2D5VA

Crystal structure of hnf-6alpha dna-binding domain in complex with the ttr promoter
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
155
structure length
135
Chain Sequence
MEEINTKEVAQRITTELKRYSIPQAIFAQRVLCRSQGTLSDLLRNPKPWSKLKSGRETFRRMWKWLQEPEFQRMSALRLPRLVFTDVQRRTLHAIFKENKRPSKELQITISQQLGLELSTVSNFFMNARRRSLDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title DNA recognition mechanism of the ONECUT homeodomain of transcription factor HNF-6
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transcription/dna
molecule keywords 5'-D(*TP*CP*TP*AP*AP*GP*TP*CP*AP*AP*TP*AP*AP*T)-3'
total genus 45
structure length 135
sequence length 155
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2d5vA02
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2d5vA01
4OB4A 4Z5CA 4BKXA 3FYMA 1OCPA 1CQTA 4BXXJ 2HQ5A 4IWRA 5FKMA 1UHSA 3F6WA 1TWFJ 3ZQCA 1ZR4A 1IGNA 4Y7NJ 2R5YA 2PMZN 4Z58A 1ZK8A 1ETQA 1FTTA 2AXZA 1Y7YA 3LSJA 3BTLA 3FKIJ 3BTCA 2Y9ZA 1QRYA 2N8GA 1AHDP 1B8IB 1XWRA 1W0UA 1Y9QA 4MO7A 5FLVA 1LMB3 3JRBA 4L5EA 2OPTA 5J3LA 4Z59A 2DMPA 2E2HJ 3KJXA 1I50J 5FLMJ 2O38A 4A3FJ 1JUMA 3HKZN 4V2FA 2IV1A 3JXBC 1ZTRA 2MGQA 1PUFB 1TWAJ 4A3IJ 2R92J 2R93J 1QPZA 4QIWN 1W0TA 3FYAA 3HZIB 1JKOC 4G12A 4A3LJ 2OF7A 1CJGA 5F0CA 1VNDA 5EEAA 1ORKA 3BD1A 2DN0A 3Q0UA 2GLOA 3JRIA 2JN6A 4CYCB 1X2NA 2E19A 2KEIA 2LFBA 1FIAA 4JX4A 4A3MJ 3CCYA 3A01A 1QP0A 1R63A 3BG9A 1ZZ9A 1P7JA 2IU7A 2CROA 5IP6A 1ETKA 1NERA 2GZUA 4X4EA 3JRGA 3MKLA 3GTPJ 2PE5A 4FCYA 5EDNA 5EGOA 3B7HA 3JR9A 4A3GJ 2K9QA 4BBRJ 2LYKA 4AC0A 2DA3A 2NS8A 2W48A 3CDLA 1FTZA 1IUFA 5EZHA 5K7FA 2LD5A 2EBIA 4A3BJ 2MQKA 2EZIA 3FMYA 1RKWA 5EZGA 2DA5A 2DA4A 2L7ZA 2VKVA 3IH3A 2DA6A 4B1RA 4XRSG 3GBFA 2AHQA 5K98B 4BBSJ 3QQAA 1RZRD 1L1MA 3ZQGA 1HDPA 2QCOA 5EGOB 2XB5A 2A6CA 3KXAA 1QP7A 4M3EA 4X4FA 1LLIA 1B72A 5F27A 3S1NJ 3QQ6A 1PRAA 2PUDA 1JKQC 3Q0VA 3FISA 1HF0A 2DMNA 1RPWA 2R1JL 2EZKA 2CU7A 1MSFC 2LVSA 1U78A 4YG7B 2IEKA 1WI3A 2JA8J 2JWTA 3GN5B 4X4HA 4CYCA 3BTIA 3A02A 4LOCA 1ETWA 3OMTA 3BR5A 3D1NI 2GM4A 3BS3A 1ZZ6A 3H0GJ 2TRTA 4X4GA 3BR0A 4UUSB 3L1PA 2M2EA 3HBLA 1WGXA 1POUA 2BNMA 2XIUA 1LQCA 1ZZCA 2ZB9A 2GRMA 3BG3A 3W6VA 1F36A 2M34A 1Z0XA 1JJ8C 3GTQJ 4BY7J 1TWCJ 2XCJA 4AYBN 1YRNA 3TRBA 3CMYA 5EG0A 4J1XA 5F0FA 1WH7A 4AUXA 1PNRA 1ZZ7A 2HINA 3RZDJ 2LYSA 1EF4A 2HYJA 3MVPA 4FE4A 4FBIA 4PU3C 4MIMA 4V2GA 5E3LA 4JYKA 2ID6A 2L7FP 1R9TJ 4X6AJ 5F04A 2KPJA 1AU7A 1JT0A 3OQOA 2VI6A 1MBHA 2IBDA 1I3QJ 3SDGA 1E3OC 1BDIA 1QP4A 2BNNA 2VPRA 2B5AA 1NTCA 2LK2A 1FJLA 1BW5A 2HI3A 3BR2A 1ENHA 4A69C 4W1UA 4A3EJ 1DW9A 1ZQ3P 3PO3J 1S7EA 2NVTJ 1Q1VA 1NK3P 1PRVA 2K9SA 3GTGJ 3SCHA 4GHJA 1RIOA 4RDUA 1JKPC 3HEFA 3OSGA 1P7IA 2DMQA 2IUOA 3GTOJ 4FTHA 3GN5A 1WH5A 2KT0A 4I6TA 1BJZA 2M0CA 1UG2A 3OOUA 4M3BA 3S1RJ 1UTXA 2EZLA 4QSHA 2RAEA 4M3DA 2LR8A 3PO2J 1HLVA 2HOTA 2HOAA 3ZOBA 2NVQJ 1B72B 1UXDA 3B6CA 1NEQA 3BDNA 2FQ4A 4DZPA 2DA2A 2JJ7A 1U8BA 2R5ZB 1IDZA 2LP0A 1UXCA 3TW7A 3UFDA 1ETVA 2ELKA 5F0HA 3QPLA 1MSEC 3VK0A 4XICA 2WV1A 4GQMA 3BR3A 3O9XA 3TW6A 5IYCJ 5E3MA 3GTLJ 1MBEA 3CLCA 3FIWA 2XGCA 2PUEA 1K83J 2DJNA 2FD5A 1A6IA 2ME0A 4M3GA 3UKGA 5DS9A 3PXPA 4DYCA 1MBFA 2JK3A 4B3AA 5JLWA 3HOVJ 2PUBA 3JREA 1MBGA 2MSYA 3HDDA 2KEJA 2ID3A 4JP0A 5IOZA 3TP3A 1O4XA 5JLXA 2LYPA 2MW8A 2EH3A 2H8RA 1RZSA 1GVDA 2HOSA 3OIOA 4XIDA 1APLC 3BQZA 3S17J 1RPEL 4YBAA 2CSFA 3JRAA 4Z5HA 3S8QA 1T33A 3S1MJ 4UUTA 3ZHMA 2XPUA 2L8NA 4JCYA 2NVXJ 1GV2A 1Z77A 4YG1A 5EF6A 4XRMA 2NOGA 2O8KA 3RZZA 2COBA 1JJ6C 3G1LA 4MFDA 4I76A 2KEKA 1U9NA 2BNOA 1LFUP 4X4CA 3OQMA 5GP9A 1QVTA 3ZQLA 1JFSA 3TEDA 2R63A 5IP7J 4RBOA 1ZZ8A 4B4CA 1RKTA 2Y9YA 4FISA 2YUSA 4I6UA 1ZKGA 1TWHJ 2LYLA 3LOCA 1ZGWA 2Y30A 1DWKA 1X58A 1MH3A 1FIPA 2M8GX 3FK6A 2IAIA 2XJ3A 3PM1A 1A5JA 2R7ZJ 4NDWA 1JWLA 1LCDA 5GPAA 4GFBA 3WHBA 2I10A 1FEXA 3GTJJ 4IA8A 4A3CJ 2CQXA 4C2MJ 1IC8A 1YRNB 3FK7A 3EUSA 2TCTA 2PUGA 5C44J 3HOWJ 1VF9A 2OR1L 2EZHA 3OP9A 5M5YJ 2JVLA 4D7MA 1OCTC 1JKRC 5J1RA 2EBYA 2FJRA 2O4AA 3I4NJ 5IYDJ 5FKNA 1IG7A 2LYRA 4X4DA 2B63J 4X1EA 1ZPQA 4IHWA 2LKXA 2JA7J 3S2HJ 1DU6A 5E3OA 1GDTA 1BL0A 5C4JJ 2XSDC 1BA5A 1ETOA 2QF7A 1TC3C 2CQQA 3ZQIA 5M5WJ 3R1FA 2E1OA 3TP0A 5F1JA 2HDDA 2XI8A 1WH8A 2LYJA 3SFIA 2BJCA 4YARA 1ADRA 2DA1A 2L9RA 2CJJA 4DYRA 4C3JJ 1Y1VJ 4EEFG 2PPXA 5FKOA 1MNMC 3BQYA 2WUSR 2E2JJ 2GBYA 4IHVA 4C3HJ 4A3JJ 4MFEA 1YSEA 3O8GA 1X2MA 2JA6J 1G2HA 4JX6A 5FKKA 4IHYA 2VUMJ 4ABZA 2AWIA 2PUCA 4Y42A 5FKLA 1IJWC 4BY1J 1ZVVA 1JT6A 2X48A 3HB9A 3NAUA 1DU0A 1F43A 4FN3A 3OSFA 2MEZA 3H3VK 2DA7A 2EWTA 3BG5A 1NK2P 5C4XJ 1WH6A 3JXCL 1R69A 4M3FA 1HCRA 1RESA 2LLKA 3DNVB 4S0HB 3K2AA 1JH9A 2AXUA 4IEJA 3VPRA 2AXVA 2GRLA 1VI0A 2DMTA 1LFBA 5EYRA 2NVYJ 1H89C 1IRZA 4X4IA 3HGGA 2LY9A 2E2IJ 2ECCA 2ICTA 1ZAYA 3ZHIA 2CUEA 2VKEA 1H88C 3M3YJ 3S15J 1MBJA 3E7LA 1QQBA 4J1WA 1VFCA 2D5VA 2O9LA 2XPWA 4W97A 2XGDA 5M3MJ 1GV5A 1XC5A 5IPAA 3SJMA 2EF8A 1WCMJ 2ECBA 3G7DA 4JCXA 1JUSA 2AUWA 3ZQHA 4IVZA 3H5TA 1SQ8A 3CROL 3BR6A 2XGEA 2LCVA 4PU8A 1GT0C 2JA5J 3CECA 2MG4A 4DZJA 1MH4A 4F8DA 1OFCX 1SANA 4XK4A 1AKHA 2K9NA 5E3NA 2P81A 2Y31A 1D5YA 5M3FJ 4Z5DA 1IV6A 2IVQA 1BW6A 1B8IA 1WPKA 2XB0X 4D5FA 1PRUA 1RR7A 3HOUJ 3F51A 1JUPA 3HOXJ 2JCGA 2L0KA 2Y2ZA 3F52A 2R5YB 3B6AA 3F0CA 1RZRA 1BDHA 1EFAA 2R0QC 2PUFA 1QVUA 2K40A 3KZ3A 1ZZBA 2IVGA 3QF3A 3JXDL 4I6ZA 5EG0B 2CUFA 1LCCA 4MLOA 2HXOA 2KDZA 4YG4A 3QPSA 1SFOJ 2X9DA 1AKHB 3LISA 3MN2A 5K7HA 1JGGA 5F08A 5IOYA 5C3EJ 1ZR2A 9ANTA 5BNGA 3G5GA 1ZUGA 2WIUB 1HOMA 2EQRA 2LYQA 1QPIA 3G1MA 3JRCA 2X6OA 4UUSA 3LSRA 2PUAA 4J19A 2HXIA 3DEWA 4C3IJ 2YU9J 5IP9J 3GTMJ 3U3WA 2DMUA 1XG1A 4X4BA 4D7NA 3QWGA 1TWGJ 4MCTA 3Q0WA 3ZKCA 5J1YA 2YS9A 5FJ8J 3LNQA 2IVBA 4XRSA 4M6VA 3RZOJ 3LSPA 5DTDA 3JRFA 5GPCA 3BR1A 3S14J 4PU7A 1UMQA 2O49A 4DW6A 3BTJA 1T56A 1QQAA 3IV5A 1JTXA 2FJ1A 2XPVA 2L49A 1LE8B 2AO9A 3WHCA 2KZ8A 1PERL 1XS9A 4Y52J 3O8HA 5HODA 4PU4C 4JX5A 1WIZA 2CRGA 3HGYA 3A03A 1ZS4A 2ICPA 3DCFA 2ME6A 4IHXA 5M5XJ 3I4MJ 2HSGA 1MBKA 1X2LA 3LFPA 4HNVA 5J1UA 1POGA 3OQNA 3QYXA 1K61A 2R5ZA 3HOZJ 4NDLA 3K7AJ 3LSGA 3SCFA 3CQZJ 1U9OA 1OJLA 5K7ZA 1LE8A 1X57A 3S1QJ 2XRLA 1HDDC 3HOYJ 3HM5A 3IH4A 2JMWA 3JRHA 1WETA 1H8AC 1VPWA 2O7OA 4FE7A 1JTYA 3NARA 3GBGA 3A01B 2NS7A 5IYBJ 4I6RA 3IVPA 1IDYA 4A93J 4D5CA 1OSLA 2G0EA 3G1OA 1B0NA 3C2BA 1ETYA 4A3DJ 2AW6A 1GUUA 3GTKJ 4JQDA 3M4OJ 3ZQFA 3IH2A 2WB1N 3Q3SA 1RETA 3S2DJ 2Y0SN 2WAQN 1JFTA 5A7LA 2LTPA 3JRDA 2FX0A 2OFYA 4DYQA 4O8BA 4MCXA 4A3KJ 2M9HA 3MLFA 1PUFA 2H1KA 2PIJA 1ITYA 3S16J 4QTRA 4I8TA 1I6HJ 2DTZA 3RQIA 2L7MP 3BT9A 3RKQA 3SCGA 1ETXA 1Y1WJ
chains in the Genus database with same CATH superfamily
1TW2A 5HLGA 3TELA 4LIVA 1XCBA 3FYMA 4G6DA 1OCPA 2BY0A 4IWRA 2GIZA 3ERMA 2STTA 1TWFJ 1ZR4A 2R5YA 4CHUA 4ZDOA 1ZK8A 3TKYA 2XAFA 3OYJA 3CCEI 3SR4A 3BTCA 1QRYA 2VT3A 2PXPA 4BS9A 3DV8A 3OOPA 1MIJA 2P6SA 2OPTA 3HXLA 2DMPA 1R1TA 3E6CC 2E2HJ 2NNYA 2O3FA 2VBYA 3PJRA 4A3FJ 3IL2A 2UXNA 2DOFA 2O6GE 3E6MA 4YELA 2R92J 1TWAJ 4XORA 3ABKH 5TRDA 1YOVB 1JKOC 2QQ8A 2OF7A 5DV5A 2WC2A 5EEAA 2FBIA 1AWCA 3BD1A 2L4AA 4HZFA 2OAZA 2DN0A 3Q0UA 5BS6A 1X2NA 3HZJA 4GO1A 1FIAA 3RPQA 3SZGA 2O8XA 2M4KA 3BG9A 3D5LA 5L3GA 1P7JA 1G8XA 1ZZ9A 4ZTFA 2VONA 5DTMA 3G6EI 4HF0A 2CROA 1BBYA 1ETKA 4RB3C 4X4EA 1W7PA 3GTPJ 2PE5A 5LFAA 2JQEA 5E18F 1LVAA 2RNJA 3PFIA 4PFOA 1KGSA 3JR9A 2JZYA 3JSOA 4AC0A 2TDXA 3OR1C 1LDJA 3BP8A 4BXFA 2AS5F 3GZ6A 1FTZA 3IRRA 3EUAA 2LD5A 3DEUA 2MQKA 2FE3A 4GQMA 2DA4A 1KONA 3E6DA 4B1RA 5D5WB 3PQKA 3SDBA 4XRSG 3ZPXA 2AHQA 1O7LA 4KJZA 3OYBA 3K4LA 4BBSJ 1RZRD 2DI3A 2OJED 5EGOB 1G6NA 1DP3A 4Y15A 1NH3A 2DJIA 5L3DA 1R4NB 2XIGA 4DE9A 2IT0A 3SHFA 4CA0A 2CMPA 3QQ6A 2RDPA 4H4KC 2MXDA 2XXAA 2DLLA 1LQ1A 3WGIA 2PXDA 3F8CA 1U78A 3FM3A 5ILVA 3LQXA 1BN5A 2KMUA 4XOPA 3KYCB 4KFCA 3EUHA 3GZNB 1HKSA 3BR5A 2GM4A 3BS3A 3DTKA 5DUIA 3M1EA 1PP8F 1DGRM 1SMTA 2HDWA 2ZNYA 1D3YA 3WTVC 2BNMA 3DU5A 3HSFA 3ZMTA 2XHKA 2M8EA 2BVMA 2Z9OA 1ZZCA 2W00A 5E79C 4I2OA 3FXLA 1K7AA 4A6DA 2R7DA 2XF7A 3P9KA 1JJ8C 3R60A 2IXSA 5H6QA 3L2RA 1MW7A 2K4BA 2XASA 3TRBA 1IXRC 1SAUA 4J1XA 2EJRA 4HSTA 3CF5F 2QVOA 1W5SA 4F3QA 3RZDJ 2LYSA 3LQQA 1EF4A 3CCQI 5E17F 3CMMA 2BEOA 2RC4A 2KIFA 3DBLB 3SEZA 2DODA 5HLIA 5E3LA 2FOKA 4JYKA 4EVIA 1R9TJ 1IN7A 1SD4A 5F04A 3GFJA 2VLAA 2XVCA 2M7AA 4LD5A 2PJRB 4KMFA 3SDGA 1QP4A 3ZQ7A 3ZP5A 2B5AA 1NTCA 3FXJA 2VOOA 2EV0A 4IX7A 1U6GA 3H9JA 1ENHA 4M71A 4A3EJ 4YIFA 2W82A 3QU3A 4FT8A 1NW3A 2BBYA 3J7YJ 4RDUA 2E7WA 3I4PA 4KIFA 2QGUA 2VB6A 4AIDA 3OSGA 2DMQA 1BIAA 1ZG3A 4FX0A 2V3CC 2LNBA 3FXQA 1WH5A 3GN5A 2KT0A 1UZCA 1M1EB 1YW7A 3WU0A 2NXNB 2HQAA 3W6JB 1FBUA 1T0FA 3GW2A 4YEJA 1R1VA 1CF7A 1J59A 1FYKA 2EZLA 2PXUA 4IXAA 3SCGA 2LR8A 3PO2J 1X3ZB 2HOTA 1WJEA 2DDBA 2OZ6A 1DDNA 2NVQJ 1NG6A 3OYIA 3HPHA 1NEQA 4DZPA 3MZYA 2VJ5A 3DTIA 2JJ7A 2I5UA 2KZGA 2EV5A 1UXCA 3CMEI 4ZYGA 4BHPA 4XL9A 1HW1A 3KFWX 3VK0A 1C0WA 1P4XA 3BR3A 3JSPA 5IYCJ 3O9XA 3GTLJ 4LLGF 2E36A 3FIWA 2DJNA 3J80Z 1A6IA 2Y0SA 1U5TA 1YW8A 3UKGA 4DYCA 1MBFA 1TL8A 1VQLI 1IW7F 2MSYA 2DFEA 2ID3A 3GXOA 3L2CA 3CCRI 1SEUA 1SFEA 1QA6A 5IOZA 2VQCA 3U2RA 2VOPA 2DYRH 1IN6A 5JLXA 1T38A 1O4XA 2LYPA 3TO9A 4ZYHA 2VEOA 2H8RA 2BE5F 4CCMA 3K2ZA 3HYIA 3IKTA 3I56I 1TQIA 3CUOA 3BQZA 2WBMA 1IN8A 3W3CA 3QYEA 4YBAA 4KNYA 2F6CA 1MJ9A 1V5FA 1LVKA 2DQRA 3ZHMA 2IS4A 4YFXF 2L8NA 4JCYA 1J0RA 2NVXJ 5HDGA 1RI7A 4YG1A 1JJ6C 4HRIA 4MFDA 3F3XA 2HR3A 5HS9A 3HRSA 3K10A 2PXLA 2VBWA 2KEKA 3LWFA 3WG7H 3VWBA 3N05A 1QVTA 3L2VA 3ZQLA 3F8FA 3PNYA 1JFSA 3FMQA 2MH9A 1LPQA 2PJRA 2BZTA 2DFFA 4RBOA 4JBAA 2ZBKA 4ZDLA 5IT3A 2LLWA 4CUGA 4I6UA 3GCMA 1U0JA 2JRTA 5DM6F 1VQ4I 1B1BA 2LYLA 2Y30A 3RPUA 3FK6A 1FP1D 4AVZA 3PM1A 5LLQA 4NDWA 1FP2A 3VYUB 3NQOA 4HDVA 5B66C 5GAGJ 2LOOA 4GFBA 3WHBA 4HV6A 4IRHA 