX B;  4LIT A;  1MBH A;  2ZME A;  1D1A A;  3HRT A;  3T0Y A;  1QPI A;  4EMS A;  4HQE A;  4X1E A;  4C3H J;  4OB4 A;  1FBU A;  1KGS A;  1WJ5 A;  4ZYG A;  1QNT A;  2A6H F;  3C3W A;  4PJJ A;  3W2V A;  2PFB A;  3BDN A;  4PCQ A;  1A6I A;  4AVZ A;  1UEL B;  2VJ4 A;  3HSE A;  2M45 A;  2BXZ A;  3UFD A;  1J75 A;  2IPQ X;  5KCM A;  2IEK A;  2MEZ A;  1UFM A;  1TP4 A;  2F48 A;  4XSZ F;  5GP9 A;  1YW8 A;  4CCM A;  1AOY A;  3W2W A;  5EEH A;  3GTG J;  1WZ2 A;  3BPX A;  1FY7 A;  3AG1 H;  3F6V A;  1WH6 A;  3OL4 A;  1R5I D;  1YO5 C;  4CCN A;  1LFP A;  3GLX A;  4EJT A;  1BOA A;  1JHH A;  2XKP A;  4ITV A;  4R79 A;  1VQ5 I;  3BRO A;  4Z5C A;  3JRF A;  2EV5 A;  3C2H A;  1ETW A;  2NOJ B;  3I64 A;  5BPI A;  4IQ4 A;  4M73 A;  1B9M A;  3CUQ C;  2XAS A;  3HB9 A;  4BYY A;  2LC2 A;  4JOM A;  3JRI A;  2XAF A;  3G73 A;  3W6V A;  4O3M A;  2R7U A;  1ZG3 A;  2GXA A;  4ZZD A;  2OQG A;  3JRG A;  4YG4 A;  1K7A A;  4BQN A;  1X4P A;  5GPA A;  3FMS A;  1ZZC A;  4ZTF A;  3NQO A;  2JN6 A;  4TV7 A;  2KIF A;  3QYB A;  2V6C A;  4W1U A;  4IZZ A;  4C3I J;  2I10 A;  4JQF A;  3K6G A;  3BDD A;  3CTA A;  4XLH A;  3IL2 A;  1SAX A;  2RV8 A;  4L0Y B;  4I6T A;  2AXU A;  1BJA A;  5F6F A;  1R1V A;  3E5U A;  4MTE A;  2VBY A;  2XIU A;  4E4H A;  2YUS A;  5E79 C;  4GFB A;  1MSF C;  3LST A;  4IWR A;  2HTJ A;  1U5T C;  3CJT B;  4D0P A;  1GT0 C;  4IOA F;  3WHC A;  3C7J A;  4AVP A;  2A68 F;  5F0H A;  1WJA A;  1ZUG A;  1ZRE A;  4QIW N;  2MSY A;  1I6X A;  3ROU A;  3CJN A;  2WTE A;  3TOA A;  1F43 A;  2FF4 A;  4B09 A;  2PUF A;  1X1A A;  4BHB A;  3IUO A;  4S0H B;  3E1S A;  1SFK A;  1E3H A;  2KFD A;  2GAU A;  4RM3 A;  1K6Y A;  1T0F A;  3JTG A;  1FOK A;  3OQN A;  2A6C A;  1XN7 A;  1NTC A;  3P9I A;  3FKJ A;  5E8G A;  4EM2 A;  3OYJ A;  2R63 A;  4LB6 B;  1BR2 A;  2Q2E B;  1I5Z A;  5ERI A;  2M3A A;  3H92 A;  5JLX A;  2F4I A;  1W4M A;  1DPU A;  5HLI A;  5LLQ A;  1JT6 A;  3MEX A;  2PJP A;  5LHH A;  2ADU A;  4M3F A;  4HPQ A;  3F23 A;  2ZJQ F;  1ZYR F;  1D5V A;  1BI0 A;  3KEQ A;  2K3F A;  2XAU A;  3DXJ F;  1ADR A;  1ZR4 A;  4V2G A;  2G7H A;  4M6V A;  1HXD A;  1ON2 A;  1K61 A;  2R5Z A;  4AIJ A;  4XOR A;  4P55 A;  2HVS A;  2IT0 A;  4N9H A;  4RMN A;  2RAE A;  3BG6 A;  5IT9 Z;  2QKM B;  3HPH A;  1FJL A;  1HF0 A;  4OAZ A;  3MKY B;  1GV5 A;  3F8C A;  3JTH A;  1IO2 A;  4HEA 2;  2V9P A;  1WWX A;  2E5N A;  1D1C A;  1IV8 A;  5HDG A;  3S1Q J;  4G8X A;  2JA2 A;  1BI2 A;  1MBG A;  1UST A;  1XMA A;  3I4M J;  2XKO A;  1JHF A;  1QRY A;  5LGU A;  1R69 A;  2VOO A;  1FWZ A;  1HST A;  4I99 C;  3L2W A;  1P4A A;  3CRO L;  2JPC A;  5GTH C;  1QHH D;  1ZRC A;  3TRB A;  4CCK A;  2KP6 A;  3KE2 A;  4LLL A;  3KP4 A;  1NH3 A;  3H35 A;  2E2J J;  2NRA C;  5IP7 J;  1FOX A;  5F0F A;  1DU0 A;  3C2B A;  1H8A C;  3TEL A;  2V9V A;  1LKX A;  1E0E A;  2DT5 A;  3JSO A;  5DM7 F;  4JCY A;  2COB A;  3JXB C;  4WK8 F;  4WWC A;  1FPQ A;  3FXL A;  2O4A A;  3TDU C;  3L2U A;  3F8N A;  1A31 A;  1HW2 A;  1KU9 A;  2EFQ A;  2DJN A;  4UXN A;  3CMA I;  2EIM H;  5H2F C;  2V79 A;  2DFE A;  4DJA A;  1IDY A;  3L1P A;  1XSV A;  4KT6 A;  2OCE A;  1ZZ7 A;  2IW5 A;  4II2 A;  4EKG A;  4OMZ A;  3IAS 2;  2HWV A;  2M2E A;  5HDK A;  4ANJ A;  2M4H A;  2DK8 A;  1RPE L;  3LAJ A;  1RI7 A;  2AXT C;  5AIQ A;  4A5N A;  1PRV A;  1JUM A;  1MNE A;  2IAI A;  2XPV A;  3OR2 C;  4UB8 C;  2LR8 A;  2X6O A;  3MKW B;  1KU2 A;  3J7A O;  1UXD A;  2CG4 A;  2PEX A;  2ICW G;  2VKE A;  2EB7 A;  4UUS B;  4LG0 B;  2H09 A;  4MFE A;  2PIJ A;  2WB1 N;  1ZRF A;  3H3V K;  4XRS A;  4KMU X;  1DU6 A;  1Z91 A;  2CJJ A;  3GME A;  2W48 A;  5F27 A;  3KXA A;  5LRR A;  3A9Z A;  2ELH A;  4HF1 A;  2PMZ A;  2LYQ A;  3EPZ A;  4G12 A;  4X4I A;  3K2Z A;  3FM5 A;  2GRL A;  1TWG J;  3SEZ A;  1WIZ A;  2CUE A;  2H6C A;  2EQR A;  5EF6 A;  3I54 A;  