2D5VA

Crystal structure of hnf-6alpha dna-binding domain in complex with the ttr promoter
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
155
structure length
135
Chain Sequence
MEEINTKEVAQRITTELKRYSIPQAIFAQRVLCRSQGTLSDLLRNPKPWSKLKSGRETFRRMWKWLQEPEFQRMSALRLPRLVFTDVQRRTLHAIFKENKRPSKELQITISQQLGLELSTVSNFFMNARRRSLDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title DNA recognition mechanism of the ONECUT homeodomain of transcription factor HNF-6
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transcription/dna
molecule keywords 5'-D(*TP*CP*TP*AP*AP*GP*TP*CP*AP*AP*TP*AP*AP*T)-3'
total genus 45
structure length 135
sequence length 155
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2d5vA02
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2d5vA01
3I4NJ 3HEFA 5J1RA 3K7AJ 2R93J 3VPRA 2LK2A 3IH4A 3B6AA 3MKLA 3Q0VA 2IEKA 1SANA 1ZUGA 3K2AA 5E3OA 2NVQJ 1T33A 2HINA 1YRNA 1H88C 5DTDA 1ZR2A 2AHQA 1R63A 3SJMA 2CSFA 1U9NA 4X4FA 1ZTRA 5FLVA 1ETQA 4X4BA 2GM4A 5K98B 3JRFA 1TWFJ 4MLOA 5IP6A 1LE8B 4IEJA 3WHCA 2O4AA 1IDYA 1ZVVA 2L9RA 2CU7A 2DA7A 1TWGJ 4IHYA 3CQZJ 1IGNA 2XPWA 5K7ZA 2ICTA 1EF4A 5JLWA 4HNVA 3S16J 5F04A 2AUWA 1H8AC 4JQDA 5J3LA 3ZQHA 3OSGA 2XCJA 3FISA 2BNMA 1QVUA 3NAUA 2AXUA 5J1UA 2M8GX 2ICPA 4MCXA 3QQAA 3BQZA 1I3QJ 3M4OJ 4YG1A 4D7NA 2E19A 4J1WA 4X4EA 5IYCJ 1MH3A 3Q0UA 3JXCL 1BDIA 2O9LA 3F0CA 1ADRA 3HGYA 3OSFA 4XRSG 2MQKA 1ZQ3P 3MVPA 3LSJA 4A3MJ 3GN5A 2D5VA 1BDHA 1VFCA 3BG5A 4A3IJ 3R1FA 1ZK8A 4M3DA 1RR7A 2O38A 4B4CA 5EG0A 2KDZA 3W6VA 1APLC 3FK6A 2DA6A 3GTLJ 2ID3A 2LD5A 2JA5J 1RIOA 4S0HB 2R5YB 3FKIJ 1WH6A 2HQ5A 2KZ8A 4AUXA 4Y42A 4YBAA 1RZRA 2DA2A 3TP3A 1ENHA 2MW8A 4MFEA 2L7ZA 3IH2A 2XSDC 3D1NI 2PE5A 1UMQA 5GP9A 2JA8J 4D5FA 3GTQJ 4O8BA 3OMTA 5E3MA 4BBSJ 1IC8A 3BTLA 2YU9J 2OFYA 4XICA 1K83J 4B3AA 4L5EA 1B72B 4DYRA 1PNRA 4W97A 2CROA 1TC3C 4M3GA 1BA5A 2K9NA 4QTRA 1PUFB 1A6IA 4XRSA 1ZS4A 3A01B 4JCXA 2DA3A 4C2MJ 3BQYA 3JR9A 5A7LA 2WB1N 1ZKGA 4MO7A 4B1RA 4PU3C 2DA1A 3IH3A 3CMYA 1MNMC 1QP4A 5M5XJ 3A03A 5IYBJ 2HXIA 2M0CA 1XG1A 4AC0A 4QIWN 2LCVA 2K9QA 1WH8A 2XIUA 4FE4A 4Z5DA 5E3LA 3Q3SA 4D5CA 1ETVA 2H1KA 3BR3A 4DYCA 1NERA 2H8RA 1ETOA 3BTIA 1F36A 4I6RA 2HOSA 1JT6A 5EDNA 4EEFG 3S1QJ 4Z5HA 2R5ZA 1QP7A 2M2EA 2LKXA 3LSRA 2IUOA 3G7DA 3JRHA 1ETKA 1BL0A 2ME0A 2KPJA 2M34A 3BR2A 3S2DJ 3QQ6A 3SCGA 4Z59A 2JCGA 1VF9A 4Z58A 1LFUP 2WIUB 1LFBA 2JN6A 4XRMA 1JUMA 4QSHA 1OCPA 2EZKA 5K7HA 3GTKJ 4Y7NJ 2ELKA 3F6WA 2ID6A 4BY1J 2XB0X 4X4HA 3OP9A 5F08A 1JFSA 5EGOB 1Z77A 1JH9A 4JX5A 1QP0A 3BTCA 2PUDA 3ZQIA 4UUTA 1D5YA 2GBYA 3RKQA 3FMYA 2GRLA 1ZZ7A 3HGGA 3JRIA 2KT0A 2ME6A 1B8IA 3OQOA 3TRBA 4NDLA 5C3EJ 1FJLA 1JTXA 5EGOA 2OR1L 1ZAYA 5IP7J 5EZHA 2LYJA 2XRLA 3SFIA 2QF7A 2LYPA 2XPUA 3ZKCA 3CDLA 1ZZ9A 2X48A 1HLVA 2HDDA 3GTJJ 1JGGA 3GTOJ 2HOAA 2HYJA 2IV1A 2PUFA 4PU7A 1X57A 2DMTA 3SDGA 2NS7A 5M3MJ 2LTPA 4M3BA 3TP0A 3BR0A 2M9HA 3HOWJ 4A3EJ 1CQTA 1UXCA 2FX0A 2MEZA 4A3KJ 4X4IA 3KZ3A 2DMUA 1F43A 4IA8A 2DJNA 2OF7A 2VPRA 1DW9A 2GLOA 1L1MA 2LY9A 2E2JJ 2NVYJ 1JWLA 4I76A 3LSGA 4ABZA 1TWAJ 3RZOJ 1ZZ6A 2IVQA 2KEJA 2G0EA 3CLCA 3GBFA 1Y7YA 1ZZ8A 1WH5A 2LR8A 3DEWA 2XJ3A 1AKHB 3ZOBA 1HDPA 2IU7A 1RPEL 4NDWA 4A3GJ 4A3DJ 1QRYA 2WUSR 2TRTA 2LLKA 1OCTC 3G1LA 3ZQFA 2AW6A 2FJ1A 4FTHA 1PUFA 2JA6J 1MSEC 2LYRA 2NS8A 5JLXA 1PRUA 1HCRA 3PO2J 2VUMJ 2WV1A 3TW7A 1DWKA 2EBYA 2L7FP 3H0GJ 1FIPA 3HKZN 3QWGA 1U78A 2PUEA 4IWRA 4FISA 2DA4A 3M3YJ 1UG2A 2VKVA 2Y9YA 4FE7A 1B0NA 5E3NA 3GTGJ 1JUPA 1RKWA 1S7EA 4MCTA 1ETYA 1QQAA 2OPTA 3ZQCA 3S1MJ 1UTXA 1XWRA 1Q1VA 5GPCA 1IV6A 2KEKA 2EBIA 3HB9A 3LOCA 3B7HA 2R5YA 3S15J 9ANTA 3SCHA 1WGXA 5FKKA 4FN3A 1X2NA 3BG3A 1X58A 2PMZN 5C44J 2R0QC 1X2LA 1U9OA 2AXZA 5EG0B 3C2BA 1LMB3 3FK7A 4A3FJ 1RKTA 1RZRD 5FKNA 3S2HJ 5BNGA 4Z5CA 2CQXA 1AU7A 2LYQA 3GN5B 3O9XA 1R69A 4X1EA 1QPZA 4I6UA 3IV5A 2R63A 1RZSA 4BY7J 2DTZA 3QPLA 1ZZBA 2N8GA 4X4CA 2BJCA 4DYQA 1T56A 3JRCA 2L49A 1SQ8A 2BNNA 2EWTA 2COBA 3UFDA 3BDNA 4A3JJ 2E2HJ 2W48A 1RESA 5FKMA 1BW5A 4CYCB 3S1RJ 1GT0C 4RBOA 1ETXA 2DMPA 1I50J 1O4XA 2DMNA 3JXBC 1ETWA 1DU0A 2HXOA 3JRAA 5FKLA 4X4GA 1YSEA 4FBIA 3BTJA 1X2MA 3QPSA 3JRBA 1W0UA 3S1NJ 3BR6A 3HOXJ 3PO3J 1QPIA 2PUCA 2FJRA 5EYRA 2PUAA 2Y31A 3HBLA 1MBGA 5K7FA 4C3IJ 2PPXA 3QF3A 4IVZA 3O8HA 3FYAA 3BT9A 4M3EA 3QYXA 4GQMA 2XGCA 3JREA 1GDTA 1IJWC 4V2GA 3RQIA 5IPAA 4CYCA 3E7LA 1NTCA 4JCYA 5FJ8J 4F8DA 3I4MJ 1MBFA 1PRVA 1YRNB 4DZJA 1PRAA 1ZPQA 3LSPA 4OB4A 4J1XA 3LNQA 3OQNA 1JKOC 2EF8A 2CUFA 1P7IA 2B63J 2Y0SN 1WPKA 1LE8A 1MBEA 2ECCA 3Q0WA 4LOCA 1FIAA 2LP0A 1PERL 1TWCJ 1WI3A 3RZZA 1MBKA 1POUA 3NARA 4JX6A 5F1JA 2GRMA 4JYKA 2JJ7A 1UHSA 5FLMJ 1JKQC 3SCFA 3TEDA 3EUSA 1GUUA 4JX4A 1MBHA 1CJGA 4IHVA 2EQRA 2QCOA 3U3WA 1NK3P 3UKGA 3PM1A 3HM5A 4A3LJ 2HOTA 4Y52J 1JJ6C 2E2IJ 5HODA 3BG9A 2CQQA 3MLFA 1H89C 1FTZA 1NEQA 1ITYA 4C3HJ 4PU4C 3HOUJ 3O8GA 2CJJA 3G5GA 1VPWA 4M6VA 5F0CA 1U8BA 3ZQGA 2JA7J 3JXDL 3LISA 2R1JL 2GZUA 1ZZCA 2HI3A 4YG7B 1P7JA 1RETA 5DS9A 4V2FA 1OFCX 1TWHJ 5EZGA 3GBGA 3H5TA 1AKHA 1JFTA 3HDDA 1UXDA 1XS9A 1HDDC 1LQCA 3KXAA 1EFAA 4BKXA 5C4JJ 3HOVJ 1MH4A 2L0KA 4D7MA 2B5AA 5GPAA 4BXXJ 1FEXA 2I10A 1FTTA 2FD5A 1GV5A 5C4XJ 3IVPA 1LLIA 3A02A 4I8TA 1VI0A 1DU6A 1ZR4A 3F52A 5EF6A 1JKPC 2AWIA 1OSLA 3ZHMA 3BS3A 3KJXA 2IAIA 2CRGA 3CROL 5M5WJ 2NVXJ 2LYSA 3VK0A 4UUSA 1I6HJ 1LCDA 3WHBA 3OOUA 4A93J 1JUSA 4A69C 4A3CJ 4A3BJ 4AYBN 4G12A 5FKOA 4GFBA 3OQMA 4C3JJ 2JK3A 2XGDA 3B6CA 3G1MA 1K61A 2LVSA 3MN2A 1IRZA 2XI8A 1Y9QA 4GHJA 2TCTA 3DNVB 3F51A 2XB5A 2IVBA 1OJLA 4X4DA 3S8QA 4I6TA 2PIJA 5F0HA 4JP0A 2L7MP 1G2HA 1JJ8C 1BW6A 1ZGWA 3HZIB 2K9SA 1W0TA 3S17J 2XGEA 2E1OA 2PUBA 2DA5A 5IOYA 3JRDA 1POGA 4FCYA 1HF0A 5IP9J 1E3OC 2O8KA 3LFPA 1WETA 1WIZA 3GTMJ 2L8NA 2O49A 1ORKA 2Y30A 2YS9A 1WCMJ 3HOZJ 3CECA 1B8IB 2P81A 2EZHA 2X9DA 2MGQA 1WH7A 4XK4A 2CUEA 1MSFC 2WAQN 3ZQLA 2NOGA 3FYMA 2JMWA 3OIOA 4PU8A 3TW6A 1Y1VJ 2LYLA 3PXPA 1JTYA 2DMQA 2A6CA 4M3FA 2EZIA 1BJZA 1JT0A 3DCFA 3JRGA 2DN0A 5M3FJ 2YUSA 4UUSB 2O7OA 3L1PA 2ECBA 2ZB9A 2Y9ZA 1MBJA 2AXVA 2HSGA 4YG4A 1AHDP 2LFBA 4DZPA 5J1YA 2K40A 4MFDA 5EEAA 2MSYA 1Y1WJ 2NVTJ 1XC5A 2Y2ZA 2XPVA 1VNDA 2X6OA 3G1OA 3RZDJ 1NK2P 2R7ZJ 1IDZA 2R5ZB 2JWTA 1R9TJ 3S14J 2EZLA 1IG7A 1Z0XA 2BNOA 2IVGA 1B72A 4J19A 1GV2A 3GTPJ 5IYDJ 4X6AJ 2PUGA 1QVTA 4IHWA 1SFOJ 4IHXA 2KEIA 2AO9A 5M5YJ 2RAEA 1GVDA 5IOZA 3HOYJ 1A5JA 4BBRJ 3CCYA 5F27A 3A01A 2R92J 3BD1A 2MG4A 3FIWA 5F0FA 1IUFA 2EH3A 2IBDA 3BR5A 2VKEA 2FQ4A 4I6ZA 4YARA 1QQBA 1HOMA 3BR1A 4DW6A 4XIDA 1JKRC 3H3VK 3ZHIA 1RPWA 4RDUA 2JVLA 4W1UA 2VI6A 4MIMA 1LCCA 2LYKA
chains in the Genus database with same CATH superfamily
1GVJA 5B1BH 3A2KA 3I4NJ 1RRJA 2VJJA 1N25A 2LK2A 3IH4A 5HDGA 3MKLA 2VE9A 3FBNB 2ZKZA 3G73A 2VKHA 3WG7H 4LLGF 4L5JA 1LEBA 4FX0A 4EKGA 4Z6YA 1H88C 4FHTA 2AHQA 2FA5A 3MEXA 2BW3A 1R63A 4EGZA 1Z9CA 1DQUA 5FLVA 3WU0A 1V5FA 4A12A 2GM4A 4X4BA 5B66C 1O3SA 1XGMA 3FMRA 4XLCA 3G0TA 4F92B 1KU2A 1MIJA 1XD7A 2YR2A 3TDUC 2P7CB 3WHCA 2O4AA 2YU3A 1IDYA 3Q9VA 2BE5F 1P4XA 4IHYA 4CCJA 2CSOA 1OMIA 2PFBA 3I71A 3KYDB 1H8AC 3ZQHA 2F4OB 3BZCA 2BNMA 3EYIA 4CA0A 4IHTA 1I3QJ 2KJBA 1U5TA 5L3GA 3M4OJ 4HW0A 3TL4X 4HLXA 1S7OA 4CHUA 3HUGB 2AQFA 5D8LB 3HSEA 3KETA 3F0CA 1GXPA 3S8PA 1D8JA 1AWCA 5DUKA 4BJ6C 2W57A 2E5NA 4E7LA 4XRSG 1K6YA 3I58A 3BCAA 3CCEI 5D4RA 3LSJA 4HQEA 4A3MJ 1YJWI 4NUBA 5D6EA 3LSIA 2KRHA 4OINF 4KNYA 5EG0A 2KDZA 3W6VA 4L18B 2A07F 1APLC 3FK6A 2QYOA 3IWFA 4YIIA 2F2EA 1RIOA 1OR7C 1RI7A 2M0MA 4BDZA 4HV5A 4EJTA 1EH8A 2V26A 2KZ8A 2BGCA 1VQLI 1Y56A 1ENHA 2VC0A 3DFGA 2MW8A 4ENKA 3HTSB 2DT5A 2DPDA 1IN8A 5DCMA 3SR4A 3ABTA 3QODA 2JA8J 3GTQJ 4O8BA 3F23A 2VBYA 4NQWB 1IC8A 1BR1A 2YU9J 4IF4A 1VQ5I 2VBZA 3TEPA 5CKTA 3QP5A 2CROA 3L00A 3MQ0A 3S32A 4EQZA 2PXQA 4Z2YA 4M3GA 4GRIA 1KU3A 1TBXA 4QTRA 1J9IA 1A6IA 4ESJA 4JK1X 4NC6A 1ZS4A 3A01B 1YLFA 3K70D 1LFPA 1B9MA 2GAUA 3GZCA 5A7LA 1NH3A 2RNJA 2WAEA 4PU3C 3M9AA 1Y0NA 2MYSA 1MNMC 3RDIA 2VQCA 3L9FA 5IYBJ 2M0CA 4XN0A 1UG0A 3U2RA 5HLGA 5E3LA 2ISYA 1ETVA 3ZP5A 4E7ZA 4ZH4F 2VT3A 3OS2A 1YYVA 1F36A 3QU3A 5J6XA 3BDDA 1QNTA 2HOSA 2IA0A 5J4YA 4EEFG 4Z5HA 2K3PA 3TOBA 3HJEA 5K5RA 2CWEA 4PSWA 1S72I 3G7DA 3JRHA 3FMSA 2FXAA 2JSPA 2M34A 3QQ6A 2M4KA 4PFPA 2A3SA 4IKFA 3AG2H 4Z59A 4QSHA 1FY7A 1OCPA 2EZKA 3CC7I 3ABUA 5AONA 5ED4A 4BDYA 2ID6A 4RB0A 2BXYA 3RTRA 4X4HA 2BEOA 3GW2A 1EA3A 4A0YA 1ZG1A 1QP0A 4JX5A 3E6CC 5HS8A 3ZQIA 1J59A 3V7CA 1VQPI 3R60A 4KN7X 4N0BA 4ZTJA 3F8FA 3OR2C 4U0WA 2KT0A 1MMDA 3TRBA 1XCVA 4EM1A 1J5YA 3VWSA 4RGUA 3J80K 1IO2A 2IPQX 4BJ5C 2LNMA 5JR3A 2OR1L 5EZHA 1YHQI 2OZUA 3F21A 2VASA 2QF7A 5K5QA 1GHCA 2LYPA 3ZKCA 1MJAA 3KZIC 2X1EA 2HQAA 1HLVA 2HDDA 2Q0OA 4CCNA 2HYJA 2OCEA 3C7JA 3E6BA 3ZQQA 2PUFA 4BUPA 2NS7A 2LTPA 4B8XA 2L54A 3TP0A 3VSKA 2BV6A 2PEXA 2D45A 2MEZA 1L0OC 2O03A 3TGNA 1F43A 2PBIA 1L1MA 2F48A 2FBHA 3HOSA 2JQ7A 2VBWA 4M6YA 2FF4A 3RZOJ 2KEJA 5F6FA 3CMAI 4M6XA 1Y7YA 2Q2EA 3GO5A 3DLAA 4EM0B 3ZOBA 2DXIA 5CLSA 4P96A 4OAYA 2VONA 3MAJA 4NDWA 1QRYA 2QM3A 2TRTA 4HRIA 1OCTC 4ENJA 3KEOA 1BC7C 2YSRA 1PUFA 4L9NA 4DE9A 3HRUA 3OR1C 3MMYB 3TW7A 4ZDOA 2XXAA 2EFOA 4XN3A 1TW3A 1JHFA 2VKVA 3CD6I 3GUDA 4JBAA 3LWFA 3SZPA 3VYRB 3LFUA 3MFKA 4WXDA 2V6CA 5E3NA 3ZRGA 3VYUB 5A2QK 4MCTA 2X4HA 1QU3A 5KK1A 2OPTA 1U6GA 1ZG3A 1UTXA 2X6WA 1Z3XA 2BXZA 1B59A 4Y3OA 5GPCA 4LITA 4IOAF 3W2AA 2RN7A 3S15J 4BAYA 2XXPA 2LRDA 1FT9A 4BNCA 2K02A 1WGXA 1K78B 1X2NA 3BG3A 1X2LA 2PMZN 2PN6A 3CMMA 3FK7A 3R0JA 4KYWA 4PGHA 5FKNA 2L01A 2ZFUA 3GN5B 1G4DA 3QYBA 2R7WA 3PIPF 4HNUA 4I6UA 2R63A 2H27A 3WTVC 1RZSA 2J7UA 4X4CA 4DYQA 1T56A 1D8KA 3E3VA 1V55H 3OMYA 2E2HJ 4KIBA 4Y4RA 1VTNC 2V1UA 2ICWG 1GT0C 2ZNZA 1ETXA 4RBOA 1N75A 3DBRB 1FP1D 2DMNA 1ETWA 4R8HA 3RCOA 3T8TA 4XSXF 2QA4I 1DU0A 3JXBC 3MZYA 5D5VB 3W6JB 2H6CA 3GZ5A 4IL6C 3GX4X 3KEQA 4IQ4A 1W0UA 4PJLA 2OQRA 3BR6A 3ROUA 3RPQA 5EYRA 2Z3YA 2GA1A 2ZJ2A 4ENNA 2Z16A 3FYAA 1S8NA 2P6TA 1P92A 4RB2C 5LGTA 3RIRA 3ZXSA 3I4MJ 3JSOA 2PXFA 1PP8F 3F8MA 4BL0B 4OB4A 2GIZA 5AIPA 1USSA 1P7IA 2VBXA 1WPKA 2WC2A 2HQRA 2JPBA 1MBEA 2CFXA 5D5WB 4DQ2A 1FIAA 3NXHA 2MH9A 2NVUB 1QZYA 3CO6C 1MBKA 3NARA 4JX6A 2JJ7A 4GYIA 3R6SA 1XGNA 2QBYB 3DQVC 2JRTA 5FLMJ 1GUUA 4LG3A 1OCZH 1GXQA 1FNNA 2M8EA 2ZJPF 3O3KA 3PM1A 5ERIA 2QSHX 4WWCA 2OJED 1H89C 1MMGA 2DK5A 2M7BA 5FRNA 5J40A 4PU4C 2ADUA 3O8GA 2VJ5A 3DPUA 3G5GA 2XF7A 4M6VA 4U88A 1WVRA 4XM3A 3WTYC 3JXDL 2R1JL 4UXNA 3ASNH 1O7LA 4WCGA 2PLYA 2GZUA 4RGXA 1UCRA 4CGZA 3NZLA 1DPUA 1MZBA 3ERMA 