4BACA 3LSHA 1IC8A 2ZXWH 1TTYA 1Y0NA 3HOWJ 2OR1L 2EZHA 5M5YJ 1UAAA 2JVLA 1OCTC 2XAGA 4PGGA 2FJRA 1WVRA 2O4AA 2A68F 1X1AA 5FKNA 2LG4A 2JPBA 4X1EA 4IHWA 2WADA 2LKXA 1UG0A 2JA7J 1DU6A 5E3OA 2ZXJA 1BL0A 4BXUA 3KL4A 1DUXC 1D8KA 4FQGA 1VQ9I 5EJCA 2IRFG 5IY5H 3HRMA 2XI8A 2E34A 2PJPA 3HHHA 4XKVA 3RYPA 4BEHA 2AXLA 1ZRCA 3H3UA 4DYRA 4EEFG 4L5JA 1MNMC 3BQYA 2OZUA 2IS6A 2E2JJ 4DBRA 5ILUA 1T95A 4C3HJ 4XLHA 4MFEA 1X2MA 5CVUA 2JA6J 2VUMJ 3OIQA 2MH2A 1OPCA 4EM1A 4R1HA 5FKLA 3OKZA 2LH9A 2FNPA 2RGVA 2KLOA 1JT6A 4BQNA 3H3VK 1K6YA 3VEPA 2DCEA 4KIGA 1HCRA 3H9QA 2V6CA 1XD7A 1KA8A 2ETHA 4RAFA 3K2AA 3OYFA 3ISPA 4Q5SF 2AXUA 5FO5A 4ZYAA 3WGGA 2GRLA 2MD5A 5EYRA 4CCLA 1ONVA 1ZAOA 2A05A 3K4BA 3M1CA 2QSFX 4RAYA 5ICEA 2K7LA 2E2IJ 2VQHA 2ICTA 1ZAYA 4CCKA 4PDKA 2CUEA 2A61A 2P5KA 2LBFA 1D1CA 3S15J 2PXFA 5F1RA 5DD8A 1D0ZA 1VFCA 1N77A 1USTA 1U8RA 2XGDA 4JOMA 1OQYA 1XC5A 3G2BA 1WCMJ 1R58A 3QYBA 2E71A 4IVZA 3CROL 4DBQA 4FETA 2MG4A 4CCJA 3V7RA 4DZJA 1OFCX 1SANA 1QZZA 3C18A 4P1WA 3RQ4A 5H2FC 4M6YA 4XLCA 2P81A 5M3FJ 1IV6A 2IVQA 1R1UA 4L18B 2JVHA 4BAYA 1B8IA 3NROA 4D5FA 4AIHA 1PRUA 2BW3A 3ASNH 3DWLE 3HOXJ 2L0KA 2Y2ZA 2VKDA 2R5YB 4ER5A 1DPRA 4AU7A 1QVUA 2K40A 3KZ3A 2R4GA 2PUFA 2IVGA 3K4NA 3BLYA 3CC7I 3OYLA 4I6ZA 3L00A 1QBJA 5DYMA 5EG0B 2HS5A 3DEEA 2OA4A 3N97A 4MLOA 4YG4A 1KZHA 1JHFA 3UWPA 1AKHB 2X9DA 2ZMEC 5KVRA 3LISA 2VASA 2DT7B 3RTRA 1FMWA 2P7VB 5K7HA 2VL8A 5F08A 5IOYA 2HQRA 9ANTA 4KDPA 4HLXA 4U0VA 1ZUGA 4XKCA 2K02A 2QLZA 4HF1A 2NOJB 4M74A 4N9IA 1FBSA 2KJCA 2W25A 3LSRA 4XOTA 5D4RA 1UCRA 3DEWA 4A0YA 4C3IJ 2K3FA 3GTMJ 2VBXA 5D8LB 2CH0A 4RLQA 1MMDA 1QO0D 3Q0WA 3JTGA 3AL0C 3LNQA 4XLPF 1I5ZA 3GEZA 3JTHA 4LK0F 3LSPA 5DTDA 4O3MA 2R7OA 2EPFA 4XLFA 1FMVA 4RGSA 4UV9A 5KCMA 2O49A 2FJ1A 3UR3C 1MJBA 3WHCA 4BHCA 4ESJA 2KZ8A 2M45A 2EFNA 1PERL 2XXPA 1XS9A 4Y52J 3O8HA 2JVGA 1TNTA 2PX9A 4JX5A 5H20A 5J4VA 3J80K 5FB2A 3VODA 1A04A 1DP7P 3H3ZA 5JVTA 4IHXA 3BC8A 2HSGA 3TBIA 1VQPI 3F6VA 4CXFA 5K5OA 1F1ZA 5J1UA 4HNVA 3QYXA 3OYDA 2K3PA 2QWWA 1K61A 3GYHX 3HOZJ 1XTAA 3CQZJ 1LE8A 2FOWA 3HOYJ 1HKQA 3UNGC 4UV8A 2F4OB 2K86A 3JRHA 3EYIA 1MDMB 3TEPA 3H36A 3I58A 3KX2A 3SZTA 4KYWA 1PUEE 3I3LA 3NWTA 1JTYA 3NARA 1K78B 2CUZA 3LFUA 4F92B 2YBDA 3MD2A 2NS7A 2V1NA 5IYBJ 4FX4A 2LLVA 2ZSHB 1WJAA 4M73A 4A93J 2NAZA 5KHDA 2G0EA 2CW7A 2FF4A 3QODA 2AW6A 3EETA 3BCBA 2QQ9A 2Y0SN 5A7LA 1RUOA 3BG7A 3OYHA 4MCXA 2M9HA 5CYVA 2HZTA 4IL6C 4AIJA 3VSKA 1RR8C 2B9SA 1G3SA 1YIJI 1DPUA 3KP4A 2PUCA 1ZS4A 3BWGA 1Y1WJ 4ER7A 6PAXA 3RYRA 4UHTA 4BKXA 1GVJA 2E5NA 5FKMA 1UJ8A 3F6WA 1LDDA 5LGUA 2V9PA 2PMZN 4QWQA 1QZXA 1ZN2A 2F4IA 2AXZA 3DXJF 1F9NA 3LSJA 4WXDA 1E2XA 3BTLA 2VE8A 2R7FA 2Y9ZA 1S8NA 2K5CA 3FXRA 1W0UA 3JRBA 4Z59A 4EQZA 1I50J 5FLMJ 3ZMUA 4BU2A 3KP7A 5CKTA 1JUMA 4V2FA 1HA8A 1ZTRA 4A3IJ 2ISYA 1OYWA 2R93J 1W0TA 2A69F 4XKBA 1WRJA 2EWNA 3IKVA 1HQCA 4HSRA 4WF2A 4XKWA 2PXTA 5DSXA 4G7ZF 1FSEA 1ORKA 1R49A 2GLOA 3PSFA 3JRIA 3PUBA 1V4RA 2KIUA 2E19A 3V8JA 3KP3A 2LFBA 1VQOI 3GZDA 3NWSA 4JX4A 4A3MJ 4E7KA 4OOIA 2BYVE 3CJTB 1HKTA 1K78A 4PZJA 3DFGA 2W84A 2ELHA 3ERED 3NEUA 2ZXIA 1ZYRF 3KEYA 1FBQA 2UXXA 3JRGA 3MKLA 5CVJA 5DRTA 2EFWA 3AG4H 1PJRA 1W4MA 2LREA 3B7HA 2CW0F 4A3GJ 1WQ2A 2V6EA 5TISC 4ZJZA 2LYKA 1MKMA 2DA3A 3M8FA 4WVLA 2W48A 2KKOA 1IUFA 5EZHA 5K7FA 1W1WE 2EBIA 2EIKH 2KZVA 4G9YA 1EKEA 5FROA 4ZYDA 2EZIA 3CCJI 1RKWA 1A31A 3IH3A 2K9MA 5LRRA 3HOTA 2RV8A 3ELKA 4EQQA 4ESBA 1L1MA 2L54A 1BOBA 2XB5A 4L0ZB 2A6CA 3KXAA 1MNDA 3KLNA 4L0YB 4LLLA 3KZYA 4X4FA 5F27A 1XB4A 4MQ9F 2HVSA 3S1NJ 1MGTA 1X4PA 3FISA 4HEA2 1HC8A 3AAFA 1WHUA 1HF0A 2XXQA 2EZKA 5FLXZ 3CLQA 4NBQA 1OR7C 1T2KA 3ZXSA 3Q5FA 4HV5A 2JWTA 3KP2A 3QRFF 3CLOA 4HW0A 4NQWB 3K4JA 3BTIA 4LOCA 3I64A 1KQ8A 1ETWA 2P5VA 3E5UA 2DK5A 1ERDA 3H0GJ 4UUSB 3L1PA 3HBLA 1UELB 4HNUA 4LFUA 1POUA 1LQCA 2KIQA 2ZB9A 3BG3A 2ZSIB 1ZHFA 3P5JA 2M34A 3OYCA 1Z0XA 2L7KA 4I01A 4F91B 3LFKA 4CCOA 1WJCA 2EFQA 4P55A 1K6OA 2X1CA 2HU9A 4IOCF 1B9NA 2Y48A 4EJTA 4AUXA 3FDYA 3H1CA 1ZZ7A 2Q8KA 2PG4A 3MVPA 4FBIA 3DLAA 3GZ5A 2A6EF 2DOAA 4B43A 2ID6A 2L7FP 2HVRA 2BXZA 1RNLA 3TOAA 1Y39A 4C30A 1RZ4A 4U7BA 5BMZA 4BE1A 2KPJA 3CESA 1AU7A 3OYAA 5FRNA 4RA2A 1FNNA 3OQOA 2IBDA 3NDBB 1ODDA 2RQQA 2CFOA 1R6RA 4MEXF 4L9TA 2BNNA 2JQ7A 2V1DA 2EFPA 4B44A 4PCQA 4LGWA 1Y0UA 4A69C 4PJJA 1XGOA 1DW9A 3PO3J 4B3XA 1J75A 1PRVA 2L9VA 4BDZA 3GTGJ 3CCUI 2A6HF 3ASOH 3SCHA 4E7IA 1JKPC 2WTEA 2HKXA 1HBXG 2OD5A 4FTHA 3ECHA 4EKIA 1BJZA 1JHHA 4YIRX 4M3BA 1FOWA 1Y6IA 3CDHA 5CQGA 1MD0A 4AYBA 1RUNA 1UTXA 3VYTB 2M0MA 2QUFA 4HX8A 2RAEA 4UUVA 1G59A 3I59A 3M7GA 1B72B 3FF5A 3B6CA 1H9TA 3LA2A 3SXYA 1F5TA 4CO8A 1H9GA 4M72A 2R5ZB 1IDZA 2LP0A 3UFDA 1S72I 3H5AA 1ETVA 2VC0A 2CO5A 5F0HA 4Y4RA 2XC7A 4RS8A 2X1DA 4IF4A 2VJIA 5E3MA 4GYIA 2L4MA 2XGCA 4M9XA 1BJAA 3O3KA 4UY8I 4M3GA 4XNFA 5HS8A 1N78A 3ME5A 3LQRA 5B3SH 1IAWA 3AG2H 1Y56A 3T5XA 2YX7A 3G3ZA 2QBYA 3I59B 2DQLA 2HTSA 5FD5A 2EH3A 2WAQA 4RMNA 4BE2A 3V7SA 1EJ9A 3M9LA 3F72A 3JRAA 1WJFA 4Z5HA 1XSVA 2WY7Q 4E7JA 2IS1A 1T33A 1H0MA 2PQ8A 3W2VA 1KU2A 3NZLA 5E1XA 1ACIA 2HTJA 1GV2A 2EA4A 4E7SA 2RQPA 2F5FA 4P5OA 1RIOH 5EF6A 4XRMA 2EV6A 3QWLA 2COMA 2O8KA 3G1LA 5BPDA 2VKHA 3M07A 4V19K 5EEGA 2E60A 3FXUA 3CUQA 1IXSB 1X4OA 3VSLA 4X4CA 3U9GA 4G6TB 4MEYF 1WSUA 3S8PA 3D5RC 3TEDA 5IP7J 4UNOA 2YPRA 1FZPB 5D4SA 2M4HA 2HPIA 2XF5A 2KL4A 2ICWG 4N0BA 5L3FA 1DWKA 1MH3A 3SYTA 2XJ3A 4H0EA 2R7ZJ 1QU3A 1U5TC 5GPAA 1SD6A 3SQNA 3TFLA 5LRSA 1STZA 1XGMA 5EEHA 3FK7A 5D5VB 1Y8QB 2WWYA 5IT9Z 2KPMA 2TCTA 2PUGA 3CMAI 1D0XA 3OP9A 4B47A 3ZRGA 1JKRC 4ZDPA 5J1RA 1VQNI 2EBYA 3I4NJ 5IYDJ 2LYRA 4X4DA 2PXVA 2QM3A 1ZPQA 2D1VA 1IUYA 2XF6A 2XDVA 4NQWA 2KRCA 5C4JJ 1YE9A 3T8TA 2XSDC 5ICFA 2QF7A 2M1BA 2ZCWA 5M5WJ 2X1EA 5F1JA 2HDDA 1WH8A 1PYVA 3SFIA 4MNUA 1YS6A 2BJCA 2DA1A 1S5LC 2H27A 1BC7C 1Y1VJ 5DCMB 3WTSC 2GBYA 3IP4B 1FYLA 4IHVA 2PXBA 1R23A 4OIOF 3O8GA 5HS7A 2UZKA 2UWMA 3KZZA 2LYCA 4ABZA 5DEQA 3E97A 1RRJA 4OBMA 1QNTA 3S3NA 2ZJRF 2KFDA 3HUGB 1IJWC 4I02A 4E70A 2X48A 3HB9A 3NAUA 4EGZA 2DA7A 3BG5A 1NK2P 5C4XJ 1WH6A 3JXCL 3RI4A 3BG6A 2IA2A 3VDXA 2BV6A 2QA4I 1RESA 3AG1H 5AIQA 4KA4A 2ZNZA 4KUMA 4KISA 4LITA 1REPC 4XN3A 4HAMA 3B02A 1CF7B 1OISA 2DMTA 1IRZA 4X4IA 4UXNA 4I98B 1HW2A 2BOLA 2VKEA 3QYFA 4HRAA 4CDGA 3CC4I 3E7LA 5B1AH 2O9LA 5M3MJ 3G7DA 3SX0A 1EV7A 1D1BA 2KJBA 3MWMA 2AUWA 3H5TA 4BH9A 1GT0C 2CGPA 2JA5J 2AQFA 1R4MB 1O3SA 4F8DA 1AKHA 2G7UA 2CSOA 3OR2C 1G3YA 2F4MB 2FNAA 3GLXA 2I8DA 1KYWA 3KEOA 2CV1A 1J09A 1I27A 3F0CA 1NG7A 1O57A 2ZO4A 3KP5A 2XRNA 1EFAA 1ZZBA 1GXQA 2L5QA 2W57A 5DTQA 2LY1A 1QHHD 2CUFA 1QGPA 2KISA 3CJQB 3IUOA 5LHGA 2O61A 4ER0A 1OYIA 5F64A 2CUJA 2E7XA 1JGGA 3ZN1A 1ZR2A 5C3EJ 3R6SA 2P6TA 3TO6A 3WE3A 2WIUB 3A9XA 3G71I 1V5GA 4AD9A 1FLIA 1ZH5A 4KN4X 3W2WA 2H6CA 4KT5C 1ZLKA 2YU9J 3MFKA 2FMYA 1XG1A 3MZHA 2E1MB 1TT5B 4WWCA 4ER6A 2W24A 5L3CA 5J1YA 2EFOA 5FJ8J 4C9YA 1B6AA 2IJLA 3BR1A 1QQIA 2R7XA 2QBYB 1USSA 1JTXA 1QB2A 2EIJH 2GOMA 2Y75A 3FWEA 2PMHA 3HSEA 3FZVA 5AIPA 4BE0A 5D6FA 1B9MA 3F6OA 2GXGA 1QPMA 3OYGA 3TL4X 5CQEA 3HKZA 1VQ6I 1POGA 3OQNA 4D1QA 4IRGA 1OCZH 2X4HA 4MTDA 3SCFA 1U9OA 3BY6A 3QPTA 1X57A 3S1QJ 1J2XA 2JUCA 1HDDC 3BPXA 3HM5A 3I71A 4OINF 2JMWA 3A0BC 2RKHA 3VFZA 5LHHA 1H8AC 4RGRA 1ZREA 2B7EA 1HSJA 2OBPA 1A35A 1Q1HA 1R7JA 3GBGA 3TDZC 4BQOA 3F8BA 4I0AA 3E5QA 2VT2A 1BI0A 3CC2I 1V3FA 4I6RA 2LY2A 3DKYA 1TT0A 2KHMA 3I5UA 3REOA 3V7CA 2Z99A 4QPQA 4XLNF 3C2BA 4AWXB 3COAC 4PK4A 1ETYA 3WTUC 4HLYA 1VQKI 2HWVA 4A3DJ 4JQDA 3X2QH 2WB1N 3A4CA 3Q3SA 1ON1A 5HLTA 3K4CA 3JRDA 2FX0A 4O8BA 3MQ0A 5E1ZB 4CZCA 3MKYB 4A3KJ 2Z3YA 4BJ6C 4EV0A 2CYYA 3MLFA 2LKPA 1TNSA 2MA3A 2PIJA 4OWRB 3S16J 2CQNA 4I8TA 2XAHA 2LKSA 1WKMA 1GXPA 1J9IA 2O38A 3GLLA 5CPRB 1TBXA 3LSKA 4Z5CA 1OKRA 3FKJA 3HC7A 4U88A 4UVCA 3L2QA 1HW5A 1CQTA 2FRHA 1FOKA 4BXXJ 3MEXA 3Q9VA 2XUBA 5KAFC 3RDIA 2ELJA 3VYRB 4Z58A 2X51A 1ETQA 4EM2A 2R7WA 4CSWA 1FTTA 1Y7YA 3L09A 2KRHA 3PUFA 4XMYA 3FKIJ 3QFIA 2N8GA 3C1DA 4WXCA 5CVIA 2KQRA 1B8IB 1Y9QA 4MO7A 4OAZA 1LMB3 5HVQC 5FD6A 4L5EA 1XX5A 5KNLA 1XMAA 2CFXA 2BHZA 3KJXA 1QZYA 3J81K 3HSRA 3R0JA 3WG9A 5A2QK 3HKZN 2NVUB 2IV1A 3FBIB 2L9SA 1PUFB 1YHQI 3E5XA 3HZIB 3FYAA 2DK8A 2QKMB 3HL2A 3ZGKA 2OCEA 4A3LJ 1CJGA 4M9ZA 4YFKF 1X1DA 1Z05A 4KITB 5L3EA 2JN6A 4HQMA 4CYCB 5LD2C 4M6XA 4Z6YA 3CP8A 3K1PA 4EJVA 3F23A 3ML6A 3A1YA 2OUMA 1QP0A 3GUDA 2IU7A 3CO6C 4U0YA 3TMOA 4CH7A 2Z33A 3OL4A 4FCYA 1BI1A 1T39A 3E3VA 1I1SA 1X1PA 2HZDA 2Z5UA 3K6GA 4RB0A 4MTEA 1L3LA 3MAJA 3CDIA 2K9QA 3L7WA 2X85A 1U5TB 1X1BA 2VC1A 4ENJA 5JHUA 2NS8A 2YR2A 5CLSA 4EJUA 3A9YA 2VJJA 2WAFA 1XMXA 3K70C 4LK1F 1BC8C 5DRYA 5EZGA 2DA5A 2L7ZA 3OY9A 2DA6A 4I99C 5K98B 1S6LA 4GGGA 5CVRA 1HDPA 3FM5A 3OL3A 1ZARA 3CCLI 2R7SA 1E3HA 4M3EA 3QU6A 3SEQA 5DUKA 1D8JA 3DU6A 1KQ0A 1WI9A 2YX4A 4UVAA 3RJPA 1PRAA 2PUDA 1EH7A 4A2UA 2DMNA 1RPWA 2R1JL 2FA5A 4OU0A 3WTZA 3WTYC 2LVSA 1OR7A 5J8CA 3W2AA 1WI3A 2JA8J 1BOAA 1Z7LA 3GN5B 2Q1ZB 4GDFA 2HYFA 4X4HA 1O3TA 1A6QA 3OMTA 1LB2A 4N4OB 3D1NI 2TRTA 3BR0A 3M9AA 3IWFA 4AIKA 2DOEA 2BHYA 2YU3A 4U87A 3DKWA 4WX9A 1B59A 4KIBA 1ZG5A 2ZJQF 1TLHB 2WV0A 2VBZA 3IC7A 3W6VA 1Z7UA 3GTQJ 4IRIA 4MHGA 3CMYA 1U3EM 2JA2A 2J7UA 2Z16A 1WH7A 1YO5C 3IHUA 1K79A 1PNRA 3BJ6A 3FMSA 3GZCA 2HYJA 4FE4A 2H6BA 3TO7A 3U21A 1E17A 3P9CA 3U1DA 4X6AJ 2V79A 2HFHA 3M8JA 2HDCA 2VQGA 2P0WA 1SD5A 3G0TA 2L9NA 4UVBA 3FXKA 2VI6A 2VPLA 1BDIA 3L2WA 4PJNA 2DXIA 4NNJA 1BW5A 1FJLA 4E4HA 1R5ID 3GZDC 3CP2A 4W1UA 2HFZA 3KIOA 2V9VA 1I39A 4G7HF 2Y0MA 3CCSI 3RSNA 2R7RA 1IRXA 1RIOA 3LAJA 4EGYA 3HEFA 3LAPA 2F5EA 3FXMA 2PXEA 4NC8A 3KE2A 3GTOJ 2MLKA 1ZLJA 4IKFA 5J6XA 2GA2A 4CYDA 2P7CB 3RKXA 3OOUA 1KU3A 1FWZA 2P4WA 2BY2A 2EINH 3MCZA 3DM5A 4EATA 2EILH 4M3DA 1HLVA 2HOAA 3ZOBA 2FQ4A 4HPQA 3LSMA 1U8BA 2KIMA 