2DJI A;  3IHU A;  4HF0 A;  1O3R A;  1PVE A;  2V7F A;  3KJX A;  4L5I A;  2E2I J;  3WGI A;  2HYG D;  2Y75 A;  1QVU A;  2HQN A;  3D0S A;  1RKW A;  1UHS A;  1WI9 A;  3EYI A;  2CU7 A;  3WU2 C;  2K9L A;  2A69 F;  5K5R A;  4D5C A;  3U2R A;  1IDZ A;  2VQH A;  2HZT A;  4CO8 A;  3BZC A;  2CO5 A;  5GAH J;  3HHG A;  3QU3 A;  4A3E J;  3PNV A;  1LE8 B;  3UR3 C;  3KYD B;  5E18 F;  4U0Y A;  2B9S A;  1GXP A;  1ULY A;  2EF8 A;  2JWT A;  4XN3 A;  4Z58 A;  5EDN A;  1TQI A;  4CXF A;  1YJN I;  2KQR A;  5K98 B;  1YQA A;  2YX4 A;  4YG2 F;  4IEJ A;  1Q1H A;  1WH7 A;  2VB6 A;  3AG4 H;  1H89 C;  4BEH A;  3VOE A;  3QP6 A;  2AXV A;  3ABL H;  4PU4 C;  2NS8 A;  3WU0 A;  3R0J A;  2CV0 A;  2DA5 A;  5IPA A;  3QP5 A;  4DQ2 A;  3DFG A;  3QPT A;  1YIT I;  2Z16 A;  2VOP A;  1B6A A;  1Y0U A;  1X1D A;  3MMY B;  1DQU A;  1LPQ A;  2P5V A;  3MKL A;  5M5Y J;  1P9Q C;  2X85 A;  4L9T A;  1R63 A;  2E2H J;  3OMY A;  5LGT A;  3LFK A;  5E20 A;  1XCB A;  3QPS A;  4AID A;  3Q3S A;  3CCL I;  4G6T B;  3IRQ A;  4IHV A;  5GAG i;  1ZTR A;  1LB2 A;  3HOT A;  3OYH A;  3BT9 A;  2E71 A;  4RGX A;  4ZC3 A;  4LFU A;  5HS7 A;  5ICG A;  3PM1 A;  4KJZ A;  5A2Q Z;  2R7Z J;  4LK0 F;  5H6Q A;  5ILS A;  3BR5 A;  2XB5 A;  2PI0 A;  2K27 A;  3WU1 B;  2L54 A;  3TO9 A;  1MIJ A;  3S17 J;  4ZDP A;  3KP6 A;  2R7S A;  2CUZ A;  1Y6I A;  2NNN A;  2KIM A;  3H9Q A;  1PER L;  4XLF A;  1E3P A;  3DCF A;  3J80 K;  3MLF A;  4IJA A;  5D8K B;  2JSC A;  5C3E J;  2ICT A;  2O5R A;  1OSL A;  3GN5 B;  5L3F A;  4KA4 A;  1R58 A;  3S2W A;  2JA8 J;  1XGM A;  4MCT A;  5TIS C;  2R5Y A;  2AWI A;  2DFH A;  3V8K A;  1YW7 A;  2LK2 A;  3AG2 H;  2OTL I;  4HNT A;  1OCR H;  3BQZ A;  1APL C;  2D45 A;  1EJ9 A;  1ZRD A;  1HCR A;  3RYP A;  4BKX A;  1NK3 P;  3LQX A;  1BL0 A;  3GEZ A;  2NVX J;  4M6Y A;  5DCM B;  4CIC A;  5D4R A;  3KP5 A;  2XXQ A;  2ZB9 A;  1B59 A;  4CYC A;  3H0D A;  1I39 A;  3ULQ B;  1WI3 A;  5CKT A;  3VWB A;  2LYR A;  2UXN A;  3HGG A;  3R09 A;  1L1M A;  1LLI A;  3KEY A;  4RB1 A;  5HOD A;  4CDG A;  2EIL H;  2OBP A;  2O03 A;  1AWC A;  4ESJ A;  3OQO A;  3FIW A;  1W7P A;  5JLW A;  3J81 K;  1WJE A;  2LKP A;  2ZXJ A;  3P9C A;  1YRN A;  3UKG A;  2R7V A;  4E7Z A;  3LSM A;  4IXA A;  3I3L A;  4RLF A;  2XGD A;  3ZQI A;  1ZZ6 A;  3TEP A;  4YFX F;  5IOZ A;  2X6X A;  3CCM I;  2DA6 A;  3BLY A;  1I27 A;  4CA0 A;  4XRF A;  5GTI C;  1ETV A;  1RZS A;  3HOS A;  2DOE A;  4HX4 A;  3GWZ A;  2VBW A;  4PZJ A;  2IA0 A;  2QSH X;  1BOB A;  3M8F A;  3PFI A;  2F5E A;  2GQQ A;  1Z3Y A;  2M0M A;  4JBA A;  4A3J J;  4A3F J;  4ZDL A;  2BGC A;  5IY5 H;  4IKF A;  4PJL A;  4RS8 A;  4ON0 A;  2JVG A;  1SD6 A;  3IV5 A;  2E35 A;  3OYE A;  5E3N A;  2KRF A;  2VJJ A;  2O49 A;  2L9V A;  1MBF A;  3SYT A;  3LMM A;  3V8L A;  2OJE D;  2BOL A;  2RNJ A;  1V4R A;  3A01 B;  3FWE A;  4QWQ A;  3JRB A;  2ZKZ A;  2DYS H;  5LD2 C;  5FLX K;  4DZP A;  3F51 A;  1J59 A;  3A4C A;  3QRF F;  2HQR A;  3HXL A;  2LYL A;  1JFS A;  1SEU A;  3CUO A;  4IF4 A;  4EM1 A;  3G1O A;  3KL4 A;  2MA3 A;  3R60 A;  5L3E A;  1VQ9 I;  1ZVV A;  1JKO C;  2KKO A;  4EAT A;  3V7S A;  1V5G A;  3R6S A;  4RB3 C;  2A07 F;  4GRI A;  2VC1 A;  2W24 A;  3SZG A;  3QPL A;  5HLH A;  1XGS A;  3CC7 I;  4PFO A;  2KRH A;  1HDP A;  3CEC A;  3RKY A;  3J7Y J;  4RAG A;  1G3Y A;  4Y7N J;  4I7H A;  2WA0 A;  3CP8 A;  2RKH A;  2FOK A;  2M7B A;  3K10 A;  3SQN A;  4XRM A;  2IS6 A;  1T33 A;  4MTD A;  2VLA A;  3BG9 A;  2IS2 A;  4G9Y A;  1ODD A;  2LNB A;  3V8J A;  5E3O A;  1R5G A;  3F6W A;  1VQ4 I;  3H9G A;  4LK1 F;  2QYO A;  3K1M A;  1MSE C;  2FNA A;  1U8R A;  5HVQ C;  1XGN A;  2BNN A;  1RZR A;  4UUV A;  2DT6 A;  1OKR A;  4V19 K;  4WF2 A;  5D4S A;  1LNW A;  3ELK A;  4WCG A;  2PXB A;  3JRE A;  2XSD C;  2P6T A;  1P2F A;  2RNG A;  4OOI A;  2FEZ A;  2K9M A;  2MH2 A;  