3KFWX 4AM3A 1F5TA 1B1BA 1ZGAA 1JFTA 1VQKI 4PZJA 4HA8A 1HKTA 1E0EA 1XS9A 1IN6A 1LQCA 4KN4X 3GFMA 2ZJQF 3HOVJ 1MH4A 4LJZF 4JQFA 2D1HA 5ILVA 5DM7F 5DV5A 4GDFA 2HFZA 3RQ4A 4CICA 2K85A 4FX4A 5GPAA 3LMMA 4WF2A 4S05A 3IVPA 3GFIA 1LLIA 4KIFA 1JKPC 2AWIA 1OSLA 3BS3A 3IHUA 1KZHA 2CRGA 2NVXJ 1OCCH 1B4AA 1OCOH 2L3DA 2L9SA 2MD5A 1K79A 3WHBA 1HQCA 5GAEJ 5HLTA 4A93J 4A69C 4A3BJ 2QUFA 4ZDPA 5FKOA 4ZYHA 3N4MA 4GFBA 3UR3C 1KYZA 3G1MA 2XGDA 3B6CA 5H6QA 1XGOA 2XAQA 1IRZA 5KNLA 4C2TA 4GHJA 3DNVB 3WE2A 3CCVI 1HA8A 2IVBA 2P5VA 1U8RA 3RSNA 4I6TA 2PIJA 3IWZA 2LG4A 5CVUA 3KP6A 2EK5A 2BBYA 2L7MP 4HSTA 2PXLA 3VOEA 1BW6A 1USTA 1ZGWA 2DBBA 2K9SA 4V19K 1YJ9I 4U7DA 1R1UA 2PUBA 4H4KC 5ILUA 2DA5A 1HF0A 1E3OC 2O8KA 2VQGA 2WY7Q 2L8NA 2D1VA 3K4LA 2Y30A 2YS9A 2BY2A 3CESA 2JA2A 2EZHA 4RM3A 2ZMEC 2M45A 3J7YJ 4YFNF 4ANJA 2XAFA 2ZFWA 5ICCA 3V8KA 3WODF 2NOGA 4BE1A 4PU8A 3IC7A 3WTWC 3ULQB 2NXNB 1JTYA 4PJ0C 2R4GA 3VYSB 1SVOA 2YUSA 4UUSB 3FZVA 2AXVA 3SHFA 5FRMA 2HTSA 1LKXA 4DZPA 1R1VA 4MFDA 4DNCA 5KHDA 2CO5A 1ZN2A 3V4GA 4I2OA 2E7XA 5TGTA 3PSIA 3AG4H 2P8TA 3PNTA 2PJRA 1DPRA 1P4WA 2BHYA 1YO5C 1Z0XA 2XKOA 3AKZA 1W5SA 2RREA 5EJCA 1SFUA 3KYCB 2IVGA 1PYVA 1GV2A 4II2A 5IYDJ 5K5OA 4IX7A 3I53A 5FFZA 2EFNA 3VSLA 1W5TA 2YX7A 2AO9A 2VJ4A 2RAEA 2R7RA 1T39A 3N97A 2PXVA 3EUHA 1FBQA 1OPCA 2WY8Q 5F27A 4XKBA 5J8FA 1G3TA 3A01A 1LNWA 3FIWA 2P5KA 3H9GA 2KMUA 4YARA 2FQ4A 1X1BA 1HOMA 3BR1A 2LF7A 1D0ZA 2IVMA 2DLLA 4DW6A 2NOJB 2KLOA 4XBFA 4L9JA 2QBYA 4IRIA 4RDUA 5E20A 2JVLA 3QOPA 1J75A 2Y69H 2VEOA 2VI6A 2XGXA 2K9LA 2LYKA 3V42A 4NQWA 3LQXA 2DJIA 3HEFA 3RI4A 2QKMB 4E7JA 1D1AA 5KVRA 3E6DA 2IEKA 1W36D 2F5DA 5LGNA 5LRSA 4KISA 1ZUGA 2O61A 2HINA 1YRNA 1ZR2A 4BXFA 3SJMA 4BH9A 2V9PA 1Z6RA 2HGCA 1ZTRA 3PSFA 2CV0A 1ETQA 5K98B 3JRFA 4XLAA 4XLNF 2EIKH 3OYLA 3OYMA 1TWFJ 1YS7A 5IP6A 1LE8B 3TFLA 3HTUA 3BC8A 2C6YA 2DOAA 2ZSIB 2CU7A 2DA7A 2LREA 1LDDA 1W36C 4BE2A 3PFIA 3QFIA 3CQZJ 1IGNA 1X3UA 3HRMA 2ICTA 1DULA 3CCJI 2HCSA 1XTAA 2Y0MA 4HNVA 1G3SA 3CC4I 2P4WA 5GAHJ 4CO8A 3TELA 3S16J 1HQ1A 2DFEA 3SQNA 2QEXI 2AUWA 2H6BA 2HVQA 4CZZA 1J7KA 3P9IA 4EJUA 2AXUA 2I8DA 3DBLB 1X4PA 5LHGA 5J1UA 2UV1A 3SYTA 1D0YA 3KLNA 1MW7A 2OU2A 4D7NA 4J1WA 4PFOA 4X4EA 3K70C 2F4MB 2HKXA 1MH3A 2ZXHA 5IYCJ 2OCCH 3OY9A 1YI2I 1Z91A 3FXQA 1R00A 4XLFA 4LFUA 3D0SA 4PJNA 1FX7A 3D5RC 1ZLKA 3LQRA 2V9VA 4FETA 4HF0A 1ZK8A 1TQIA 2X6YA 2DDAA 2ACJA 2JA5J 4S0HB 2R5YB 3F8NA 2GOMA 4I02A 3F6VA 2HQ5A 3D5SC 4M9ZA 4EMSA 4YBAA 2IW5A 3ECHA 2ZSHB 4XLEA 4PJMA 3IH2A 5BPIA 3PUBA 2XSDC 2PE5A 2W85A 2M4HA 4D5FA 1SAXA 1QQIA 3OMTA 1Y0UA 3FMQA 4BBSJ 3BTLA 3A1YA 3FXLA 3E5QA 1OYIA 3LL7A 4YELA 4E4HA 1K83J 4XICA 3WGIA 4L5EA 4DYRA 1BI3A 4IHSA 1Y6IA 1VQ6I 4WXHA 3IKVA 3ERED 2IS4A 2O0YA 4NC7A 2DT7B 5FGMA 2EFPA 2DA3A 2F6CA 5D8KB 5HOOA 1KU7A 4EZIA 3BQYA 3JR9A 2V1NA 1VZ0A 1ZKGA 4B1RA 2DA1A 2FMLA 4I0AA 4B43A 3CMYA 3A03A 2HXIA 2LCVA 2K9QA 2DDBA 4FE4A 1IN7A 3Q3SA 1SFXA 5JVGF 2J5PA 1S29A 1EH6A 2MFZA 3BR3A 4DYCA 3L2CA 2H1KA 2YX4A 1SD7A 3BTIA 3U1DA 4KFCA 1JT6A 3S1QJ 2X1DA 2R3SA 4I99C 5JVTA 5KAFC 2AXTC 2MH2A 2QLZA 2QWWA 4KDPA 4E7KA 2JCGA 4ETSA 1LFBA 4XRMA 3ME5A 1JUMA 2VXDA 5K7HA 2Q2EB 1OR7A 4Y7NJ 2F5FA 2KIFA 1X19A 1I1SA 4BY1J 4LK0F 2XB0X 1FSEA 2FOWA 5EEGA 4PSXA 3OYIA 1QGPA 4Q2JA 3OP9A 5HDNA 1JFSA 1FYLA 3IRRA 3SZTA 4Q47A 3IKTA 2DW4A 2JT1A 3UWPA 3FMYA 5F64A 2QSGX 1WJ5A 3PJRA 2GRLA 1FOYA 4LG0B 3HHHA 4LMYA 1B8IA 3JSPA 3OQOA 3HSRA 2VODA 2M4GA 3ISPA 4NDLA 4QWQA 5C3EJ 1U5TC 1JTXA 5EGOA 2HU9A 4QPOA 2QQ9A 1MKMA 2PXUA 5B5EC 3MKZA 1UZCA 2NAZA 2VE8A 3GTOJ 3GTJJ 2HOAA 3U21A 2OC6A 3RJPA 1X57A 2HPIA 3SDGA 3T5XA 2DCEA 3L7WA 1JXSA 1CQTA 3ABKH 4IVNA 1UXCA 2KDOA 3CJTB 3KZ3A 2DJNA 2OF7A 3K4JA 3QU6A 5FD5A 4PUSA 2E2JJ 1JWLA 3WGGA 3J81K 1UHMA 3DP7A 3DU5A 4CDGA 2CW7A 1SFEA 3OL3A 4XOPA 2R7DA 2HVRA 2LR8A 1HDPA 2O5RA 1U3EM 3OYHA 2WUSR 3MEJA 3ZQFA 4HPQA 1K4SA 4M71A 2JA6J 1MSEC 1IXSB 1BN5A 1WJDA 2Y0SA 3VWBA 2VUMJ 2WV1A 3A9ZA 1DWKA 2OV7A 4FQGA 2XAGA 3H0GJ 2O3FA 2PUEA 4FISA 4BHCA 2WBMA 2XV4S 3W3CA 1EV7A 2KRFA 4EM2A 2R7UA 3H92A 2MD0A 3WU1B 4AU7A 1YITI 5HLIA 4E70A 2R7TA 4HNTA 3JAMZ 4R1HA 3QOXA 1ZG5A 2RQQA 3FXMA 2E36A 3LAJA 1UFMA 4OIOF 1TW2A 3LOCA 1A35A 9ANTA 1XSVA 1RC9A 4CCOA 4FN3A 2EJRA 1X58A 2AXZA 2R0QC 5D5XB 1LMB3 1U9OA 1SD4A 3C2BA 4KMFA 1R4MB 1MJBA 3O9XA 4LLLA 1AU7A 3IAM2 1NW3A 2HZDA 1A6QA 2A68F 1R69A 4S04A 4YFKF 2M87A 3WE3A 3DU6A 4BY7J 2DTZA 3QPLA 1ZZBA 2BJCA 1T38A 3PL8A 1OQYA 2OBPA 2BNNA 2COBA 1DGRM 2IS2A 3BDNA 1WKMA 1U5TB 2W48A 3L2QA 3P7NA 1ZRFA 2E7WA 4C2UA 3FBIB 2M5WA 3C2GA 1I50J 4U7BA 1QHGA 5DEQA 4BU2A 4EKIA 4AVZA 2E1NA 3KPHA 5FKLA 2VN2A 1X2MA 3HHGA 3QPSA 1LDJA 4IO9F 3S1NJ 3PO3J 1QPIA 3OYEA 3OYFA 2E71A 1FZPB 1ZARA 2JUGA 4PDKA 1MBGA 1OLTA 1KGSA 4YIRX 3BPVA 3O8HA 1A36A 5LEJA 2WV0A 4HG2A 4I98B 3GYHX 3QYXA 2BHZA 1REPC 4V2GA 4BJTA 2HCNA 3WU2C 3J81Z 2EINH 4JCYA 2HTJA 6PAXA 3DPLC 3CDHA 4BXUA 2LY2A 3T8RA 1PRAA 3WTTC 2GWRA 1ZPQA 3U1KA 3LSPA 4J1XA 3LNQA 3OQNA 1JKOC 1ZHFA 1PJRA 3F3XA 3B02A 5L3DA 1WRJA 5FFXA 2ECCA 4XKWA 1Z05A 3J7AY 3ZR8X 2GRMA 3V7SA 4EATA 1U2ZA 2G9WA 3TOAA 3R61A 3AAFA 3TEDA 3EUSA 1HBXG 2PI0A 1I27A 5DD8A 3GF2A 4F91B 1MBHA 3B73A 1CJGA 3NDBB 4IHVA 4KT6A 3ONQA 2HYGD 3M8FA 1YFHA 1XMKA 4KICA 3RPUA 1ZELA 1V5EA 3VDXA 1NK3P 3UKGA 3HM5A 4HDUA 4A3LJ 2HOTA 2LSOA 1JJ6C 2O8XA 5HODA 4OOIA 1XDUA 4AWXB 4HDVA 1G59A 1NEQA 3DLLF 3EDPA 1HC8A 1T0FA 3GFJA 2EA2A 3IUOA 4Y15A 1ITYA 1QBJA 3L2UA 2B7EA 2EFQA 2A5YB 1VPWA 5F0CA 1U8BA 3ZQGA 4G6TB 4IOCF 2HI3A 2JVHA 2ZXWH 3MD2A 1RETA 1T6SA 1R7JA 2KFDA 2KIUA 3CJQB 4PGGA 1BI2A 4V2FA 1IUYA 1TWHJ 4KT5C 4ER0A 4IZZA 4AVPA 4AIKA 1F9NA 3ZMZA 3H5TA 1D5VA 2DQLA 3KXAA 2HEOA 5TJJA 1UAAA 1FYMA 4D7MA 2R7QA 5F1RA 3OIQA 2B5AA 3LA3A 3JTGA 5BQTA 2I10A 1FEXA 2MXDA 1TNSA 4XMYA 4I8TA 1TZLA 3A02A 1VI0A 4I01A 1DU6A 1ZR4A 2ZCWA 4HX4A 5EF6A 1T95A 2LMDA 4UVAA 2IRFG 4AIDA 2IAIA 4LGWA 4ENMA 2IJLA 2F5VA 4QPQA 4C30A 2F4IA 2VPLA 1JUSA 4A3CJ 2FQ3A 2HOEA 4G9YA 3MZ8A 1VQNI 3OQMA 1YW8A 3P5JA 1I39A 4L0ZB 3H3UA 3CZ6A 2PJPA 2WA0A 3DTEA 1Y9QA 1LDKB 2XB5A 1H9GA 4X4DA 3S8QA 3ZMSA 1QA6A 1OKRA 3CP2A 2XASA 3G3ZA 2Z9OA 1G2HA 2L4MA 3E6MA 2LY1A 1JGSA 2E1OA 5FLXK 1R22A 2DFHA 1CF7B 4G6DA 5DTRA 2LLWA 1E3HA 5EEHA 1POGA 3JRDA 4FCYA 3LFPA 4C9YA 2O49A 3KZYA 1WCMJ 2CUJA 3HOZJ 3CECA 3IL2A 4E7HA 2QVOA 4LG0A 1K6OA 1W1WE 1DP7P 4XK4A 4YIFA 3KCCA 1MSFC 2ESHA 1K7AA 3NROA 2HQNA 2A6CA 4IQJA 1BJZA 2L7KA 3PFYA 1JT0A 3PE5A 2IGOA 2O7OA 4YG4A 2Y9ZA 1MBJA 3M7GA 4EJVA 1K4TA 3AL0C 3KZZA 2MA3A 5J1YA 1Z6TA 2DFFA 2MSYA 1XC5A 3GFLA 2FEZA 2XPVA 1VNDA 3G1OA 3PQKA 1NK2P 2HDCA 4HAMA 1IDZA 2FUG2 2R5ZB 5LHHA 4XQFA 3JTHA 3E0JB 1IG7A 2M30A 4A5MA 3DBHB 2NYXA 1XX5A 5E1XA 2BNOA 3T0YA 5IT3A 5L3EA 3GTPJ 1SMTA 4HX8A 1P6RA 1SFOJ 5M5YJ 2K4BA 3W6KB 1NHAA 3I59B 4XORA 2E1MC 5D5UB 2IS6A 2YBDA 2VIXA 4IJAA 4AD9A 1IUFA 5F0FA 4I6ZA 1QQBA 5FD6A 2UWMA 3K2ZA 1YTYA 2DOFA 2DU9A 1J09A 4MIMA 3BZ6A 1LCCA 4ZYAA 4F93B 5FB2A 2A61A 4CCKA 2V6EA 3B6AA 4ASNA 1V5GA 5BPDA 3K1NA 1PP7U 1TL8A 1U0JA 1MFQC 3ZN0A 4I7HA 4B47A 1O57A 3ZMVA 3O6BB 1SANA 2XSJC 2NVQJ 1T33A 3K0LA 3GLXA 5DTDA 3BZKA 4XRFA 2CSFA 3PUFA 4X4FA 4LK1F 2VQHA 3HSFA 4L0YB 3A0HC 2LBFB 2CYYA 3DTIA 3MKYB 4MLOA 4BGDA 1OISA 4A6EA 2L9RA 1HKQA 3HRTA 1W5CC 2QQAA 1TWGJ 3LSMA 3KIOA 5H6RA 1Z1DA 5DTMA 2EV0A 3CP8A 3FKJA 4F55A 1P4AA 1IXRC 4ER5A 3BP8A 4NB5A 5F04A 2FFHA 4JQDA 4RLQA 2OAZA 3QYEA 1YW9A 5DRYA 5E8IA 1QVUA 3NAUA 1TNTA 3S2WA 3BG6A 3QQAA 2HDWA 4ITVA 4YG1A 5HVQC 2E19A 3WTXC 2AS5F 4RAZA 4BE0A 3Q0UA 2GXAA 1BDIA 2O9LA 1ADRA 2XROA 3HGYA 2KHMA 3OSFA 1BJAA 3J7AO 4EGYA 1KONA 2CQ7A 2RNGA 2V3CC 1XMXA 3W2WA 2MQKA 3L09A 2QGUA 3RYRA 3F9KA 1VFCA 2ZC2A 4A3IJ 4O3MA 2TDXA 1RR7A 1BR4A 4H0EA 2O38A 1Z3YA 2XIGA 5GAGJ 4OIRF 2LD5A 2BYVE 4PK4A 1H0MA 1FBUA 2A05A 1WH6A 1F1ZA 2NNNA 3NWTA 1YX5A 2OD5A 1WJBA 5HDKA 1ZREA 4MFEA 2L7ZA 2KKOA 3GXOA 5LEKA 4XOTA 1LPQA 5GP9A 3OYNA 3OYDA 4ESBA 2VJIA 2E34A 5E3MA 5CVJA 2GXGA 2IA2A 1IAWA 1VQ9I 3QWLA 1O3TA 3CMEI 1WJAA 3LSHA 4W97A 2X6XA 4L9VA 2XHKA 5GAGi 2K9NA 1YE9A 4ZYGA 5E17F 1PUEE 3PQJA 2NRAC 2BVLA 4C2MJ 2Z99A 4MO7A 4BYYA 3LA7A 1JI8A 3GLLA 3IH3A 1G8XA 1QP4A 1HSTA 5M5XJ 2K27A 4Z5DA 1YOVB 1SEUA 1WH8A 3GZDC 2UXXA 1FSHA 2FBKA 2KJCA 2H8RA 3L2RA 4K2EA 1BM9A 5DUIA 3MKWB 4DOZA 4CXFA 5EDNA 1R49A 5DT2A 1Z67A 3S93A 2JZYA 2PJRB 3R09A 3IRQA 1UELB 1ON1A 2M2EA 4GYGA 3LSRA 1VQMI 2IUOA 4NNJA 5L3FA 3DKXA 1ETKA 2F5CA 1TLHB 2ME0A 2KPJA 3AG1H 3BR2A 2E5ZA 3SCGA 1VF9A 4XKVA 5J47A 1LFUP 4OMYA 1R36A 2DODA 4N9IA 4BACA 1WJCA 2R7OA 2LF8A 2ELKA 4HF1A 2ZO4A 3F6WA 2CG4A 1CF7A 4BEHB 2M3AA 4KMUX 2HKOA 4BHPA 3K9TA 5F08A 3LA2A 5EGOB 2HVSA 1JH9A 3BTCA 4LIUA 4WXCA 5ILSA 2PUDA 2Z5UA 4UUTA 5IY5H 1D5YA 5IT9K 3RKYA 3RKQA 3CLQA 3H1CA 3JRIA 2ME6A 2OZ6A 3HC7A 3TKYA 1N77A 5ICFA 2LYJA 4XLPF 5KAIC 2XRLA 2ZNYA 3SFIA 4Q48A 3FXJA 3BPXA 2CW8A 4YEJA 1ZZ9A 1LEAA 2X48A 3BWGA 3DKWA 2XC7A 2X1CA 2A6TA 2IV1A 3M9LA 4PU7A 3DXJF 2KPMA 3BCBA 1XB4A 3K4KA 2J7WA 2FSWA 3HOWJ 2FNAA 2M1BA 4A3EJ 3M1CA 2FRHA 2FX0A 1YQAA 4A3KJ 2DMUA 4HLYA 1X3WB 3DTKA 1DDNA 2VPRA 4HSRA 2GLOA 5DYMA 2LY9A 2ODRD 4ABZA 3LSGA 1ZZ6A 1TWAJ 2EPFA 2IP2A 3CLCA 1SVLA 4EK9A 1WH5A 2XJ3A 1AKHB 3OV8A 4KITB 4OAZA 1RPEL 1QO0D 4A3GJ 2Q1ZB 4A3DJ 3G1LA 1MDMB 4QLCU 4BQAA 2AW6A 2JQEA 4A0ZA 2A5WA 2VXZA 2Z1DA 3FDYA 1W7PA 5JLXA 1PRUA 1HCRA 3FHZA 2R7SA 2LOOA 4BQNA 3V8LA 5L3CA 2DA4A 1UG2A 2W4SA 3OL4A 4FE7A 2IA1A 3U9GA 4TV7A 2W25A 1RKWA 1ETYA 2RGVA 3ZQCA 3S1MJ 1I1GA 1Q1VA 3I64A 2DT6A 3I55I 3TBIA 4P9FA 2ZMEA 5CQGA 1U2WA 3HPGA 2EBIA 3HB9A 1R4NB 3KLOA 4F52A 1WHUA 3OYAA 2DYRH 3E1SA 2QSFX 1IXCA 2R5YA 4Y33A 4MNUA 1IN4A 5C44J 2WB1A 1QZXA 1BIBA 3DEUA 5E18F 1RZRD 3VEPA 1D1CA 2ELHA 2P7VB 5BNGA 2CQXA 4P9UA 3S2HJ 4OWRB 4Z5CA 3KL4A 4DGWB 4X1EA 1QPZA 1FC3A 3IV5A 3C2HA 2HS5A 2N8GA 1BOAA 4E7SA 2GQQA 4YG2F 1RESA 2M7AA 4ZZDA 4DJAA 3S1RJ 1WFXA 2PMHA 5GADJ 3CCRI 5FO5A 4WK8F 2LNBA 2HXOA 2AQEA 3ZQ7A 1AOYA 4X4GA 3BTJA 1Z7UA 3WG9A 3ZGKA 4MHGA 2CS3A 3OIPA 3HOXJ 1W4MA 3HZJA 2PUCA 1NG6A 2Y31A 3HBLA 2PPXA 3QF3A 4NC8A 1SD5A 4RA2A 4HBLA 3BT9A 4G94A 3OKZA 1BI1A 2E35A 4GQMA 2WAFA 3G6EI 1GDTA 1IJWC 3NEUA 3HIFA 3RQIA 3ZMUA 4CYCA 3DV8A 1KQ0A 1JHHA 2V1DA 5H2FC 2DPUA 1S5LC 2DFIA 1P9QC 2L9VA 1MBFA 3JCUC 1MMNA 2CUZA 3CCSI 1YRNB 4DZJA 1PRVA 1V54H 3EETA 4GGGA 2R7FA 3QP6A 4F3QA 2EF8A 2CUFA 2CFOA 2Y0SN 4CSWA 5TRDA 2W24A 3NQOA 3BLYA 1LE8A 3Q0WA 5CQEA 2ZXIA 1PERL 1WI3A 1TQMA 3I56I 4OU0A 4XL9A 1G3WA 3H5NA 5F1JA 3DF8A 4HEA2 2W00A 4JYKA 3M1EA 1UHSA 2IGMA 1WJFA 3QOEA 1ZGJA 