5DT2A 3TW7A 4BUPA 2EIMH 2ELKA 1ZGAA 3DBRB 3PNVA 4I0BA 4OIRF 4XICA 3PE5A 3FX3A 3TW6A 1MBEA 3C7JA 3HUGA 2PXQA 3E6BA 2GXBA 3CLCA 2PUEA 2HQNA 5J4YA 2ME0A 3R61A 4YFNF 3EDPA 4B3AA 3DLLF 5TJJA 4F7ZA 3HG9A 1XSDA 3KPHA 1MBGA 2IPQX 2KEJA 4XM3A 4JP0A 3TP3A 2XKPA 3S3OA 2E1CA 4A12A 2K85A 2XKOA 1RZSA 2RNGA 3OIOA 5J40A 3BDDA 2YSRA 1E0EA 1APLC 3G73A 4A5MA 3ZQQA 3ABUA 2E1MC 1BM9A 1X1CA 3WTTC 5JVGF 3S8QA 2CV0A 3K4KA 4D9JA 4DOZA 2L01A 3ULQB 5DTRA 5JFRA 5BPIA 2K4JA 3B73A 1Z77A 3LA3A 3ZCOA 3OYMA 2NOGA 3WU1B 3RZZA 2COBA 3CF2A 4ETSA 1Z67A 4I76A 3GFIA 2G9WA 1U9NA 1WZ2A 2H1LA 1LFUP 2BNOA 4R79A 3AKZA 3K1NA 3OQMA 2MLGA 4NC6A 2PFBA 1VQ8I 2ISZA 2X6YA 3ZPLA 2R63A 3IRQA 2Y69H 4G94A 1ZZ8A 4B4CA 1RKTA 4FISA 3ZR8X 1ZKGA 2PBIA 2E1NA 2GAUA 3LOCA 1ZGWA 1IV8A 3GWZA 1R71A 2J5OA 1XCVA 2JUGA 1EA3A 1OCRH 1A5JA 1JWLA 2O03A 3QAHA 2RVCA 4EZIA 5CJ9A 2V1UA 4XSXF 4KN7X 3GTJJ 4IA8A 2CQXA 3J81Z 4NB5A 3J7AO 3PIOF 3EUSA 2HCSA 4L5IA 1HQ1A 1WJ5A 2GZWA 2JRMA 4D7MA 2Q0OA 4LLNA 2QSHX 4XQFA 2IGMA 1P4AA 4DGWB 2H8WA 2FUG2 3EUHC 3AG3H 2L2OA 4N9HA 4A5NA 1KYZA 2DYSH 2QSGX 3R4KA 5GAEJ 2DTRA 3M8EA 2FMLA 3GMEA 1IRGA 3EQLF 1TC3C 3WGHA 3I9V2 3R1FA 2E1OA 2EB7A 4LB5A 4NHJA 3TP0A 4S05A 1SC7A 4U0WA 2ESNA 3AL0B 2ODRD 1MNEA 1S3JA 1ADRA 3S3MA 2V7FA 2CJJA 2ZFWA 3N4MA 2JSPA 4HX7A 4PJMA 2WA0A 3LSIA 3FHZA 2FBKA 2AQEA 2UUZA 4A3JJ 1YSEA 2E5ZA 2BY3A 1G2HA 5FKKA 1Z6TA 4HDUA 4Y42A 1YI2I 4IOAF 2OQGA 1ZVVA 2IA0A 1F43A 3V4GA 4FN3A 2MEZA 3HRTA 3GUUA 4LG0B 4XLAA 4LG3A 3FHNA 3DNVB 4G7OF 5GAHJ 1WJBA 4BEHB 4MGRA 4Q48A 4IO9F 3VPRA 3H5RA 1JI8A 3OYEA 1ZG1A 1VI0A 3VOEA 2A5YB 1PVEA 4ENKA 1FOXA 1UHWA 4GRIA 4EKGA 1O7FA 1KU9A 2LY9A 3HGGA 1FSHA 3K1MA 1MFQC 3ZHIA 2B0LA 4ITVA 3QOEA 4HOBA 1V55H 3M3YJ 1BR2A 1MBJA 2Z2SB 2V4JC 5KK1A 1QQBA 4J1WA 4GCVA 1GV5A 5IPAA 2A3SA 2XGXA 3SJMA 4E7LA 4JCXA 1JUSA 3L9FA 4FHTA 4RGUA 3ZQHA 3EUKL 2OTJI 2IA1A 3BR6A 2XGEA 4PU8A 3EPZA 3CECA 2BVLA 1BR1A 5E3NA 3HHGA 2HEOA 2CG4A 1BW6A 2XB0X 3RCOA 4BJTA 1LUJB 4ZZLA 2VE9A 1T98A 1OMIA 3F51A 5E20A 5HDNA 5GADJ 4N4NB 3F52A 1R00A 1BDHA 4Y3OA 2D1HA 2R0QC 2MABA 4HBLA 3ABLH 2O5RA 4PSWA 4S04A 4RAZA 2OCCH 3T8RA 2ACJA 1CGPA 1LCCA 2MYSA 3KP6A 2KDZA 3ABTA 3DBHB 1SFOJ 3GO5A 2VXDA 3V42A 4A0XA 5LHIA 1SMYF 3MN2A 4B48A 3GX4X 1ZELA 2VQLA 4CCNA 1IF1A 4KT6A 1TZLA 1HOMA 2CWEA 2WY8Q 2EQRA 1QPIA 1G3TA 3CZ6A 3JRCA 4UUSA 2GXAA 4ESFA 2JPCA 2X6WA 4TV7A 4DQ2A 5ICCA 3IAS2 4OIPF 3QOXA 2PUAA 2HKOA 4RM2A 3W6KB 2GOXB 2V26A 3U3WA 2DMUA 4X4BA 3QWGA 1UHMA 1TWGJ 4PGHA 2M3AA 3BOQA 4WCGA 1VQ7I 3OWQA 1IXCA 1LJ9A 4XRSA 3PIPF 3RZOJ 3JRFA 3V8KA 2FFHA 3BJAA 5GPCA 4RLFA 1DULA 3T1BA 3S14J 2GQQA 4DW6A 1Z6RA 3I55I 1QQAA 2HGCA 3IV5A 1L0OC 3H92A 1S29A 2V9KA 2XPVA 3CO7C 2L49A 5E1WA 2VIXA 4PU4C 2A07F 2M5WA 3QOPA 1IZ1A 5FFXA 1D5VA 4RB2C 2OC6A 4II2A 5BQTA 1YQAA 2ME6A 3K69A 1MMAA 3I4MJ 1G4DA 2KDOA 1MBKA 2ZMEB 3EYYA 1X2LA 3O2PE 2MD0A 1JE8A 3Q9SA 4ZTJA 3LSGA 4NC7A 3F9KA 2XRLA 1UFMA 3QPHA 3LSTA 1DGWY 1T8IA 2R7UA 3NXHA 2O7OA 1VPWA 2MFZA 1P6RA 3F21A 2RREA 2P8TA 2XV4S 2NNNA 3CCVI 4IPAA 4BGDA 3A01B 2HCNA 2ZKZA 1XDSA 2W4SA 4IQJA 1IDYA 3I0TA 4MQVA 2R3SA 3ESWB 1XGSA 3M4OJ 1X3UA 2DDAA 3ZMSA 1RETA 4O5VA 3S2DJ 3QOWA 2WAQN 1JFTA 2LTPA 5F6FA 2LC2A 2OFYA 4ER3A 4DYQA 1I3AA 4IVNA 2F5DA 2W1OA 4QTRA 4BQAA 2DTZA 1I6HJ 2L7MP 3RKQA 3BZKA 1S7OA 4P96A 1VQMI 2JTVA 2PMUA 4OB4A 1IN5A 1YIOA 1WFXA 4ON0A 4G8XA 2Z1DA 4M9SA 1YX3A 3KYDB 2HQ5A 4ASNA 2MC3A 4HNTA 1UHSA 1OYYA 4ZYEA 5L3BA 5DM7F 3ZQCA 4Y7NJ 1IGNA 2LDUA 2IW5A 1R22A 3PL8A 1AHDP 1DQUA 3S93A 1J7KA 1D0YA 1XWRA 2BY1A 2IGOA 2W85A 4EMSA 5FLVA 2VJ4A 5J3LA 3A9ZA 5B5EC 3TOBA 4DE8A 3MMYB 3CTAA 3JXBC 3ZMDA 3DF8A 3C3WA 2MGQA 1WJDA 5KAIC 1R5HA 3H0DA 1QPZA 4QIWN 4BJ5C 3OIPA 4G12A 1FOYA 2DFHA 5F0CA 1VNDA 1P4WA 4LB6B 4HQEA 3MKZA 1JXSA 1N25A 2KEIA 3HIFA 1HXDA 3C2HA 5JUWA 2R7QA 1XN7A 3BJOA 4G6QA 4L9NA 3CCYA 3A01A 3WU2C 2F5VA 2HNHA 4CICA 1LEBA 1R63A 1FX7A 2D45A 4GXOA 4PSXA 4Q2JA 1S7AA 5IP6A 1X19A 1NERA 2GZUA 4PUSA 1YFHA 1MZBA 2VXZA 5D6EA 3J7AY 3DPLC 2L3DA 5EDNA 5EGOA 3OS1A 5E8GA 4AM3A 2HPMA 4KMUX 4BBRJ 1VQ5I 3P7NA 2ZMEA 3CDLA 1KU7A 3GF2A 3GFLA 4OMZA 4A3BJ 4XR6A 3FMYA 2DAOA 2VKVA 4ZC3A 3GBFA 2STWA 2LF8A 2CQ7A 3VB2A 2V1XA 2K9LA 3QQAA 1FT9A 4UB8C 3ZQGA 1OCOH 2FQ3A 2QCOA 1QP7A 4L9VA 1LLIA 1B72A 1W7PB 2CV2A 5GTIC 3MZ8A 4OMYA 1JKQC 2MC4A 3OV8A 3Q0VA 1XDUA 5IT9K 4GYGA 2CU7A 1MSFC 1AOYA 4YG7B 2PLYA 2IEKA 3KZIC 1YG2A 3G4SI 4CYCA 2ESHA 2X0LA 3A02A 4IHSA 4OIQF 3VYSB 1R5GA 1ZZ6A 4X4GA 2OTLI 2WB1A 2M2EA 1T6SA 3KYLA 5D5UB 1WGXA 3WODF 4RB1A 2XIUA 3PFYA 2LNMA 1K4TA 2GRMA 2J7WA 3S2WA 1U2ZA 1F36A 4BY7J 4Q47A 1TWCJ 1N75A 2XCJA 4AYBN 1F4KA 1YRNA 5H6RA 5EG0A 5JHFA 1LEAA 1HSTA 3RIRA 1LKXA 4B09A 4YRVA 3H9GA 5F0FA 5LGTA 4PJLA 2HINA 5FFZA 2IGKA 4LJZF 4PU3C 2X6XA 1MMSA 2PEXA 1FC3A 1QHGA 4MIMA 3S32A 2DPDA 4V2GA 1YITI 2IVMA 3D0SA 3FXOA 1OCCH 1YJ9I 5D5XB 1JT0A 1MBHA 1E3OC 1I3QJ 1XMKA 4EM0B 3ECOA 3IAM2 5LGNA 1VZ0A 2VPRA 3SFZA 2LK2A 2QQBA 2H94A 4F93B 1YTYA 5TGTA 2HI3A 3BCAA 3BR2A 1YS7A 1P2FA 3CUQB 1ZQ3P 2ZJPF 1JGSA 1S7EA 2LMDA 2NVTJ 1Q1VA 1NK3P 2R7VA 3CCMI 2K9SA 5DCFA 2GWRA 4GHJA 2K27A 3K4MA 2F5CA 4RAGA 4L9JA 1P7IA 2IUOA 5HNHA 4HYEA 5DDGA 5HOOA 2XAQA 4I6TA 2M0CA 1UG2A 3S1RJ 3T0YA 2L1PA 1B4AA 3TQNA 5JI6A 2VN2A 5J8FA 4QSHA 1XPXA 1IO2A 3JAMZ 2MBFA 5GAGi 4IZZA 2DO7A 3OS2A 1UXDA 3BDNA 2IGNA 3OYNA 1SVLA 2DA2A 4LG0A 1K4SA 1Z9CA 1SFKA 5A2QZ 3P9IA 4IHTA 4UB6C 2RN7A 3QPLA 4X0GA 1MSEC 3ROUA 5J47A 2WV1A 2L02A 5AONA 3IWZA 3KLOA 2QKLB 2W7NA 4AVPA 1LNWA 1X3WB 2FSWA 1K83J 4EJOA 3F22A 1Z91A 4LIUA 2FD5A 3PXPA 5DS9A 2PUBA 2JK3A 3HOVJ 5JLWA 4Y33A 4PJ0C 3JREA 3HDDA 3DP7A 5HDKA 2XAJA 3PQJA 4XSZF 4ZZDA 3BPVA 3J7ZI 3A2KA 3I53A 2MW8A 1BR4A 2PI0A 3A0HC 1GVDA 3K0LA 4RGXA 2HOSA 2HVQA 2HYGD 4XIDA 3BZCA 2GIVA 3S17J 4CGZA 3U1KA 1RPEL 5K1YA 1Z21A 3WE2A 2CSFA 2J5PA 2CQKA 3ONQA 2IP2A 1TP4A 4NUBA 3S1MJ 4UUTA 2XPUA 1W36C 2ZC2A 3RKYA 1IN4A 4O6JA 1MJAA 3WTXC 2DT5A 2QZ8A 2FU4A 3F8NA 2AXTC 3BZ6A 5FGMA 1YW9A 4YG2F 1ZRDA 1BI3A 5GP9A 2BXYA 3VWSA 3JCUC 2C6YA 2QYOA 1ULYA 3OYKA 2GA1A 4ZH4F 2Y9YA 3FMRA 2YUSA 3R0AA 1TWHJ 2LSOA 2O0YA 2DT6A 1X58A 2D2WA 2QEXI 1FIPA 2M8GX 3GFMA 2IAIA 1LCDA 2M7BA 4BHBA 3F8MA 3ZMVA 2DW4A 4J00A 1O3QA 1EH6A 5GAHi 5JR3A 2I10A 5ED4A 1FEXA 2PN6A 4A3CJ 4C2MJ 1PP7U 1YRNB 4OAYA 4XN0A 5C44J 4XONA 2QENA 1VF9A 2G7HA 4C2TA 2P5LC 4EJWA 2Q2EA 1IG7A 1TQPA 3KEQA 2H09A 3C2GA 1D1AA 4BQQA 2B63J 5FRMA 1MMNA 3S2HJ 4LMYA 5B1BH 1GDTA 2ZXHA 4E7HA 4QLCU 1T0FC 1BA5A 1ETOA 1BIBA 1W7PD 3GVAA 1Z3YA 2A5WA 2CQQA 3ZQIA 3TDUC 3I54A 2A6TA 3HOSA 2FEZA 4WXHA 4BL0B 1KQ9A 2LYJA 3E0JB 4BNCA 4XLEA 1W36D 4YARA 5CVVA 3D5SC 4A0ZA 2L9RA 1MDMA 1XSXA 2NS0A 3DTEA 4C3JJ 2PPXA 2WAEA 1A36A 1W5TA 4HF2A 5FKOA 3CJNA 4C2UA 2F48A 2WUSR 1NHAA 1TW3A 4ENNA 1YJWI 1ZGJA 3LL7A 4JK1X 4JX6A 4IHYA 2VODA 2AWIA 5ILSA 4DJAA 1G3WA 4BY1J 1DU0A 2IS2A 1T08B 3OSFA 3JW4A 2EWTA 4BDYA 1R69A 2EK5A 4M3FA 2LLKA 5DCMA 2LF7A 4S0HB 1JH9A 1AA7A 4IEJA 3RPUD 4DIQA 1PDNC 5D8KB 2AXVA 1V54H 5BOXA 1LFBA 4Z2YA 1LDKB 2NVYJ 1H89C 4JQFA 4E6KG 2ECCA 5GTHC 1YYVA 1H88C 4F52A 2F2EA 3RKWA 3OS0A 1E3PA 2M30A 4II3A 3DPTA 4XRFA 2D5VA 3ZMZA 4B8XA 2XPWA 1FPQA 1Z1DA 3HRUA 4W97A 4U7DA 3HTSB 2EF8A 4EK9A 2NYXA 2ECBA 5ERIA 1VTNC 2Q2EB 4K2EA 1SQ8A 2LCVA 1WWXA 2M87A 3MEJA 2FBHA 1MH4A 4XK4A 3OMYA 1FYMA 2K9NA 1J5YA 1R36A 3SZPA 2Y31A 1D5YA 4Z5DA 1TQMA 4I7HA 3LMMA 1WPKA 2DFIA 1W5CC 3H5NA 1RR7A 2KRFA 4IQ4A 2OV7A 4J01A 3HOUJ 1JUPA 2CS3A 2JCGA 5E8IA 2KP6A 1Z3XA 3B6AA 3NRVA 4Y13A 1SVOA 1RZRA 4I09A 4CZZA 4ANJA 2NRAC 2BGCA 2XAUA 5LBQA 1QZEA 2BW3B 1LFPA 1GLNA 4Y17A 3QF3A 3JXDL 2R7TA 5LEJA 2OU2A 4ENMA 4DNCA 2PXKA 3K70D 2HXOA 3QPSA 5FLXK 3BROA 3LA7A 1SAXA 2JSCA 1FY7A 3G5GA 5BNGA 1BI2A 3K9TA 3E1SA 2LYQA 3DKXA 4HG2A 1I6XA 3G1MA 2X6OA 1YJNI 4J19A 1GHCA 3ZN0A 3HPGA 1SD7A 2HXIA 2ZJ2A 5HLHA 1SVMA 2LBFB 5IP9J 5K5RA 4D7NA 1SFUA 2HOEA 4MCTA 5LEKA 3ZKCA 1YX5A 2M4GA 2YS9A 3HJEA 3JAMK 2IVBA 2DPUA 5HNFA 4M6VA 3PSIA 4PU7A 1UMQA 1U2WA 3L2UA 3BTJA 1T56A 1S9HA 4RM3A 4KICA 1ZRFA 1LE8B 2AO9A 2UV1A 1I1GA 5HODA 2E35A 1WIZA 2CRGA 1V5EA 3HGYA 3A03A 3QP5A 1EH8A 2EA2A 4P9UA 2ICPA 3DCFA 4R8HA 3R09A 2PMZA 5M5XJ 4HX4A 3TGNA 2XROA 3LFPA 2XSJC 4WK8F 1RC9A 1UB9A 2R5ZA 3K7AJ 4NDLA 3V8LA 3CUQC 5K5QA 2JT1A 5K7ZA 1OJLA 1O3RA 3DQVC 4BYYA 2CW8A 3IH4A 4FASD 2DU9A 3ABMH 1WETA 4F55A 3CJRB 3O6BB 4FE7A 1IRFA 3WTWC 3KCCA 2LRDA 1YLFA 4P9FA 4D0PA 3CD6I 2ZFUA 3IVPA 4D5CA 1OSLA 3FBNB 2ADUA 3G1OA 1B0NA 1P9QC 5DD4A 3DPUA 1GUUA 4IJAA 4Q4ZF 4XBFA 3GTKJ 1ON2A 2OQRA 3IH2A 3ZQFA 3OWTA 2FXAA 2DBBA 4HA8A 4E7ZA 3MKWB 1SFXA 3KETA 1Y8RB 3H35A 1PUFA 4QPOA 3PNTA 2H1KA 3HTUA 3QP6A 1P92A 2QQAA 1ITYA 1OLTA 4PFPA 4YIIA 1XGNA 3RQIA 3BT9A 4A6EA 5ICGA 1MMGA 1ETXA 3AFHA
chains in the Genus database with same CATH topology