2LY1 A;  1VQ7 I;  4Q4Z F;  2L4M A;  4R1H A;  3ZOB A;  2PMZ N;  3GBF A;  3DBH B;  3TBI A;  4ZH4 F;  1RIO H;  2JA6 J;  1XTA A;  2M30 A;  2DTZ A;  4UVC A;  2MC4 A;  3GUD A;  4XQF A;  3HEF A;  4D7M A;  5FB2 A;  4LJZ F;  4M72 A;  1ACI A;  3FF5 A;  4OMY A;  3I58 A;  2PQ8 A;  2DU9 A;  2UXX A;  1VFC A;  2DO7 A;  1GDT A;  1QZY A;  4DGW B;  3WTW C;  1IJW C;  4XOP A;  4OIQ F;  3K4C A;  3ZMZ A;  2P81 A;  2R7F A;  5EYR A;  2X9D A;  4HNV A;  5JFR A;  2ME0 A;  4KMF A;  2ZXH A;  1ZKG A;  3NEU A;  4PJN A;  1OR7 A;  1RR7 A;  2VKV A;  2QGU A;  2KL4 A;  2XAH A;  3L9F A;  1JTX A;  4M9X A;  4BQO A;  4D1Q A;  2F4M B;  1Z6T A;  3OIQ A;  1T39 A;  2EBI A;  1V55 H;  2ZXI A;  5DUI A;  3BPV A;  1D0Y A;  2V6E A;  1VQP I;  2FMY A;  1XMK A;  2EZH A;  3CUQ B;  4ESB A;  3S3N A;  3FMQ A;  5M5X J;  2XJ3 A;  4ETS A;  1ZR2 A;  2Z9O A;  2V3C C;  4BXX J;  2HGC A;  3DQV C;  2NNY A;  3FHZ A;  1YX5 A;  1TNS A;  4PU7 A;  4CGZ A;  1JT0 A;  2KPJ A;  2BHZ A;  2L7Z A;  1LDD A;  2E1M B;  1WJD A;  5DM6 F;  3I55 I;  1KZH A;  2GXG A;  3HC7 A;  2DI3 A;  2R7D A;  3BP8 A;  3NAU A;  3QQ6 A;  1LCC A;  1RPW A;  2HR3 A;  3S1M J;  3GTQ J;  2PLY A;  2M1B A;  4CYD A;  4XR6 A;  4O6J A;  2QLZ A;  2J7U A;  2IA2 A;  2L9S A;  2H1K A;  3GTL J;  4PGG A;  4A0X A;  1MH3 A;  3HHH A;  2BVM A;  2CMP A;  3BJO A;  3BQY A;  2L7F P;  2A6T A;  2PG4 A;  2UUZ A;  1KYZ A;  1W5S A;  4KIC A;  5K5O A;  2KDZ A;  2LYC A;  1QO0 D;  1D5Y A;  1TTY A;  3L7W A;  2HIN A;  4BS9 A;  3ZRG A;  1G4D A;  4HDU A;  1VQ8 I;  4U87 A;  1Q1V A;  4NUB A;  3SXY A;  3C18 A;  2HTS A;  3SFZ A;  3V42 A;  2LG4 A;  1FSH A;  2JVH A;  4ABZ A;  4KIB A;  4Y33 A;  1JE8 A;  1FIP A;  4EZI A;  2STW A;  1MBJ A;  5LRS A;  4L0Z B;  2O8X A;  4ER0 A;  2K9Q A;  2TCT A;  3CCU I;  3RDI A;  2D1H A;  3CCV I;  2VAS A;  4EQQ A;  2WUS R;  1ORK A;  4R8H A;  2HQA A;  5CVJ A;  4YEJ A;  4CZZ A;  2B7E A;  2QBY B;  3IVP A;  4BAY A;  3FXM A;  2HXI A;  3A0H C;  3A9X A;  1LMB 3;  1B4A A;  4A3D J;  2BVL A;  4EJO A;  1UMQ A;  1TZL A;  3IH3 A;  2GXB A;  1IRX A;  2NS0 A;  2V1X A;  3K70 C;  2M8G X;  3RIR A;  2JRT A;  1MDM B;  1BI3 A;  4B44 A;  2VC0 A;  2CQX A;  3I4P A;  1Y9Q A;  3EYY A;  4A3I J;  3AKZ A;  2GRM A;  2HCN A;  2EH3 A;  4Z5H A;  3HIF A;  2QEX I;  4X0G A;  1B9N A;  1N25 A;  2Q1Z B;  4QPQ A;  5ICC A;  5CQE A;  1MJ9 A;  3TKY A;  1XCV A;  3I4N J;  1NK2 P;  1KQ0 A;  4A3B J;  2MH9 A;  2XAJ A;  3WTX C;  1FBS A;  2A3S A;  2IVQ A;  1ZAO A;  3S2H J;  2OPT A;  2KPM A;  4LMY A;  5FKO A;  1B72 B;  2PXD A;  4DYQ A;  3FXR A;  4E70 A;  3M1C A;  2LNM A;  1OLT A;  2ZFW A;  4K2E A;  5F1R A;  2ESH A;  4EM0 B;  5D5W B;  2DW4 A;  4II3 A;  4XL9 A;  5FRO A;  4EEF G;  1UTX A;  1P7I A;  4FE7 A;  5B5E C;  2W57 A;  1QA6 A;  3D5S C;  4QSH A;  2TRT A;  3QF3 A;  2RVC A;  3E6C C;  3CCY A;  1LJ9 A;  5KNL A;  4L5E A;  1VQK I;  3EUK L;  4Z59 A;  4PUS A;  1U9O A;  4N4N B;  3TL4 X;  5E3L A;  3G1L A;  5DDG A;  3U1K A;  3MZY A;  3CC4 I;  3FK7 A;  1B8I A;  5EZH A;  1YX3 A;  4IRG A;  3MFK A;  1Y7Y A;  1VI0 A;  3ZMU A;  2NYX A;  3EUH A;  1POU A;  3ZQC A;  2VOD A;  5DD8 A;  1OQY A;  5DTQ A;  1OCO H;  2KDO A;  2KZ8 A;  1RNL A;  1R22 A;  3HM5 A;  5B3S H;  4EJU A;  5DSX A;  3K4K A;  3GO5 A;  3T8T A;  2P7V B;  3SZT A;  4PSX A;  3JCU C;  3ERE D;  5D6F A;  1DWK A;  2EIJ H;  3LWF A;  2ZME B;  3HGY A;  4IRI A;  2XAQ A;  1SD4 A;  1XPX A;  3GX4 X;  3LSR A;  4YEL A;  2LLV A;  2HKO A;  2E1M C;  2QF7 A;  3ZN0 A;  3G4S I;  3ESW B;  2XXP A;  3MEJ A;  1QP7 A;  3CP2 A;  2VKH A;  3E6D A;  2X0L A;  1VZ0 A;  1YG2 A;  3K4N A;  4I0A A;  4B47 A;  3E5Q A;  1T2K A;  2BEO A;  1Y1V J;  1UHM A;  4U0W A;  5LHG A;  3OYN A;  3H5N A;  2RC4 A;  4A3K J;  1DP7 P;  2DA2 A;  1TT5 B;  4UVA A;  2VEO A;  2GA1 A;  4YRV A;  5TGT A;  1FP1 D;  3GFM A;  3I5U A;  4XRS