3OYKA 1J2XA 5LRRA 1XSDA 3HG9A 2EQRA 2QCOA 1ZRCA 3U3WA 2XF6A 2PQ8A 4IRHA 2DI3A 5CVRA 2P0WA 2E2IJ 4ZYDA 2CQQA 3G4SI 1FLIA 3MLFA 1BR2A 2EV6A 3K6GA 4G6QA 3QRFF 1FTZA 3CF5F 4OIQF 1K78A 3HOUJ 4EV0A 1S6LA 2CJJA 4P5OA 1T8IA 3J80Z 4A2UA 4P55A 2CW0F 5BS6A 1R5GA 1HSJA 2QQBA 2JA7J 3LISA 4MTDA 3WGHA 3ABLH 1DUXC 2KQRA 3HKZA 3IAS2 4D0PA 3IP4B 4R79A 2LLVA 5DS9A 1OFCX 3HYIA 3CCQI 3HPHA 4G7OF 2K5CA 3CJNA 3CLOA 1V3FA 1UXDA 4CUGA 1BOBA 4CYDA 4AIHA 3TDZC 1HDDC 2MC4A 1EFAA 4BKXA 4BHBA 2VQLA 1LB2A 3QAHA 2BOLA 1W7PB 3C3WA 1OCRH 3M8JA 4MTEA 1QB2A 1GV5A 5C4XJ 1EH7A 1IZ1A 3E5XA 2EB7A 2EWNA 3F52A 3KE2A 4F7ZA 1GLNA 1E3PA 3J7ZI 4ER7A 1IRFA 3ZHMA 1T98A 3C18A 1Z7LA 3M07A 2HZTA 2LYSA 2UXNA 3VK0A 4UUSA 1I6HJ 4ESFA 1UHWA 3OOUA 4KUMA 1BIAA 1F4KA 4RGRA 4C3JJ 3DKYA 4GXOA 3DPTA 1K61A 2XI8A 1RR8C 2PXKA 1E17A 3SFZA 1EJ9A 3F51A 4U0VA 1OJLA 4D1QA 4Q5SF 3F72A 3QPTA 3S3NA 5F0HA 4JP0A 5E79C 5CPRB 2EFWA 1W0TA 2ESNA 2XGEA 3KP5A 3RKXA 3Q9SA 2MC3A 3BG7A 3K69A 5B1AH 2XVCA 3CCLI 1WETA 5FROA 5IP9J 1WIZA 4Y13A 1ORKA 2DYSH 4UNOA 3BJAA 3NRVA 2P81A 4II3A 3K1MA 2X9DA 1MD0A 2UZKA 2MGQA 2EA4A 4LD5A 1WSUA 1WH7A 5ICEA 3GCMA 2O6GE 3HRSA 4ZTFA 4UHTA 4WX9A 2CUEA 1IV8A 2RQPA 4M73A 3ZQLA 3LQQA 3FYMA 4U87A 4BQOA 3QOWA 3OIOA 2QENA 4LIVA 3TW6A 1XDSA 4CCLA 2LYLA 2DMQA 2PG4A 3DCFA 3TQNA 3JRGA 4BEHA 5DTQA 2DN0A 4MQ9F 5JUWA 2ECBA 2MLKA 3A9XA 5JHUA 2JVGA 3X2QH 4HZFA 4N4OB 2BZTA 2H94A 1Y1WJ 1X3ZB 2GIVA 2Y2ZA 3FF5A 2H8WA 4DBQA 2G7UA 2X6OA 3GEZA 4YFXF 1FP2A 4AYBA 4E6KG 2NNYA 1FOKA 1R9TJ 1KQ8A 2KIMA 2B0LA 4E7IA 1YX3A 3OYGA 3M8EA 1B72A 2VOOA 4J19A 2UUZA 4EJWA 3ZN1A 3KP3A 4IHXA 4RB1A 4J00A 1RIOH 2KEIA 2XXQA 2BVMA 1MMAA 5IOZA 3HOYJ 2KZVA 1ACIA 4O6JA 4AIJA 1BBYA 1Y39A 2R92J 1VQ7I 1QHHD 4MEYF 4GO1A 1R23A 4EQQA 4I09A 2R7XA 3SEZA 3CUQB 2EH3A 2IBDA 1TTYA 1BI0A 4XNFA 4UV8A 1JKRC 1XCBA 4XIDA 4Q4ZF 3G2BA 2R7VA 1RPWA 1JE8A 2E1MB 3K10A 4W1UA 4LB5A 3FXRA 2VKDA 1YJNI 1B6AA 2AXLA 2LKSA 2NS0A 2Z2SB 3GVAA 3K7AJ 2X0LA 3GWZA 3VPRA 5J1RA 2R93J 5JI6A 5CYVA 3Q0VA 5DCMB 5KCMA 1TQPA 3OS1A 4UY8I 3K2AA 1ONVA 5E3OA 2ETHA 3CO7C 2QZ8A 1HKSA 1U9NA 1QZZA 2IGNA 2EIJH 2P5LC 4DE8A 1SMYF 2CQKA 4IRGA 3SDBA 3COAC 3MWMA 2EV5A 4IEJA 2JSCA 1ZVVA 5HS7A 3A4CA 3RKWA 2XPWA 2ZXJA 5K7ZA 1DGWY 1EF4A 5JLWA 1FYKA 3OYCA 3K4NA 3I0TA 3K4BA 4HRAA 2PMUA 3VB2A 4NHJA 3D5LA 3A0BC 5J3LA 3OSGA 3QPHA 4G7HF 2XCJA 2GA2A 3FISA 3MCZA 4L9TA 3H36A 3QYFA 4Y17A 2M8GX 2ICPA 4MCXA 3FWEA 2JTVA 3OWTA 1TT0A 2BY3A 1LVKA 3BQZA 2KL4A 3RPUD 4RAFA 3RYPA 2VOPA 1MNEA 4RM2A 4B09A 4PCQA 2WTEA 3PNVA 1S9HA 2MLGA 5B3SH 3JXCL 3PNYA 3DWLE 1ZQ3P 3MVPA 4ZYEA 3EPZA 3EQLF 3A9YA 2D5VA 1T0FC 3GN5A 1P2FA 1YG2A 4RAGA 1BDHA 3BG5A 4HOBA 3ELKA 3R1FA 5GAHi 4M3DA 4B4CA 2J5OA 1XN7A 2DA6A 3GTLJ 4MGRA 2ID3A 2KIQA 2LYCA 4UV9A 1HW1A 2WAQA 1Q1HA 4RB3C 3FKIJ 1A31A 4AUXA 4Y42A 1XPXA 3CUQA 1YIOA 3V8JA 2DA2A 2KZGA 3TP3A 1RZRA 2JUCA 1SFKA 2PXEA 3D1NI 1FBSA 4RMNA 3OYBA 1UMQA 4RS8A 1I3AA 2CGPA 2IS1A 3ECOA 2OFYA 5J4VA 4B3AA 5LBQA 5E1WA 2Z33A 1B72B 2RKHA 1PNRA 2VC1A 3SXYA 4JOMA 1R6RA 5E1ZB 1TC3C 1SVMA 4YRVA 1BA5A 2K86A 3I9V2 1PUFB 3FXUA 1S3JA 2FBIA 2LKPA 2KISA 4XRSA 4JCXA 2STWA 2WADA 5DSXA 2WB1N 3AFHA 3VYTB 3E5UA 1XG1A 4AC0A 4QIWN 2W7NA 4A0XA 1O3QA 2XIUA 4D5CA 3OS0A 1NERA 4N4NB 1ETOA 4XLHA 4KIGA 1R58A 4I6RA 2Q8KA 4M9XA 5AIQA 2R5ZA 1QP7A 1HW5A 4ZDLA 2LKXA 2PXBA 2ELJA 1MDMA 3GUUA 3GMEA 3DEEA 3P9KA 1BL0A 2Y75A 3S2DJ 3V7RA 3ZPLA 4Z58A 2K7LA 2WIUB 3C1DA 2JN6A 3I4PA 2E1CA 3GTKJ 1O7FA 1Y8QB 3ML6A 5GTHC 1WQ2A 3PIOF 1FMWA 2PMZA 1T2KA 1Z77A 4XONA 4ON0A 2IGKA 4A5NA 4B3XA 1J0RA 4ER6A 2GBYA 2MABA 5HNFA 4BS9A 3ASOH 4FT8A 1ZZ7A 4HQMA 3HGGA 5LFAA 4D9JA 2KP6A 1R5ID 1R5HA 4UB6C 2OQGA 5L3BA 5DRTA 3G71I 1FJLA 4FASD 2DTRA 1O3RA 1ZAYA 1IN5A 5IP7J 2HWVA 3VFZA 2PXPA 2XPUA 1E2XA 3CDLA 3ABMH 1PVEA 1IRXA 1D0XA 1JGGA 3CC2I 1DP3A 2DMTA 1IW7F 2LC2A 5M3MJ 5DD4A 3KEYA 4M3BA 2K4JA 3F22A 3BR0A 2M9HA 3BOQA 2A69F 4X4IA 4IA8A 2L02A 1H9TA 2XDVA 1DW9A 1WJEA 2NVYJ 3S3MA 4I76A 3BY6A 2L1PA 2IVQA 1FPQA 2VLAA 2Y48A 2G0EA 3TMOA 3GBFA 4M9SA 5LLQA 1ZZ8A 3DEWA 4MQVA 2XF5A 3FXKA 3K4CA 2W84A 2IU7A 1G3YA 3EUKL 1ON2A 2LLKA 2XUBA 2KRCA 2I5UA 4HX7A 1QZEA 2V79A 2FJ1A 4FTHA 5BOXA 2V1XA 2LYRA 3GZNB 2NS8A 4OIPF 4X0GA 2FE3A 3LSKA 4O5VA 4KA4A 1L3LA 3PO2J 5JFRA 2V4JC 2EBYA 2L7FP 1UB9A 2QKLB 2W82A 1FIPA 3HKZN 4ZC3A 1U78A 3QWGA 4B48A 4IWRA 2DQRA 3M3YJ 4OBMA 2Y9YA 1B0NA 3H5AA 1R71A 3I54A 3GTGJ 1JUPA 2H09A 5TISC 1WWXA 3AL0B 1S7EA 1XMAA 1N78A 3GZDA 3KX2A 1QQAA 3CTAA 3AG3H 1XWRA 3WTSC 4XR6A 4UUVA 4HV6A 1VQ4I 3UNGC 4CCMA 1FWZA 1IV6A 3FM5A 1YS6A 4EJOA 2A6HF 3B7HA 3SCHA 2KEKA 3F8BA 1IF1A 3JW4A 1RZ4A 5FKKA 3ZCOA 4DIQA 5DDGA 2XAUA 2IT0A 5EG0B 4A3FJ 2A6EF 4N9HA 1RKTA 3OOPA 3EUHC 2LYQA 3HOTA 1SD6A 2LDUA 3ZMTA 4UVBA 1IRGA 4I0BA 1ZH5A 1KQ9A 3JRCA 1WZ2A 1SQ8A 3HUGA 2EWTA 2L49A 4L5IA 3UFDA 4A3JJ 5CJ9A 5FKMA 4B44A 2CV2A 1BW5A 4CYCB 5DM6F 2DMPA 2OUMA 4LB6B 1O4XA 3H9QA 4IPAA 2VL8A 2XKPA 3FHNA 4MEXF 3JRAA 3T1BA 2X85A 1YSEA 4FBIA 1ERDA 3K4MA 3JRBA 3P9CA 3LAPA 2WWYA 2JRMA 2F5EA 3BJOA 4CH7A 2FJRA 2L4AA 3CUQC 2PUAA 2IXSA 1ZYRF 4NBQA 2E60A 4C3IJ 4P1WA 5K7FA 1LJ9A 4IVZA 4M3EA 1QPMA 2L2OA 2LBFA 2XGCA 3JREA 2P6SA 5IPAA 3E7LA 1NTCA 1KYWA 1YW7A 5FJ8J 4F8DA 2MBFA 1NG7A 2BW3B 3BROA 2GXBA 3SX0A 2H1LA 2XRNA 5HLHA 5LD2C 1D3YA 3EUAA 3R4KA 1KA8A 2B63J 2EILH 1LVAA 1ZAOA 4GCVA 1V4RA 3TO9A 2GZWA 3CF2A 3FXOA 4LOCA 5FLXZ 3KP7A 2LP0A 1TWCJ 3RZZA 3R0AA 1POUA 4RGSA 3I3LA 1JKQC 2HFHA 3SCFA 2OA4A 2XAHA 2ZMEB 4JX4A 5DCFA 4LLNA 3BJ6A 3ZMDA 1VQ8I 1KU9A 1FMVA 2FU4A 1VQOI 3WTUC 4OMZA 1X1CA 4XKCA 4WVLA 4Y52J 3N05A 2FMYA 1MGTA 3BG9A 5HS9A 5H20A 1MJ9A 4PJJA 2PX9A 2XAJA 4C3HJ 4CZCA 1SC7A 3HXLA 2L9NA 3JAMK 4M74A 1OYYA 1ZZCA 4M72A 5CVIA 4YG7B 1G6NA 1P7JA 3SEQA 3GZ6A 2CQNA 3H5RA 3I59A 2COMA 2K9MA 1TT5B 3VODA 2CH0A 4XSZF 3GBGA 3LSTA 4UB8C 3I5UA 1M1EB 5EZGA 1PDNC 2K3FA 1AKHA 3HDDA 2X51A 3LFKA 4DBRA 4ZZLA 5C4JJ 5D6FA 4A6DA 2L0KA 2RDPA 3DM5A 3KP4A 1C0WA 2CV1A 1D1BA 3H9JA 5JHFA 4BXXJ 1X4OA 1FTTA 2FD5A 1RUOA 2YPRA 1RNLA 1W7PD 2OTLI 1X1DA 3TO7A 2HPMA 2L5QA 3KJXA 3HL2A 1CGPA 3K1PA 3CROL 5M5WJ 2FOKA 1HW2A 5A2QZ 1LCDA 5LGUA 2HNHA 5IT9Z 5J8CA 1OYWA 4AYBN 1ZLJA 1RUNA 4G12A 3CDIA 1TP4A 2VT2A 5BMZA 2V9KA 2RVCA 4G7ZF 4IXAA 2JK3A 4U0YA 2LVSA 3MN2A 2DO7A 1MMSA 2TCTA 4UVCA 2FNPA 2QQ8A 3ESWB 2ZBKA 4RAYA 2LH9A 1HXDA 1SAUA 3F8CA 2D2WA 1EKEA 3S3OA 4G8XA 2W1OA 1JJ8C 3HZIB 4EVIA 3Q5FA 3S17J 2BY0A 3OYJA 1XSXA 3CUOA 2CMPA 5IOYA 2HR3A 1ZRDA 3CCUI 3NWSA 4J01A 3ZPXA 3GTMJ 3W2VA 2ZJRF 3MZHA 1B8IB 2RC4A 1B9NA 1AA7A 2GOXB 1LUJB 2B9SA 1Y8RB 1T08B 2BY1A 1A04A 2WAQN 3FX3A 5LHIA 2RV8A 2JMWA 3KP2A 5E8GA 3TO6A 2ISZA 2V7FA 3OWQA 1YIJI 1Y1VJ 3PXPA 3EYYA 4M3FA 2EZIA 3O2PE 1R1TA 5GTIC 3CJRB 3REOA 4KJZA 5M3FJ 3L1PA 1I6XA 2ZB9A 2DAOA 1UJ8A 2HSGA 2HYFA 1AHDP 2LFBA 2OTJI 2K40A 1ODDA 5EEAA 3H35A 2NVTJ 1X1PA 1Z21A 3RZDJ 2R7ZJ 5K1YA 1STZA 2JPCA 2JWTA 4HF2A 3S14J 2EZLA 2VB6A 1BC8C 3H3ZA 4HYEA 3H0DA 3CCMI 5ICGA 1WI9A 4ER3A 3F6OA 4ZJZA 4X6AJ 2PXDA 1ULYA 1X1AA 2PUGA 1QVTA 4IHWA 1MNDA 1GVDA 5CVVA 1LQ1A 5D4SA 3KYLA 1S7AA 1XGSA 3WTZA 1A5JA 4BBRJ 3FM3A 3CCYA 4RLFA 2DK8A 1I5ZA 1FOWA 1FOXA 3BD1A 2STTA 2DOEA 2MG4A 3L2WA 3BR5A 3L2VA 2VKEA 4BQQA 3E97A 3H3VK 3ZHIA 5HNHA 2PXTA 2EIMH 2G7HA 3SZGA
chains in the Genus database with same CATH topology
3I4NJ 3HEFA 5J1RA 3K7AJ 2R93J 3VPRA 2LK2A 3IH4A 3B6AA 3MKLA 3Q0VA 2IEKA 1SANA 1ZUGA 3K2AA 5E3OA 2NVQJ 1T33A 2HINA 1YRNA 1H88C 5DTDA 1ZR2A 2AHQA 1R63A 3SJMA 2CSFA 1U9NA 4X4FA 1ZTRA 5FLVA 1ETQA 4X4BA 2GM4A 5K98B 3JRFA 1TWFJ 4MLOA 5IP6A 1LE8B 4IEJA 3WHCA 2O4AA 1IDYA 1ZVVA 2L9RA 2CU7A 2DA7A 1TWGJ 4IHYA 3CQZJ 1IGNA 2XPWA 5K7ZA 2ICTA 1EF4A 5JLWA 4HNVA 3S16J 5F04A 2AUWA 1H8AC 4JQDA 5J3LA 3ZQHA 3OSGA 2XCJA 3FISA 2BNMA 1QVUA 3NAUA 2AXUA 5J1UA 2M8GX 2ICPA 4MCXA 3QQAA 3BQZA 1I3QJ 3M4OJ 4YG1A 4D7NA 2E19A 4J1WA 4X4EA 5IYCJ 1MH3A 3Q0UA 3JXCL 1BDIA 2O9LA 3F0CA 1ADRA 3HGYA 3OSFA 4XRSG 2MQKA 1ZQ3P 3MVPA 3LSJA 4A3MJ 3GN5A 2D5VA 1BDHA 1VFCA 3BG5A 4A3IJ 3R1FA 1ZK8A 4M3DA 1RR7A 2O38A 4B4CA 5EG0A 2KDZA 3W6VA 1APLC 3FK6A 2DA6A 3GTLJ 2ID3A 2LD5A 2JA5J 1RIOA 4S0HB 2R5YB 3FKIJ 1WH6A 2HQ5A 2KZ8A 4AUXA 4Y42A 4YBAA 1RZRA 2DA2A 3TP3A 1ENHA 2MW8A 4MFEA 2L7ZA 3IH2A 2XSDC 3D1NI 2PE5A 1UMQA 5GP9A 2JA8J 4D5FA 3GTQJ 4O8BA 3OMTA 5E3MA 4BBSJ 1IC8A 3BTLA 2YU9J 2OFYA 4XICA 1K83J 4B3AA 4L5EA 1B72B 4DYRA 1PNRA 4W97A 2CROA 1TC3C 4M3GA 1BA5A 2K9NA 4QTRA 1PUFB 1A6IA 4XRSA 1ZS4A 3A01B 4JCXA 2DA3A 4C2MJ 3BQYA 3JR9A 5A7LA 2WB1N 1ZKGA 4MO7A 4B1RA 4PU3C 2DA1A 3IH3A 3CMYA 1MNMC 1QP4A 5M5XJ 3A03A 5IYBJ 2HXIA 2M0CA 1XG1A 4AC0A 4QIWN 2LCVA 2K9QA 1WH8A 2XIUA 4FE4A 4Z5DA 5E3LA 3Q3SA 4D5CA 1ETVA 2H1KA 3BR3A 4DYCA 1NERA 2H8RA 1ETOA 3BTIA 1F36A 4I6RA 2HOSA 1JT6A 5EDNA 4EEFG 3S1QJ 4Z5HA 2R5ZA 1QP7A 2M2EA 2LKXA 3LSRA 2IUOA 3G7DA 3JRHA 1ETKA 1BL0A 2ME0A 2KPJA 2M34A 3BR2A 3S2DJ 3QQ6A 3SCGA 4Z59A 2JCGA 1VF9A 4Z58A 1LFUP 2WIUB 1LFBA 2JN6A 4XRMA 1JUMA 4QSHA 1OCPA 2EZKA 5K7HA 3GTKJ 4Y7NJ 2ELKA 3F6WA 2ID6A 4BY1J 2XB0X 4X4HA 3OP9A 5F08A 1JFSA 5EGOB 1Z77A 1JH9A 4JX5A 1QP0A 3BTCA 2PUDA 3ZQIA 4UUTA 1D5YA 2GBYA 3RKQA 3FMYA 2GRLA 1ZZ7A 3HGGA 3JRIA 2KT0A 2ME6A 1B8IA 3OQOA 3TRBA 4NDLA 5C3EJ 1FJLA 1JTXA 5EGOA 2OR1L 1ZAYA 5IP7J 5EZHA 2LYJA 2XRLA 3SFIA 2QF7A 2LYPA 2XPUA 3ZKCA 3CDLA 1ZZ9A 2X48A 1HLVA 2HDDA 3GTJJ 1JGGA 3GTOJ 2HOAA 2HYJA 2IV1A 2PUFA 4PU7A 1X57A 2DMTA 3SDGA 2NS7A 5M3MJ 2LTPA 4M3BA 3TP0A 3BR0A 2M9HA 3HOWJ 4A3EJ 1CQTA 1UXCA 2FX0A 2MEZA 4A3KJ 4X4IA 3KZ3A 2DMUA 1F43A 4IA8A 2DJNA 2OF7A 2VPRA 1DW9A 2GLOA 1L1MA 2LY9A 2E2JJ 2NVYJ 1JWLA 4I76A 3LSGA 4ABZA 1TWAJ 3RZOJ 1ZZ6A 2IVQA 2KEJA 2G0EA 3CLCA 3GBFA 1Y7YA 1ZZ8A 1WH5A 2LR8A 3DEWA 2XJ3A 1AKHB 3ZOBA 1HDPA 2IU7A 1RPEL 4NDWA 4A3GJ 4A3DJ 1QRYA 2WUSR 2TRTA 2LLKA 1OCTC 3G1LA 3ZQFA 2AW6A 2FJ1A 4FTHA 1PUFA 2JA6J 1MSEC 2LYRA 2NS8A 5JLXA 1PRUA 1HCRA 3PO2J 2VUMJ 2WV1A 3TW7A 1DWKA 2EBYA 2L7FP 3H0GJ 1FIPA 3HKZN 3QWGA 1U78A 2PUEA 4IWRA 4FISA 2DA4A 3M3YJ 1UG2A 2VKVA 2Y9YA 4FE7A 1B0NA 5E3NA 3GTGJ 1JUPA 1RKWA 1S7EA 4MCTA 1ETYA 1QQAA 2OPTA 3ZQCA 3S1MJ 1UTXA 1XWRA 1Q1VA 5GPCA 1IV6A 2KEKA 2EBIA 3HB9A 3LOCA 3B7HA 2R5YA 3S15J 9ANTA 3SCHA 1WGXA 5FKKA 4FN3A 1X2NA 3BG3A 1X58A 2PMZN 5C44J 2R0QC 1X2LA 1U9OA 2AXZA 5EG0B 3C2BA 1LMB3 3FK7A 4A3FJ 1RKTA 1RZRD 5FKNA 3S2HJ 5BNGA 4Z5CA 2CQXA 1AU7A 2LYQA 3GN5B 3O9XA 1R69A 4X1EA 1QPZA 4I6UA 3IV5A 2R63A 1RZSA 4BY7J 2DTZA 3QPLA 1ZZBA 2N8GA 4X4CA 2BJCA 4DYQA 1T56A 3JRCA 2L49A 1SQ8A 2BNNA 2EWTA 2COBA 3UFDA 3BDNA 4A3JJ 2E2HJ 2W48A 