4OB4A 4Z5CA 4BKXA 3FYMA 1OCPA 1CQTA 4BXXJ 2HQ5A 4IWRA 5FKMA 1UHSA 3F6WA 1TWFJ 3ZQCA 1ZR4A 1IGNA 4Y7NJ 2R5YA 2PMZN 4Z58A 1ZK8A 1ETQA 1FTTA 2AXZA 1Y7YA 3LSJA 3BTLA 3FKIJ 3BTCA 2Y9ZA 1QRYA 2N8GA 1AHDP 1B8IB 1XWRA 1W0UA 1Y9QA 4MO7A 5FLVA 1LMB3 3JRBA 4L5EA 2OPTA 5J3LA 4Z59A 2DMPA 2E2HJ 3KJXA 1I50J 5FLMJ 2O38A 4A3FJ 1JUMA 3HKZN 4V2FA 2IV1A 3JXBC 1ZTRA 2MGQA 1PUFB 1TWAJ 4A3IJ 2R92J 2R93J 1QPZA 4QIWN 1W0TA 3FYAA 3HZIB 1JKOC 4G12A 4A3LJ 2OF7A 1CJGA 5F0CA 1VNDA 5EEAA 1ORKA 3BD1A 2DN0A 3Q0UA 2GLOA 3JRIA 2JN6A 4CYCB 1X2NA 2E19A 2KEIA 2LFBA 1FIAA 4JX4A 4A3MJ 3CCYA 3A01A 1QP0A 1R63A 3BG9A 1ZZ9A 1P7JA 2IU7A 2CROA 5IP6A 1ETKA 1NERA 2GZUA 4X4EA 3JRGA 3MKLA 3GTPJ 2PE5A 4FCYA 5EDNA 5EGOA 3B7HA 3JR9A 4A3GJ 2K9QA 4BBRJ 2LYKA 4AC0A 2DA3A 2NS8A 2W48A 3CDLA 1FTZA 1IUFA 5EZHA 5K7FA 2LD5A 2EBIA 4A3BJ 2MQKA 2EZIA 3FMYA 1RKWA 5EZGA 2DA5A 2DA4A 2L7ZA 2VKVA 3IH3A 2DA6A 4B1RA 4XRSG 3GBFA 2AHQA 5K98B 4BBSJ 3QQAA 1RZRD 1L1MA 3ZQGA 1HDPA 2QCOA 5EGOB 2XB5A 2A6CA 3KXAA 1QP7A 4M3EA 4X4FA 1LLIA 1B72A 5F27A 3S1NJ 3QQ6A 1PRAA 2PUDA 1JKQC 3Q0VA 3FISA 1HF0A 2DMNA 1RPWA 2R1JL 2EZKA 2CU7A 1MSFC 2LVSA 1U78A 4YG7B 2IEKA 1WI3A 2JA8J 2JWTA 3GN5B 4X4HA 4CYCA 3BTIA 3A02A 4LOCA 1ETWA 3OMTA 3BR5A 3D1NI 2GM4A 3BS3A 1ZZ6A 3H0GJ 2TRTA 4X4GA 3BR0A 4UUSB 3L1PA 2M2EA 3HBLA 1WGXA 1POUA 2BNMA 2XIUA 1LQCA 1ZZCA 2ZB9A 2GRMA 3BG3A 3W6VA 1F36A 2M34A 1Z0XA 1JJ8C 3GTQJ 4BY7J 1TWCJ 2XCJA 4AYBN 1YRNA 3TRBA 3CMYA 5EG0A 4J1XA 5F0FA 1WH7A 4AUXA 1PNRA 1ZZ7A 2HINA 3RZDJ 2LYSA 1EF4A 2HYJA 3MVPA 4FE4A 4FBIA 4PU3C 4MIMA 4V2GA 5E3LA 4JYKA 2ID6A 2L7FP 1R9TJ 4X6AJ 5F04A 2KPJA 1AU7A 1JT0A 3OQOA 2VI6A 1MBHA 2IBDA 1I3QJ 3SDGA 1E3OC 1BDIA 1QP4A 2BNNA 2VPRA 2B5AA 1NTCA 2LK2A 1FJLA 1BW5A 2HI3A 3BR2A 1ENHA 4A69C 4W1UA 4A3EJ 1DW9A 1ZQ3P 3PO3J 1S7EA 2NVTJ 1Q1VA 1NK3P 1PRVA 2K9SA 3GTGJ 3SCHA 4GHJA 1RIOA 4RDUA 1JKPC 3HEFA 3OSGA 1P7IA 2DMQA 2IUOA 3GTOJ 4FTHA 3GN5A 1WH5A 2KT0A 4I6TA 1BJZA 2M0CA 1UG2A 3OOUA 4M3BA 3S1RJ 1UTXA 2EZLA 4QSHA 2RAEA 4M3DA 2LR8A 3PO2J 1HLVA 2HOTA 2HOAA 3ZOBA 2NVQJ 1B72B 1UXDA 3B6CA 1NEQA 3BDNA 2FQ4A 4DZPA 2DA2A 2JJ7A 1U8BA 2R5ZB 1IDZA 2LP0A 1UXCA 3TW7A 3UFDA 1ETVA 2ELKA 5F0HA 3QPLA 1MSEC 3VK0A 4XICA 2WV1A 4GQMA 3BR3A 3O9XA 3TW6A 5IYCJ 5E3MA 3GTLJ 1MBEA 3CLCA 3FIWA 2XGCA 2PUEA 1K83J 2DJNA 2FD5A 1A6IA 2ME0A 4M3GA 3UKGA 5DS9A 3PXPA 4DYCA 1MBFA 2JK3A 4B3AA 5JLWA 3HOVJ 2PUBA 3JREA 1MBGA 2MSYA 3HDDA 2KEJA 2ID3A 4JP0A 5IOZA 3TP3A 1O4XA 5JLXA 2LYPA 2MW8A 2EH3A 2H8RA 1RZSA 1GVDA 2HOSA 3OIOA 4XIDA 1APLC 3BQZA 3S17J 1RPEL 4YBAA 2CSFA 3JRAA 4Z5HA 3S8QA 1T33A 3S1MJ 4UUTA 3ZHMA 2XPUA 2L8NA 4JCYA 2NVXJ 1GV2A 1Z77A 4YG1A 5EF6A 4XRMA 2NOGA 2O8KA 3RZZA 2COBA 1JJ6C 3G1LA 4MFDA 4I76A 2KEKA 1U9NA 2BNOA 1LFUP 4X4CA 3OQMA 5GP9A 1QVTA 3ZQLA 1JFSA 3TEDA 2R63A 5IP7J 4RBOA 1ZZ8A 4B4CA 1RKTA 2Y9YA 4FISA 2YUSA 4I6UA 1ZKGA 1TWHJ 2LYLA 3LOCA 1ZGWA 2Y30A 1DWKA 1X58A 1MH3A 1FIPA 2M8GX 3FK6A 2IAIA 2XJ3A 3PM1A 1A5JA 2R7ZJ 4NDWA 1JWLA 1LCDA 5GPAA 4GFBA 3WHBA 2I10A 1FEXA 3GTJJ 4IA8A 4A3CJ 2CQXA 4C2MJ 1IC8A 1YRNB 3FK7A 3EUSA 2TCTA 2PUGA 5C44J 3HOWJ 1VF9A 2OR1L 2EZHA 3OP9A 5M5YJ 2JVLA 4D7MA 1OCTC 1JKRC 5J1RA 2EBYA 2FJRA 2O4AA 3I4NJ 5IYDJ 5FKNA 1IG7A 2LYRA 4X4DA 2B63J 4X1EA 1ZPQA 4IHWA 2LKXA 2JA7J 3S2HJ 1DU6A 5E3OA 1GDTA 1BL0A 5C4JJ 2XSDC 1BA5A 1ETOA 2QF7A 1TC3C 2CQQA 3ZQIA 5M5WJ 3R1FA 2E1OA 3TP0A 5F1JA 2HDDA 2XI8A 1WH8A 2LYJA 3SFIA 2BJCA 4YARA 1ADRA 2DA1A 2L9RA 2CJJA 4DYRA 4C3JJ 1Y1VJ 4EEFG 2PPXA 5FKOA 1MNMC 3BQYA 2WUSR 2E2JJ 2GBYA 4IHVA 4C3HJ 4A3JJ 4MFEA 1YSEA 3O8GA 1X2MA 2JA6J 1G2HA 4JX6A 5FKKA 4IHYA 2VUMJ 4ABZA 2AWIA 2PUCA 4Y42A 5FKLA 1IJWC 4BY1J 1ZVVA 1JT6A 2X48A 3HB9A 3NAUA 1DU0A 1F43A 4FN3A 3OSFA 2MEZA 3H3VK 2DA7A 2EWTA 3BG5A 1NK2P 5C4XJ 1WH6A 3JXCL 1R69A 4M3FA 1HCRA 1RESA 2LLKA 3DNVB 4S0HB 3K2AA 1JH9A 2AXUA 4IEJA 3VPRA 2AXVA 2GRLA 1VI0A 2DMTA 1LFBA 5EYRA 2NVYJ 1H89C 1IRZA 4X4IA 3HGGA 2LY9A 2E2IJ 2ECCA 2ICTA 1ZAYA 3ZHIA 2CUEA 2VKEA 1H88C 3M3YJ 3S15J 1MBJA 3E7LA 1QQBA 4J1WA 1VFCA 2D5VA 2O9LA 2XPWA 4W97A 2XGDA 5M3MJ 1GV5A 1XC5A 5IPAA 3SJMA 2EF8A 1WCMJ 2ECBA 3G7DA 4JCXA 1JUSA 2AUWA 3ZQHA 4IVZA 3H5TA 1SQ8A 3CROL 3BR6A 2XGEA 2LCVA 4PU8A 1GT0C 2JA5J 3CECA 2MG4A 4DZJA 1MH4A 4F8DA 1OFCX 1SANA 4XK4A 1AKHA 2K9NA 5E3NA 2P81A 2Y31A 1D5YA 5M3FJ 4Z5DA 1IV6A 2IVQA 1BW6A 1B8IA 1WPKA 2XB0X 4D5FA 1PRUA 1RR7A 3HOUJ 3F51A 1JUPA 3HOXJ 2JCGA 2L0KA 2Y2ZA 3F52A 2R5YB 3B6AA 3F0CA 1RZRA 1BDHA 1EFAA 2R0QC 2PUFA 1QVUA 2K40A 3KZ3A 1ZZBA 2IVGA 3QF3A 3JXDL 4I6ZA 5EG0B 2CUFA 1LCCA 4MLOA 2HXOA 2KDZA 4YG4A 3QPSA 1SFOJ 2X9DA 1AKHB 3LISA 3MN2A 5K7HA 1JGGA 5F08A 5IOYA 5C3EJ 1ZR2A 9ANTA 5BNGA 3G5GA 1ZUGA 2WIUB 1HOMA 2EQRA 2LYQA 1QPIA 3G1MA 3JRCA 2X6OA 4UUSA 3LSRA 2PUAA 4J19A 2HXIA 3DEWA 4C3IJ 2YU9J 5IP9J 3GTMJ 3U3WA 2DMUA 1XG1A 4X4BA 4D7NA 3QWGA 1TWGJ 4MCTA 3Q0WA 3ZKCA 5J1YA 2YS9A 5FJ8J 3LNQA 2IVBA 4XRSA 4M6VA 3RZOJ 3LSPA 5DTDA 3JRFA 5GPCA 3BR1A 3S14J 4PU7A 1UMQA 2O49A 4DW6A 3BTJA 1T56A 1QQAA 3IV5A 1JTXA 2FJ1A 2XPVA 2L49A 1LE8B 2AO9A 3WHCA 2KZ8A 1PERL 1XS9A 4Y52J 3O8HA 5HODA 4PU4C 4JX5A 1WIZA 2CRGA 3HGYA 3A03A 1ZS4A 2ICPA 3DCFA 2ME6A 4IHXA 5M5XJ 3I4MJ 2HSGA 1MBKA 1X2LA 3LFPA 4HNVA 5J1UA 1POGA 3OQNA 3QYXA 1K61A 2R5ZA 3HOZJ 4NDLA 3K7AJ 3LSGA 3SCFA 3CQZJ 1U9OA 1OJLA 5K7ZA 1LE8A 1X57A 3S1QJ 2XRLA 1HDDC 3HOYJ 3HM5A 3IH4A 2JMWA 3JRHA 1WETA 1H8AC 1VPWA 2O7OA 4FE7A 1JTYA 3NARA 3GBGA 3A01B 2NS7A 5IYBJ 4I6RA 3IVPA 1IDYA 4A93J 4D5CA 1OSLA 2G0EA 3G1OA 1B0NA 3C2BA 1ETYA 4A3DJ 2AW6A 1GUUA 3GTKJ 4JQDA 3M4OJ 3ZQFA 3IH2A 2WB1N 3Q3SA 1RETA 3S2DJ 2Y0SN 2WAQN 1JFTA 5A7LA 2LTPA 3JRDA 2FX0A 2OFYA 4DYQA 4O8BA 4MCXA 4A3KJ 2M9HA 3MLFA 1PUFA 2H1KA 2PIJA 1ITYA 3S16J 4QTRA 4I8TA 1I6HJ 2DTZA 3RQIA 2L7MP 3BT9A 3RKQA 3SCGA 1ETXA 1Y1WJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OB4 A;  4Z5C A;  4BKX A;  3FYM A;  1OCP A;  1CQT A;  4BXX J;  2HQ5 A;  4IWR A;  5FKM A;  1UHS A;  3F6W A;  1TWF J;  3ZQC A;  1ZR4 A;  1IGN A;  4Y7N J;  2R5Y A;  2PMZ N;  4Z58 A;  1ZK8 A;  1ETQ A;  1FTT A;  2AXZ A;  1Y7Y A;  3LSJ A;  3BTL A;  3FKI J;  3BTC A;  2Y9Z A;  1QRY A;  2N8G A;  1AHD P;  1B8I B;  1XWR A;  1W0U A;  1Y9Q A;  4MO7 A;  5FLV A;  1LMB 3;  3JRB A;  4L5E A;  2OPT A;  5J3L A;  4Z59 A;  2DMP A;  2E2H J;  3KJX A;  1I50 J;  5FLM J;  2O38 A;  4A3F J;  1JUM A;  3HKZ N;  4V2F A;  2IV1 A;  3JXB C;  1ZTR A;  2MGQ A;  1PUF B;  1TWA J;  4A3I J;  2R92 J;  2R93 J;  1QPZ A;  4QIW N;  1W0T A;  3FYA A;  3HZI B;  1JKO C;  4G12 A;  4A3L J;  2OF7 A;  1CJG A;  5F0C A;  1VND A;  5EEA A;  1ORK A;  3BD1 A;  2DN0 A;  3Q0U A;  2GLO A;  3JRI A;  2JN6 A;  4CYC B;  1X2N A;  2E19 A;  2KEI A;  2LFB A;  1FIA A;  4JX4 A;  4A3M J;  3CCY A;  3A01 A;  1QP0 A;  1R63 A;  3BG9 A;  1ZZ9 A;  1P7J A;  2IU7 A;  2CRO A;  5IP6 A;  1ETK A;  1NER A;  2GZU A;  4X4E A;  3JRG A;  3MKL A;  3GTP J;  2PE5 A;  4FCY A;  5EDN A;  5EGO A;  3B7H A;  3JR9 A;  4A3G J;  2K9Q A;  4BBR J;  2LYK A;  4AC0 A;  2DA3 A;  2NS8 A;  2W48 A;  3CDL A;  1FTZ A;  1IUF A;  5EZH A;  5K7F A;  2LD5 A;  2EBI A;  4A3B J;  2MQK A;  2EZI A;  3FMY A;  1RKW A;  5EZG A;  2DA5 A;  2DA4 A;  2L7Z A;  2VKV A;  3IH3 A;  2DA6 A;  4B1R A;  4XRS G;  3GBF A;  2AHQ A;  5K98 B;  4BBS J;  3QQA A;  1RZR D;  1L1M A;  3ZQG A;  1HDP A;  2QCO A;  5EGO B;  2XB5 A;  2A6C A;  3KXA A;  1QP7 A;  4M3E A;  4X4F A;  1LLI A;  1B72 A;  5F27 A;  3S1N J;  3QQ6 A;  1PRA A;  2PUD A;  1JKQ C;  3Q0V A;  3FIS A;  1HF0 A;  2DMN A;  1RPW A;  2R1J L;  2EZK A;  2CU7 A;  1MSF C;  2LVS A;  1U78 A;  4YG7 B;  2IEK A;  1WI3 A;  2JA8 J;  2JWT A;  3GN5 B;  4X4H A;  4CYC A;  3BTI A;  3A02 A;  4LOC A;  1ETW A;  3OMT A;  3BR5 A;  3D1N I;  2GM4 A;  3BS3 A;  1ZZ6 A;  3H0G J;  2TRT A;  4X4G A;  3BR0 A;  4UUS B;  3L1P A;  2M2E A;  3HBL A;  1WGX A;  1POU A;  2BNM A;  2XIU A;  1LQC A;  1ZZC A;  2ZB9 A;  2GRM A;  3BG3 A;  3W6V A;  1F36 A;  2M34 A;  1Z0X A;  1JJ8 C;  3GTQ J;  4BY7 J;  1TWC J;  2XCJ A;  4AYB N;  1YRN A;  3TRB A;  3CMY A;  5EG0 A;  4J1X A;  5F0F A;  1WH7 A;  4AUX A;  1PNR A;  1ZZ7 A;  2HIN A;  3RZD J;  2LYS A;  1EF4 A;  2HYJ A;  3MVP A;  4FE4 A;  4FBI A;  4PU3 C;  4MIM A;  4V2G A;  5E3L A;  4JYK A;  2ID6 A;  2L7F P;  1R9T J;  4X6A J;  5F04 A;  2KPJ A;  1AU7 A;  1JT0 A;  3OQO A;  2VI6 A;  1MBH A;  2IBD A;  1I3Q J;  3SDG A;  1E3O C;  1BDI A;  1QP4 A;  2BNN A;  2VPR A;  2B5A A;  1NTC A;  2LK2 A;  1FJL A;  1BW5 A;  2HI3 A;  3BR2 A;  1ENH A;  4A69 C;  4W1U A;  4A3E J;  1DW9 A;  1ZQ3 P;  3PO3 J;  1S7E A;  2NVT J;  1Q1V A;  1NK3 P;  1PRV A;  2K9S A;  3GTG J;  3SCH A;  4GHJ A;  1RIO A;  4RDU A;  1JKP C;  3HEF A;  3OSG A;  1P7I A;  2DMQ A;  2IUO A;  3GTO J;  4FTH A;  3GN5 A;  1WH5 A;  2KT0 A;  4I6T A;  1BJZ A;  2M0C A;  1UG2 A;  3OOU A;  4M3B A;  3S1R J;  1UTX A;  2EZL A;  4QSH A;  2RAE A;  4M3D A;  2LR8 A;  3PO2 J;  1HLV A;  2HOT A;  2HOA A;  3ZOB A;  2NVQ J;  1B72 B;  1UXD A;  3B6C A;  1NEQ A;  3BDN A;  2FQ4 A;  4DZP A;  2DA2 A;  2JJ7 A;  1U8B A;  2R5Z B;  1IDZ A;  2LP0 A;  1UXC A;  3TW7 A;  3UFD A;  1ETV A;  2ELK A;  5F0H A;  3QPL A;  1MSE C;  3VK0 A;  4XIC A;  2WV1 A;  4GQM A;  3BR3 A;  3O9X A;  3TW6 A;  5IYC J;  5E3M A;  3GTL J;  1MBE A;  3CLC A;  3FIW A;  2XGC A;  2PUE A;  1K83 J;  2DJN A;  2FD5 A;  1A6I A;  2ME0 A;  4M3G A;  3UKG A;  5DS9 A;  3PXP A;  4DYC A;  1MBF A;  2JK3 A;  4B3A A;  5JLW A;  3HOV J;  2PUB A;  3JRE A;  1MBG A;  2MSY A;  3HDD A;  2KEJ A;  2ID3 A;  4JP0 A;  5IOZ A;  3TP3 A;  1O4X A;  5JLX A;  2LYP A;  2MW8 A;  2EH3 A;  2H8R A;  1RZS A;  1GVD A;  2HOS A;  3OIO A;  4XID A;  1APL C;  3BQZ A;  3S17 J;  1RPE L;  4YBA A;  2CSF A;  3JRA A;  4Z5H A;  3S8Q A;  1T33 A;  3S1M J;  4UUT A;  3ZHM A;  2XPU A;  2L8N A;  4JCY A;  2NVX J;  1GV2 A;  1Z77 A;  4YG1 A;  5EF6 A;  4XRM A;  2NOG A;  2O8K A;  3RZZ A;  2COB A;  1JJ6 C;  3G1L A;  4MFD A;  4I76 A;  2KEK A;  1U9N A;  2BNO A;  1LFU P;  4X4C A;  3OQM A;  5GP9 A;  1QVT A;  3ZQL A;  1JFS A;  3TED A;  2R63 A;  5IP7 J;  4RBO A;  1ZZ8 A;  4B4C A;  1RKT A;  2Y9Y A;  4FIS A;  2YUS A;  4I6U A;  1ZKG A;  1TWH J;  2LYL A;  3LOC A;  1ZGW A;  2Y30 A;  1DWK A;  1X58 A;  1MH3 A;  1FIP A;  2M8G X;  3FK6 A;  2IAI A;  2XJ3 A;  3PM1 A;  1A5J A;  2R7Z J;  4NDW A;  1JWL A;  1LCD A;  5GPA A;  4GFB A;  3WHB A;  2I10 A;  1FEX A;  3GTJ J;  4IA8 A;  4A3C J;  2CQX A;  4C2M J;  1IC8 A;  1YRN B;  3FK7 A;  3EUS A;  2TCT A;  2PUG A;  5C44 J;  3HOW J;  1VF9 A;  2OR1 L;  2EZH A;  3OP9 A;  5M5Y J;  2JVL A;  4D7M A;  1OCT C;  1JKR C;  5J1R A;  2EBY A;  2FJR A;  2O4A A;  3I4N J;  5IYD J;  5FKN A;  1IG7 A;  2LYR A;  4X4D A;  2B63 J;  4X1E A;  1ZPQ A;  4IHW A;  2LKX A;  2JA7 J;  3S2H J;  1DU6 A;  5E3O A;  