G;  5J4V A;  2Q2E A;  4AUX A;  1MMS A;  1T56 A;  3KYC B;  2JSP A;  3WTT C;  2HPI A;  4DYC A;  2XV4 S;  1SD7 A;  4YG7 B;  5ED4 A;  3QOW A;  4BY7 J;  1XG1 A;  4PJM A;  3LA3 A;  2ZNY A;  4G7O F;  2ZSI B;  5E17 F;  2HKX A;  3VEP A;  2Z99 A;  3GTP J;  1SMY F;  1I3A A;  4EGY A;  1QPM A;  5TJJ A;  1W36 D;  2B0L A;  3KET A;  4F55 A;  2DLL A;  1O7F A;  3SR4 A;  4FN3 A;  3KZZ A;  3ECO A;  5C4X J;  4RAF A;  4D9J A;  1R00 A;  1R7J A;  3K2A A;  1BIA A;  2KJB A;  2LBF A;  3QOE A;  3TO7 A;  1FLI A;  2JCG A;  4Q2J A;  3CMM A;  4DBR A;  2DA4 A;  3S3O A;  3F22 A;  1BN5 A;  1I1S A;  4C2M J;  4MO7 A;  4G6D A;  2R0Q C;  1B0N A;  3P9K A;  4M6X A;  3J7A Y;  3ZHI A;  2AW6 A;  2LRD A;  3A9Y A;  1REP C;  1T98 A;  5FLM J;  1WFX A;  3CC2 I;  1EKE A;  3QYE A;  2PUE A;  3FBN B;  4JYK A;  2IVM A;  2AO9 A;  3A1Y A;  4E7I A;  1W0T A;  3OOP A;  3OR1 C;  2ELK A;  3OYD A;  1ON1 A;  1YOV B;  3F8F A;  3TP3 A;  1G8X A;  1OCC H;  4ESF A;  2LYK A;  3IRR A;  2MYS A;  2X1C A;  1QZZ A;  1SAN A;  1R4N B;  2F5V A;  2JJ7 A;  3J7Z I;  1ZZB A;  3FYM A;  2PXQ A;  2NS7 A;  3TP0 A;  3BY6 A;  3ONQ A;  2M4G A;  4I6R A;  3I9V 2;  1O3T A;  2L3D A;  3R0A A;  1RKT A;  3FXK A;  4XNF A;  1JGS A;  1MMN A;  4KIT B;  3GTO J;  1Z67 A;  2GBY A;  3DEE A;  2IU7 A;  4J1X A;  4BBR J;  1ZGJ A;  1L0O C;  2QZ8 A;  4OIR F;  2Y9Z A;  1E2X A;  1W1W E;  2R7Q A;  4UUT A;  1LDJ A;  2OTJ I;  3FKI J;  4YFK F;  2DA3 A;  4YIF A;  1DP3 A;  3QOX A;  3GZD C;  1TT0 A;  2DA1 A;  3OYF A;  4IO9 F;  1HLV A;  1AA7 A;  4HG2 A;  4P1W A;  4OIN F;  3L09 A;  1BDI A;  3H5T A;  2HQ5 A;  4UVB A;  3WGH A;  2OAZ A;  3WTZ A;  1S7E A;  2YR2 A;  2XXA A;  2UV1 A;  4X4C A;  2CSO A;  3DWL E;  4X4G A;  4KN7 X;  1P92 A;  4X4F A;  3HZI B;  4UHT A;  3CO7 C;  3DPU A;  2J5P A;  2LY9 A;  1SMT A;  4MEX F;  1OMI A;  3I0T A;  3C1D A;  2R7W A;  1EFA A;  2DMQ A;  1V3F A;  3N05 A;  4A6E A;  4IQJ A;  4L18 B;  1Z0X A;  2HI3 A;  1I50 J;  1GLN A;  2WAF A;  1QZX A;  4NB5 A;  4JX5 A;  1Z05 A;  4C30 A;  4XBF A;  1LQ1 A;  2ZNZ A;  1S7A A;  2GWR A;  2KMU A;  3DKY A;  4UUS A;  2VJI A;  2O61 A;  2P6S A;  2DMN A;  3Q9V A;  1EV7 A;  4BY1 J;  3NAR A;  3PQK A;  3JXD L;  3SHF A;  3D5L A;  1R5H A;  1WVR A;  2JUC A;  2QEN A;  4M3E A;  2DYR H;  3RKX A;  3OOU A;  2W82 A;  3M9A A;  3PQJ A;  3F52 A;  3QWG A;  1YYV A;  1CF7 A;  4ENN A;  3QOP A;  2JA7 J;  2K85 A;  4MIM A;  2LP0 A;  1PJR A;  4YAR A;  3IH4 A;  1BDH A;  1TC3 C;  4YII A;  4I6Z A;  1ZK8 A;  2LCV A;  1SVO A;  2ZME C;  2QSF X;  1R4M B;  3P7N A;  5BQT A;  2I5U A;  4IX7 A;  3HPG A;  1MJB A;  1NG7 A;  4D5F A;  5DT2 A;  2EIN H;  3BCB A;  4BQA A;  4J00 A;  1FYK A;  2HVR A;  3I59 B;  2KIQ A;  3VDX A;  4F3Q A;  1PRU A;  1LVA A;  2KLO A;  2VQL A;  3E0J B;  1SD5 A;  2LVS A;  2FE3 A;  3O6B B;  3DKW A;  4XKV A;  1WRJ A;  1K83 J;  2MG4 A;  3G5G A;  2K4J A;  5K7F A;  1KU7 A;  4D7N A;  2B5A A;  3HL2 A;  2IV1 A;  1R9T J;  3JRH A;  3L00 A;  2IGN A;  2VE9 A;  2W1O A;  3KYL A;  3CF2 A;  5H20 A;  4BJ6 C;  1Y39 A;  3ZKC A;  4Z5D A;  2QVO A;  3CCQ I;  3G2B A;  2KZG A;  2P5K A;  1QB2 A;  2PXL A;  1WQ2 A;  2QWW A;  2B63 J;  3H1C A;  1U2W A;  1D1B A;  3GZC A;  2E1C A;  1IZ1 A;  1FC3 A;  2M7A A;  1XGO A;  1H0M A;  2RGV A;  3H3Z A;  1IN8 A;  2CW8 A;  2DTR A;  2MFZ A;  3DTK A;  1SVL A;  2KHM A;  4JX6 A;  5ICF A;  2VE8 A;  4G7Z F;  2BYV E;  1X2L A;  2BZT A;  5FD6 A;  2EV0 A;  4HV6 A;  2ESN A;  3DU6 A;  3RPU D;  3SJM A;  2NVY J;  1Z21 A;  3BD1 A;  4IA8 A;  2XAG A;  1FT9 A;  3FZV A;  4L9N A;  1TWA J;  1IRG A;  2E36 A;  4C3J J;  3PSI A;  2PXE A;  4UV8 A;  1G2H A;  3UWP A;  3S8Q A;  2BY2 A;  2AXL A;  4FQG A;  2H1L A;  5IOY A;  3KEO A;  1W5T A;  1EH6 A;  2DOA A;  2XVC A;  1JUS A;  1F1Z A;  1FSE A;  5F64 A;  2CWE A;  3L2C A;  2HDD A;  2UWM A;  2Z3Y A;  1MMG A;  2XPW