1RESA 5FKMA 1BW5A 4CYCB 3S1RJ 1GT0C 4RBOA 1ETXA 2DMPA 1I50J 1O4XA 2DMNA 3JXBC 1ETWA 1DU0A 2HXOA 3JRAA 5FKLA 4X4GA 1YSEA 4FBIA 3BTJA 1X2MA 3QPSA 3JRBA 1W0UA 3S1NJ 3BR6A 3HOXJ 3PO3J 1QPIA 2PUCA 2FJRA 5EYRA 2PUAA 2Y31A 3HBLA 1MBGA 5K7FA 4C3IJ 2PPXA 3QF3A 4IVZA 3O8HA 3FYAA 3BT9A 4M3EA 3QYXA 4GQMA 2XGCA 3JREA 1GDTA 1IJWC 4V2GA 3RQIA 5IPAA 4CYCA 3E7LA 1NTCA 4JCYA 5FJ8J 4F8DA 3I4MJ 1MBFA 1PRVA 1YRNB 4DZJA 1PRAA 1ZPQA 3LSPA 4OB4A 4J1XA 3LNQA 3OQNA 1JKOC 2EF8A 2CUFA 1P7IA 2B63J 2Y0SN 1WPKA 1LE8A 1MBEA 2ECCA 3Q0WA 4LOCA 1FIAA 2LP0A 1PERL 1TWCJ 1WI3A 3RZZA 1MBKA 1POUA 3NARA 4JX6A 5F1JA 2GRMA 4JYKA 2JJ7A 1UHSA 5FLMJ 1JKQC 3SCFA 3TEDA 3EUSA 1GUUA 4JX4A 1MBHA 1CJGA 4IHVA 2EQRA 2QCOA 3U3WA 1NK3P 3UKGA 3PM1A 3HM5A 4A3LJ 2HOTA 4Y52J 1JJ6C 2E2IJ 5HODA 3BG9A 2CQQA 3MLFA 1H89C 1FTZA 1NEQA 1ITYA 4C3HJ 4PU4C 3HOUJ 3O8GA 2CJJA 3G5GA 1VPWA 4M6VA 5F0CA 1U8BA 3ZQGA 2JA7J 3JXDL 3LISA 2R1JL 2GZUA 1ZZCA 2HI3A 4YG7B 1P7JA 1RETA 5DS9A 4V2FA 1OFCX 1TWHJ 5EZGA 3GBGA 3H5TA 1AKHA 1JFTA 3HDDA 1UXDA 1XS9A 1HDDC 1LQCA 3KXAA 1EFAA 4BKXA 5C4JJ 3HOVJ 1MH4A 2L0KA 4D7MA 2B5AA 5GPAA 4BXXJ 1FEXA 2I10A 1FTTA 2FD5A 1GV5A 5C4XJ 3IVPA 1LLIA 3A02A 4I8TA 1VI0A 1DU6A 1ZR4A 3F52A 5EF6A 1JKPC 2AWIA 1OSLA 3ZHMA 3BS3A 3KJXA 2IAIA 2CRGA 3CROL 5M5WJ 2NVXJ 2LYSA 3VK0A 4UUSA 1I6HJ 1LCDA 3WHBA 3OOUA 4A93J 1JUSA 4A69C 4A3CJ 4A3BJ 4AYBN 4G12A 5FKOA 4GFBA 3OQMA 4C3JJ 2JK3A 2XGDA 3B6CA 3G1MA 1K61A 2LVSA 3MN2A 1IRZA 2XI8A 1Y9QA 4GHJA 2TCTA 3DNVB 3F51A 2XB5A 2IVBA 1OJLA 4X4DA 3S8QA 4I6TA 2PIJA 5F0HA 4JP0A 2L7MP 1G2HA 1JJ8C 1BW6A 1ZGWA 3HZIB 2K9SA 1W0TA 3S17J 2XGEA 2E1OA 2PUBA 2DA5A 5IOYA 3JRDA 1POGA 4FCYA 1HF0A 5IP9J 1E3OC 2O8KA 3LFPA 1WETA 1WIZA 3GTMJ 2L8NA 2O49A 1ORKA 2Y30A 2YS9A 1WCMJ 3HOZJ 3CECA 1B8IB 2P81A 2EZHA 2X9DA 2MGQA 1WH7A 4XK4A 2CUEA 1MSFC 2WAQN 3ZQLA 2NOGA 3FYMA 2JMWA 3OIOA 4PU8A 3TW6A 1Y1VJ 2LYLA 3PXPA 1JTYA 2DMQA 2A6CA 4M3FA 2EZIA 1BJZA 1JT0A 3DCFA 3JRGA 2DN0A 5M3FJ 2YUSA 4UUSB 2O7OA 3L1PA 2ECBA 2ZB9A 2Y9ZA 1MBJA 2AXVA 2HSGA 4YG4A 1AHDP 2LFBA 4DZPA 5J1YA 2K40A 4MFDA 5EEAA 2MSYA 1Y1WJ 2NVTJ 1XC5A 2Y2ZA 2XPVA 1VNDA 2X6OA 3G1OA 3RZDJ 1NK2P 2R7ZJ 1IDZA 2R5ZB 2JWTA 1R9TJ 3S14J 2EZLA 1IG7A 1Z0XA 2BNOA 2IVGA 1B72A 4J19A 1GV2A 3GTPJ 5IYDJ 4X6AJ 2PUGA 1QVTA 4IHWA 1SFOJ 4IHXA 2KEIA 2AO9A 5M5YJ 2RAEA 1GVDA 5IOZA 3HOYJ 1A5JA 4BBRJ 3CCYA 5F27A 3A01A 2R92J 3BD1A 2MG4A 3FIWA 5F0FA 1IUFA 2EH3A 2IBDA 3BR5A 2VKEA 2FQ4A 4I6ZA 4YARA 1QQBA 1HOMA 3BR1A 4DW6A 4XIDA 1JKRC 3H3VK 3ZHIA 1RPWA 4RDUA 2JVLA 4W1UA 2VI6A 4MIMA 1LCCA 2LYKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I4N J;  3HEF A;  5J1R A;  3K7A J;  2R93 J;  3VPR A;  2LK2 A;  3IH4 A;  3B6A A;  3MKL A;  3Q0V A;  2IEK A;  1SAN A;  1ZUG A;  3K2A A;  5E3O A;  2NVQ J;  1T33 A;  2HIN A;  1YRN A;  1H88 C;  5DTD A;  1ZR2 A;  2AHQ A;  1R63 A;  3SJM A;  2CSF A;  1U9N A;  4X4F A;  1ZTR A;  5FLV A;  1ETQ A;  4X4B A;  2GM4 A;  5K98 B;  3JRF A;  1TWF J;  4MLO A;  5IP6 A;  1LE8 B;  4IEJ A;  3WHC A;  2O4A A;  1IDY A;  1ZVV A;  2L9R A;  2CU7 A;  2DA7 A;  1TWG J;  4IHY A;  3CQZ J;  1IGN A;  2XPW A;  5K7Z A;  2ICT A;  1EF4 A;  5JLW A;  4HNV A;  3S16 J;  5F04 A;  2AUW A;  1H8A C;  4JQD A;  5J3L A;  3ZQH A;  3OSG A;  2XCJ A;  3FIS A;  2BNM A;  1QVU A;  3NAU A;  2AXU A;  5J1U A;  2M8G X;  2ICP A;  4MCX A;  3QQA A;  3BQZ A;  1I3Q J;  3M4O J;  4YG1 A;  4D7N A;  2E19 A;  4J1W A;  4X4E A;  5IYC J;  1MH3 A;  3Q0U A;  3JXC L;  1BDI A;  2O9L A;  3F0C A;  1ADR A;  3HGY A;  3OSF A;  4XRS G;  2MQK A;  1ZQ3 P;  3MVP A;  3LSJ A;  4A3M J;  3GN5 A;  2D5V A;  1BDH A;  1VFC A;  3BG5 A;  4A3I J;  3R1F A;  1ZK8 A;  4M3D A;  1RR7 A;  2O38 A;  4B4C A;  5EG0 A;  2KDZ A;  3W6V A;  1APL C;  3FK6 A;  2DA6 A;  3GTL J;  2ID3 A;  2LD5 A;  2JA5 J;  1RIO A;  4S0H B;  2R5Y B;  3FKI J;  1WH6 A;  2HQ5 A;  2KZ8 A;  4AUX A;  4Y42 A;  4YBA A;  1RZR A;  2DA2 A;  3TP3 A;  1ENH A;  2MW8 A;  4MFE A;  2L7Z A;  3IH2 A;  2XSD C;  3D1N I;  2PE5 A;  1UMQ A;  5GP9 A;  2JA8 J;  4D5F A;  3GTQ J;  4O8B A;  3OMT A;  5E3M A;  4BBS J;  1IC8 A;  3BTL A;  2YU9 J;  2OFY A;  4XIC A;  1K83 J;  4B3A A;  4L5E A;  1B72 B;  4DYR A;  1PNR A;  4W97 A;  2CRO A;  1TC3 C;  4M3G A;  1BA5 A;  2K9N A;  4QTR A;  1PUF B;  1A6I A;  4XRS A;  1ZS4 A;  3A01 B;  4JCX A;  2DA3 A;  4C2M J;  3BQY A;  3JR9 A;  5A7L A;  2WB1 N;  1ZKG A;  4MO7 A;  4B1R A;  4PU3 C;  2DA1 A;  3IH3 A;  3CMY A;  1MNM C;  1QP4 A;  5M5X J;  3A03 A;  5IYB J;  2HXI A;  2M0C A;  1XG1 A;  4AC0 A;  4QIW N;  2LCV A;  2K9Q A;  1WH8 A;  2XIU A;  4FE4 A;  4Z5D A;  5E3L A;  3Q3S A;  4D5C A;  1ETV A;  2H1K A;  3BR3 A;  4DYC A;  1NER A;  2H8R A;  1ETO A;  3BTI A;  1F36 A;  4I6R A;  2HOS A;  1JT6 A;  5EDN A;  4EEF G;  3S1Q J;  4Z5H A;  2R5Z A;  1QP7 A;  2M2E A;  2LKX A;  3LSR A;  2IUO A;  3G7D A;  3JRH A;  1ETK A;  1BL0 A;  2ME0 A;  2KPJ A;  2M34 A;  3BR2 A;  3S2D J;  3QQ6 A;  3SCG A;  4Z59 A;  2JCG A;  1VF9 A;  4Z58 A;  1LFU P;  2WIU B;  1LFB A;  2JN6 A;  4XRM A;  1JUM A;  4QSH A;  1OCP A;  2EZK A;  5K7H A;  3GTK J;  4Y7N J;  2ELK A;  3F6W A;  2ID6 A;  4BY1 J;  2XB0 X;  4X4H A;  3OP9 A;  5F08 A;  1JFS A;  5EGO B;  1Z77 A;  1JH9 A;  4JX5 A;  1QP0 A;  3BTC A;  2PUD A;  3ZQI A;  4UUT A;  1D5Y A;  2GBY A;  3RKQ A;  3FMY A;  2GRL A;  1ZZ7 A;  3HGG A;  3JRI A;  2KT0 A;  2ME6 A;  1B8I A;  3OQO A;  3TRB A;  4NDL A;  5C3E J;  1FJL A;  1JTX A;  5EGO A;  2OR1 L;  1ZAY A;  5IP7 J;  5EZH A;  2LYJ A;  2XRL A;  3SFI A;  2QF7 A;  2LYP A;  2XPU A;  3ZKC A;  3CDL A;  1ZZ9 A;  2X48 A;  1HLV A;  2HDD A;  3GTJ J;  1JGG A;  3GTO J;  2HOA A;  2HYJ A;  2IV1 A;  2PUF A;  4PU7 A;  1X57 A;  2DMT A;  3SDG A;  2NS7 A;  5M3M J;  2LTP A;  4M3B A;  3TP0 A;  3BR0 A;  2M9H A;  3HOW J;  4A3E J;  1CQT A;  1UXC A;  2FX0 A;  2MEZ A;  4A3K J;  4X4I A;  3KZ3 A;  2DMU A;  1F43 A;  4IA8 A;  2DJN A;  2OF7 A;  2VPR A;  1DW9 A;  2GLO A;  1L1M A;  2LY9 A;  2E2J J;  2NVY J;  1JWL A;  4I76 A;  3LSG A;  4ABZ A;  1TWA J;  3RZO J;  1ZZ6 A;  2IVQ A;  2KEJ A;  2G0E A;  3CLC A;  3GBF A;  1Y7Y A;  1ZZ8 A;  1WH5 A;  2LR8 A;  3DEW A;  2XJ3 A;  1AKH B;  3ZOB A;  1HDP A;  2IU7 A;  1RPE L;  4NDW A;  4A3G J;  4A3D J;  1QRY A;  2WUS R;  2TRT A;  2LLK A;  1OCT C;  3G1L A;  3ZQF A;  2AW6 A;  2FJ1 A;  4FTH A;  1PUF A;  2JA6 J;  1MSE C;  2LYR A;  2NS8 A;  5JLX A;  1PRU A;  1HCR A;  3PO2 J;  2VUM J;  2WV1 A;  3TW7 A;  1DWK A;  2EBY A;  2L7F P;  3H0G J;  1FIP A;  3HKZ N;  3QWG A;  1U78 A;  2PUE A;  4IWR A;  4FIS A;  2DA4 A;  3M3Y J;  1UG2 A;  2VKV A;  2Y9Y A;  4FE7 A;  1B0N A;  5E3N A;  3GTG J;  1JUP A;  1RKW A;  1S7E A;  4MCT A;  1ETY A;  1QQA A;  2OPT A;  3ZQC A;  3S1M J;  1UTX A;  1XWR A;  1Q1V A;  5GPC A;  1IV6 A;  2KEK A;  2EBI A;  3HB9 A;  3LOC A;  3B7H A;  2R5Y A;  3S15 J;  9ANT A;  3SCH A;  1WGX A;  5FKK A;  4FN3 A;  1X2N A;  3BG3 A;  1X58 A;  2PMZ N;  5C44 J;  2R0Q C;  1X2L A;  1U9O A;  2AXZ A;  5EG0 B;  3C2B A;  1LMB 3;  3FK7 A;  4A3F J;  1RKT A;  1RZR D;  5FKN A;  3S2H J;  5BNG A;  4Z5C A;  2CQX A;  1AU7 A;  2LYQ A;  3GN5 B;  3O9X A;  1R69 A;  4X1E A;  1QPZ A;  4I6U A;  3IV5 A;  2R63 A;  1RZS A;  4BY7 J;  2DTZ A;  3QPL A;  1ZZB A;  2N8G A;  4X4C A;  2BJC A;  4DYQ A;  1T56 A;  3JRC A;  2L49 A;  1SQ8 A;  2BNN A;  2EWT A;  2COB A;  3UFD A;  3BDN A;  4A3J J;  2E2H J;  2W48 A;  1RES A;  5FKM A;  1BW5 A;  4CYC B;  3S1R J;  1GT0 C;  4RBO A;  1ETX A;  2DMP A;  1I50 J;  1O4X A;  2DMN A;  3JXB C;  1ETW A;  1DU0 A;  2HXO A;  3JRA A;  5FKL A;  4X4G A;  1YSE A;  4FBI A;  3BTJ A;  1X2M A;  3QPS A;  3JRB A;  1W0U A;  3S1N J;  3BR6 A;  3HOX J;  3PO3 J;  1QPI A;  2PUC A;  2FJR A;  5EYR A;  2PUA A;  2Y31 A;  3HBL A;  1MBG A;  5K7F A;  4C3I J;  2PPX A;  3QF3 A;  4IVZ A;  3O8H A;  3FYA A;  3BT9 A;  4M3E A;  3QYX A;  4GQM A;  2XGC A;  3JRE A;  1GDT A;  1IJW C;  4V2G A;  3RQI A;  5IPA A;  4CYC A;  3E7L A;  1NTC A;  4JCY A;  5FJ8 J;  4F8D A;  3I4M J;  1MBF A;  1PRV A;  1YRN B;  4DZJ A;  1PRA A;  1ZPQ A;  3LSP A;  4OB4 A;  4J1X A;  3LNQ A;  3OQN A;  1JKO C;  2EF8 A;  2CUF A;  1P7I A;  2B63 J;  2Y0S N;  1WPK A;  1LE8 A;  1MBE A;  2ECC A;  3Q0W A;  4LOC A;  1FIA A;  2LP0 A;  1PER L;  1TWC J;  1WI3 A;  3RZZ A;  1MBK A;  1POU A;  3NAR A;  4JX6 A;  5F1J A;  2GRM A;  4JYK A;  2JJ7 A;  1UHS A;  5FLM J;  1JKQ C;  3SCF A;  3TED A;  3EUS A;  1GUU A;  4JX4 A;  1MBH A;  1CJG A;  4IHV A;  2EQR A;  2QCO A;  3U3W A;  1NK3 P;  3UKG A;  3PM1 A;  3HM5 A;  4A3L J;  2HOT A;  4Y52 J;  1JJ6 C;  2E2I J;  5HOD A;  3BG9 A;  2CQQ A;  3MLF A;  1H89 C;  1FTZ A;  1NEQ A;  1ITY A;  4C3H J;  4PU4 C;  3HOU J;  3O8G A;  2CJJ A;  3G5G A;  1VPW A;  4M6V A;  5F0C A;  1U8B A;  3ZQG A;  2JA7 J;  3JXD L;  3LIS A;  2R1J L;  2GZU A;  1ZZC A;  2HI3 A;  4YG7 B;  1P7J A;  1RET A;  5DS9 A;  4V2F A;  1OFC X;  1TWH J;  5EZG A;  3GBG A;  3H5T A;  1AKH A;  1JFT A;  3HDD A;  1UXD A;  1XS9 A;  1HDD C;  1LQC A;  3KXA A;  1EFA A;  4BKX A;  5C4J J;  3HOV J;  1MH4 A;  2L0K A;  4D7M A;  2B5A A;  5GPA A;  4BXX J;  1FEX A;  2I10 A;  1FTT A;  2FD5 A;  1GV5 A;  5C4X J;  3IVP A;  1LLI A;  3A02 A;  4I8T A;  1VI0 A;  1DU6 A;  1ZR4 A;  3F52 A;  5EF6 A;  1JKP C;  2AWI A;  1OSL A;  3ZHM A;  3BS3 A;  3KJX A;  2IAI A;  2CRG A;  3CRO L;  5M5W J;  2NVX J;  2LYS A;  3VK0 A;  4UUS A;  1I6H J;  1LCD A;  3WHB A;  3OOU A;  4A93 J;  1JUS A;  4A69 C;  4A3C J;  4A3B J;  4AYB N;  4G12 A;  5FKO A;  4GFB A;  3OQM A;  4C3J J;  2JK3 A;  2XGD A;  3B6C A;  3G1M A;  1K61 A;  2LVS A;  3MN2 A;  1IRZ A;  2XI8 A;  1Y9Q A;  4GHJ A;  2TCT A;  3DNV B;  3F51 A;  2XB5 A;  2IVB A;  1OJL A;  4X4D A;  3S8Q A;  4I6T A;  2PIJ A;  5F0H A;  4JP0 A;  2L7M P;  1G2H A;  1JJ8 C;  1BW6 A;  1ZGW A;  3HZI B;  2K9S A;  1W0T A;  3S17 J;  2XGE A;  2E1O A;  2PUB A;  2DA5 A;  5IOY A;  3JRD A;  1POG A;  4FCY A;  1HF0 A;  5IP9 J;  1E3O C;  2O8K A;  3LFP A;  1WET A;  1WIZ A;  3GTM J;  2L8N A;  2O49 A;  1ORK A;  2Y30 A;  2YS9 A;  1WCM J;  3HOZ J;  3CEC A;  1B8I B;  2P81 A;  2EZH A;  2X9D A;  2MGQ A;  1WH7 A;  4XK4 A;  2CUE A;  1MSF C;  2WAQ N;  3ZQL A;  2NOG A;  3FYM A;  2JMW A;  3OIO A;  4PU8 A;  3TW6 A;  1Y1V J;  2LYL A;  3PXP A;  1JTY A;  2DMQ A;  2A6C A;  4M3F A;  2EZI A;  1BJZ A;  1JT0 A;  3DCF A;  3JRG A;  2DN0 A;  5M3F J;  2YUS A;  4UUS B;  2O7O A;  3L1P A;  2ECB A;  2ZB9 A;  2Y9Z A;  1MBJ A;  2AXV A;  2HSG A;  4YG4 A;  1AHD P;  2LFB A;  4DZP A;  5J1Y A;  2K40 A;  4MFD A;  5EEA A;  2MSY A;  1Y1W J;  2NVT J;  1XC5 A;  2Y2Z A;  2XPV A;  1VND A;  2X6O A;  3G1O A;  3RZD J;  1NK2 P;  2R7Z J;  1IDZ A;  2R5Z B;  2JWT A;  1R9T J;  3S14 J;  2EZL A;  1IG7 A;  1Z0X A;  2BNO A;  2IVG A;  1B72 A;  4J19 A;  1GV2 A;  3GTP J;  5IYD J;  4X6A J;  2PUG A;  1QVT A;  4IHW A;  1SFO J;  4IHX A;  2KEI A;  2AO9 A;  5M5Y J;  2RAE A;  1GVD A;  5IOZ A;  3HOY J;  1A5J A;  4BBR J;  3CCY A;  5F27 A;  3A01 A;  2R92 J;  3BD1 A;  2MG4 A;  3FIW A;  5F0F A;  1IUF A;  2EH3 A;  2IBD A;  3BR5 A;  2VKE A;  2FQ4 A;  4I6Z A;  4YAR A;  1QQB A;  1HOM A;  3BR1 A;  4DW6 A;  4XID A;  1JKR C;  3H3V K;  3ZHI A;  1RPW A;  4RDU A;  2JVL A;  4W1U A;  2VI6 A;  4MIM A;  1LCC A;  2LYK A; 