1GDT A;  1BL0 A;  5C4J J;  2XSD C;  1BA5 A;  1ETO A;  2QF7 A;  1TC3 C;  2CQQ A;  3ZQI A;  5M5W J;  3R1F A;  2E1O A;  3TP0 A;  5F1J A;  2HDD A;  2XI8 A;  1WH8 A;  2LYJ A;  3SFI A;  2BJC A;  4YAR A;  1ADR A;  2DA1 A;  2L9R A;  2CJJ A;  4DYR A;  4C3J J;  1Y1V J;  4EEF G;  2PPX A;  5FKO A;  1MNM C;  3BQY A;  2WUS R;  2E2J J;  2GBY A;  4IHV A;  4C3H J;  4A3J J;  4MFE A;  1YSE A;  3O8G A;  1X2M A;  2JA6 J;  1G2H A;  4JX6 A;  5FKK A;  4IHY A;  2VUM J;  4ABZ A;  2AWI A;  2PUC A;  4Y42 A;  5FKL A;  1IJW C;  4BY1 J;  1ZVV A;  1JT6 A;  2X48 A;  3HB9 A;  3NAU A;  1DU0 A;  1F43 A;  4FN3 A;  3OSF A;  2MEZ A;  3H3V K;  2DA7 A;  2EWT A;  3BG5 A;  1NK2 P;  5C4X J;  1WH6 A;  3JXC L;  1R69 A;  4M3F A;  1HCR A;  1RES A;  2LLK A;  3DNV B;  4S0H B;  3K2A A;  1JH9 A;  2AXU A;  4IEJ A;  3VPR A;  2AXV A;  2GRL A;  1VI0 A;  2DMT A;  1LFB A;  5EYR A;  2NVY J;  1H89 C;  1IRZ A;  4X4I A;  3HGG A;  2LY9 A;  2E2I J;  2ECC A;  2ICT A;  1ZAY A;  3ZHI A;  2CUE A;  2VKE A;  1H88 C;  3M3Y J;  3S15 J;  1MBJ A;  3E7L A;  1QQB A;  4J1W A;  1VFC A;  2D5V A;  2O9L A;  2XPW A;  4W97 A;  2XGD A;  5M3M J;  1GV5 A;  1XC5 A;  5IPA A;  3SJM A;  2EF8 A;  1WCM J;  2ECB A;  3G7D A;  4JCX A;  1JUS A;  2AUW A;  3ZQH A;  4IVZ A;  3H5T A;  1SQ8 A;  3CRO L;  3BR6 A;  2XGE A;  2LCV A;  4PU8 A;  1GT0 C;  2JA5 J;  3CEC A;  2MG4 A;  4DZJ A;  1MH4 A;  4F8D A;  1OFC X;  1SAN A;  4XK4 A;  1AKH A;  2K9N A;  5E3N A;  2P81 A;  2Y31 A;  1D5Y A;  5M3F J;  4Z5D A;  1IV6 A;  2IVQ A;  1BW6 A;  1B8I A;  1WPK A;  2XB0 X;  4D5F A;  1PRU A;  1RR7 A;  3HOU J;  3F51 A;  1JUP A;  3HOX J;  2JCG A;  2L0K A;  2Y2Z A;  3F52 A;  2R5Y B;  3B6A A;  3F0C A;  1RZR A;  1BDH A;  1EFA A;  2R0Q C;  2PUF A;  1QVU A;  2K40 A;  3KZ3 A;  1ZZB A;  2IVG A;  3QF3 A;  3JXD L;  4I6Z A;  5EG0 B;  2CUF A;  1LCC A;  4MLO A;  2HXO A;  2KDZ A;  4YG4 A;  3QPS A;  1SFO J;  2X9D A;  1AKH B;  3LIS A;  3MN2 A;  5K7H A;  1JGG A;  5F08 A;  5IOY A;  5C3E J;  1ZR2 A;  9ANT A;  5BNG A;  3G5G A;  1ZUG A;  2WIU B;  1HOM A;  2EQR A;  2LYQ A;  1QPI A;  3G1M A;  3JRC A;  2X6O A;  4UUS A;  3LSR A;  2PUA A;  4J19 A;  2HXI A;  3DEW A;  4C3I J;  2YU9 J;  5IP9 J;  3GTM J;  3U3W A;  2DMU A;  1XG1 A;  4X4B A;  4D7N A;  3QWG A;  1TWG J;  4MCT A;  3Q0W A;  3ZKC A;  5J1Y A;  2YS9 A;  5FJ8 J;  3LNQ A;  2IVB A;  4XRS A;  4M6V A;  3RZO J;  3LSP A;  5DTD A;  3JRF A;  5GPC A;  3BR1 A;  3S14 J;  4PU7 A;  1UMQ A;  2O49 A;  4DW6 A;  3BTJ A;  1T56 A;  1QQA A;  3IV5 A;  1JTX A;  2FJ1 A;  2XPV A;  2L49 A;  1LE8 B;  2AO9 A;  3WHC A;  2KZ8 A;  1PER L;  1XS9 A;  4Y52 J;  3O8H A;  5HOD A;  4PU4 C;  4JX5 A;  1WIZ A;  2CRG A;  3HGY A;  3A03 A;  1ZS4 A;  2ICP A;  3DCF A;  2ME6 A;  4IHX A;  5M5X J;  3I4M J;  2HSG A;  1MBK A;  1X2L A;  3LFP A;  4HNV A;  5J1U A;  1POG A;  3OQN A;  3QYX A;  1K61 A;  2R5Z A;  3HOZ J;  4NDL A;  3K7A J;  3LSG A;  3SCF A;  3CQZ J;  1U9O A;  1OJL A;  5K7Z A;  1LE8 A;  1X57 A;  3S1Q J;  2XRL A;  1HDD C;  3HOY J;  3HM5 A;  3IH4 A;  2JMW A;  3JRH A;  1WET A;  1H8A C;  1VPW A;  2O7O A;  4FE7 A;  1JTY A;  3NAR A;  3GBG A;  3A01 B;  2NS7 A;  5IYB J;  4I6R A;  3IVP A;  1IDY A;  4A93 J;  4D5C A;  1OSL A;  2G0E A;  3G1O A;  1B0N A;  3C2B A;  1ETY A;  4A3D J;  2AW6 A;  1GUU A;  3GTK J;  4JQD A;  3M4O J;  3ZQF A;  3IH2 A;  2WB1 N;  3Q3S A;  1RET A;  3S2D J;  2Y0S N;  2WAQ N;  1JFT A;  5A7L A;  2LTP A;  3JRD A;  2FX0 A;  2OFY A;  4DYQ A;  4O8B A;  4MCX A;  4A3K J;  2M9H A;  3MLF A;  1PUF A;  2H1K A;  2PIJ A;  1ITY A;  3S16 J;  4QTR A;  4I8T A;  1I6H J;  2DTZ A;  3RQI A;  2L7M P;  3BT9 A;  3RKQ A;  3SCG A;  1ETX A;  1Y1W J; 
#chains in the Genus database with same CATH topology
 1TW2 A;  5HLG A;  3TEL A;  4LIV A;  1XCB A;  3FYM A;  4G6D A;  1OCP A;  2BY0 A;  4IWR A;  2GIZ A;  3ERM A;  2STT A;  1TWF J;  1ZR4 A;  2R5Y A;  4CHU A;  4ZDO A;  1ZK8 A;  3TKY A;  2XAF A;  3OYJ A;  3CCE I;  3SR4 A;  3BTC A;  1QRY A;  2VT3 A;  2PXP A;  4BS9 A;  3DV8 A;  3OOP A;  1MIJ A;  2P6S A;  2OPT A;  3HXL A;  2DMP A;  1R1T A;  3E6C C;  2E2H J;  2NNY A;  2O3F A;  2VBY A;  3PJR A;  4A3F J;  3IL2 A;  2UXN A;  2DOF A;  2O6G E;  3E6M A;  4YEL A;  2R92 J;  1TWA J;  4XOR A;  3ABK H;  5TRD A;  1YOV B;  1JKO C;  2QQ8 A;  2OF7 A;  5DV5 A;  2WC2 A;  5EEA A;  2FBI A;  1AWC A;  3BD1 A;  2L4A A;  4HZF A;  2OAZ A;  2DN0 A;  3Q0U A;  5BS6 A;  1X2N A;  3HZJ A;  4GO1 A;  1FIA A;  3RPQ A;  3SZG A;  2O8X A;  2M4K A;  3BG9 A;  3D5L A;  5L3G A;  1P7J A;  1G8X A;  1ZZ9 A;  4ZTF A;  2VON A;  5DTM A;  3G6E I;  4HF0 A;  2CRO A;  1BBY A;  1ETK A;  4RB3 C;  4X4E A;  1W7P A;  3GTP J;  2PE5 A;  5LFA A;  2JQE A;  5E18 F;  1LVA A;  2RNJ A;  3PFI A;  4PFO A;  1KGS A;  3JR9 A;  2JZY A;  3JSO A;  4AC0 A;  2TDX A;  3OR1 C;  1LDJ A;  3BP8 A;  4BXF A;  2AS5 F;  3GZ6 A;  1FTZ A;  3IRR A;  3EUA A;  2LD5 A;  3DEU A;  2MQK A;  2FE3 A;  4GQM A;  2DA4 A;  1KON A;  3E6D A;  4B1R A;  5D5W B;  3PQK A;  3SDB A;  4XRS G;  3ZPX A;  2AHQ A;  1O7L A;  4KJZ A;  3OYB A;  3K4L A;  4BBS J;  1RZR D;  2DI3 A;  2OJE D;  5EGO B;  1G6N A;  1DP3 A;  4Y15 A;  1NH3 A;  2DJI A;  5L3D A;  1R4N B;  2XIG A;  4DE9 A;  2IT0 A;  3SHF A;  4CA0 A;  2CMP A;  3QQ6 A;  2RDP A;  4H4K C;  2MXD A;  2XXA A;  2DLL A;  1LQ1 A;  3WGI A;  2PXD A;  3F8C A;  1U78 A;  3FM3 A;  5ILV A;  3LQX A;  1BN5 A;  2KMU A;  4XOP A;  3KYC B;  4KFC A;  3EUH A;  3GZN B;  1HKS A;  3BR5 A;  2GM4 A;  3BS3 A;  3DTK A;  5DUI A;  3M1E A;  1PP8 F;  1DGR M;  1SMT A;  2HDW A;  2ZNY A;  1D3Y A;  3WTV C;  2BNM A;  3DU5 A;  3HSF A;  3ZMT A;  2XHK A;  2M8E A;  2BVM A;  2Z9O A;  1ZZC A;  2W00 A;  5E79 C;  4I2O A;  3FXL A;  1K7A A;  4A6D A;  2R7D A;  2XF7 A;  3P9K A;  1JJ8 C;  3R60 A;  2IXS A;  5H6Q A;  3L2R A;  1MW7 A;  2K4B A;  2XAS A;  3TRB A;  1IXR C;  1SAU A;  4J1X A;  2EJR A;  4HST A;  3CF5 F;  2QVO A;  1W5S A;  4F3Q A;  3RZD J;  2LYS A;  3LQQ A;  1EF4 A;  3CCQ I;  5E17 F;  3CMM A;  2BEO A;  2RC4 A;  2KIF A;  3DBL B;  3SEZ A;  2DOD A;  5HLI A;  5E3L A;  2FOK A;  4JYK A;  4EVI A;  1R9T J;  1IN7 A;  1SD4 A;  5F04 A;  3GFJ A;  2VLA A;  2XVC A;  2M7A A;  4LD5 A;  2PJR B;  4KMF A;  3SDG A;  1QP4 A;  3ZQ7 A;  3ZP5 A;  2B5A A;  1NTC A;  3FXJ A;  2VOO A;  2EV0 A;  4IX7 A;  1U6G A;  3H9J A;  1ENH A;  4M71 A;  4A3E J;  4YIF A;  2W82 A;  3QU3 A;  4FT8 A;  1NW3 A;  2BBY A;  3J7Y J;  4RDU A;  2E7W A;  3I4P A;  4KIF A;  2QGU A;  2VB6 A;  4AID A;  3OSG A;  2DMQ A;  1BIA A;  1ZG3 A;  4FX0 A;  2V3C C;  2LNB A;  3FXQ A;  1WH5 A;  3GN5 A;  2KT0 A;  1UZC A;  1M1E B;  1YW7 A;  3WU0 A;  2NXN B;  2HQA A;  3W6J B;  1FBU A;  1T0F A;  3GW2 A;  4YEJ A;  1R1V A;  1CF7 A;  1J59 A;  1FYK A;  2EZL A;  2PXU A;  4IXA A;  3SCG A;  2LR8 A;  3PO2 J;  1X3Z B;  2HOT A;  1WJE A;  2DDB A;  2OZ6 A;  1DDN A;  2NVQ J;  1NG6 A;  3OYI A;  3HPH A;  1NEQ A;  4DZP A;  3MZY A;  2VJ5 A;  3DTI A;  2JJ7 A;  2I5U A;  2KZG A;  2EV5 A;  1UXC A;  3CME I;  4ZYG A;  4BHP A;  4XL9 A;  1HW1 A;  3KFW X;  3VK0 A;  1C0W A;  1P4X A;  3BR3 A;  3JSP A;  5IYC J;  3O9X A;  3GTL J;  4LLG F;  2E36 A;  3FIW A;  2DJN A;  3J80 Z;  1A6I A;  2Y0S A;  1U5T A;  1YW8 A;  3UKG A;  4DYC A;  1MBF A;  1TL8 A;  1VQL I;  1IW7 F;  2MSY A;  2DFE A;  2ID3 A;  3GXO A;  3L2C A;  3CCR I;  1SEU A;  1SFE A;  1QA6 A;  5IOZ A;  2VQC A;  3U2R A;  2VOP A;  2DYR H;  1IN6 A;  5JLX A;  1T38 A;  1O4X A;  2LYP A;  3TO9 A;  4ZYH A;  2VEO A;  2H8R A;  2BE5 F;  4CCM A;  3K2Z A;  3HYI A;  3IKT A;  3I56 I;  1TQI A;  3CUO A;  3BQZ A;  2WBM A;  1IN8 A;  3W3C A;  3QYE A;  4YBA A;  4KNY A;  2F6C A;  1MJ9 A;  1V5F A;  1LVK A;  2DQR A;  3ZHM A;  2IS4 A;  4YFX F;  2L8N A;  4JCY A;  1J0R A;  2NVX J;  5HDG A;  1RI7 A;  4YG1 A;  1JJ6 C;  4HRI A;  4MFD A;  3F3X A;  2HR3 A;  5HS9 A;  3HRS A;  3K10 A;  2PXL A;  2VBW A;  2KEK A;  3LWF A;  3WG7 H;  3VWB A;  3N05 A;  1QVT A;  3L2V A;  3ZQL A;  3F8F A;  3PNY A;  1JFS A;  3FMQ A;  2MH9 A;  1LPQ A;  2PJR A;  2BZT A;  2DFF A;  4RBO A;  4JBA A;  2ZBK A;  4ZDL A;  5IT3 A;  2LLW A;  4CUG A;  4I6U A;  3GCM A;  1U0J A;  2JRT A;  5DM6 F;  1VQ4 I;  1B1B A;  2LYL A;  2Y30 A;  3RPU A;  3FK6 A;  1FP1 D;  4AVZ A;  3PM1 A;  5LLQ A;  4NDW A;  1FP2 A;  3VYU B;  3NQO A;  4HDV A;  5B66 C;  5GAG J;  2LOO A;  4GFB A;  3WHB A;  4HV6 A;  4IRH A;  4BAC A;  3LSH A;  1IC8 A;  2ZXW H;  1TTY A;  1Y0N A;  3HOW J;  2OR1 L;  2EZH A;  5M5Y J;  1UAA A;  2JVL A;  1OCT C;  2XAG A;  4PGG A;  2FJR A;  1WVR A;  2O4A A;  2A68 F;  1X1A A;  5FKN A;  2LG4 A;  2JPB A;  4X1E A;  4IHW A;  2WAD A;  2LKX A;  1UG0 A;  2JA7 J;  1DU6 A;  5E3O A;  2ZXJ A;  1BL0 A;  4BXU A;  3KL4 A;  1DUX C;  1D8K A;  4FQG A;  1VQ9 I;  5EJC A;  2IRF G;  5IY5 H;  3HRM A;  2XI8 A;  2E34 A;  2PJP A;  3HHH A;  4XKV A;  3RYP A;  4BEH A;  2AXL A;  1ZRC A;  3H3U A;  4DYR A;  4EEF G;  4L5J A;  1MNM C;  3BQY A;  2OZU A;  2IS6 A;  2E2J J;  4DBR A;  5ILU A;  1T95 A;  4C3H J;  4XLH A;  4MFE A;  1X2M A;  5CVU A;  2JA6 J;  2VUM J;  3OIQ A;  2MH2 A;  1OPC A;  4EM1 A;  4R1H A;  5FKL A;  3OKZ A;  2LH9 A;  2FNP A;  2RGV A;  2KLO A;  1JT6 A;  4BQN A;  3H3V K;  1K6Y A;  3VEP A;  2DCE A;  4KIG A;  1HCR A;  3H9Q A;  2V6C A;  1XD7 A;  1KA8 A;  2ETH A;  4RAF A;  3K2A A;  3OYF A;  3ISP A;  4Q5S F;  2AXU A;  5FO5 A;  4ZYA A;  3WGG A;  2GRL A;  2MD5 A;  5EYR A;  4CCL A;  1ONV A;  1ZAO A;  2A05 A;  3K4B A;  3M1C A;  2QSF X;  4RAY A;  5ICE A;  2K7L A;  2E2I J;  2VQH A;  2ICT A;  1ZAY A;  4CCK A;  4PDK A;  2CUE A;  2A61 A;  2P5K A;  2LBF A;  1D1C A;  3S15 J;  2PXF A;  5F1R A;  5DD8 A;  1D0Z A;  1VFC A;  1N77 A;  1UST A;  1U8R A;  2XGD A;  4JOM A;  