A;  3HTU A;  3LSG A;  2XC7 A;  3S15 J;  2XGX A;  1TWF J;  3OIO A;  2OF7 A;  1J2X A;  4S05 A;  2BHY A;  2E7X A;  3HZJ A;  3B6A A;  3DU5 A;  5ICE A;  1FTT A;  2ECB A;  4XLN F;  5F0C A;  1DDN A;  5LEK A;  4IHS A;  2LFB A;  4RAY A;  5CPR B;  3VYS B;  3DNV B;  4I76 A;  2XRN A;  2M4K A;  3HBL A;  4MEY F;  3GN5 A;  2R1J L;  4BXF A;  4P5O A;  4Q47 A;  2HZD A;  3BR1 A;  1YIJ I;  3TO6 A;  4HYE A;  1L3L A;  1QP4 A;  2DXI A;  1K4S A;  2L2O A;  3JRC A;  3BG5 A;  2Y31 A;  3RYR A;  2I8D A;  4M71 A;  2GIV A;  1LQC A;  4PDK A;  5J1Y A;  3REO A;  3FXJ A;  2NAZ A;  1X2M A;  1T0F C;  2W85 A;  3MWM A;  2FQ3 A;  2LMD A;  2JMW A;  1WKM A;  5KAI C;  1JXS A;  5HNH A;  2R3S A;  4KDP A;  5DCM A;  3DM5 A;  1J0R A;  1FX7 A;  4HLX A;  4QTR A;  1J7K A;  4CHU A;  2AXZ A;  4A0Y A;  5D6E A;  1GVD A;  4BEH B;  3HDD A;  5K1Y A;  3PSF A;  1RIO A;  2CFX A;  1AHD P;  2DDB A;  2RQP A;  3GLL A;  5FGM A;  3VOD A;  1PYV A;  5CVU A;  2VQG A;  3PO2 J;  4MFD A;  3K4L A;  4M9S A;  3HG9 A;  2PUB A;  2DK5 A;  2H94 A;  3M8J A;  3KLN A;  1AKH A;  4AD9 A;  3GVA A;  3CQZ J;  3JAM K;  2DQR A;  5E8I A;  4FAS D;  3GF2 A;  3RQI A;  1KU3 A;  3RTR A;  1EH8 A;  2DBB A;  4H4K C;  1IUF A;  3FYA A;  2F6C A;  3BWG A;  2BBY A;  2EFP A;  2EZK A;  1ETX A;  2P0W A;  2XI8 A;  2FBI A;  2CRO A;  3T8R A;  3IKV A;  5D5X B;  2X6W A;  3E6B A;  1FZP B;  5JVT A;  3CLQ A;  2DAO A;  2LF7 A;  3J80 Z;  4H0E A;  1X2N A;  3R4K A;  1XWR A;  5DRY A;  2HYF A;  1O3Q A;  2LOO A;  3GZN B;  2O8K A;  2OFY A;  5HS8 A;  2WWY A;  2HOA A;  4FET A;  1YW9 A;  4Y3O A;  3S8P A;  3D1N I;  3GTJ J;  1X57 A;  4BJ5 C;  4MHG A;  4CCJ A;  3A01 A;  2MD5 A;  4GYI A;  2W7N A;  3VWS A;  2O0Y A;  5HLG A;  2EIK H;  3NRV A;  3CES A;  3ASO H;  5EZG A;  3WG7 H;  3ZCO A;  1BC8 C;  3WE2 A;  1JJ6 C;  3JRD A;  4IHT A;  2PUC A;  4J1W A;  1YI2 I;  5JVG F;  3BTC A;  1O7L A;  4MNU A;  5A7L A;  4EJV A;  3HRM A;  2MBF A;  2BY3 A;  3FK6 A;  5M3M J;  2QM3 A;  2PX9 A;  1UCR A;  4MQ9 F;  3KFW X;  4HX7 A;  1PUF A;  3R61 A;  3J81 Z;  1EF4 A;  1T08 B;  4S04 A;  5DV5 A;  2WAE A;  1QP0 A;  3F21 A;  3BJ6 A;  4IL6 C;  5L3G A;  4ZYH A;  4A93 J;  2KEI A;  1B1B A;  1Y56 A;  1J5Y A;  1W0U A;  1Y0N A;  3LQR A;  4CYC B;  1JTY A;  2KZV A;  3F6O A;  5GAH i;  3CDI A;  2DOF A;  1MBE A;  1QVT A;  3H5A A;  2LKX A;  1ZAY A;  1W7P B;  4BE1 A;  3MZ8 A;  1YRN B;  3LA2 A;  4CCO A;  3A0B C;  4PU8 A;  1UG0 A;  2IVB A;  4F92 B;  3AL0 C;  2VPR A;  1QU3 A;  1IRZ A;  2XGE A;  2M8E A;  3I53 A;  2M0C A;  2Y9Y A;  3M07 A;  2HOS A;  1X3U A;  3EUA A;  3ABU A;  1GUU A;  2A05 A;  1S3J A;  4RGR A;  2CGP A;  2PJR A;  3GZ5 A;  4Y15 A;  2DN0 A;  5FFZ A;  1NW3 A;  1H88 C;  2DFF A;  2XF5 A;  2IJL A;  2ECC A;  4A3L J;  4PFP A;  1RUN A;  2ZCW A;  2FBK A;  5FLX Z;  4EJW A;  4F8D A;  1WCM J;  4A3M J;  3NZL A;  2FOW A;  2L5Q A;  4L9J A;  2QQA A;  4ZJZ A;  4LLN A;  3ZGK A;  1XS9 A;  2K4B A;  2E1N A;  3R1F A;  1P6R A;  1JKQ C;  2NXN B;  2VUM J;  2LTP A;  4XSX F;  3DF8 A;  2IP2 A;  2L4A A;  2XRL A;  4QPO A;  1HKQ A;  1STZ A;  1TBX A;  2Y30 A;  4U7B A;  4OWR B;  3VFZ A;  3VSK A;  1R23 A;  3V7C A;  1XX5 A;  4Y13 A;  2BW3 B;  3G3Z A;  2P5L C;  2V1U A;  2BNO A;  3BR0 A;  3WTU C;  1DUX C;  3LSJ A;  5HOO A;  2MD0 A;  1SFX A;  2R4G A;  3O2P E;  1LVK A;  1X19 A;  1JGG A;  3ZMT A;  3OKZ A;  4B4C A;  4NQW B;  5LGN A;  3JSP A;  2TDX A;  2VQC A;  2ZJR F;  1RUO A;  4LB5 A;  2XIG A;  4I02 A;  1T38 A;  1P4W A;  3QPH A;  1MMD A;  2DMT A;  4A5M A;  5EEA A;  1PNR A;  1QQB A;  3S1R J;  2CQ7 A;  1YTY A;  3CUQ A;  1J09 A;  2VJ5 A;  4GYG A;  2PBI A;  2HYJ A;  1MND A;  1OCZ H;  2DPU A;  3CLO A;  4HDV A;  2R7R A;  1HBX G;  4EQZ A;  1LUJ B;  4A69 C;  2Z33 A;  2Z1D A;  3WOD F;  1ZGA A;  2HS5 A;  3CF5 F;  1ITY A;  2PXV A;  2PE5 A;  1VQL I;  4GGG A;  2X1D