#chains in the Genus database with same CATH topology
 1GVJ A;  5B1B H;  3A2K A;  3I4N J;  1RRJ A;  2VJJ A;  1N25 A;  2LK2 A;  3IH4 A;  5HDG A;  3MKL A;  2VE9 A;  3FBN B;  2ZKZ A;  3G73 A;  2VKH A;  3WG7 H;  4LLG F;  4L5J A;  1LEB A;  4FX0 A;  4EKG A;  4Z6Y A;  1H88 C;  4FHT A;  2AHQ A;  2FA5 A;  3MEX A;  2BW3 A;  1R63 A;  4EGZ A;  1Z9C A;  1DQU A;  5FLV A;  3WU0 A;  1V5F A;  4A12 A;  2GM4 A;  4X4B A;  5B66 C;  1O3S A;  1XGM A;  3FMR A;  4XLC A;  3G0T A;  4F92 B;  1KU2 A;  1MIJ A;  1XD7 A;  2YR2 A;  3TDU C;  2P7C B;  3WHC A;  2O4A A;  2YU3 A;  1IDY A;  3Q9V A;  2BE5 F;  1P4X A;  4IHY A;  4CCJ A;  2CSO A;  1OMI A;  2PFB A;  3I71 A;  3KYD B;  1H8A C;  3ZQH A;  2F4O B;  3BZC A;  2BNM A;  3EYI A;  4CA0 A;  4IHT A;  1I3Q J;  2KJB A;  1U5T A;  5L3G A;  3M4O J;  4HW0 A;  3TL4 X;  4HLX A;  1S7O A;  4CHU A;  3HUG B;  2AQF A;  5D8L B;  3HSE A;  3KET A;  3F0C A;  1GXP A;  3S8P A;  1D8J A;  1AWC A;  5DUK A;  4BJ6 C;  2W57 A;  2E5N A;  4E7L A;  4XRS G;  1K6Y A;  3I58 A;  3BCA A;  3CCE I;  5D4R A;  3LSJ A;  4HQE A;  4A3M J;  1YJW I;  4NUB A;  5D6E A;  3LSI A;  2KRH A;  4OIN F;  4KNY A;  5EG0 A;  2KDZ A;  3W6V A;  4L18 B;  2A07 F;  1APL C;  3FK6 A;  2QYO A;  3IWF A;  4YII A;  2F2E A;  1RIO A;  1OR7 C;  1RI7 A;  2M0M A;  4BDZ A;  4HV5 A;  4EJT A;  1EH8 A;  2V26 A;  2KZ8 A;  2BGC A;  1VQL I;  1Y56 A;  1ENH A;  2VC0 A;  3DFG A;  2MW8 A;  4ENK A;  3HTS B;  2DT5 A;  2DPD A;  1IN8 A;  5DCM A;  3SR4 A;  3ABT A;  3QOD A;  2JA8 J;  3GTQ J;  4O8B A;  3F23 A;  2VBY A;  4NQW B;  1IC8 A;  1BR1 A;  2YU9 J;  4IF4 A;  1VQ5 I;  2VBZ A;  3TEP A;  5CKT A;  3QP5 A;  2CRO A;  3L00 A;  3MQ0 A;  3S32 A;  4EQZ A;  2PXQ A;  4Z2Y A;  4M3G A;  4GRI A;  1KU3 A;  1TBX A;  4QTR A;  1J9I A;  1A6I A;  4ESJ A;  4JK1 X;  4NC6 A;  1ZS4 A;  3A01 B;  1YLF A;  3K70 D;  1LFP A;  1B9M A;  2GAU A;  3GZC A;  5A7L A;  1NH3 A;  2RNJ A;  2WAE A;  4PU3 C;  3M9A A;  1Y0N A;  2MYS A;  1MNM C;  3RDI A;  2VQC A;  3L9F A;  5IYB J;  2M0C A;  4XN0 A;  1UG0 A;  3U2R A;  5HLG A;  5E3L A;  2ISY A;  1ETV A;  3ZP5 A;  4E7Z A;  4ZH4 F;  2VT3 A;  3OS2 A;  1YYV A;  1F36 A;  3QU3 A;  5J6X A;  3BDD A;  1QNT A;  2HOS A;  2IA0 A;  5J4Y A;  4EEF G;  4Z5H A;  2K3P A;  3TOB A;  3HJE A;  5K5R A;  2CWE A;  4PSW A;  1S72 I;  3G7D A;  3JRH A;  3FMS A;  2FXA A;  2JSP A;  2M34 A;  3QQ6 A;  2M4K A;  4PFP A;  2A3S A;  4IKF A;  3AG2 H;  4Z59 A;  4QSH A;  1FY7 A;  1OCP A;  2EZK A;  3CC7 I;  3ABU A;  5AON A;  5ED4 A;  4BDY A;  2ID6 A;  4RB0 A;  2BXY A;  3RTR A;  4X4H A;  2BEO A;  3GW2 A;  1EA3 A;  4A0Y A;  1ZG1 A;  1QP0 A;  4JX5 A;  3E6C C;  5HS8 A;  3ZQI A;  1J59 A;  3V7C A;  1VQP I;  3R60 A;  4KN7 X;  4N0B A;  4ZTJ A;  3F8F A;  3OR2 C;  4U0W A;  2KT0 A;  1MMD A;  3TRB A;  1XCV A;  4EM1 A;  1J5Y A;  3VWS A;  4RGU A;  3J80 K;  1IO2 A;  2IPQ X;  4BJ5 C;  2LNM A;  5JR3 A;  2OR1 L;  5EZH A;  1YHQ I;  2OZU A;  3F21 A;  2VAS A;  2QF7 A;  5K5Q A;  1GHC A;  2LYP A;  3ZKC A;  1MJA A;  3KZI C;  2X1E A;  2HQA A;  1HLV A;  2HDD A;  2Q0O A;  4CCN A;  2HYJ A;  2OCE A;  3C7J A;  3E6B A;  3ZQQ A;  2PUF A;  4BUP A;  2NS7 A;  2LTP A;  4B8X A;  2L54 A;  3TP0 A;  3VSK A;  2BV6 A;  2PEX A;  2D45 A;  2MEZ A;  1L0O C;  2O03 A;  3TGN A;  1F43 A;  2PBI A;  1L1M A;  2F48 A;  2FBH A;  3HOS A;  2JQ7 A;  2VBW A;  4M6Y A;  2FF4 A;  3RZO J;  2KEJ A;  5F6F A;  3CMA I;  4M6X A;  1Y7Y A;  2Q2E A;  3GO5 A;  3DLA A;  4EM0 B;  3ZOB A;  2DXI A;  5CLS A;  4P96 A;  4OAY A;  2VON A;  3MAJ A;  4NDW A;  1QRY A;  2QM3 A;  2TRT A;  4HRI A;  1OCT C;  4ENJ A;  3KEO A;  1BC7 C;  2YSR A;  1PUF A;  4L9N A;  4DE9 A;  3HRU A;  3OR1 C;  3MMY B;  3TW7 A;  4ZDO A;  2XXA A;  2EFO A;  4XN3 A;  1TW3 A;  1JHF A;  2VKV A;  3CD6 I;  3GUD A;  4JBA A;  3LWF A;  3SZP A;  3VYR B;  3LFU A;  3MFK A;  4WXD A;  2V6C A;  5E3N A;  3ZRG A;  3VYU B;  5A2Q K;  4MCT A;  2X4H A;  1QU3 A;  5KK1 A;  2OPT A;  1U6G A;  1ZG3 A;  1UTX A;  2X6W A;  1Z3X A;  2BXZ A;  1B59 A;  4Y3O A;  5GPC A;  4LIT A;  4IOA F;  3W2A A;  2RN7 A;  3S15 J;  4BAY A;  2XXP A;  2LRD A;  1FT9 A;  4BNC A;  2K02 A;  1WGX A;  1K78 B;  1X2N A;  3BG3 A;  1X2L A;  2PMZ N;  2PN6 A;  3CMM A;  3FK7 A;  3R0J A;  4KYW A;  4PGH A;  5FKN A;  2L01 A;  2ZFU A;  3GN5 B;  1G4D A;  3QYB A;  2R7W A;  3PIP F;  4HNU A;  4I6U A;  2R63 A;  2H27 A;  3WTV C;  1RZS A;  2J7U A;  4X4C A;  4DYQ A;  1T56 A;  1D8K A;  3E3V A;  1V55 H;  3OMY A;  2E2H J;  4KIB A;  4Y4R A;  1VTN C;  2V1U A;  2ICW G;  1GT0 C;  2ZNZ A;  1ETX A;  4RBO A;  1N75 A;  3DBR B;  1FP1 D;  2DMN A;  1ETW A;  4R8H A;  3RCO A;  3T8T A;  4XSX F;  2QA4 I;  1DU0 A;  3JXB C;  3MZY A;  5D5V B;  3W6J B;  2H6C A;  3GZ5 A;  4IL6 C;  3GX4 X;  3KEQ A;  4IQ4 A;  1W0U A;  4PJL A;  2OQR A;  3BR6 A;  3ROU A;  3RPQ A;  5EYR A;  2Z3Y A;  2GA1 A;  2ZJ2 A;  4ENN A;  2Z16 A;  3FYA A;  1S8N A;  2P6T A;  1P92 A;  4RB2 C;  5LGT A;  3RIR A;  3ZXS A;  3I4M J;  3JSO A;  2PXF A;  1PP8 F;  3F8M A;  4BL0 B;  4OB4 A;  2GIZ A;  5AIP A;  1USS A;  1P7I A;  2VBX A;  1WPK A;  2WC2 A;  2HQR A;  2JPB A;  1MBE A;  2CFX A;  5D5W B;  4DQ2 A;  1FIA A;  3NXH A;  2MH9 A;  2NVU B;  1QZY A;  3CO6 C;  1MBK A;  3NAR A;  4JX6 A;  2JJ7 A;  4GYI A;  3R6S A;  1XGN A;  2QBY B;  3DQV C;  2JRT A;  5FLM J;  1GUU A;  4LG3 A;  1OCZ H;  1GXQ A;  1FNN A;  2M8E A;  2ZJP F;  3O3K A;  3PM1 A;  5ERI A;  2QSH X;  4WWC A;  2OJE D;  1H89 C;  1MMG A;  2DK5 A;  2M7B A;  5FRN A;  5J40 A;  4PU4 C;  2ADU A;  3O8G A;  2VJ5 A;  3DPU A;  3G5G A;  2XF7 A;  4M6V A;  4U88 A;  1WVR A;  4XM3 A;  3WTY C;  3JXD L;  2R1J L;  4UXN A;  3ASN H;  1O7L A;  4WCG A;  2PLY A;  2GZU A;  4RGX A;  1UCR A;  4CGZ A;  3NZL A;  1DPU A;  1MZB A;  3ERM A;  3KFW X;  4AM3 A;  1F5T A;  1B1B A;  1ZGA A;  1JFT A;  1VQK I;  4PZJ A;  4HA8 A;  1HKT A;  1E0E A;  1XS9 A;  1IN6 A;  1LQC A;  4KN4 X;  3GFM A;  2ZJQ F;  3HOV J;  1MH4 A;  4LJZ F;  4JQF A;  2D1H A;  5ILV A;  5DM7 F;  5DV5 A;  4GDF A;  2HFZ A;  3RQ4 A;  4CIC A;  2K85 A;  4FX4 A;  5GPA A;  3LMM A;  4WF2 A;  4S05 A;  3IVP A;  3GFI A;  1LLI A;  4KIF A;  1JKP C;  2AWI A;  1OSL A;  3BS3 A;  3IHU A;  1KZH A;  2CRG A;  2NVX J;  1OCC H;  1B4A A;  1OCO H;  2L3D A;  2L9S A;  2MD5 A;  1K79 A;  3WHB A;  1HQC A;  5GAE J;  5HLT A;  4A93 J;  4A69 C;  4A3B J;  2QUF A;  4ZDP A;  5FKO A;  4ZYH A;  3N4M A;  4GFB A;  3UR3 C;  1KYZ A;  3G1M A;  2XGD A;  3B6C A;  5H6Q A;  1XGO A;  2XAQ A;  1IRZ A;  5KNL A;  4C2T A;  4GHJ A;  3DNV B;  3WE2 A;  3CCV I;  1HA8 A;  2IVB A;  2P5V A;  1U8R A;  3RSN A;  4I6T A;  2PIJ A;  3IWZ A;  2LG4 A;  5CVU A;  3KP6 A;  2EK5 A;  2BBY A;  2L7M P;  4HST A;  2PXL A;  3VOE A;  1BW6 A;  1UST A;  1ZGW A;  2DBB A;  2K9S A;  4V19 K;  1YJ9 I;  4U7D A;  1R1U A;  2PUB A;  4H4K C;  5ILU A;  2DA5 A;  1HF0 A;  1E3O C;  2O8K A;  2VQG A;  2WY7 Q;  2L8N A;  2D1V A;  3K4L A;  2Y30 A;  2YS9 A;  2BY2 A;  3CES A;  2JA2 A;  2EZH A;  4RM3 A;  2ZME C;  2M45 A;  3J7Y J;  4YFN F;  4ANJ A;  2XAF A;  2ZFW A;  5ICC A;  3V8K A;  3WOD F;  2NOG A;  4BE1 A;  4PU8 A;  3IC7 A;  3WTW C;  3ULQ B;  2NXN B;  1JTY A;  4PJ0 C;  2R4G A;  3VYS B;  1SVO A;  2YUS A;  4UUS B;  3FZV A;  2AXV A;  3SHF A;  5FRM A;  2HTS A;  1LKX A;  4DZP A;  1R1V A;  4MFD A;  4DNC A;  5KHD A;  2CO5 A;  1ZN2 A;  3V4G A;  4I2O A;  2E7X A;  5TGT A;  3PSI A;  3AG4 H;  2P8T A;  3PNT A;  2PJR A;  1DPR A;  1P4W A;  2BHY A;  1YO5 C;  1Z0X A;  2XKO A;  3AKZ A;  1W5S A;  2RRE A;  5EJC A;  1SFU A;  3KYC B;  2IVG A;  1PYV A;  1GV2 A;  4II2 A;  5IYD J;  5K5O A;  4IX7 A;  3I53 A;  5FFZ A;  2EFN A;  3VSL A;  1W5T A;  2YX7 A;  2AO9 A;  2VJ4 A;  2RAE A;  2R7R A;  1T39 A;  3N97 A;  2PXV A;  3EUH A;  1FBQ A;  1OPC A;  2WY8 Q;  5F27 A;  4XKB A;  5J8F A;  1G3T A;  3A01 A;  1LNW A;  3FIW A;  2P5K A;  3H9G A;  2KMU A;  4YAR A;  2FQ4 A;  1X1B A;  1HOM A;  3BR1 A;  2LF7 A;  1D0Z A;  2IVM A;  2DLL A;  4DW6 A;  2NOJ B;  2KLO A;  4XBF A;  4L9J A;  2QBY A;  4IRI A;  4RDU A;  5E20 A;  2JVL A;  3QOP A;  1J75 A;  2Y69 H;  2VEO A;  2VI6 A;  2XGX A;  2K9L A;  2LYK A;  3V42 A;  4NQW A;  3LQX A;  2DJI A;  3HEF A;  3RI4 A;  2QKM B;  4E7J A;  1D1A A;  5KVR A;  3E6D A;  2IEK A;  1W36 D;  2F5D A;  5LGN A;  5LRS A;  4KIS A;  1ZUG A;  2O61 A;  2HIN A;  1YRN A;  1ZR2 A;  4BXF A;  3SJM A;  4BH9 A;  2V9P A;  1Z6R A;  2HGC A;  1ZTR A;  3PSF A;  2CV0 A;  1ETQ A;  5K98 B;  3JRF A;  4XLA A;  4XLN F;  2EIK H;  3OYL A;  3OYM A;  1TWF J;  1YS7 A;  5IP6 A;  1LE8 B;  3TFL A;  3HTU A;  3BC8 A;  2C6Y A;  2DOA A;  2ZSI B;  2CU7 A;  2DA7 A;  2LRE A;  1LDD A;  1W36 C;  4BE2 A;  3PFI A;  3QFI A;  3CQZ J;  1IGN A;  1X3U A;  3HRM A;  2ICT A;  1DUL A;  3CCJ I;  2HCS A;  1XTA A;  2Y0M A;  4HNV A;  1G3S A;  3CC4 I;  2P4W A;  5GAH J;  4CO8 A;  3TEL A;  3S16 J;  1HQ1 A;  2DFE A;  3SQN A;  2QEX I;  2AUW A;  2H6B A;  2HVQ A;  4CZZ A;  1J7K A;  3P9I A;  4EJU A;  2AXU A;  2I8D A;  3DBL B;  1X4P A;  5LHG A;  5J1U A;  2UV1 A;  3SYT A;  1D0Y A;  3KLN A;  1MW7 A;  2OU2 A;  4D7N A;  4J1W A;  4PFO A;  4X4E A;  3K70 C;  2F4M B;  2HKX A;  1MH3 A;  2ZXH A;  5IYC J;  2OCC H;  3OY9 A;  1YI2 I;  1Z91 A;  3FXQ A;  1R00 A;  4XLF A;  4LFU A;  3D0S A;  4PJN A;  1FX7 A;  3D5R C;  1ZLK A;  3LQR A;  2V9V A;  4FET A;  4HF0 A;  1ZK8 A;  1TQI A;  2X6Y A;  2DDA A;  2ACJ A;  2JA5 J;  4S0H B;  2R5Y B;  3F8N A;  2GOM A;  4I02 A;  3F6V A;  2HQ5 A;  3D5S C;  4M9Z A;  4EMS A;  4YBA A;  2IW5 A;  3ECH A;  2ZSH B;  4XLE A;  4PJM A;  3IH2 A;  5BPI A;  3PUB A;  2XSD C;  2PE5 A;  2W85 A;  2M4H A;  4D5F A;  1SAX A;  1QQI A;  3OMT