1OQY A;  1XC5 A;  3G2B A;  1WCM J;  1R58 A;  3QYB A;  2E71 A;  4IVZ A;  3CRO L;  4DBQ A;  4FET A;  2MG4 A;  4CCJ A;  3V7R A;  4DZJ A;  1OFC X;  1SAN A;  1QZZ A;  3C18 A;  4P1W A;  3RQ4 A;  5H2F C;  4M6Y A;  4XLC A;  2P81 A;  5M3F J;  1IV6 A;  2IVQ A;  1R1U A;  4L18 B;  2JVH A;  4BAY A;  1B8I A;  3NRO A;  4D5F A;  4AIH A;  1PRU A;  2BW3 A;  3ASN H;  3DWL E;  3HOX J;  2L0K A;  2Y2Z A;  2VKD A;  2R5Y B;  4ER5 A;  1DPR A;  4AU7 A;  1QVU A;  2K40 A;  3KZ3 A;  2R4G A;  2PUF A;  2IVG A;  3K4N A;  3BLY A;  3CC7 I;  3OYL A;  4I6Z A;  3L00 A;  1QBJ A;  5DYM A;  5EG0 B;  2HS5 A;  3DEE A;  2OA4 A;  3N97 A;  4MLO A;  4YG4 A;  1KZH A;  1JHF A;  3UWP A;  1AKH B;  2X9D A;  2ZME C;  5KVR A;  3LIS A;  2VAS A;  2DT7 B;  3RTR A;  1FMW A;  2P7V B;  5K7H A;  2VL8 A;  5F08 A;  5IOY A;  2HQR A;  9ANT A;  4KDP A;  4HLX A;  4U0V A;  1ZUG A;  4XKC A;  2K02 A;  2QLZ A;  4HF1 A;  2NOJ B;  4M74 A;  4N9I A;  1FBS A;  2KJC A;  2W25 A;  3LSR A;  4XOT A;  5D4R A;  1UCR A;  3DEW A;  4A0Y A;  4C3I J;  2K3F A;  3GTM J;  2VBX A;  5D8L B;  2CH0 A;  4RLQ A;  1MMD A;  1QO0 D;  3Q0W A;  3JTG A;  3AL0 C;  3LNQ A;  4XLP F;  1I5Z A;  3GEZ A;  3JTH A;  4LK0 F;  3LSP A;  5DTD A;  4O3M A;  2R7O A;  2EPF A;  4XLF A;  1FMV A;  4RGS A;  4UV9 A;  5KCM A;  2O49 A;  2FJ1 A;  3UR3 C;  1MJB A;  3WHC A;  4BHC A;  4ESJ A;  2KZ8 A;  2M45 A;  2EFN A;  1PER L;  2XXP A;  1XS9 A;  4Y52 J;  3O8H A;  2JVG A;  1TNT A;  2PX9 A;  4JX5 A;  5H20 A;  5J4V A;  3J80 K;  5FB2 A;  3VOD A;  1A04 A;  1DP7 P;  3H3Z A;  5JVT A;  4IHX A;  3BC8 A;  2HSG A;  3TBI A;  1VQP I;  3F6V A;  4CXF A;  5K5O A;  1F1Z A;  5J1U A;  4HNV A;  3QYX A;  3OYD A;  2K3P A;  2QWW A;  1K61 A;  3GYH X;  3HOZ J;  1XTA A;  3CQZ J;  1LE8 A;  2FOW A;  3HOY J;  1HKQ A;  3UNG C;  4UV8 A;  2F4O B;  2K86 A;  3JRH A;  3EYI A;  1MDM B;  3TEP A;  3H36 A;  3I58 A;  3KX2 A;  3SZT A;  4KYW A;  1PUE E;  3I3L A;  3NWT A;  1JTY A;  3NAR A;  1K78 B;  2CUZ A;  3LFU A;  4F92 B;  2YBD A;  3MD2 A;  2NS7 A;  2V1N A;  5IYB J;  4FX4 A;  2LLV A;  2ZSH B;  1WJA A;  4M73 A;  4A93 J;  2NAZ A;  5KHD A;  2G0E A;  2CW7 A;  2FF4 A;  3QOD A;  2AW6 A;  3EET A;  3BCB A;  2QQ9 A;  2Y0S N;  5A7L A;  1RUO A;  3BG7 A;  3OYH A;  4MCX A;  2M9H A;  5CYV A;  2HZT A;  4IL6 C;  4AIJ A;  3VSK A;  1RR8 C;  2B9S A;  1G3S A;  1YIJ I;  1DPU A;  3KP4 A;  2PUC A;  1ZS4 A;  3BWG A;  1Y1W J;  4ER7 A;  6PAX A;  3RYR A;  4UHT A;  4BKX A;  1GVJ A;  2E5N A;  5FKM A;  1UJ8 A;  3F6W A;  1LDD A;  5LGU A;  2V9P A;  2PMZ N;  4QWQ A;  1QZX A;  1ZN2 A;  2F4I A;  2AXZ A;  3DXJ F;  1F9N A;  3LSJ A;  4WXD A;  1E2X A;  3BTL A;  2VE8 A;  2R7F A;  2Y9Z A;  1S8N A;  2K5C A;  3FXR A;  1W0U A;  3JRB A;  4Z59 A;  4EQZ A;  1I50 J;  5FLM J;  3ZMU A;  4BU2 A;  3KP7 A;  5CKT A;  1JUM A;  4V2F A;  1HA8 A;  1ZTR A;  4A3I J;  2ISY A;  1OYW A;  2R93 J;  1W0T A;  2A69 F;  4XKB A;  1WRJ A;  2EWN A;  3IKV A;  1HQC A;  4HSR A;  4WF2 A;  4XKW A;  2PXT A;  5DSX A;  4G7Z F;  1FSE A;  1ORK A;  1R49 A;  2GLO A;  3PSF A;  3JRI A;  3PUB A;  1V4R A;  2KIU A;  2E19 A;  3V8J A;  3KP3 A;  2LFB A;  1VQO I;  3GZD A;  3NWS A;  4JX4 A;  4A3M J;  4E7K A;  4OOI A;  2BYV E;  3CJT B;  1HKT A;  1K78 A;  4PZJ A;  3DFG A;  2W84 A;  2ELH A;  3ERE D;  3NEU A;  2ZXI A;  1ZYR F;  3KEY A;  1FBQ A;  2UXX A;  3JRG A;  3MKL A;  5CVJ A;  5DRT A;  2EFW A;  3AG4 H;  1PJR A;  1W4M A;  2LRE A;  3B7H A;  2CW0 F;  4A3G J;  1WQ2 A;  2V6E A;  5TIS C;  4ZJZ A;  2LYK A;  1MKM A;  2DA3 A;  3M8F A;  4WVL A;  2W48 A;  2KKO A;  1IUF A;  5EZH A;  5K7F A;  1W1W E;  2EBI A;  2EIK H;  2KZV A;  4G9Y A;  1EKE A;  5FRO A;  4ZYD A;  2EZI A;  3CCJ I;  1RKW A;  1A31 A;  3IH3 A;  2K9M A;  5LRR A;  3HOT A;  2RV8 A;  3ELK A;  4EQQ A;  4ESB A;  1L1M A;  2L54 A;  1BOB A;  2XB5 A;  4L0Z B;  2A6C A;  3KXA A;  1MND A;  3KLN A;  4L0Y B;  4LLL A;  3KZY A;  4X4F A;  5F27 A;  1XB4 A;  4MQ9 F;  2HVS A;  3S1N J;  1MGT A;  1X4P A;  3FIS A;  4HEA 2;  1HC8 A;  3AAF A;  1WHU A;  1HF0 A;  2XXQ A;  2EZK A;  5FLX Z;  3CLQ A;  4NBQ A;  1OR7 C;  1T2K A;  3ZXS A;  3Q5F A;  4HV5 A;  2JWT A;  3KP2 A;  3QRF F;  3CLO A;  4HW0 A;  4NQW B;  3K4J A;  3BTI A;  4LOC A;  3I64 A;  1KQ8 A;  1ETW A;  2P5V A;  3E5U A;  2DK5 A;  1ERD A;  3H0G J;  4UUS B;  3L1P A;  3HBL A;  1UEL B;  4HNU A;  4LFU A;  1POU A;  1LQC A;  2KIQ A;  2ZB9 A;  3BG3 A;  2ZSI B;  1ZHF A;  3P5J A;  2M34 A;  3OYC A;  1Z0X A;  2L7K A;  4I01 A;  4F91 B;  3LFK A;  4CCO A;  1WJC A;  2EFQ A;  4P55 A;  1K6O A;  2X1C A;  2HU9 A;  4IOC F;  1B9N A;  2Y48 A;  4EJT A;  4AUX A;  3FDY A;  3H1C A;  1ZZ7 A;  2Q8K A;  2PG4 A;  3MVP A;  4FBI A;  3DLA A;  3GZ5 A;  2A6E F;  2DOA A;  4B43 A;  2ID6 A;  2L7F P;  2HVR A;  2BXZ A;  1RNL A;  3TOA A;  1Y39 A;  4C30 A;  1RZ4 A;  4U7B A;  5BMZ A;  4BE1 A;  2KPJ A;  3CES A;  1AU7 A;  3OYA A;  5FRN A;  4RA2 A;  1FNN A;  3OQO A;  2IBD A;  3NDB B;  1ODD A;  2RQQ A;  2CFO A;  1R6R A;  4MEX F;  4L9T A;  2BNN A;  2JQ7 A;  2V1D A;  2EFP A;  4B44 A;  4PCQ A;  4LGW A;  1Y0U A;  4A69 C;  4PJJ A;  1XGO A;  1DW9 A;  3PO3 J;  4B3X A;  1J75 A;  1PRV A;  2L9V A;  4BDZ A;  3GTG J;  3CCU I;  2A6H F;  3ASO H;  3SCH A;  4E7I A;  1JKP C;  2WTE A;  2HKX A;  1HBX G;  2OD5 A;  4FTH A;  3ECH A;  4EKI A;  1BJZ A;  1JHH A;  4YIR X;  4M3B A;  1FOW A;  1Y6I A;  3CDH A;  5CQG A;  1MD0 A;  4AYB A;  1RUN A;  1UTX A;  3VYT B;  2M0M A;  2QUF A;  4HX8 A;  2RAE A;  4UUV A;  1G59 A;  3I59 A;  3M7G A;  1B72 B;  3FF5 A;  3B6C A;  1H9T A;  3LA2 A;  3SXY A;  1F5T A;  4CO8 A;  1H9G A;  4M72 A;  2R5Z B;  1IDZ A;  2LP0 A;  3UFD A;  1S72 I;  3H5A A;  1ETV A;  2VC0 A;  2CO5 A;  5F0H A;  4Y4R A;  2XC7 A;  4RS8 A;  2X1D A;  4IF4 A;  2VJI A;  5E3M A;  4GYI A;  2L4M A;  2XGC A;  4M9X A;  1BJA A;  3O3K A;  4UY8 I;  4M3G A;  4XNF A;  5HS8 A;  1N78 A;  3ME5 A;  3LQR A;  5B3S H;  1IAW A;  3AG2 H;  1Y56 A;  3T5X A;  2YX7 A;  3G3Z A;  2QBY A;  3I59 B;  2DQL A;  2HTS A;  5FD5 A;  2EH3 A;  2WAQ A;  4RMN A;  4BE2 A;  3V7S A;  1EJ9 A;  3M9L A;  3F72 A;  3JRA A;  1WJF A;  4Z5H A;  1XSV A;  2WY7 Q;  4E7J A;  2IS1 A;  1T33 A;  1H0M A;  2PQ8 A;  3W2V A;  1KU2 A;  3NZL A;  5E1X A;  1ACI A;  2HTJ A;  1GV2 A;  2EA4 A;  4E7S A;  2RQP A;  2F5F A;  4P5O A;  1RIO H;  5EF6 A;  4XRM A;  2EV6 A;  3QWL A;  2COM A;  2O8K A;  3G1L A;  5BPD A;  2VKH A;  3M07 A;  4V19 K;  5EEG A;  2E60 A;  3FXU A;  3CUQ A;  1IXS B;  1X4O A;  3VSL A;  4X4C A;  3U9G A;  4G6T B;  4MEY F;  1WSU A;  3S8P A;  3D5R C;  3TED A;  5IP7 J;  4UNO A;  2YPR A;  1FZP B;  5D4S A;  2M4H A;  2HPI A;  2XF5 A;  2KL4 A;  2ICW G;  4N0B A;  5L3F A;  1DWK A;  1MH3 A;  3SYT A;  2XJ3 A;  4H0E A;  2R7Z J;  1QU3 A;  1U5T C;  5GPA A;  1SD6 A;  3SQN A;  3TFL A;  5LRS A;  1STZ A;  1XGM A;  5EEH A;  3FK7 A;  5D5V B;  1Y8Q B;  2WWY A;  5IT9 Z;  2KPM A;  2TCT A;  2PUG A;  3CMA I;  1D0X A;  3OP9 A;  4B47 A;  3ZRG A;  1JKR C;  4ZDP A;  5J1R A;  1VQN I;  2EBY A;  3I4N J;  5IYD J;  2LYR A;  4X4D A;  2PXV A;  2QM3 A;  1ZPQ A;  2D1V A;  1IUY A;  2XF6 A;  2XDV A;  4NQW A;  2KRC A;  5C4J J;  1YE9 A;  3T8T A;  2XSD C;  5ICF A;  2QF7 A;  2M1B A;  2ZCW A;  5M5W J;  2X1E A;  5F1J A;  2HDD A;  1WH8 A;  1PYV A;  3SFI A;  4MNU A;  1YS6 A;  2BJC A;  2DA1 A;  1S5L C;  2H27 A;  1BC7 C;  1Y1V J;  5DCM B;  3WTS C;  2GBY A;  3IP4 B;  1FYL A;  4IHV A;  2PXB A;  1R23 A;  4OIO F;  3O8G A;  5HS7 A;  2UZK A;  2UWM A;  3KZZ A;  2LYC A;  4ABZ A;  5DEQ A;  3E97 A;  1RRJ A;  4OBM A;  1QNT A;  3S3N A;  2ZJR F;  2KFD A;  3HUG B;  1IJW C;  4I02 A;  4E70 A;  2X48 A;  3HB9 A;  3NAU A;  4EGZ A;  2DA7 A;  3BG5 A;  1NK2 P;  5C4X J;  1WH6 A;  3JXC L;  3RI4 A;  3BG6 A;  2IA2 A;  3VDX A;  2BV6 A;  2QA4 I;  1RES A;  3AG1 H;  5AIQ A;  4KA4 A;  2ZNZ A;  4KUM A;  4KIS A;  4LIT A;  1REP C;  4XN3 A;  4HAM A;  3B02 A;  1CF7 B;  1OIS A;  2DMT A;  1IRZ A;  4X4I A;  4UXN A;  4I98 B;  1HW2 A;  2BOL A;  2VKE A;  3QYF A;  4HRA A;  4CDG A;  3CC4 I;  3E7L A;  5B1A H;  2O9L A;  5M3M J;  3G7D A;  3SX0 A;  1EV7 A;  1D1B A;  2KJB A;  3MWM A;  2AUW A;  3H5T A;  4BH9 A;  1GT0 C;  2CGP A;  2JA5 J;  2AQF A;  1R4M B;  1O3S A;  4F8D A;  1AKH A;  2G7U A;  2CSO A;  3OR2 C;  1G3Y A;  2F4M B;  2FNA A;  3GLX A;  2I8D A;  1KYW A;  3KEO A;  2CV1 A;  1J09 A;  1I27 A;  3F0C A;  1NG7 A;  1O57 A;  2ZO4 A;  3KP5 A;  2XRN A;  1EFA A;  1ZZB A;  1GXQ A;  2L5Q A;  2W57 A;  5DTQ A;  2LY1 A;  1QHH D;  2CUF A;  1QGP A;  2KIS A;  3CJQ B;  3IUO A;  5LHG A;  2O61 A;  4ER0 A;  1OYI A;  5F64 A;  2CUJ A;  2E7X A;  1JGG A;  3ZN1 A;  1ZR2 A;  5C3E J;  3R6S A;  2P6T A;  3TO6 A;  3WE3 A;  2WIU B;  3A9X A;  3G71 I;  1V5G A;  4AD9 A;  1FLI A;  1ZH5 A;  4KN4 X;  3W2W A;  2H6C A;  4KT5 C;  1ZLK A;  2YU9 J;  3MFK A;  2FMY A;  1XG1 A;  3MZH A;  2E1M B;  1TT5 B;  4WWC A;  4ER6 A;  2W24 A;  5L3C A;  5J1Y A;  2EFO A;  5FJ8 J;  4C9Y A;  1B6A A;  2IJL A;  3BR1 A;  1QQI A;  2R7X A;  2QBY B;  1USS A;  1JTX A;  1QB2 A;  2EIJ H;  2GOM A;  2Y75 A;  3FWE A;  2PMH A;  3HSE A;  3FZV A;  5AIP A;  4BE0 A;  5D6F A;  1B9M A;  3F6O A;  2GXG A;  1QPM A;  3OYG A;  3TL4 X;  5CQE A;  3HKZ A;  1VQ6 I;  1POG A;  3OQN A;  4D1Q A;  4IRG A;  1OCZ H;  2X4H A;  4MTD A;  3SCF A;  1U9O A;  3BY6 A;  3QPT A;  1X57 A;  3S1Q J;  1J2X A;  2JUC A;  1HDD C;  3BPX A;  3HM5 A;  3I71 A;  4OIN F;  2JMW A;  3A0B C;  2RKH A;  3VFZ A;  5LHH A;  1H8A C;  4RGR A;  1ZRE A;  2B7E A;  1HSJ A;  2OBP A;  1A35 A;  1Q1H A;  1R7J A;  3GBG A;  3TDZ C;  4BQO A;  3F8B A;  4I0A A;  3E5Q A;  2VT2 A;  1BI0 A;  3CC2 I;  1V3F A;  4I6R A;  2LY2 A;  3DKY A;  1TT0 A;  2KHM A;  3I5U A;  3REO A;  3V7C