A;  1U9N A;  3K7A J;  4GO1 A;  4XN0 A;  1ONV A;  4BH9 A;  3GFL A;  1ZEL A;  2ZBK A;  1MMA A;  1Z6R A;  5K7Z A;  1FOW A;  1I3Q J;  3ZQG A;  2J7W A;  2PXU A;  4PGH A;  5DEQ A;  4BJT A;  3Q5F A;  1XSX A;  2E5Z A;  1MFQ C;  1X58 A;  2VXD A;  3E97 A;  1K78 B;  5F1J A;  2BV6 A;  3LL7 A;  5CVI A;  2M5W A;  1U5T A;  4HW0 A;  2GM4 A;  2EPF A;  5FD5 A;  1RC9 A;  4UB6 C;  3OS1 A;  4AM3 A;  1LDK B;  2EWN A;  5CJ9 A;  1TWH J;  2F4O B;  2PN6 A;  4QLC U;  2OA4 A;  1Y8Q B;  3AFH A;  2QKL B;  1UAA A;  1TW3 A;  2CV2 A;  3ECH A;  3M8E A;  4KNY A;  2AQE A;  4ER5 A;  3FX3 A;  4LLG F;  5FLV A;  2IUO A;  2ZJ2 A;  3T5X A;  1Z9C A;  1ZG5 A;  4PJ0 C;  1XDU A;  2FJR A;  3OYL A;  5FKN A;  3BTL A;  2OR1 L;  2XPU A;  4X4H A;  3LNQ A;  4NC6 A;  2HDC A;  3OV8 A;  4Y17 A;  4XKB A;  2D5V A;  2KIS A;  1G59 A;  1UB9 A;  2DPD A;  3QU6 A;  2G0E A;  4N4O B;  5J3L A;  2MXD A;  2EFW A;  2EK5 A;  5EG0 B;  5BOX A;  4I2O A;  2HSG A;  4FE4 A;  3QAH A;  2VN2 A;  3M7G A;  4G7H F;  2PXK A;  5CLS A;  1IN7 A;  4I8T A;  3SCF A;  3KP2 A;  3KP3 A;  4BQQ A;  2M34 A;  1IG7 A;  2KEJ A;  3NXH A;  4WXC A;  5JR3 A;  3PIP F;  3HUG A;  1UXC A;  4HRA A;  2P7C B;  1IN4 A;  3SDB A;  1OCT C;  2EZL A;  1NER A;  2O6G E;  1K6O A;  4JK1 X;  1OCP A;  3M4O J;  2ODR D;  4X4E A;  1BJZ A;  2XSJ C;  3B02 A;  3HOY J;  3TOB A;  2KEK A;  3Q9S A;  2FD5 A;  3B6C A;  1TWC J;  2L1P A;  1WGX A;  3W3C A;  3JXC L;  2LY2 A;  2YU3 A;  3EET A;  2EA4 A;  2A5Y B;  1JFT A;  3PJR A;  3O3K A;  4ENJ A;  3FXQ A;  2STT A;  1G3T A;  2WBM A;  4ENK A;  1YLF A;  2IGO A;  3ZR8 X;  3KX2 A;  3A03 A;  2BE5 F;  2MAB A;  4XKC A;  4CSW A;  1DW9 A;  4NDW A;  1SFO J;  4DNC A;  5E1X A;  3K4M A;  4M3G A;  5LHI A;  3ZQL A;  1VND A;  4EV0 A;  3MQ0 A;  5DS9 A;  1BW6 A;  5D5V B;  5CVR A;  2G7U A;  2IGM A;  3GZ6 A;  3BG3 A;  1VQN I;  3IC7 A;  2JZY A;  4EGZ A;  1C0W A;  2OZ6 A;  3I71 A;  1OYI A;  1FNN A;  2DCE A;  1YS7 A;  3WG9 A;  3HRU A;  1XD7 A;  1H9G A;  4HQM A;  9ANT A;  1RZ4 A;  2Y69 H;  4HV5 A;  5AIP A;  1WPK A;  4ZDO A;  4L9V A;  1MBK A;  1VTN C;  3TQN A;  1TQM A;  2FNP A;  2V1D A;  1QQI A;  3K69 A;  2Y0S A;  3KCC A;  2UZK A;  2PUA A;  1SVM A;  4CCL A;  4LOC A;  1S29 A;  2CW7 A;  1D3Y A;  4EKI A;  5BS6 A;  2OQR A;  1FOY A;  3OYB A;  4KN4 X;  1J9I A;  1HA8 A;  3HJE A;  1NHA A;  3TDZ C;  4IVN A;  3H3U A;  3A02 A;  1DUL A;  3TW7 A;  5EGO B;  2D1V A;  5DCF A;  4ZTJ A;  2HOT A;  4J19 A;  3HKZ A;  2V26 A;  4RA2 A;  3IWF A;  4KFC A;  4M3D A;  1HQ1 A;  4XMY A;  4LD5 A;  4Q5S F;  4ER7 A;  1OIS A;  4A0Z A;  4HOB A;  2J5O A;  1BIB A;  4OU0 A;  4XLE A;  3Q0V A;  3BZK A;  2ME6 A;  5K5Q A;  4WXD A;  1A36 A;  1FIA A;  1IGN A;  3HOW J;  2R7T A;  5F04 A;  2LYJ A;  3V7R A;  3ZP5 A;  1HSJ A;  1S8N A;  1V5F A;  2WV1 A;  2YPR A;  1ZPQ A;  2KRC A;  2WIU B;  4C9Y A; 
#chains in the Genus database with same CATH homology
 2NVX J;  1ETO A;  2K9N A;  5EG0 A;  4IHX A;  2L7M P;  2ZB9 A;  2H8R A;  2BNM A;  3G1M A;  4CYC A;  2JA7 J;  2LYR A;  1WI3 A;  1L1M A;  3BR3 A;  3HGG A;  2LP0 A;  2XGC A;  4MIM A;  5FJ8 J;  4YAR A;  2FJ1 A;  3IH4 A;  1TC3 C;  5IYB J;  4I6Z A;  2E19 A;  5HOD A;  1ZK8 A;  2LCV A;  5BNG A;  4FTH A;  1PRA A;  3OQO A;  3FIW A;  1SQ8 A;  3MVP A;  5JLW A;  2LD5 A;  1IV6 A;  1YRN A;  4D5F A;  3UKG A;  1LCD A;  2XGD A;  1PRU A;  3ZQI A;  3TED A;  1ZZ6 A;  5IOZ A;  1Y1W J;  3RZO J;  4FBI A;  2LVS A;  1F36 A;  2AHQ A;  1OFC X;  2DA6 A;  1FTZ A;  2NOG A;  1K83 J;  2MG4 A;  3BR6 A;  3G5G A;  5K7F A;  1ETV A;  1RZS A;  3F0C A;  2FX0 A;  1VPW A;  4D7N A;  2B5A A;  2IV1 A;  2CUF A;  3S2D J;  2WAQ N;  4M3B A;  3JRH A;  1R9T J;  5FKK A;  1B8I B;  3O9X A;  4A3J J;  4A3F J;  5J1R A;  2R92 J;  1YSE A;  2XCJ A;  3ZKC A;  2MGQ A;  3IV5 A;  3SCH A;  1WH8 A;  1WH5 A;  4Z5D A;  2O7O A;  