A;  1Y0U A;  3FMQ A;  4BBS J;  3BTL A;  3A1Y A;  3FXL A;  3E5Q A;  1OYI A;  3LL7 A;  4YEL A;  4E4H A;  1K83 J;  4XIC A;  3WGI A;  4L5E A;  4DYR A;  1BI3 A;  4IHS A;  1Y6I A;  1VQ6 I;  4WXH A;  3IKV A;  3ERE D;  2IS4 A;  2O0Y A;  4NC7 A;  2DT7 B;  5FGM A;  2EFP A;  2DA3 A;  2F6C A;  5D8K B;  5HOO A;  1KU7 A;  4EZI A;  3BQY A;  3JR9 A;  2V1N A;  1VZ0 A;  1ZKG A;  4B1R A;  2DA1 A;  2FML A;  4I0A A;  4B43 A;  3CMY A;  3A03 A;  2HXI A;  2LCV A;  2K9Q A;  2DDB A;  4FE4 A;  1IN7 A;  3Q3S A;  1SFX A;  5JVG F;  2J5P A;  1S29 A;  1EH6 A;  2MFZ A;  3BR3 A;  4DYC A;  3L2C A;  2H1K A;  2YX4 A;  1SD7 A;  3BTI A;  3U1D A;  4KFC A;  1JT6 A;  3S1Q J;  2X1D A;  2R3S A;  4I99 C;  5JVT A;  5KAF C;  2AXT C;  2MH2 A;  2QLZ A;  2QWW A;  4KDP A;  4E7K A;  2JCG A;  4ETS A;  1LFB A;  4XRM A;  3ME5 A;  1JUM A;  2VXD A;  5K7H A;  2Q2E B;  1OR7 A;  4Y7N J;  2F5F A;  2KIF A;  1X19 A;  1I1S A;  4BY1 J;  4LK0 F;  2XB0 X;  1FSE A;  2FOW A;  5EEG A;  4PSX A;  3OYI A;  1QGP A;  4Q2J A;  3OP9 A;  5HDN A;  1JFS A;  1FYL A;  3IRR A;  3SZT A;  4Q47 A;  3IKT A;  2DW4 A;  2JT1 A;  3UWP A;  3FMY A;  5F64 A;  2QSG X;  1WJ5 A;  3PJR A;  2GRL A;  1FOY A;  4LG0 B;  3HHH A;  4LMY A;  1B8I A;  3JSP A;  3OQO A;  3HSR A;  2VOD A;  2M4G A;  3ISP A;  4NDL A;  4QWQ A;  5C3E J;  1U5T C;  1JTX A;  5EGO A;  2HU9 A;  4QPO A;  2QQ9 A;  1MKM A;  2PXU A;  5B5E C;  3MKZ A;  1UZC A;  2NAZ A;  2VE8 A;  3GTO J;  3GTJ J;  2HOA A;  3U21 A;  2OC6 A;  3RJP A;  1X57 A;  2HPI A;  3SDG A;  3T5X A;  2DCE A;  3L7W A;  1JXS A;  1CQT A;  3ABK H;  4IVN A;  1UXC A;  2KDO A;  3CJT B;  3KZ3 A;  2DJN A;  2OF7 A;  3K4J A;  3QU6 A;  5FD5 A;  4PUS A;  2E2J J;  1JWL A;  3WGG A;  3J81 K;  1UHM A;  3DP7 A;  3DU5 A;  4CDG A;  2CW7 A;  1SFE A;  3OL3 A;  4XOP A;  2R7D A;  2HVR A;  2LR8 A;  1HDP A;  2O5R A;  1U3E M;  3OYH A;  2WUS R;  3MEJ A;  3ZQF A;  4HPQ A;  1K4S A;  4M71 A;  2JA6 J;  1MSE C;  1IXS B;  1BN5 A;  1WJD A;  2Y0S A;  3VWB A;  2VUM J;  2WV1 A;  3A9Z A;  1DWK A;  2OV7 A;  4FQG A;  2XAG A;  3H0G J;  2O3F A;  2PUE A;  4FIS A;  4BHC A;  2WBM A;  2XV4 S;  3W3C A;  1EV7 A;  2KRF A;  4EM2 A;  2R7U A;  3H92 A;  2MD0 A;  3WU1 B;  4AU7 A;  1YIT I;  5HLI A;  4E70 A;  2R7T A;  4HNT A;  3JAM Z;  4R1H A;  3QOX A;  1ZG5 A;  2RQQ A;  3FXM A;  2E36 A;  3LAJ A;  1UFM A;  4OIO F;  1TW2 A;  3LOC A;  1A35 A;  9ANT A;  1XSV A;  1RC9 A;  4CCO A;  4FN3 A;  2EJR A;  1X58 A;  2AXZ A;  2R0Q C;  5D5X B;  1LMB 3;  1U9O A;  1SD4 A;  3C2B A;  4KMF A;  1R4M B;  1MJB A;  3O9X A;  4LLL A;  1AU7 A;  3IAM 2;  1NW3 A;  2HZD A;  1A6Q A;  2A68 F;  1R69 A;  4S04 A;  4YFK F;  2M87 A;  3WE3 A;  3DU6 A;  4BY7 J;  2DTZ A;  3QPL A;  1ZZB A;  2BJC A;  1T38 A;  3PL8 A;  1OQY A;  2OBP A;  2BNN A;  2COB A;  1DGR M;  2IS2 A;  3BDN A;  1WKM A;  1U5T B;  2W48 A;  3L2Q A;  3P7N A;  1ZRF A;  2E7W A;  4C2U A;  3FBI B;  2M5W A;  3C2G A;  1I50 J;  4U7B A;  1QHG A;  5DEQ A;  4BU2 A;  4EKI A;  4AVZ A;  2E1N A;  3KPH A;  5FKL A;  2VN2 A;  1X2M A;  3HHG A;  3QPS A;  1LDJ A;  4IO9 F;  3S1N J;  3PO3 J;  1QPI A;  3OYE A;  3OYF A;  2E71 A;  1FZP B;  1ZAR A;  2JUG A;  4PDK A;  1MBG A;  1OLT A;  1KGS A;  4YIR X;  3BPV A;  3O8H A;  1A36 A;  5LEJ A;  2WV0 A;  4HG2 A;  4I98 B;  3GYH X;  3QYX A;  2BHZ A;  1REP C;  4V2G A;  4BJT A;  2HCN A;  3WU2 C;  3J81 Z;  2EIN H;  4JCY A;  2HTJ A;  6PAX A;  3DPL C;  3CDH A;  4BXU A;  2LY2 A;  3T8R A;  1PRA A;  3WTT C;  2GWR A;  1ZPQ A;  3U1K A;  3LSP A;  4J1X A;  3LNQ A;  3OQN A;  1JKO C;  1ZHF A;  1PJR A;  3F3X A;  3B02 A;  5L3D A;  1WRJ A;  5FFX A;  2ECC A;  4XKW A;  1Z05 A;  3J7A Y;  3ZR8 X;  2GRM A;  3V7S A;  4EAT A;  1U2Z A;  2G9W A;  3TOA A;  3R61 A;  3AAF A;  3TED A;  3EUS A;  1HBX G;  2PI0 A;  1I27 A;  5DD8 A;  3GF2 A;  4F91 B;  1MBH A;  3B73 A;  1CJG A;  3NDB B;  4IHV A;  4KT6 A;  3ONQ A;  2HYG D;  3M8F A;  1YFH A;  1XMK A;  4KIC A;  3RPU A;  1ZEL A;  1V5E A;  3VDX A;  1NK3 P;  3UKG A;  3HM5 A;  4HDU A;  4A3L J;  2HOT A;  2LSO A;  1JJ6 C;  2O8X A;  5HOD A;  4OOI A;  1XDU A;  4AWX B;  4HDV A;  1G59 A;  1NEQ A;  3DLL F;  3EDP A;  1HC8 A;  1T0F A;  3GFJ A;  2EA2 A;  3IUO A;  4Y15 A;  1ITY A;  1QBJ A;  3L2U A;  2B7E A;  2EFQ A;  2A5Y B;  1VPW A;  5F0C A;  1U8B A;  3ZQG A;  4G6T B;  4IOC F;  2HI3 A;  2JVH A;  2ZXW H;  3MD2 A;  1RET A;  1T6S A;  1R7J A;  2KFD A;  2KIU A;  3CJQ B;  4PGG A;  1BI2 A;  4V2F A;  1IUY A;  1TWH J;  4KT5 C;  4ER0 A;  4IZZ A;  4AVP A;  4AIK A;  1F9N A;  3ZMZ A;  3H5T A;  1D5V A;  2DQL A;  3KXA A;  2HEO A;  5TJJ A;  1UAA A;  1FYM A;  4D7M A;  2R7Q A;  5F1R A;  3OIQ A;  2B5A A;  3LA3 A;  3JTG A;  5BQT A;  2I10 A;  1FEX A;  2MXD A;  1TNS A;  4XMY A;  4I8T A;  1TZL A;  3A02 A;  1VI0 A;  4I01 A;  1DU6 A;  1ZR4 A;  2ZCW A;  4HX4 A;  5EF6 A;  1T95 A;  2LMD A;  4UVA A;  2IRF G;  4AID A;  2IAI A;  4LGW A;  4ENM A;  2IJL A;  2F5V A;  4QPQ A;  4C30 A;  2F4I A;  2VPL A;  1JUS A;  4A3C J;  2FQ3 A;  2HOE A;  4G9Y A;  3MZ8 A;  1VQN I;  3OQM A;  1YW8 A;  3P5J A;  1I39 A;  4L0Z B;  3H3U A;  3CZ6 A;  2PJP A;  2WA0 A;  3DTE A;  1Y9Q A;  1LDK B;  2XB5 A;  1H9G A;  4X4D A;  3S8Q A;  3ZMS A;  1QA6 A;  1OKR A;  3CP2 A;  2XAS A;  3G3Z A;  2Z9O A;  1G2H A;  2L4M A;  3E6M A;  2LY1 A;  1JGS A;  2E1O A;  5FLX K;  1R22 A;  2DFH A;  1CF7 B;  4G6D A;  5DTR A;  2LLW A;  1E3H A;  5EEH A;  1POG A;  3JRD A;  4FCY A;  3LFP A;  4C9Y A;  2O49 A;  3KZY A;  1WCM J;  2CUJ A;  3HOZ J;  3CEC A;  3IL2 A;  4E7H A;  2QVO A;  4LG0 A;  1K6O A;  1W1W E;  1DP7 P;  4XK4 A;  4YIF A;  3KCC A;  1MSF C;  2ESH A;  1K7A A;  3NRO A;  2HQN A;  2A6C A;  4IQJ A;  1BJZ A;  2L7K A;  3PFY A;  1JT0 A;  3PE5 A;  2IGO A;  2O7O A;  4YG4 A;  2Y9Z A;  1MBJ A;  3M7G A;  4EJV A;  1K4T A;  3AL0 C;  3KZZ A;  2MA3 A;  5J1Y A;  1Z6T A;  2DFF A;  2MSY A;  1XC5 A;  3GFL A;  2FEZ A;  2XPV A;  1VND A;  3G1O A;  3PQK A;  1NK2 P;  2HDC A;  4HAM A;  1IDZ A;  2FUG 2;  2R5Z B;  5LHH A;  4XQF A;  3JTH A;  3E0J B;  1IG7 A;  2M30 A;  4A5M A;  3DBH B;  2NYX A;  1XX5 A;  5E1X A;  2BNO A;  3T0Y A;  5IT3 A;  5L3E A;  3GTP J;  1SMT A;  4HX8 A;  1P6R A;  1SFO J;  5M5Y J;  2K4B A;  3W6K B;  1NHA A;  3I59 B;  4XOR A;  2E1M C;  5D5U B;  2IS6 A;  2YBD A;  2VIX A;  4IJA A;  4AD9 A;  1IUF A;  5F0F A;  4I6Z A;  1QQB A;  5FD6 A;  2UWM A;  3K2Z A;  1YTY A;  2DOF A;  2DU9 A;  1J09 A;  4MIM A;  3BZ6 A;  1LCC A;  4ZYA A;  4F93 B;  5FB2 A;  2A61 A;  4CCK A;  2V6E A;  3B6A A;  4ASN A;  1V5G A;  5BPD A;  3K1N A;  1PP7 U;  1TL8 A;  1U0J A;  1MFQ C;  3ZN0 A;  4I7H A;  4B47 A;  1O57 A;  3ZMV A;  3O6B B;  1SAN A;  2XSJ C;  2NVQ J;  1T33 A;  3K0L A;  3GLX A;  5DTD A;  3BZK A;  4XRF A;  2CSF A;  3PUF A;  4X4F A;  4LK1 F;  2VQH A;  3HSF A;  4L0Y B;  3A0H C;  2LBF B;  2CYY A;  3DTI A;  3MKY B;  4MLO A;  4BGD A;  1OIS A;  4A6E A;  2L9R A;  1HKQ A;  3HRT A;  1W5C C;  2QQA A;  1TWG J;  3LSM A;  3KIO A;  5H6R A;  1Z1D A;  5DTM A;  2EV0 A;  3CP8 A;  3FKJ A;  4F55 A;  1P4A A;  1IXR C;  4ER5 A;  3BP8 A;  4NB5 A;  5F04 A;  2FFH A;  4JQD A;  4RLQ A;  2OAZ A;  3QYE A;  1YW9 A;  5DRY A;  5E8I A;  1QVU A;  3NAU A;  1TNT A;  3S2W A;  3BG6 A;  3QQA A;  2HDW A;  4ITV A;  4YG1 A;  5HVQ C;  2E19 A;  3WTX C;  2AS5 F;  4RAZ A;  4BE0 A;  3Q0U A;  2GXA A;  1BDI A;  2O9L A;  1ADR A;  2XRO A;  3HGY A;  2KHM A;  3OSF A;  1BJA A;  3J7A O;  4EGY A;  1KON A;  2CQ7 A;  2RNG A;  2V3C C;  1XMX A;  3W2W A;  2MQK A;  3L09 A;  2QGU A;  3RYR A;  3F9K A;  1VFC A;  2ZC2 A;  4A3I J;  4O3M A;  2TDX A;  1RR7 A;  1BR4 A;  4H0E A;  2O38 A;  1Z3Y A;  2XIG A;  5GAG J;  4OIR F;  2LD5 A;  2BYV E;  4PK4 A;  1H0M A;  1FBU A;  2A05 A;  1WH6 A;  1F1Z A;  2NNN A;  3NWT A;  1YX5 A;  2OD5 A;  1WJB A;  5HDK A;  1ZRE A;  4MFE A;  2L7Z A;  2KKO A;  3GXO A;  5LEK A;  4XOT A;  1LPQ A;  5GP9 A;  3OYN A;  3OYD A;  4ESB A;  2VJI A;  2E34 A;  5E3M A;  5CVJ A;  2GXG A;  2IA2 A;  1IAW A;  1VQ9 I;  3QWL A;  1O3T A;  3CME I;  1WJA A;  3LSH A;  4W97 A;  2X6X A;  4L9V A;  2XHK A;  5GAG i;  2K9N A;  1YE9 A;  4ZYG A;  5E17 F;  1PUE E;  3PQJ A;  2NRA C;  2BVL A;  4C2M J;  2Z99 A;  4MO7 A;  4BYY A;  3LA7 A;  1JI8 A;  3GLL A;  3IH3 A;  1G8X A;  1QP4 A;  1HST A;  5M5X J;  2K27 A;  4Z5D A;  1YOV B;  1SEU A;  1WH8 A;  3GZD C;  2UXX A;  1FSH A;  2FBK A;  2KJC A;  2H8R A;  3L2R A;  4K2E A;  1BM9 A;  5DUI A;  3MKW B;  4DOZ A;  4CXF A;  5EDN A;  1R49 A;  5DT2 A;  1Z67 A;  3S93 A;  2JZY A;  2PJR B;  3R09 A;  3IRQ A;  1UEL B;  1ON1 A;  2M2E A;  4GYG A;  3LSR A;  1VQM I;  2IUO A;  4NNJ A;  5L3F A;  3DKX A;  1ETK A;  2F5C A;  1TLH B;  2ME0 A;  2KPJ A;  3AG1 H;  3BR2 A;  2E5Z A;  3SCG A;  1VF9 A;  4XKV A;  5J47 A;  1LFU P;  4OMY A;  1R36 A;  2DOD A;  4N9I A;  4BAC A;  1WJC A;  2R7O A;  2LF8 A;  2ELK A;  4HF1 A;  2ZO4 A;  3F6W A;  2CG4 A;  1CF7 A;  4BEH B;  2M3A A;  4KMU X;  2HKO A;  4BHP A;  3K9T A;  5F08 A;  3LA2 A;  5EGO B;  2HVS A;  1JH9 A;  3BTC A;  4LIU A;  4WXC A;  5ILS A;  2PUD A;  2Z5U A;  4UUT A;  5IY5 H;  1D5Y A;  5IT9 K;  3RKY A;  3RKQ A;  3CLQ A;  3H1C A;  3JRI A;  2ME6 A;  2OZ6 A;  3HC7 A;  3TKY A;  1N77 A;  5ICF A;  2LYJ A;  4XLP F;  5KAI C;  2XRL A;  2ZNY A;  3SFI A;  4Q48 A;  3FXJ A;  3BPX A;  2CW8 A;  4YEJ A;  1ZZ9 A;  1LEA A;  2X48 A;  3BWG A;  3DKW A;  2XC7 A;  2X1C A;  2A6T A;  2IV1 A;  3M9L A;  4PU7 A;  3DXJ F;  2KPM A;  3BCB A;  1XB4 A;  3K4K A;  2J7W A;  2FSW A;  3HOW J;  2FNA A;  2M1B A;  4A3E J;  3M1C A;  2FRH A;  2FX0 A;  1YQA A;  4A3K J;  2DMU A;  4HLY A;  1X3W B;  3DTK A;  1DDN A;  2VPR A;  4HSR A;  2GLO A;  5DYM A;  2LY9 A;  2ODR D;  4ABZ A;  3LSG A;  1ZZ6 A;  1TWA J;  2EPF A;  2IP2 A;  3CLC A;  1SVL A;  4EK9 A;  1WH5 A;  2XJ3 A;  1AKH B;  3OV8 A;  4KIT B;  4OAZ A;  1RPE L;  1QO0 D;  4A3G J;  2Q1Z B;  4A3D J;  3G1L A;  1MDM B;  4QLC U;  4BQA A;  2AW6 A;  2JQE A;  4A0Z A;  2A5W A;  2VXZ A;  2Z1D A;  3FDY A;  1W7P A;  5JLX A;  1PRU A;  1HCR A;  3FHZ A;  2R7S A;  2LOO A;  4BQN A;  3V8L A;  5L3C A;  2DA4 A;  1UG2 A;  2W4S A;  3OL4 A;  4FE7 A;  2IA1 A;  3U9G A;  4TV7 A;  2W25 A;  1RKW A;  1ETY A;  2RGV A;  3ZQC A;  3S1M J;  1I1G A;  1Q1V A;  3I64 A;  2DT6 A;  3I55 I;  3TBI A;  4P9F A;  2ZME A;  5CQG A;  1U2W A;  3HPG A;  2EBI A;  3HB9 A;  1R4N B;  3KLO A;  4F52 A;  1WHU A;  3OYA A;  2DYR H;  3E1S A;  2QSF X;  1IXC A;  2R5Y A;  4Y33 A;  4MNU