A;  2Z99 A;  4QPQ A;  4XLN F;  3C2B A;  4AWX B;  3COA C;  4PK4 A;  1ETY A;  3WTU C;  4HLY A;  1VQK I;  2HWV A;  4A3D J;  4JQD A;  3X2Q H;  2WB1 N;  3A4C A;  3Q3S A;  1ON1 A;  5HLT A;  3K4C A;  3JRD A;  2FX0 A;  4O8B A;  3MQ0 A;  5E1Z B;  4CZC A;  3MKY B;  4A3K J;  2Z3Y A;  4BJ6 C;  4EV0 A;  2CYY A;  3MLF A;  2LKP A;  1TNS A;  2MA3 A;  2PIJ A;  4OWR B;  3S16 J;  2CQN A;  4I8T A;  2XAH A;  2LKS A;  1WKM A;  1GXP A;  1J9I A;  2O38 A;  3GLL A;  5CPR B;  1TBX A;  3LSK A;  4Z5C A;  1OKR A;  3FKJ A;  3HC7 A;  4U88 A;  4UVC A;  3L2Q A;  1HW5 A;  1CQT A;  2FRH A;  1FOK A;  4BXX J;  3MEX A;  3Q9V A;  2XUB A;  5KAF C;  3RDI A;  2ELJ A;  3VYR B;  4Z58 A;  2X51 A;  1ETQ A;  4EM2 A;  2R7W A;  4CSW A;  1FTT A;  1Y7Y A;  3L09 A;  2KRH A;  3PUF A;  4XMY A;  3FKI J;  3QFI A;  2N8G A;  3C1D A;  4WXC A;  5CVI A;  2KQR A;  1B8I B;  1Y9Q A;  4MO7 A;  4OAZ A;  1LMB 3;  5HVQ C;  5FD6 A;  4L5E A;  1XX5 A;  5KNL A;  1XMA A;  2CFX A;  2BHZ A;  3KJX A;  1QZY A;  3J81 K;  3HSR A;  3R0J A;  3WG9 A;  5A2Q K;  3HKZ N;  2NVU B;  2IV1 A;  3FBI B;  2L9S A;  1PUF B;  1YHQ I;  3E5X A;  3HZI B;  3FYA A;  2DK8 A;  2QKM B;  3HL2 A;  3ZGK A;  2OCE A;  4A3L J;  1CJG A;  4M9Z A;  4YFK F;  1X1D A;  1Z05 A;  4KIT B;  5L3E A;  2JN6 A;  4HQM A;  4CYC B;  5LD2 C;  4M6X A;  4Z6Y A;  3CP8 A;  3K1P A;  4EJV A;  3F23 A;  3ML6 A;  3A1Y A;  2OUM A;  1QP0 A;  3GUD A;  2IU7 A;  3CO6 C;  4U0Y A;  3TMO A;  4CH7 A;  2Z33 A;  3OL4 A;  4FCY A;  1BI1 A;  1T39 A;  3E3V A;  1I1S A;  1X1P A;  2HZD A;  2Z5U A;  3K6G A;  4RB0 A;  4MTE A;  1L3L A;  3MAJ A;  3CDI A;  2K9Q A;  3L7W A;  2X85 A;  1U5T B;  1X1B A;  2VC1 A;  4ENJ A;  5JHU A;  2NS8 A;  2YR2 A;  5CLS A;  4EJU A;  3A9Y A;  2VJJ A;  2WAF A;  1XMX A;  3K70 C;  4LK1 F;  1BC8 C;  5DRY A;  5EZG A;  2DA5 A;  2L7Z A;  3OY9 A;  2DA6 A;  4I99 C;  5K98 B;  1S6L A;  4GGG A;  5CVR A;  1HDP A;  3FM5 A;  3OL3 A;  1ZAR A;  3CCL I;  2R7S A;  1E3H A;  4M3E A;  3QU6 A;  3SEQ A;  5DUK A;  1D8J A;  3DU6 A;  1KQ0 A;  1WI9 A;  2YX4 A;  4UVA A;  3RJP A;  1PRA A;  2PUD A;  1EH7 A;  4A2U A;  2DMN A;  1RPW A;  2R1J L;  2FA5 A;  4OU0 A;  3WTZ A;  3WTY C;  2LVS A;  1OR7 A;  5J8C A;  3W2A A;  1WI3 A;  2JA8 J;  1BOA A;  1Z7L A;  3GN5 B;  2Q1Z B;  4GDF A;  2HYF A;  4X4H A;  1O3T A;  1A6Q A;  3OMT A;  1LB2 A;  4N4O B;  3D1N I;  2TRT A;  3BR0 A;  3M9A A;  3IWF A;  4AIK A;  2DOE A;  2BHY A;  2YU3 A;  4U87 A;  3DKW A;  4WX9 A;  1B59 A;  4KIB A;  1ZG5 A;  2ZJQ F;  1TLH B;  2WV0 A;  2VBZ A;  3IC7 A;  3W6V A;  1Z7U A;  3GTQ J;  4IRI A;  4MHG A;  3CMY A;  1U3E M;  2JA2 A;  2J7U A;  2Z16 A;  1WH7 A;  1YO5 C;  3IHU A;  1K79 A;  1PNR A;  3BJ6 A;  3FMS A;  3GZC A;  2HYJ A;  4FE4 A;  2H6B A;  3TO7 A;  3U21 A;  1E17 A;  3P9C A;  3U1D A;  4X6A J;  2V79 A;  2HFH A;  3M8J A;  2HDC A;  2VQG A;  2P0W A;  1SD5 A;  3G0T A;  2L9N A;  4UVB A;  3FXK A;  2VI6 A;  2VPL A;  1BDI A;  3L2W A;  4PJN A;  2DXI A;  4NNJ A;  1BW5 A;  1FJL A;  4E4H A;  1R5I D;  3GZD C;  3CP2 A;  4W1U A;  2HFZ A;  3KIO A;  2V9V A;  1I39 A;  4G7H F;  2Y0M A;  3CCS I;  3RSN A;  2R7R A;  1IRX A;  1RIO A;  3LAJ A;  4EGY A;  3HEF A;  3LAP A;  2F5E A;  3FXM A;  2PXE A;  4NC8 A;  3KE2 A;  3GTO J;  2MLK A;  1ZLJ A;  4IKF A;  5J6X A;  2GA2 A;  4CYD A;  2P7C B;  3RKX A;  3OOU A;  1KU3 A;  1FWZ A;  2P4W A;  2BY2 A;  2EIN H;  3MCZ A;  3DM5 A;  4EAT A;  2EIL H;  4M3D A;  1HLV A;  2HOA A;  3ZOB A;  2FQ4 A;  4HPQ A;  3LSM A;  1U8B A;  2KIM A;  5DT2 A;  3TW7 A;  4BUP A;  2EIM H;  2ELK A;  1ZGA A;  3DBR B;  3PNV A;  4I0B A;  4OIR F;  4XIC A;  3PE5 A;  3FX3 A;  3TW6 A;  1MBE A;  3C7J A;  3HUG A;  2PXQ A;  3E6B A;  2GXB A;  3CLC A;  2PUE A;  2HQN A;  5J4Y A;  2ME0 A;  3R61 A;  4YFN F;  3EDP A;  4B3A A;  3DLL F;  5TJJ A;  4F7Z A;  3HG9 A;  1XSD A;  3KPH A;  1MBG A;  2IPQ X;  2KEJ A;  4XM3 A;  4JP0 A;  3TP3 A;  2XKP A;  3S3O A;  2E1C A;  4A12 A;  2K85 A;  2XKO A;  1RZS A;  2RNG A;  3OIO A;  5J40 A;  3BDD A;  2YSR A;  1E0E A;  1APL C;  3G73 A;  4A5M A;  3ZQQ A;  3ABU A;  2E1M C;  1BM9 A;  1X1C A;  3WTT C;  5JVG F;  3S8Q A;  2CV0 A;  3K4K A;  4D9J A;  4DOZ A;  2L01 A;  3ULQ B;  5DTR A;  5JFR A;  5BPI A;  2K4J A;  3B73 A;  1Z77 A;  3LA3 A;  3ZCO A;  3OYM A;  2NOG A;  3WU1 B;  3RZZ A;  2COB A;  3CF2 A;  4ETS A;  1Z67 A;  4I76 A;  3GFI A;  2G9W A;  1U9N A;  1WZ2 A;  2H1L A;  1LFU P;  2BNO A;  4R79 A;  3AKZ A;  3K1N A;  3OQM A;  2MLG A;  4NC6 A;  2PFB A;  1VQ8 I;  2ISZ A;  2X6Y A;  3ZPL A;  2R63 A;  3IRQ A;  2Y69 H;  4G94 A;  1ZZ8 A;  4B4C A;  1RKT A;  4FIS A;  3ZR8 X;  1ZKG A;  2PBI A;  2E1N A;  2GAU A;  3LOC A;  1ZGW A;  1IV8 A;  3GWZ A;  1R71 A;  2J5O A;  1XCV A;  2JUG A;  1EA3 A;  1OCR H;  1A5J A;  1JWL A;  2O03 A;  3QAH A;  2RVC A;  4EZI A;  5CJ9 A;  2V1U A;  4XSX F;  4KN7 X;  3GTJ J;  4IA8 A;  2CQX A;  3J81 Z;  4NB5 A;  3J7A O;  3PIO F;  3EUS A;  2HCS A;  4L5I A;  1HQ1 A;  1WJ5 A;  2GZW A;  2JRM A;  4D7M A;  2Q0O A;  4LLN A;  2QSH X;  4XQF A;  2IGM A;  1P4A A;  4DGW B;  2H8W A;  2FUG 2;  3EUH C;  3AG3 H;  2L2O A;  4N9H A;  4A5N A;  1KYZ A;  2DYS H;  2QSG X;  3R4K A;  5GAE J;  2DTR A;  3M8E A;  2FML A;  3GME A;  1IRG A;  3EQL F;  1TC3 C;  3WGH A;  3I9V 2;  3R1F A;  2E1O A;  2EB7 A;  4LB5 A;  4NHJ A;  3TP0 A;  4S05 A;  1SC7 A;  4U0W A;  2ESN A;  3AL0 B;  2ODR D;  1MNE A;  1S3J A;  1ADR A;  3S3M A;  2V7F A;  2CJJ A;  2ZFW A;  3N4M A;  2JSP A;  4HX7 A;  4PJM A;  2WA0 A;  3LSI A;  3FHZ A;  2FBK A;  2AQE A;  2UUZ A;  4A3J J;  1YSE A;  2E5Z A;  2BY3 A;  1G2H A;  5FKK A;  1Z6T A;  4HDU A;  4Y42 A;  1YI2 I;  4IOA F;  2OQG A;  1ZVV A;  2IA0 A;  1F43 A;  3V4G A;  4FN3 A;  2MEZ A;  3HRT A;  3GUU A;  4LG0 B;  4XLA A;  4LG3 A;  3FHN A;  3DNV B;  4G7O F;  5GAH J;  1WJB A;  4BEH B;  4MGR A;  4Q48 A;  4IO9 F;  3VPR A;  3H5R A;  1JI8 A;  3OYE A;  1ZG1 A;  1VI0 A;  3VOE A;  2A5Y B;  1PVE A;  4ENK A;  1FOX A;  1UHW A;  4GRI A;  4EKG A;  1O7F A;  1KU9 A;  2LY9 A;  3HGG A;  1FSH A;  3K1M A;  1MFQ C;  3ZHI A;  2B0L A;  4ITV A;  3QOE A;  4HOB A;  1V55 H;  3M3Y J;  1BR2 A;  1MBJ A;  2Z2S B;  2V4J C;  5KK1 A;  1QQB A;  4J1W A;  4GCV A;  1GV5 A;  5IPA A;  2A3S A;  2XGX A;  3SJM A;  4E7L A;  4JCX A;  1JUS A;  3L9F A;  4FHT A;  4RGU A;  3ZQH A;  3EUK L;  2OTJ I;  2IA1 A;  3BR6 A;  2XGE A;  4PU8 A;  3EPZ A;  3CEC A;  2BVL A;  1BR1 A;  5E3N A;  3HHG A;  2HEO A;  2CG4 A;  1BW6 A;  2XB0 X;  3RCO A;  4BJT A;  1LUJ B;  4ZZL A;  2VE9 A;  1T98 A;  1OMI A;  3F51 A;  5E20 A;  5HDN A;  5GAD J;  4N4N B;  3F52 A;  1R00 A;  1BDH A;  4Y3O A;  2D1H A;  2R0Q C;  2MAB A;  4HBL A;  3ABL H;  2O5R A;  4PSW A;  4S04 A;  4RAZ A;  2OCC H;  3T8R A;  2ACJ A;  1CGP A;  1LCC A;  2MYS A;  3KP6 A;  2KDZ A;  3ABT A;  3DBH B;  1SFO J;  3GO5 A;  2VXD A;  3V42 A;  4A0X A;  5LHI A;  1SMY F;  3MN2 A;  4B48 A;  3GX4 X;  1ZEL A;  2VQL A;  4CCN A;  1IF1 A;  4KT6 A;  1TZL A;  1HOM A;  2CWE A;  2WY8 Q;  2EQR A;  1QPI A;  1G3T A;  3CZ6 A;  3JRC A;  4UUS A;  2GXA A;  4ESF A;  2JPC A;  2X6W A;  4TV7 A;  4DQ2 A;  5ICC A;  3IAS 2;  4OIP F;  3QOX A;  2PUA A;  2HKO A;  4RM2 A;  3W6K B;  2GOX B;  2V26 A;  3U3W A;  2DMU A;  4X4B A;  3QWG A;  1UHM A;  1TWG J;  4PGH A;  2M3A A;  3BOQ A;  4WCG A;  1VQ7 I;  3OWQ A;  1IXC A;  1LJ9 A;  4XRS A;  3PIP F;  3RZO J;  3JRF A;  3V8K A;  2FFH A;  3BJA A;  5GPC A;  4RLF A;  1DUL A;  3T1B A;  3S14 J;  2GQQ A;  4DW6 A;  1Z6R A;  3I55 I;  1QQA A;  2HGC A;  3IV5 A;  1L0O C;  3H92 A;  1S29 A;  2V9K A;  2XPV A;  3CO7 C;  2L49 A;  5E1W A;  2VIX A;  4PU4 C;  2A07 F;  2M5W A;  3QOP A;  1IZ1 A;  5FFX A;  1D5V A;  4RB2 C;  2OC6 A;  4II2 A;  5BQT A;  1YQA A;  2ME6 A;  3K69 A;  1MMA A;  3I4M J;  1G4D A;  2KDO A;  1MBK A;  2ZME B;  3EYY A;  1X2L A;  3O2P E;  2MD0 A;  1JE8 A;  3Q9S A;  4ZTJ A;  3LSG A;  4NC7 A;  3F9K A;  2XRL A;  1UFM A;  3QPH A;  3LST A;  1DGW Y;  1T8I A;  2R7U A;  3NXH A;  2O7O A;  1VPW A;  2MFZ A;  1P6R A;  3F21 A;  2RRE A;  2P8T A;  2XV4 S;  2NNN A;  3CCV I;  4IPA A;  4BGD A;  3A01 B;  2HCN A;  2ZKZ A;  1XDS A;  2W4S A;  4IQJ A;  1IDY A;  3I0T A;  4MQV A;  2R3S A;  3ESW B;  1XGS A;  3M4O J;  1X3U A;  2DDA A;  3ZMS A;  1RET A;  4O5V A;  3S2D J;  3QOW A;  2WAQ N;  1JFT A;  2LTP A;  5F6F A;  2LC2 A;  2OFY A;  4ER3 A;  4DYQ A;  1I3A A;  4IVN A;  2F5D A;  2W1O A;  4QTR A;  4BQA A;  2DTZ A;  1I6H J;  2L7M P;  3RKQ A;  3BZK A;  1S7O A;  4P96 A;  1VQM I;  2JTV A;  2PMU A;  4OB4 A;  1IN5 A;  1YIO A;  1WFX A;  4ON0 A;  4G8X A;  2Z1D A;  4M9S A;  1YX3 A;  3KYD B;  2HQ5 A;  4ASN A;  2MC3 A;  4HNT A;  1UHS A;  1OYY A;  4ZYE A;  5L3B A;  5DM7 F;  3ZQC A;  4Y7N J;  1IGN A;  2LDU A;  2IW5 A;  1R22 A;  3PL8 A;  1AHD P;  1DQU A;  3S93 A;  1J7K A;  1D0Y A;  1XWR A;  2BY1 A;  2IGO A;  2W85 A;  4EMS A;  5FLV A;  2VJ4 A;  5J3L A;  3A9Z A;  5B5E C;  3TOB A;  4DE8 A;  3MMY B;  3CTA A;  3JXB C;  3ZMD A;  3DF8 A;  3C3W A;  2MGQ A;  1WJD A;  5KAI C;  1R5H A;  3H0D A;  1QPZ A;  4QIW N;  4BJ5 C;  3OIP A;  4G12 A;  1FOY A;  2DFH A;  5F0C A;  1VND A;  1P4W A;  4LB6 B;  4HQE A;  3MKZ A;  1JXS A;  1N25 A;  2KEI A;  3HIF A;  1HXD A;  3C2H A;  5JUW A;  2R7Q A;  1XN7 A;  3BJO A;  4G6Q A;  4L9N A;  3CCY A;  3A01 A;  3WU2 C;  2F5V A;  2HNH A;  4CIC A;  1LEB A;  1R63 A;  1FX7 A;  2D45 A;  4GXO A;  4PSX A;  4Q2J A;  1S7A A;  5IP6 A;  1X19 A;  1NER A;  2GZU A;  4PUS A;  1YFH A;  1MZB A;  2VXZ A;  5D6E A;  3J7A Y;  3DPL C;  2L3D A;  5EDN A;  5EGO A;  3OS1 A;  5E8G A;  4AM3 A;  2HPM A;  4KMU X;  4BBR J;  1VQ5 I;  3P7N A;  2ZME A;  3CDL A;  1KU7 A;  3GF2 A;  3GFL A;  4OMZ A;  4A3B J;  4XR6 A;  3FMY A;  2DAO