4JQD A;  5E3N A;  4JX4 A;  4MLO A;  4A3G J;  1JWL A;  1MBF A;  2O49 A;  2B63 J;  2QCO A;  4GHJ A;  3PXP A;  1BW5 A;  3IH2 A;  3A01 B;  3JRB A;  1BA5 A;  4JX6 A;  2N8G A;  4DZP A;  3OSG A;  1X2L A;  3F51 A;  3GTK J;  1O4X A;  2CSF A;  2LYL A;  3VK0 A;  4DZJ A;  1JFS A;  3Q0U A;  3G1O A;  5M3F J;  3KZ3 A;  3SJM A;  1JKP C;  3HOZ J;  3G7D A;  3RZD J;  1ZVV A;  1JKO C;  2NVY J;  3RKQ A;  3BD1 A;  2CQQ A;  4IA8 A;  4YBA A;  4X6A J;  4JP0 A;  1ZZ8 A;  1TWA J;  5FKM A;  4XID A;  4C3J J;  1G2H A;  3S8Q A;  3QPL A;  1B72 A;  2HXO A;  5IOY A;  5FKL A;  5E3M A;  1HDP A;  3CEC A;  3ZQH A;  1JUS A;  4Y7N J;  2AUW A;  2E1O A;  5IP6 A;  3U3W A;  2HDD A;  4XRM A;  1LFU P;  2XPW A;  1T33 A;  3BG9 A;  3LSG A;  3S15 J;  4I6U A;  1TWF J;  3OIO A;  2OF7 A;  2NVQ J;  5IP9 J;  3B6A A;  5E3O A;  1FTT A;  5EGO A;  2ECB A;  3F6W A;  5F0C A;  2GLO A;  2LFB A;  3LOC A;  1U78 A;  1MSE C;  1MNM C;  3VPR A;  4MCX A;  3DNV B;  1XC5 A;  4JCX A;  1RZR A;  4I76 A;  2BNN A;  3HBL A;  2R1J L;  3GN5 A;  3LSP A;  3BTI A;  1LFB A;  3SDG A;  2CRG A;  3BR1 A;  1QP4 A;  3JRE A;  2XSD C;  1ZQ3 P;  3JRC A;  4IVZ A;  3BG5 A;  2Y31 A;  2O9L A;  4Y42 A;  4FCY A;  3S16 J;  3O8G A;  3QQA A;  1LQC A;  2K40 A;  5J1Y A;  3ZOB A;  2PMZ N;  5J1U A;  1X2M A;  3GBF A;  2XB0 X;  2JMW A;  3BTJ A;  2BJC A;  1QQA A;  4B1R A;  1ETY A;  2JA6 J;  2DTZ A;  1MBH A;  4GQM A;  4QTR A;  3HEF A;  2AXZ A;  4D7M A;  1GVD A;  3HDD A;  1QPI A;  1RIO A;  1AHD P;  4X1E A;  4C3H J;  3PO2 J;  4OB4 A;  4MFD A;  1VFC A;  1GDT A;  3BR2 A;  2R5Z B;  2PUB A;  1IJW C;  5F08 A;  1AKH A;  1ETQ A;  3CQZ J;  2P81 A;  5EYR A;  1ZGW A;  3BDN A;  2X9D A;  1A6I A;  4HNV A;  3RQI A;  3UFD A;  1IUF A;  2MEZ A;  2ME0 A;  3FYA A;  2IEK A;  1ZKG A;  2DMU A;  3O8H A;  4AC0 A;  1RR7 A;  2VKV A;  2EZK A;  5GP9 A;  1JTX A;  1ETX A;  2XI8 A;  3GTG J;  2PUD A;  2EBI A;  2CRO A;  1WH6 A;  2NVT J;  3RZZ A;  2EZH A;  4Z5C A;  3JRF A;  1X2N A;  5M5X J;  1XWR A;  2XJ3 A;  1ETW A;  1ZR2 A;  2JK3 A;  3ZQF A;  2FQ4 A;  2O8K A;  2OFY A;  4BXX J;  3GTM J;  2HOA A;  3D1N I;  3HB9 A;  3JRI A;  3GTJ J;  4XIC A;  3W6V A;  3A01 A;  1JT0 A;  1LE8 A;  1X57 A;  2KPJ A;  4PU7 A;  2L7Z A;  3JRG A;  1UG2 A;  4YG4 A;  1CJG A;  5GPA A;  5EZG A;  1ZZC A;  2JN6 A;  4W1U A;  1JJ6 C;  3JRD A;  4FIS A;  4C3I J;  3NAU A;  3QQ6 A;  2PUC A;  1LCC A;  2I10 A;  1RPW A;  2Y0S N;  3MN2 A;  3S1M J;  4J1W A;  3GTQ J;  3BTC A;  4I6T A;  5A7L A;  3WHB A;  2AXU A;  4O8B A;  3FK6 A;  1MH4 A;  5M3M J;  3GTL J;  1PUF A;  2H1K A;  2L8N A;  1MH3 A;  2XIU A;  3DEW A;  2YUS A;  4GFB A;  1EF4 A;  3BQY A;  2VI6 A;  2L7F P;  1MSF C;  1QP0 A;  4IWR A;  1GT0 C;  2KDZ A;  3WHC A;  1D5Y A;  4A93 J;  2KEI A;  1A5J A;  1QPZ A;  1W0U A;  4CYC B;  2HIN A;  3HKZ N;  1JTY A;  5F0H A;  2JA5 J;  4PU3 C;  1ZUG A;  4QIW N;  2IBD A;  2MSY A;  1MBE A;  3EUS A;  1QVT A;  1Q1V A;  2LKX A;  5C44 J;  1ZAY A;  1YRN B;  1F43 A;  4ABZ A;  2PUF A;  4PU8 A;  3ZHM A;  2IVB A;  1FIP A;  1MBJ A;  2VPR A;  1IRZ A;  4S0H B;  2K9Q A;  2XGE A;  2M9H A;  2O38 A;  1HDD C;  2M0C A;  2Y9Y A;  2TCT A;  2HOS A;  1RET A;  3OQN A;  2A6C A;  2WUS R;  1NTC A;  1ORK A;  1WET A;  5C4J J;  1GUU A;  2R63 A;  3PO3 J;  3IVP A;  2DN0 A;  2HXI A;  5JLX A;  5M5W J;  1H88 C;  4Y52 J;  3OSF A;  2GZU A;  1JT6 A;  2ECC A;  1VF9 A;  4A3L J;  1LMB 3;  4NDL A;  4M3F A;  4A3D J;  1ZS4 A;  1UMQ A;  1U8B A;  2YU9 J;  4F8D A;  1WCM J;  4A3M J;  3IH3 A;  1ZZ9 A;  4XK4 A;  2LLK A;  5IYD J;  2M8G X;  5DTD A;  1ZR4 A;  1XS9 A;  4V2G A;  3TW6 A;  4M6V A;  3LIS A;  1ADR A;  2CQX A;  1K61 A;  1Y9Q A;  3R1F A;  2R5Z A;  4A3I J;  1JKQ C;  1GV2 A;  3JR9 A;  1ETK A;  4V2F A;  2VUM J;  2GRM A;  2LTP A;  1JH9 A;  2EH3 A;  2RAE A;  4Z5H A;  2XRL A;  1FJL A;  2Y30 A;  1HF0 A;  