A;  1IN4 A;  5C44 J;  2WB1 A;  1QZX A;  1BIB A;  3DEU A;  5E18 F;  1RZR D;  3VEP A;  1D1C A;  2ELH A;  2P7V B;  5BNG A;  2CQX A;  4P9U A;  3S2H J;  4OWR B;  4Z5C A;  3KL4 A;  4DGW B;  4X1E A;  1QPZ A;  1FC3 A;  3IV5 A;  3C2H A;  2HS5 A;  2N8G A;  1BOA A;  4E7S A;  2GQQ A;  4YG2 F;  1RES A;  2M7A A;  4ZZD A;  4DJA A;  3S1R J;  1WFX A;  2PMH A;  5GAD J;  3CCR I;  5FO5 A;  4WK8 F;  2LNB A;  2HXO A;  2AQE A;  3ZQ7 A;  1AOY A;  4X4G A;  3BTJ A;  1Z7U A;  3WG9 A;  3ZGK A;  4MHG A;  2CS3 A;  3OIP A;  3HOX J;  1W4M A;  3HZJ A;  2PUC A;  1NG6 A;  2Y31 A;  3HBL A;  2PPX A;  3QF3 A;  4NC8 A;  1SD5 A;  4RA2 A;  4HBL A;  3BT9 A;  4G94 A;  3OKZ A;  1BI1 A;  2E35 A;  4GQM A;  2WAF A;  3G6E I;  1GDT A;  1IJW C;  3NEU A;  3HIF A;  3RQI A;  3ZMU A;  4CYC A;  3DV8 A;  1KQ0 A;  1JHH A;  2V1D A;  5H2F C;  2DPU A;  1S5L C;  2DFI A;  1P9Q C;  2L9V A;  1MBF A;  3JCU C;  1MMN A;  2CUZ A;  3CCS I;  1YRN B;  4DZJ A;  1PRV A;  1V54 H;  3EET A;  4GGG A;  2R7F A;  3QP6 A;  4F3Q A;  2EF8 A;  2CUF A;  2CFO A;  2Y0S N;  4CSW A;  5TRD A;  2W24 A;  3NQO A;  3BLY A;  1LE8 A;  3Q0W A;  5CQE A;  2ZXI A;  1PER L;  1WI3 A;  1TQM A;  3I56 I;  4OU0 A;  4XL9 A;  1G3W A;  3H5N A;  5F1J A;  3DF8 A;  4HEA 2;  2W00 A;  4JYK A;  3M1E A;  1UHS A;  2IGM A;  1WJF A;  3QOE A;  1ZGJ A;  3OYK A;  1J2X A;  5LRR A;  1XSD A;  3HG9 A;  2EQR A;  2QCO A;  1ZRC A;  3U3W A;  2XF6 A;  2PQ8 A;  4IRH A;  2DI3 A;  5CVR A;  2P0W A;  2E2I J;  4ZYD A;  2CQQ A;  3G4S I;  1FLI A;  3MLF A;  1BR2 A;  2EV6 A;  3K6G A;  4G6Q A;  3QRF F;  1FTZ A;  3CF5 F;  4OIQ F;  1K78 A;  3HOU J;  4EV0 A;  1S6L A;  2CJJ A;  4P5O A;  1T8I A;  3J80 Z;  4A2U A;  4P55 A;  2CW0 F;  5BS6 A;  1R5G A;  1HSJ A;  2QQB A;  2JA7 J;  3LIS A;  4MTD A;  3WGH A;  3ABL H;  1DUX C;  2KQR A;  3HKZ A;  3IAS 2;  4D0P A;  3IP4 B;  4R79 A;  2LLV A;  5DS9 A;  1OFC X;  3HYI A;  3CCQ I;  3HPH A;  4G7O F;  2K5C A;  3CJN A;  3CLO A;  1V3F A;  1UXD A;  4CUG A;  1BOB A;  4CYD A;  4AIH A;  3TDZ C;  1HDD C;  2MC4 A;  1EFA A;  4BKX A;  4BHB A;  2VQL A;  1LB2 A;  3QAH A;  2BOL A;  1W7P B;  3C3W A;  1OCR H;  3M8J A;  4MTE A;  1QB2 A;  1GV5 A;  5C4X J;  1EH7 A;  1IZ1 A;  3E5X A;  2EB7 A;  2EWN A;  3F52 A;  3KE2 A;  4F7Z A;  1GLN A;  1E3P A;  3J7Z I;  4ER7 A;  1IRF A;  3ZHM A;  1T98 A;  3C18 A;  1Z7L A;  3M07 A;  2HZT A;  2LYS A;  2UXN A;  3VK0 A;  4UUS A;  1I6H J;  4ESF A;  1UHW A;  3OOU A;  4KUM A;  1BIA A;  1F4K A;  4RGR A;  4C3J J;  3DKY A;  4GXO A;  3DPT A;  1K61 A;  2XI8 A;  1RR8 C;  2PXK A;  1E17 A;  3SFZ A;  1EJ9 A;  3F51 A;  4U0V A;  1OJL A;  4D1Q A;  4Q5S F;  3F72 A;  3QPT A;  3S3N A;  5F0H A;  4JP0 A;  5E79 C;  5CPR B;  2EFW A;  1W0T A;  2ESN A;  2XGE A;  3KP5 A;  3RKX A;  3Q9S A;  2MC3 A;  3BG7 A;  3K69 A;  5B1A H;  2XVC A;  3CCL I;  1WET A;  5FRO A;  5IP9 J;  1WIZ A;  4Y13 A;  1ORK A;  2DYS H;  4UNO A;  3BJA A;  3NRV A;  2P81 A;  4II3 A;  3K1M A;  2X9D A;  1MD0 A;  2UZK A;  2MGQ A;  2EA4 A;  4LD5 A;  1WSU A;  1WH7 A;  5ICE A;  3GCM A;  2O6G E;  3HRS A;  4ZTF A;  4UHT A;  4WX9 A;  2CUE A;  1IV8 A;  2RQP A;  4M73 A;  3ZQL A;  3LQQ A;  3FYM A;  4U87 A;  4BQO A;  3QOW A;  3OIO A;  2QEN A;  4LIV A;  3TW6 A;  1XDS A;  4CCL A;  2LYL A;  2DMQ A;  2PG4 A;  3DCF A;  3TQN A;  3JRG A;  4BEH A;  5DTQ A;  2DN0 A;  4MQ9 F;  5JUW A;  2ECB A;  2MLK A;  3A9X A;  5JHU A;  2JVG A;  3X2Q H;  4HZF A;  4N4O B;  2BZT A;  2H94 A;  1Y1W J;  1X3Z B;  2GIV A;  2Y2Z A;  3FF5 A;  2H8W A;  4DBQ A;  2G7U A;  2X6O A;  3GEZ A;  4YFX F;  1FP2 A;  4AYB A;  4E6K G;  2NNY A;  1FOK A;  1R9T J;  1KQ8 A;  2KIM A;  2B0L A;  4E7I A;  1YX3 A;  3OYG A;  3M8E A;  1B72 A;  2VOO A;  4J19 A;  2UUZ A;  4EJW A;  3ZN1 A;  3KP3 A;  4IHX A;  4RB1 A;  4J00 A;  1RIO H;  2KEI A;  2XXQ A;  2BVM A;  1MMA A;  5IOZ A;  3HOY J;  2KZV A;  1ACI A;  4O6J A;  4AIJ A;  1BBY A;  1Y39 A;  2R92 J;  1VQ7 I;  1QHH D;  4MEY F;  4GO1 A;  1R23 A;  4EQQ A;  4I09 A;  2R7X A;  3SEZ A;  3CUQ B;  2EH3 A;  2IBD A;  1TTY A;  1BI0 A;  4XNF A;  4UV8 A;  1JKR C;  1XCB A;  4XID A;  4Q4Z F;  3G2B A;  2R7V A;  1RPW A;  1JE8 A;  2E1M B;  3K10 A;  4W1U A;  4LB5 A;  3FXR A;  2VKD A;  1YJN I;  1B6A A;  2AXL A;  2LKS A;  2NS0 A;  2Z2S B;  3GVA A;  3K7A J;  2X0L A;  3GWZ A;  3VPR A;  5J1R A;  2R93 J;  5JI6 A;  5CYV A;  3Q0V A;  5DCM B;  5KCM A;  1TQP A;  3OS1 A;  4UY8 I;  3K2A A;  1ONV A;  5E3O A;  2ETH A;  3CO7 C;  2QZ8 A;  1HKS A;  1U9N A;  1QZZ A;  2IGN A;  2EIJ H;  2P5L C;  4DE8 A;  1SMY F;  2CQK A;  4IRG A;  3SDB A;  3COA C;  3MWM A;  2EV5 A;  4IEJ A;  2JSC A;  1ZVV A;  5HS7 A;  3A4C A;  3RKW A;  2XPW A;  2ZXJ A;  5K7Z A;  1DGW Y;  1EF4 A;  5JLW A;  1FYK A;  3OYC A;  3K4N A;  3I0T A;  3K4B A;  4HRA A;  2PMU A;  3VB2 A;  4NHJ A;  3D5L A;  3A0B C;  5J3L A;  3OSG A;  3QPH A;  4G7H F;  2XCJ A;  2GA2 A;  3FIS A;  3MCZ A;  4L9T A;  3H36 A;  3QYF A;  4Y17 A;  2M8G X;  2ICP A;  4MCX A;  3FWE A;  2JTV A;  3OWT A;  1TT0 A;  2BY3 A;  1LVK A;  3BQZ A;  2KL4 A;  3RPU D;  4RAF A;  3RYP A;  2VOP A;  1MNE A;  4RM2 A;  4B09 A;  4PCQ A;  2WTE A;  3PNV A;  1S9H A;  2MLG A;  5B3S H;  3JXC L;  3PNY A;  3DWL E;  1ZQ3 P;  3MVP A;  4ZYE A;  3EPZ A;  3EQL F;  3A9Y A;  2D5V A;  1T0F C;  3GN5 A;  1P2F A;  1YG2 A;  4RAG A;  1BDH A;  3BG5 A;  4HOB A;  3ELK A;  3R1F A;  5GAH i;  4M3D A;  4B4C A;  2J5O A;  1XN7 A;  2DA6 A;  3GTL J;  4MGR A;  2ID3 A;  2KIQ A;  2LYC A;  4UV9 A;  1HW1 A;  2WAQ A;  1Q1H A;  4RB3 C;  3FKI J;  1A31 A;  4AUX A;  4Y42 A;  1XPX A;  3CUQ A;  1YIO A;  3V8J A;  2DA2 A;  2KZG A;  3TP3 A;  1RZR A;  2JUC A;  1SFK A;  2PXE A;  3D1N I;  1FBS A;  4RMN A;  3OYB A;  1UMQ A;  4RS8 A;  1I3A A;  2CGP A;  2IS1 A;  3ECO A;  2OFY A;  5J4V A;  4B3A A;  5LBQ A;  5E1W A;  2Z33 A;  1B72 B;  2RKH A;  1PNR A;  2VC1 A;  3SXY A;  4JOM A;  1R6R A;  5E1Z B;  1TC3 C;  1SVM A;  4YRV A;  1BA5 A;  2K86 A;  3I9V 2;  1PUF B;  3FXU A;  1S3J A;  2FBI A;  2LKP A;  2KIS A;  4XRS A;  4JCX A;  2STW A;  2WAD A;  5DSX A;  2WB1 N;  3AFH A;  3VYT B;  3E5U A;  1XG1 A;  4AC0 A;  4QIW N;  2W7N A;  4A0X A;  1O3Q A;  2XIU A;  4D5C A;  3OS0 A;  1NER A;  4N4N B;  1ETO A;  4XLH A;  4KIG A;  1R58 A;  4I6R A;  2Q8K A;  4M9X A;  5AIQ A;  2R5Z A;  1QP7 A;  1HW5 A;  4ZDL A;  2LKX A;  2PXB A;  2ELJ A;  1MDM A;  3GUU A;  3GME A;  3DEE A;  3P9K A;  1BL0 A;  2Y75 A;  3S2D J;  3V7R A;  3ZPL A;  4Z58 A;  2K7L A;  2WIU B;  3C1D A;  2JN6 A;  3I4P A;  2E1C A;  3GTK J;  1O7F A;  1Y8Q B;  3ML6 A;  5GTH C;  1WQ2 A;  3PIO F;  1FMW A;  2PMZ A;  1T2K A;  1Z77 A;  4XON A;  4ON0 A;  2IGK A;  4A5N A;  4B3X A;  1J0R A;  4ER6 A;  2GBY A;  2MAB A;  5HNF A;  4BS9 A;  3ASO H;  4FT8 A;  1ZZ7 A;  4HQM A;  3HGG A;  5LFA A;  4D9J A;  2KP6 A;  1R5I D;  1R5H A;  4UB6 C;  2OQG A;  5L3B A;  5DRT A;  3G71 I;  1FJL A;  4FAS D;  2DTR A;  1O3R A;  1ZAY A;  1IN5 A;  5IP7 J;  2HWV A;  3VFZ A;  2PXP A;  2XPU A;  1E2X A;  3CDL A;  3ABM H;  1PVE A;  1IRX A;  1D0X A;  1JGG A;  3CC2 I;  1DP3 A;  2DMT A;  1IW7 F;  2LC2 A;  5M3M J;  5DD4 A;  3KEY A;  4M3B A;  2K4J A;  3F22 A;  3BR0 A;  2M9H A;  3BOQ A;  2A69 F;  4X4I A;  4IA8 A;  2L02 A;  1H9T A;  2XDV A;  1DW9 A;  1WJE A;  2NVY J;  3S3M A;  4I76 A;  3BY6 A;  2L1P A;  2IVQ A;  1FPQ A;  2VLA A;  2Y48 A;  2G0E A;  3TMO A;  3GBF A;  4M9S A;  5LLQ A;  1ZZ8 A;  3DEW A;  4MQV A;  2XF5 A;  3FXK A;  3K4C A;  2W84 A;  2IU7 A;  1G3Y A;  3EUK L;  1ON2 A;  2LLK A;  2XUB A;  2KRC A;  2I5U A;  4HX7 A;  1QZE A;  2V79 A;  2FJ1 A;  4FTH A;  5BOX A;  2V1X A;  2LYR A;  3GZN B;  2NS8 A;  4OIP F;  4X0G A;  2FE3 A;  3LSK A;  4O5V A;  4KA4 A;  1L3L A;  3PO2 J;  5JFR A;  2V4J C;  2EBY A;  2L7F P;  1UB9 A;  2QKL B;  2W82 A;  1FIP A;  3HKZ N;  4ZC3 A;  1U78 A;  3QWG A;  4B48 A;  4IWR A;  2DQR A;  3M3Y J;  4OBM A;  2Y9Y A;  1B0N A;  3H5A A;  1R71 A;  3I54 A;  3GTG J;  1JUP A;  2H09 A;  5TIS C;  1WWX A;  3AL0 B;  1S7E A;  1XMA A;  1N78 A;  3GZD A;  3KX2 A;  1QQA A;  3CTA A;  3AG3 H;  1XWR A;  3WTS C;  4XR6 A;  4UUV A;  4HV6 A;  1VQ4 I;  3UNG C;  4CCM A;  1FWZ A;  1IV6 A;  3FM5 A;  1YS6 A;  4EJO A;  2A6H F;  3B7H A;  3SCH A;  2KEK A;  3F8B A;  1IF1 A;  3JW4 A;  1RZ4 A;  5FKK A;  3ZCO A;  4DIQ A;  5DDG A;  2XAU A;  2IT0 A;  5EG0 B;  4A3F J;  2A6E F;  4N9H A;  1RKT A;  3OOP A;  3EUH C;  2LYQ A;  3HOT A;  1SD6 A;  2LDU A;  3ZMT A;  4UVB A;  1IRG A;  4I0B A;  1ZH5 A;  1KQ9 A;  3JRC A;  1WZ2 A;  1SQ8 A;  3HUG A;  2EWT A;  2L49 A;  4L5I A;  3UFD A;  4A3J J;  5CJ9 A;  5FKM A;  4B44 A;  2CV2 A;  1BW5 A;  4CYC B;  5DM6 F;  2DMP A;  2OUM A;  4LB6 B;  1O4X A;  3H9Q A;  4IPA A;  2VL8 A;  2XKP A;  3FHN A;  4MEX F;  3JRA A;  3T1B A;  2X85 A;  1YSE A;  4FBI A;  1ERD A;  3K4M A;  3JRB A;  3P9C A;  3LAP A;  2WWY A;  2JRM A;  2F5E A;  3BJO A;  4CH7 A;  2FJR A;  2L4A A;  3CUQ C;  2PUA A;  2IXS A;  1ZYR F;  4NBQ A;  2E60 A;  4C3I J;  4P1W A;  5K7F A;  1LJ9 A;  4IVZ A;  4M3E A;  1QPM A;  2L2O A;  2LBF A;  2XGC A;  3JRE A;  2P6S A;  5IPA A;  3E7L A;  1NTC A;  1KYW A;  1YW7 A;  5FJ8 J;  4F8D A;  2MBF A;  1NG7 A;  2BW3 B;  3BRO A;  2GXB A;  3SX0 A;  2H1L A;  2XRN A;  5HLH A;  5LD2 C;  1D3Y A;  3EUA A;  3R4K A;  1KA8 A;  2B63 J;  2EIL H;  1LVA A;  1ZAO A;  4GCV A;  1V4R A;  3TO9 A;  2GZW A;  3CF2 A;  3FXO A;  4LOC A;  5FLX Z;  3KP7 A;  2LP0 A;  1TWC J;  3RZZ A;  3R0A A;  1POU A;  4RGS A;  3I3L A;  1JKQ C;  2HFH A;  3SCF A;  2OA4 A;  2XAH A;  2ZME B;  4JX4 A;  5DCF A;  4LLN A;  3BJ6 A;  3ZMD A;  1VQ8 I;  1KU9 A;  1FMV A;  2FU4 A;  1VQO I;  3WTU C;  4OMZ A;  1X1C A;  4XKC A;  4WVL A;  4Y52 J;  3N05 A;  2FMY A;  1MGT A;  3BG9 A;  5HS9 A;  5H20 A;  1MJ9 A;  4PJJ A;  2PX9 A;  2XAJ A;  4C3H J;  4CZC A;  1SC7 A;  3HXL A;  2L9N A;  3JAM K;  4M74 A;  1OYY A;  1ZZC A;  4M72 A;  5CVI A;  4YG7 B;  1G6N A;  1P7J A;  3SEQ A;  3GZ6 A;  2CQN A;  3H5R A;  3I59 A;  2COM A;  2K9M A;  1TT5 B;  3VOD A;  2CH0 A;  4XSZ F;  3GBG A;  3LST A;  4UB8 C;  3I5U A;  1M1E B;  5EZG A;  1PDN C;  2K3F A;  1AKH A;  3HDD A;  2X51 A;  3LFK A;  4DBR A;  4ZZL A;  5C4J J;  5D6F A;  4A6D A;  2L0K A;  2RDP A;  3DM5 A;  3KP4 A;  1C0W A;  2CV1 A;  1D1B A;  3H9J A;  5JHF A;  4BXX J;  1X4O A;  1FTT A;  2FD5 A;  1RUO A;  2YPR A;  1RNL A;  1W7P D;  2OTL I;  1X1D A;  3TO7 A;  2HPM A;  2L5Q A;  3KJX A;  3HL2 A;  1CGP A;  3K1P A;  3CRO L;  5M5W J;  2FOK A;  1HW2 A;  5A2Q Z;  1LCD A;  5LGU A;  2HNH A;  5IT9 Z;  5J8C A;  1OYW A;  4AYB N;  1ZLJ A;  1RUN A;  4G12 A;  3CDI A;  1TP4 A;  2VT2 A;  5BMZ A;  2V9K A;  2RVC A;  4G7Z F;  4IXA A;  2JK3 A;  4U0Y A;  2LVS A;  3MN2 A;  2DO7 A;  1MMS A;  2TCT A;  4UVC A;  2FNP A;  2QQ8 A;  3ESW B;  2ZBK A;  4RAY A;  2LH9 A;  1HXD A;  1SAU A;  3F8C A;  2D2W A;  1EKE A;  3S3O A;  4G8X A;  2W1O A;  1JJ8 C;  3HZI B;  4EVI A;  3Q5F A;  3S17 J;  2BY0 A;  3OYJ A;  1XSX A;  3CUO A;  2CMP A;  5IOY A;  2HR3 A;  1ZRD A;  3CCU I;  3NWS A;  4J01 A;  3ZPX A;  3GTM J;  3W2V A;  2ZJR F;  3MZH A;  1B8I B;  2RC4 A;  1B9N A;  1AA7 A;  2GOX B;  1LUJ B;  2B9S A;  1Y8R B;  1T08 B;  2BY1 A;  1A04 A;  2WAQ N;  3FX3 A;  5LHI A;  2RV8 A;  2JMW A;  3KP2 A;  5E8G A;  3TO6 A;  2ISZ A;  2V7F A;  3OWQ A;  1YIJ I;  1Y1V J;  3PXP A;  3EYY A;  4M3F A;  2EZI A;  3O2P E;  1R1T A;  5GTI C;  3CJR B;  3REO A;  4KJZ A;  5M3F J;  3L1P A;  1I6X A;  2ZB9 A;  2DAO A;  1UJ8 A;  2HSG A;  2HYF A;  1AHD P;  2LFB A;  2OTJ I;  2K40 A;  1ODD A;  5EEA A;  3H35 A;  2NVT J;  1X1P A;  1Z21 A;  3RZD J;  2R7Z J;  5K1Y A;  1STZ A;  2JPC A;  2JWT A;  4HF2 A;  3S14 J;  2EZL A;  2VB6 A;  1BC8 C;  3H3Z A;  4HYE A;  3H0D A;  3CCM I;  5ICG A;  1WI9 A;  4ER3 A;  3F6O A;  4ZJZ A;  4X6A J;  2PXD A;  1ULY A;  1X1A A;  2PUG A;  1QVT A;  4IHW A;  1MND A;  1GVD A;  5CVV A;  1LQ1 A;  5D4S A;  3KYL A;  1S7A A;  1XGS A;  3WTZ A;  1A5J A;  4BBR J;  3FM3 A;  3CCY A;  4RLF A;  2DK8 A;  1I5Z A;  1FOW A;  1FOX A;  3BD1 A;  2STT A;  2DOE A;  2MG4 A;  3L2W A;  3BR5 A;  3L2V A;  2VKE A;  4BQQ A;  3E97 A;  3H3V K;  3ZHI A;  5HNH A;  2PXT A;  2EIM H;  2G7H A;  3SZG A; 
#chains in the Genus database with same CATH homology
 3I4N J;  3HEF A;  5J1R A;  3K7A J;  2R93 J;  3VPR A;  2LK2 A;  3IH4 A;  3B6A A;  3MKL A;  3Q0V A;  2IEK A;  1SAN A;  1ZUG A;  3K2A A;  5E3O A;  2NVQ J;  1T33 A;  2HIN A;  1YRN A;  1H88 C;  5DTD A;  1ZR2 A;  2AHQ A;  1R63 A;  3SJM A;  2CSF A;  1U9N A;  4X4F A;  1ZTR A;  5FLV A;  1ETQ A;  4X4B A;  2GM4 A;  5K98 B;  3JRF A;  1TWF J;  4MLO A;  5IP6 A;  1LE8 B;  4IEJ A;  3WHC A;  2O4A A;  1IDY A;  1ZVV A;  2L9R A;  2CU7 A;  2DA7 A;  1TWG J;  4IHY A;  3CQZ J;  1IGN A;  2XPW A;  5K7Z A;  2ICT A;  1EF4 A;  5JLW A;  4HNV A;  3S16 J;  5F04 A;  2AUW A;  1H8A C;  4JQD A;  5J3L A;  3ZQH A;  3OSG A;  2XCJ A;  3FIS A;  2BNM A;  1QVU A;  3NAU A;  2AXU A;  5J1U A;  2M8G X;  2ICP A;  4MCX A;  3QQA A;  3BQZ A;  1I3Q J;  3M4O J;  4YG1 A;  4D7N A;  2E19 A;  4J1W A;  4X4E A;  5IYC J;  1MH3 A;  3Q0U A;  3JXC L;  1BDI A;  2O9L A;  3F0C A;  1ADR A;  3HGY A;  3OSF A;  4XRS G;  2MQK A;  1ZQ3 P;  3MVP A;  3LSJ A;  4A3M J;  3GN5 A;  2D5V A;  1BDH A;  1VFC A;  3BG5 A;  4A3I J;  3R1F A;  1ZK8 A;  4M3D A;  1RR7 A;  2O38 A;  4B4C A;  5EG0 A;  2KDZ A;  3W6V A;  1APL C;  3FK6 A;  2DA6 A;  3GTL J;  2ID3 A;  2LD5 A;  2JA5 J;  1RIO A;  4S0H B;  2R5Y B;  3FKI J;  1WH6 A;  2HQ5 A;  2KZ8 A;  4AUX A;  4Y42 A;  4YBA A;  1RZR A;  2DA2 A;  3TP3 A;  1ENH A;  2MW8 A;  4MFE A;  2L7Z A;  3IH2 A;  2XSD C;  3D1N I;  2PE5 A;  1UMQ A;  5GP9 A;  2JA8 J;  4D5F A;  3GTQ J;  4O8B A;  3OMT A;  5E3M A;  4BBS J;  1IC8 A;  3BTL A;  2YU9 J;  2OFY A;  4XIC A;  1K83 J;  4B3A A;  4L5E A;  1B72 B;  4DYR A;  1PNR A;  4W97 A;  2CRO A;  1TC3 C;  4M3G A;  1BA5 A;  2K9N A;  4QTR A;  1PUF B;  1A6I A;  4XRS A;  1ZS4 A;  3A01 B;  4JCX A;  2DA3 A;  4C2M J;  3BQY A;  3JR9 A;  5A7L A;  2WB1 N;  1ZKG A;  4MO7 A;  4B1R A;  4PU3 C;  2DA1 A;  3IH3 A;  3CMY A;  1MNM C;  1QP4 A;  5M5X J;  3A03 A;  5IYB J;  2HXI A;  2M0C A;  1XG1 A;  4AC0 A;  4QIW N;  2LCV A;  2K9Q A;  1WH8 A;  2XIU A;  4FE4 A;  4Z5D A;  5E3L A;  3Q3S A;  4D5C A;  1ETV A;  2H1K A;  3BR3 A;  4DYC A;  1NER A;  2H8R A;  1ETO A;  3BTI A;  1F36 A;  4I6R A;  2HOS A;  1JT6 A;  5EDN A;  4EEF G;  3S1Q J;  4Z5H A;  2R5Z A;  1QP7 A;  2M2E A;  2LKX A;  3LSR A;  2IUO A;  3G7D A;  3JRH A;  1ETK A;  1BL0 A;  2ME0 A;  2KPJ A;  2M34 A;  3BR2 A;  3S2D J;  3QQ6 A;  3SCG A;  4Z59 A;  2JCG A;  1VF9 A;  4Z58 A;  1LFU P;  2WIU B;  1LFB A;  2JN6 A;  4XRM A;  1JUM A;  4QSH A;  1OCP A;  2EZK A;  5K7H A;  3GTK J;  4Y7N J;  2ELK A;  3F6W A;  2ID6 A;  4BY1 J;  2XB0 X;  4X4H A;  3OP9 A;  5F08 A;  1JFS A;  5EGO B;  1Z77 A;  1JH9 A;  4JX5 A;  1QP0 A;  3BTC A;  2PUD A;  3ZQI A;  4UUT A;  1D5Y A;  2GBY A;  3RKQ A;  3FMY A;  2GRL A;  1ZZ7 A;  3HGG A;  3JRI A;  2KT0 A;  2ME6 A;  1B8I A;  3OQO A;  3TRB A;  4NDL A;  5C3E J;  1FJL A;  1JTX A;  5EGO A;  2OR1 L;  1ZAY A;  5IP7 J;  5EZH A;  2LYJ A;  2XRL A;  3SFI A;  2QF7 A;  2LYP A;  2XPU A;  3ZKC A;  3CDL A;  1ZZ9 A;  2X48 A;  1HLV A;  2HDD A;  3GTJ J;  1JGG A;  3GTO J;  2HOA A;  2HYJ A;  2IV1 A;  2PUF A;  4PU7 A;  1X57 A;  2DMT A;  3SDG A;  2NS7 A;  5M3M J;  2LTP A;  4M3B A;  3TP0 A;  3BR0 A;  2M9H A;  3HOW J;  4A3E J;  1CQT A;  1UXC A;  2FX0 A;  2MEZ A;  4A3K J;  4X4I A;  3KZ3 A;  2DMU A;  1F43 A;  4IA8 A;  2DJN A;  2OF7 A;  2VPR A;  1DW9 A;  2GLO A;  1L1M A;  2LY9 A;  2E2J J;  2NVY J;  1JWL A;  4I76 A;  3LSG A;  4ABZ A;  1TWA J;  3RZO J;  1ZZ6 A;  2IVQ A;  2KEJ A;  2G0E A;  3CLC A;  3GBF A;  1Y7Y A;  1ZZ8 A;  1WH5 A;  2LR8 A;  3DEW A;  2XJ3 A;  1AKH B;  3ZOB A;  1HDP A;  2IU7 A;  1RPE L;  4NDW A;  4A3G J;  4A3D J;  1QRY A;  2WUS R;  2TRT A;  2LLK A;  1OCT C;  3G1L A;  3ZQF A;  2AW6 A;  2FJ1 A;  4FTH A;  1PUF A;  2JA6 J;  1MSE C;  2LYR A;  2NS8 A;  5JLX A;  1PRU A;  1HCR A;  3PO2 J;  2VUM J;  2WV1 A;  3TW7 A;  1DWK A;  2EBY A;  2L7F P;  3H0G J;  1FIP A;  3HKZ N;  3QWG A;  1U78 A;  2PUE A;  4IWR A;  4FIS A;  2DA4 A;  3M3Y J;  1UG2 A;  2VKV A;  2Y9Y A;  4FE7 A;  1B0N A;  5E3N A;  3GTG J;  1JUP A;  1RKW A;  1S7E A;  4MCT A;  1ETY A;  1QQA A;  2OPT A;  3ZQC A;  3S1M J;  1UTX A;  1XWR A;  1Q1V A;  5GPC A;  1IV6 A;  2KEK A;  2EBI A;  3HB9 A;  3LOC A;  3B7H A;  2R5Y A;  3S15 J;  9ANT A;  3SCH A;  1WGX A;  5FKK A;  4FN3 A;  1X2N A;  3BG3 A;  1X58 A;  2PMZ N;  5C44 J;  2R0Q C;  1X2L A;  1U9O A;  2AXZ A;  5EG0 B;  3C2B A;  1LMB 3;  3FK7 A;  4A3F J;  1RKT A;  1RZR D;  5FKN A;  3S2H J;  5BNG A;  4Z5C A;  2CQX A;  1AU7 A;  2LYQ A;  3GN5 B;  3O9X A;  1R69 A;  4X1E A;  1QPZ A;  4I6U A;  3IV5 A;  2R63 A;  1RZS A;  4BY7 J;  2DTZ A;  3QPL A;  1ZZB A;  2N8G A;  4X4C A;  2BJC A;  4DYQ A;  1T56 A;  3JRC A;  2L49 A;  1SQ8 A;  2BNN A;  2EWT A;  2COB A;  3UFD A;  3BDN A;  4A3J J;  2E2H J;  2W48 A;  1RES A;  5FKM A;  1BW5 A;  4CYC B;  3S1R J;  1GT0 C;  4RBO A;  1ETX A;  2DMP A;  1I50 J;  1O4X A;  2DMN A;  3JXB C;  1ETW A;  1DU0 A;  2HXO A;  3JRA A;  5FKL A;  4X4G A;  1YSE A;  4FBI A;  3BTJ A;  1X2M A;  3QPS A;  3JRB A;  1W0U A;  3S1N J;  3BR6 A;  3HOX J;  3PO3 J;  1QPI A;  2PUC A;  2FJR A;  5EYR A;  2PUA A;  2Y31 A;  3HBL A;  1MBG A;  5K7F A;  4C3I J;  2PPX A;  3QF3 A;  4IVZ A;  3O8H A;  3FYA A;  3BT9 A;  4M3E A;  3QYX A;  4GQM A;  2XGC A;  3JRE A;  1GDT A;  1IJW C;  4V2G A;  3RQI A;  5IPA A;  4CYC A;  3E7L A;  1NTC A;  4JCY A;  5FJ8 J;  4F8D A;  3I4M J;  1MBF A;  1PRV A;  1YRN B;  4DZJ A;  1PRA A;  1ZPQ A;  3LSP A;  4OB4 A;  4J1X A;  3LNQ A;  3OQN A;  1JKO C;  2EF8 A;  2CUF A;  1P7I A;  2B63 J;  2Y0S N;  1WPK A;  1LE8 A;  1MBE A;  2ECC A;  3Q0W A;  4LOC A;  1FIA A;  2LP0 A;  1PER L;  1TWC J;  1WI3 A;  3RZZ A;  1MBK A;  1POU A;  3NAR A;  4JX6 A;  5F1J A;  2GRM A;  4JYK A;  2JJ7 A;  1UHS A;  5FLM J;  1JKQ C;  3SCF A;  3TED A;  3EUS A;  1GUU A;  4JX4 A;  1MBH A;  1CJG A;  4IHV A;  2EQR A;  2QCO A;  3U3W A;  1NK3 P;  3UKG A;  3PM1 A;  3HM5 A;  4A3L J;  2HOT A;  4Y52 J;  1JJ6 C;  2E2I J;  5HOD A;  3BG9 A;  2CQQ A;  3MLF A;  1H89 C;  1FTZ A;  1NEQ A;  1ITY A;  4C3H J;  4PU4 C;  3HOU J;  3O8G A;  2CJJ A;  3G5G A;  1VPW A;  4M6V A;  5F0C A;  1U8B A;  3ZQG A;  2JA7 J;  3JXD L;  3LIS A;  2R1J L;  2GZU A;  1ZZC A;  2HI3 A;  4YG7 B;  1P7J A;  1RET A;  5DS9 A;  4V2F A;  1OFC X;  1TWH J;  5EZG A;  3GBG A;  3H5T A;  1AKH A;  1JFT A;  3HDD A;  1UXD A;  1XS9 A;  1HDD C;  1LQC A;  3KXA A;  1EFA A;  4BKX A;  5C4J J;  3HOV J;  1MH4 A;  2L0K A;  4D7M A;  2B5A A;  5GPA A;  4BXX J;  1FEX A;  2I10 A;  1FTT A;  2FD5 A;  1GV5 A;  5C4X J;  3IVP A;  1LLI A;  3A02 A;  4I8T A;  1VI0 A;  1DU6 A;  1ZR4 A;  3F52 A;  5EF6 A;  1JKP C;  2AWI A;  1OSL A;  3ZHM A;  3BS3 A;  3KJX A;  2IAI A;  2CRG A;  3CRO L;  5M5W J;  2NVX J;  2LYS A;  3VK0 A;  4UUS A;  1I6H J;  1LCD A;  3WHB A;  3OOU A;  4A93 J;  1JUS A;  4A69 C;  4A3C J;  4A3B J;  4AYB N;  4G12 A;  5FKO A;  4GFB A;  3OQM A;  4C3J J;  2JK3 A;  2XGD A;  3B6C A;  3G1M A;  1K61 A;  2LVS A;  3MN2 A;  1IRZ A;  2XI8 A;  1Y9Q A;  4GHJ A;  2TCT A;  3DNV B;  3F51 A;  2XB5 A;  2IVB A;  1OJL A;  4X4D A;  3S8Q A;  4I6T A;  2PIJ A;  5F0H A;  4JP0 A;  2L7M P;  1G2H A;  1JJ8 C;  1BW6 A;  1ZGW A;  3HZI B;  2K9S A;  1W0T A;  3S17 J;  2XGE A;  2E1O A;  2PUB A;  2DA5 A;  5IOY A;  3JRD A;  1POG A;  4FCY A;  1HF0 A;  5IP9 J;  1E3O C;  2O8K A;  3LFP A;  1WET A;  1WIZ A;  3GTM J;  2L8N A;  2O49 A;  1ORK A;  2Y30 A;  2YS9 A;  1WCM J;  3HOZ J;  3CEC A;  1B8I B;  2P81 A;  2EZH A;  2X9D A;  2MGQ A;  1WH7 A;  4XK4 A;  2CUE A;  1MSF C;  2WAQ N;  3ZQL A;  2NOG A;  3FYM A;  2JMW A;  3OIO A;  4PU8 A;  3TW6 A;  1Y1V J;  2LYL A;  3PXP A;  1JTY A;  2DMQ A;  2A6C A;  4M3F A;  2EZI A;  1BJZ A;  1JT0 A;  3DCF A;  3JRG A;  2DN0 A;  5M3F J;  2YUS A;  4UUS B;  2O7O A;  3L1P A;  2ECB A;  2ZB9 A;  2Y9Z A;  1MBJ A;  2AXV A;  2HSG A;  4YG4 A;  1AHD P;  2LFB A;  4DZP A;  5J1Y A;  2K40 A;  4MFD A;  5EEA A;  2MSY A;  1Y1W J;  2NVT J;  1XC5 A;  2Y2Z A;  2XPV A;  1VND A;  2X6O A;  3G1O A;  3RZD J;  1NK2 P;  2R7Z J;  1IDZ A;  2R5Z B;  2JWT A;  1R9T J;  3S14 J;  2EZL A;  1IG7 A;  1Z0X A;  2BNO A;  2IVG A;  1B72 A;  4J19 A;  1GV2 A;  3GTP J;  5IYD J;  4X6A J;  2PUG A;  1QVT A;  4IHW A;  1SFO J;  4IHX A;  2KEI A;  2AO9 A;  5M5Y J;  2RAE A;  1GVD A;  5IOZ A;  3HOY J;  1A5J A;  4BBR J;  3CCY A;  5F27 A;  3A01 A;  2R92 J;  3BD1 A;  2MG4 A;  3FIW A;  5F0F A;  1IUF A;  2EH3 A;  2IBD A;  3BR5 A;  2VKE A;  2FQ4 A;  4I6Z A;  4YAR A;  1QQB A;  1HOM A;  3BR1 A;  4DW6 A;  4XID A;  1JKR C;  3H3V K;  3ZHI A;  1RPW A;  4RDU A;  2JVL A;  4W1U A;  2VI6 A;  4MIM A;  1LCC A;  2LYK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...