1GV5 A;  3CDL A;  5K7H A;  2MW8 A;  3BR0 A;  2BNO A;  3LSJ A;  3JRA A;  3I4N J;  1JGG A;  1NK2 P;  3S1Q J;  1OJL A;  1MBG A;  4B4C A;  4IHY A;  4A3B J;  3I4M J;  1QRY A;  4X4D A;  4DW6 A;  1R69 A;  2IVQ A;  3LFP A;  3S2H J;  2OPT A;  3QYX A;  5FKO A;  2DMT A;  5EEA A;  1B72 B;  1PNR A;  1QQB A;  3S1R J;  3CRO L;  4IHW A;  4DYQ A;  2ID6 A;  3TRB A;  2HYJ A;  2Y2Z A;  3CLC A;  2E2J J;  4EEF G;  1UTX A;  1P7I A;  4A69 C;  4FE7 A;  5IP7 J;  3S14 J;  5F0F A;  1DU0 A;  1LLI A;  4QSH A;  3C2B A;  4X4B A;  2TRT A;  1H8A C;  2DA7 A;  3CCY A;  1ITY A;  4JCY A;  2PE5 A;  2COB A;  1U9N A;  3K7A J;  3JXB C;  4L5E A;  4Z59 A;  1HOM A;  1U9O A;  5E3L A;  2ICP A;  3G1L A;  1I6H J;  5K7Z A;  3FK7 A;  1B8I A;  1I3Q J;  5EZH A;  3ZQG A;  1Y7Y A;  2O4A A;  1VI0 A;  2KT0 A;  1POU A;  1X58 A;  2DJN A;  2EZI A;  3ZQC A;  5F1J A;  2KZ8 A;  1BDH A;  2GM4 A;  1IDY A;  3CMY A;  3HM5 A;  1TWH J;  2R93 J;  3L1P A;  4BBS J;  1NEQ A;  4W97 A;  1ZZ7 A;  1DWK A;  3HGY A;  2M2E A;  1IC8 A;  1RPE L;  5FLV A;  1PRV A;  3LSR A;  2IUO A;  1JJ8 C;  2QF7 A;  3HOV J;  4YG1 A;  1JUM A;  1QP7 A;  2IAI A;  2XPV A;  1UXD A;  2LR8 A;  2X6O A;  2FJR A;  2VKE A;  5FKN A;  3OP9 A;  4UUS B;  2R5Y B;  4MFE A;  3BTL A;  2PIJ A;  1Y1V J;  1AKH B;  2OR1 L;  2WB1 N;  2XPU A;  3H3V K;  4XRS A;  1DU6 A;  4A3C J;  4B3A A;  4X4H A;  3LNQ A;  3Q0W A;  4A3K J;  2CJJ A;  2DA2 A;  2D5V A;  2W48 A;  5F27 A;  3KXA A;  4XRS G;  1RZR D;  2G0E A;  5J3L A;  1T56 A;  4AUX A;  2LYQ A;  5EG0 B;  4G12 A;  2HSG A;  2LYP A;  4X4I A;  4FE4 A;  3FMY A;  4DYC A;  3OQM A;  2GRL A;  1TWG J;  2K9S A;  4I8T A;  1WIZ A;  4YG7 B;  2CUE A;  2EQR A;  4BY7 J;  5EF6 A;  3SCF A;  1XG1 A;  3HOU J;  3B7H A;  3OMT A;  2ID3 A;  2L0K A;  3KJX A;  2M34 A;  1IG7 A;  2KEJ A;  2E2I J;  3GTP J;  1QVU A;  1UXC A;  1RKW A;  2MQK A;  1UHS A;  2CU7 A;  4FN3 A;  1NER A;  1OCT C;  2EZL A;  5C4X J;  4D5C A;  1IDZ A;  1LE8 B;  1OCP A;  4A3E J;  3M4O J;  3K2A A;  2JCG A;  2YS9 A;  2DA4 A;  4X4E A;  1BJZ A;  2KEK A;  3HOY J;  3H0G J;  4C2M J;  3GBG A;  4MO7 A;  2FD5 A;  2R0Q C;  3B6C A;  1B0N A;  1Z77 A;  3ZHI A;  1TWC J;  2AW6 A;  1WGX A;  2JWT A;  2EF8 A;  4Z58 A;  5EDN A;  2LYS A;  1JKR C;  3JXC L;  5K98 B;  5FLM J;  2PUE A;  1JFT A;  4IEJ A;  1WH7 A;  4JYK A;  4AYB N;  2AO9 A;  1H89 C;  1W0T A;  1P7J A;  2ELK A;  2AXV A;  3TP3 A;  2EWT A;  1PUF B;  2LYK A;  2NS8 A;  3A03 A;  4PU4 C;  2DA5 A;  5IPA A;  3E7L A;  1CQT A;  1SAN A;  1DW9 A;  4NDW A;  1SFO J;  2WIU B;  2JJ7 A;  3FYM A;  1ZZB A;  2NS7 A;  4M3G A;  3TP0 A;  5GPC A;  4I6R A;  3ZQL A;  1VND A;  2JVL A;  1RKT A;  5DS9 A;  1BW6 A;  2IU7 A;  3MKL A;  3GTO J;  2GBY A;  5M5Y J;  4J1X A;  3BG3 A;  4BBR J;  1R63 A;  2E2H J;  2Y9Z A;  4UUT A;  2EBY A;  3SCG A;  3FKI J;  9ANT A;  2DA3 A;  2L9R A;  3QPS A;  3Q3S A;  3BS3 A;  1FEX A;  1WPK A;  4IHV A;  1MBK A;  1ZTR A;  2DA1 A;  1HLV A;  2PUA A;  4RDU A;  1POG A;  4LOC A;  5IYC J;  3BT9 A;  1BDI A;  1AU7 A;  2PPX A;  2HQ5 A;  3H5T A;  1S7E A;  3PM1 A;  4X4C A;  3SFI A;  2R7Z J;  4X4G A;  3BR5 A;  2XB5 A;  3M3Y J;  4X4F A;  3S17 J;  3HZI B;  3A02 A;  2X48 A;  2LY9 A;  3TW7 A;  5EGO B;  2HOT A;  1PER L;  1EFA A;  4J19 A;  3DCF A;  4RBO A;  3F52 A;  2DMP A;  2DMQ A;  3MLF A;  1RES A;  3FIS A;  1Z0X A;  5C3E J;  2HI3 A;  1I50 J;  2ICT A;  4M3D A;  2IVG A;  2L49 A;  4JX5 A;  1OSL A;  3GN5 B;  2PUG A;  2JA8 J;  3HOX J;  4UUS A;  2R5Y A;  2AWI A;  4MCT A;  3Q0V A;  2DMN A;  2ME6 A;  1JUP A;  4BY1 J;  2LK2 A;  1FIA A;  3NAR A;  1IGN A;  3HOW J;  3JXD L;  2LYJ A;  5F04 A;  3S1N J;  3BQZ A;  2WV1 A;  4M3E A;  4DYR A;  1APL C;  1ENH A;  3OOU A;  1HCR A;  4BKX A;  1E3O C;  1ZPQ A;  3QWG A;  1NK3 P;  1BL0 A;  3QF3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...