A;  2VKV A;  4ZC3 A;  3GBF A;  2STW A;  2LF8 A;  2CQ7 A;  3VB2 A;  2V1X A;  2K9L A;  3QQA A;  1FT9 A;  4UB8 C;  3ZQG A;  1OCO H;  2FQ3 A;  2QCO A;  1QP7 A;  4L9V A;  1LLI A;  1B72 A;  1W7P B;  2CV2 A;  5GTI C;  3MZ8 A;  4OMY A;  1JKQ C;  2MC4 A;  3OV8 A;  3Q0V A;  1XDU A;  5IT9 K;  4GYG A;  2CU7 A;  1MSF C;  1AOY A;  4YG7 B;  2PLY A;  2IEK A;  3KZI C;  1YG2 A;  3G4S I;  4CYC A;  2ESH A;  2X0L A;  3A02 A;  4IHS A;  4OIQ F;  3VYS B;  1R5G A;  1ZZ6 A;  4X4G A;  2OTL I;  2WB1 A;  2M2E A;  1T6S A;  3KYL A;  5D5U B;  1WGX A;  3WOD F;  4RB1 A;  2XIU A;  3PFY A;  2LNM A;  1K4T A;  2GRM A;  2J7W A;  3S2W A;  1U2Z A;  1F36 A;  4BY7 J;  4Q47 A;  1TWC J;  1N75 A;  2XCJ A;  4AYB N;  1F4K A;  1YRN A;  5H6R A;  5EG0 A;  5JHF A;  1LEA A;  1HST A;  3RIR A;  1LKX A;  4B09 A;  4YRV A;  3H9G A;  5F0F A;  5LGT A;  4PJL A;  2HIN A;  5FFZ A;  2IGK A;  4LJZ F;  4PU3 C;  2X6X A;  1MMS A;  2PEX A;  1FC3 A;  1QHG A;  4MIM A;  3S32 A;  2DPD A;  4V2G A;  1YIT I;  2IVM A;  3D0S A;  3FXO A;  1OCC H;  1YJ9 I;  5D5X B;  1JT0 A;  1MBH A;  1E3O C;  1I3Q J;  1XMK A;  4EM0 B;  3ECO A;  3IAM 2;  5LGN A;  1VZ0 A;  2VPR A;  3SFZ A;  2LK2 A;  2QQB A;  2H94 A;  4F93 B;  1YTY A;  5TGT A;  2HI3 A;  3BCA A;  3BR2 A;  1YS7 A;  1P2F A;  3CUQ B;  1ZQ3 P;  2ZJP F;  1JGS A;  1S7E A;  2LMD A;  2NVT J;  1Q1V A;  1NK3 P;  2R7V A;  3CCM I;  2K9S A;  5DCF A;  2GWR A;  4GHJ A;  2K27 A;  3K4M A;  2F5C A;  4RAG A;  4L9J A;  1P7I A;  2IUO A;  5HNH A;  4HYE A;  5DDG A;  5HOO A;  2XAQ A;  4I6T A;  2M0C A;  1UG2 A;  3S1R J;  3T0Y A;  2L1P A;  1B4A A;  3TQN A;  5JI6 A;  2VN2 A;  5J8F A;  4QSH A;  1XPX A;  1IO2 A;  3JAM Z;  2MBF A;  5GAG i;  4IZZ A;  2DO7 A;  3OS2 A;  1UXD A;  3BDN A;  2IGN A;  3OYN A;  1SVL A;  2DA2 A;  4LG0 A;  1K4S A;  1Z9C A;  1SFK A;  5A2Q Z;  3P9I A;  4IHT A;  4UB6 C;  2RN7 A;  3QPL A;  4X0G A;  1MSE C;  3ROU A;  5J47 A;  2WV1 A;  2L02 A;  5AON A;  3IWZ A;  3KLO A;  2QKL B;  2W7N A;  4AVP A;  1LNW A;  1X3W B;  2FSW A;  1K83 J;  4EJO A;  3F22 A;  1Z91 A;  4LIU A;  2FD5 A;  3PXP A;  5DS9 A;  2PUB A;  2JK3 A;  3HOV J;  5JLW A;  4Y33 A;  4PJ0 C;  3JRE A;  3HDD A;  3DP7 A;  5HDK A;  2XAJ A;  3PQJ A;  4XSZ F;  4ZZD A;  3BPV A;  3J7Z I;  3A2K A;  3I53 A;  2MW8 A;  1BR4 A;  2PI0 A;  3A0H C;  1GVD A;  3K0L A;  4RGX A;  2HOS A;  2HVQ A;  2HYG D;  4XID A;  3BZC A;  2GIV A;  3S17 J;  4CGZ A;  3U1K A;  1RPE L;  5K1Y A;  1Z21 A;  3WE2 A;  2CSF A;  2J5P A;  2CQK A;  3ONQ A;  2IP2 A;  1TP4 A;  4NUB A;  3S1M J;  4UUT A;  2XPU A;  1W36 C;  2ZC2 A;  3RKY A;  1IN4 A;  4O6J A;  1MJA A;  3WTX C;  2DT5 A;  2QZ8 A;  2FU4 A;  3F8N A;  2AXT C;  3BZ6 A;  5FGM A;  1YW9 A;  4YG2 F;  1ZRD A;  1BI3 A;  5GP9 A;  2BXY A;  3VWS A;  3JCU C;  2C6Y A;  2QYO A;  1ULY A;  3OYK A;  2GA1 A;  4ZH4 F;  2Y9Y A;  3FMR A;  2YUS A;  3R0A A;  1TWH J;  2LSO A;  2O0Y A;  2DT6 A;  1X58 A;  2D2W A;  2QEX I;  1FIP A;  2M8G X;  3GFM A;  2IAI A;  1LCD A;  2M7B A;  4BHB A;  3F8M A;  3ZMV A;  2DW4 A;  4J00 A;  1O3Q A;  1EH6 A;  5GAH i;  5JR3 A;  2I10 A;  5ED4 A;  1FEX A;  2PN6 A;  4A3C J;  4C2M J;  1PP7 U;  1YRN B;  4OAY A;  4XN0 A;  5C44 J;  4XON A;  2QEN A;  1VF9 A;  2G7H A;  4C2T A;  2P5L C;  4EJW A;  2Q2E A;  1IG7 A;  1TQP A;  3KEQ A;  2H09 A;  3C2G A;  1D1A A;  4BQQ A;  2B63 J;  5FRM A;  1MMN A;  3S2H J;  4LMY A;  5B1B H;  1GDT A;  2ZXH A;  4E7H A;  4QLC U;  1T0F C;  1BA5 A;  1ETO A;  1BIB A;  1W7P D;  3GVA A;  1Z3Y A;  2A5W A;  2CQQ A;  3ZQI A;  3TDU C;  3I54 A;  2A6T A;  3HOS A;  2FEZ A;  4WXH A;  4BL0 B;  1KQ9 A;  2LYJ A;  3E0J B;  4BNC A;  4XLE A;  1W36 D;  4YAR A;  5CVV A;  3D5S C;  4A0Z A;  2L9R A;  1MDM A;  1XSX A;  2NS0 A;  3DTE A;  4C3J J;  2PPX A;  2WAE A;  1A36 A;  1W5T A;  4HF2 A;  5FKO A;  3CJN A;  4C2U A;  2F48 A;  2WUS R;  1NHA A;  1TW3 A;  4ENN A;  1YJW I;  1ZGJ A;  3LL7 A;  4JK1 X;  4JX6 A;  4IHY A;  2VOD A;  2AWI A;  5ILS A;  4DJA A;  1G3W A;  4BY1 J;  1DU0 A;  2IS2 A;  1T08 B;  3OSF A;  3JW4 A;  2EWT A;  4BDY A;  1R69 A;  2EK5 A;  4M3F A;  2LLK A;  5DCM A;  2LF7 A;  4S0H B;  1JH9 A;  1AA7 A;  4IEJ A;  3RPU D;  4DIQ A;  1PDN C;  5D8K B;  2AXV A;  1V54 H;  5BOX A;  1LFB A;  4Z2Y A;  1LDK B;  2NVY J;  1H89 C;  4JQF A;  4E6K G;  2ECC A;  5GTH C;  1YYV A;  1H88 C;  4F52 A;  2F2E A;  3RKW A;  3OS0 A;  1E3P A;  2M30 A;  4II3 A;  3DPT A;  4XRF A;  2D5V A;  3ZMZ A;  4B8X A;  2XPW A;  1FPQ A;  1Z1D A;  3HRU A;  4W97 A;  4U7D A;  3HTS B;  2EF8 A;  4EK9 A;  2NYX A;  2ECB A;  5ERI A;  1VTN C;  2Q2E B;  4K2E A;  1SQ8 A;  2LCV A;  1WWX A;  2M87 A;  3MEJ A;  2FBH A;  1MH4 A;  4XK4 A;  3OMY A;  1FYM A;  2K9N A;  1J5Y A;  1R36 A;  3SZP A;  2Y31 A;  1D5Y A;  4Z5D A;  1TQM A;  4I7H A;  3LMM A;  1WPK A;  2DFI A;  1W5C C;  3H5N A;  1RR7 A;  2KRF A;  4IQ4 A;  2OV7 A;  4J01 A;  3HOU J;  1JUP A;  2CS3 A;  2JCG A;  5E8I A;  2KP6 A;  1Z3X A;  3B6A A;  3NRV A;  4Y13 A;  1SVO A;  1RZR A;  4I09 A;  4CZZ A;  4ANJ A;  2NRA C;  2BGC A;  2XAU A;  5LBQ A;  1QZE A;  2BW3 B;  1LFP A;  1GLN A;  4Y17 A;  3QF3 A;  3JXD L;  2R7T A;  5LEJ A;  2OU2 A;  4ENM A;  4DNC A;  2PXK A;  3K70 D;  2HXO A;  3QPS A;  5FLX K;  3BRO A;  3LA7 A;  1SAX A;  2JSC A;  1FY7 A;  3G5G A;  5BNG A;  1BI2 A;  3K9T A;  3E1S A;  2LYQ A;  3DKX A;  4HG2 A;  1I6X A;  3G1M A;  2X6O A;  1YJN I;  4J19 A;  1GHC A;  3ZN0 A;  3HPG A;  1SD7 A;  2HXI A;  2ZJ2 A;  5HLH A;  1SVM A;  2LBF B;  5IP9 J;  5K5R A;  4D7N A;  1SFU A;  2HOE A;  4MCT A;  5LEK A;  3ZKC A;  1YX5 A;  2M4G A;  2YS9 A;  3HJE A;  3JAM K;  2IVB A;  2DPU A;  5HNF A;  4M6V A;  3PSI A;  4PU7 A;  1UMQ A;  1U2W A;  3L2U A;  3BTJ A;  1T56 A;  1S9H A;  4RM3 A;  4KIC A;  1ZRF A;  1LE8 B;  2AO9 A;  2UV1 A;  1I1G A;  5HOD A;  2E35 A;  1WIZ A;  2CRG A;  1V5E A;  3HGY A;  3A03 A;  3QP5 A;  1EH8 A;  2EA2 A;  4P9U A;  2ICP A;  3DCF A;  4R8H A;  3R09 A;  2PMZ A;  5M5X J;  4HX4 A;  3TGN A;  2XRO A;  3LFP A;  2XSJ C;  4WK8 F;  1RC9 A;  1UB9 A;  2R5Z A;  3K7A J;  4NDL A;  3V8L A;  3CUQ C;  5K5Q A;  2JT1 A;  5K7Z A;  1OJL A;  1O3R A;  3DQV C;  4BYY A;  2CW8 A;  3IH4 A;  4FAS D;  2DU9 A;  3ABM H;  1WET A;  4F55 A;  3CJR B;  3O6B B;  4FE7 A;  1IRF A;  3WTW C;  3KCC A;  2LRD A;  1YLF A;  4P9F A;  4D0P A;  3CD6 I;  2ZFU A;  3IVP A;  4D5C A;  1OSL A;  3FBN B;  2ADU A;  3G1O A;  1B0N A;  1P9Q C;  5DD4 A;  3DPU A;  1GUU A;  4IJA A;  4Q4Z F;  4XBF A;  3GTK J;  1ON2 A;  2OQR A;  3IH2 A;  3ZQF A;  3OWT A;  2FXA A;  2DBB A;  4HA8 A;  4E7Z A;  3MKW B;  1SFX A;  3KET A;  1Y8R B;  3H35 A;  1PUF A;  4QPO A;  3PNT A;  2H1K A;  3HTU A;  3QP6 A;  1P92 A;  2QQA A;  1ITY A;  1OLT A;  4PFP A;  4YII A;  1XGN A;  3RQI A;  3BT9 A;  4A6E A;  5ICG A;  1MMG A;  1ETX A;  3AFH A; 
#chains in the Genus database with same CATH homology
 4OB4 A;  4Z5C A;  4BKX A;  3FYM A;  1OCP A;  1CQT A;  4BXX J;  2HQ5 A;  4IWR A;  5FKM A;  1UHS A;  3F6W A;  1TWF J;  3ZQC A;  1ZR4 A;  1IGN A;  4Y7N J;  2R5Y A;  2PMZ N;  4Z58 A;  1ZK8 A;  1ETQ A;  1FTT A;  2AXZ A;  1Y7Y A;  3LSJ A;  3BTL A;  3FKI J;  3BTC A;  2Y9Z A;  1QRY A;  2N8G A;  1AHD P;  1B8I B;  1XWR A;  1W0U A;  1Y9Q A;  4MO7 A;  5FLV A;  1LMB 3;  3JRB A;  4L5E A;  2OPT A;  5J3L A;  4Z59 A;  2DMP A;  2E2H J;  3KJX A;  1I50 J;  5FLM J;  2O38 A;  4A3F J;  1JUM A;  3HKZ N;  4V2F A;  2IV1 A;  3JXB C;  1ZTR A;  2MGQ A;  1PUF B;  1TWA J;  4A3I J;  2R92 J;  2R93 J;  1QPZ A;  4QIW N;  1W0T A;  3FYA A;  3HZI B;  1JKO C;  4G12 A;  4A3L J;  2OF7 A;  1CJG A;  5F0C A;  1VND A;  5EEA A;  1ORK A;  3BD1 A;  2DN0 A;  3Q0U A;  2GLO A;  3JRI A;  2JN6 A;  4CYC B;  1X2N A;  2E19 A;  2KEI A;  2LFB A;  1FIA A;  4JX4 A;  4A3M J;  3CCY A;  3A01 A;  1QP0 A;  1R63 A;  3BG9 A;  1ZZ9 A;  1P7J A;  2IU7 A;  2CRO A;  5IP6 A;  1ETK A;  1NER A;  2GZU A;  4X4E A;  3JRG A;  3MKL A;  3GTP J;  2PE5 A;  4FCY A;  5EDN A;  5EGO A;  3B7H A;  3JR9 A;  4A3G J;  2K9Q A;  4BBR J;  2LYK A;  4AC0 A;  2DA3 A;  2NS8 A;  2W48 A;  3CDL A;  1FTZ A;  1IUF A;  5EZH A;  5K7F A;  2LD5 A;  2EBI A;  4A3B J;  2MQK A;  2EZI A;  3FMY A;  1RKW A;  5EZG A;  2DA5 A;  2DA4 A;  2L7Z A;  2VKV A;  3IH3 A;  2DA6 A;  4B1R A;  4XRS G;  3GBF A;  2AHQ A;  5K98 B;  4BBS J;  3QQA A;  1RZR D;  1L1M A;  3ZQG A;  1HDP A;  2QCO A;  5EGO B;  2XB5 A;  2A6C A;  3KXA A;  1QP7 A;  4M3E A;  4X4F A;  1LLI A;  1B72 A;  5F27 A;  3S1N J;  3QQ6 A;  1PRA A;  2PUD A;  1JKQ C;  3Q0V A;  3FIS A;  1HF0 A;  2DMN A;  1RPW A;  2R1J L;  2EZK A;  2CU7 A;  1MSF C;  2LVS A;  1U78 A;  4YG7 B;  2IEK A;  1WI3 A;  2JA8 J;  2JWT A;  3GN5 B;  4X4H A;  4CYC A;  3BTI A;  3A02 A;  4LOC A;  1ETW A;  3OMT A;  3BR5 A;  3D1N I;  2GM4 A;  3BS3 A;  1ZZ6 A;  3H0G J;  2TRT A;  4X4G A;  3BR0 A;  4UUS B;  3L1P A;  2M2E A;  3HBL A;  1WGX A;  1POU A;  2BNM A;  2XIU A;  1LQC A;  1ZZC A;  2ZB9 A;  2GRM A;  3BG3 A;  3W6V A;  1F36 A;  2M34 A;  1Z0X A;  1JJ8 C;  3GTQ J;  4BY7 J;  1TWC J;  2XCJ A;  4AYB N;  1YRN A;  3TRB A;  3CMY A;  5EG0 A;  4J1X A;  5F0F A;  1WH7 A;  4AUX A;  1PNR A;  1ZZ7 A;  2HIN A;  3RZD J;  2LYS A;  1EF4 A;  2HYJ A;  3MVP A;  4FE4 A;  4FBI A;  4PU3 C;  4MIM A;  4V2G A;  5E3L A;  4JYK A;  2ID6 A;  2L7F P;  1R9T J;  4X6A J;  5F04 A;  2KPJ A;  1AU7 A;  1JT0 A;  3OQO A;  2VI6 A;  1MBH A;  2IBD A;  1I3Q J;  3SDG A;  1E3O C;  1BDI A;  1QP4 A;  2BNN A;  2VPR A;  2B5A A;  1NTC A;  2LK2 A;  1FJL A;  1BW5 A;  2HI3 A;  3BR2 A;  1ENH A;  4A69 C;  4W1U A;  4A3E J;  1DW9 A;  1ZQ3 P;  3PO3 J;  1S7E A;  2NVT J;  1Q1V A;  1NK3 P;  1PRV A;  2K9S A;  3GTG J;  3SCH A;  4GHJ A;  1RIO A;  4RDU A;  1JKP C;  3HEF A;  3OSG A;  1P7I A;  2DMQ A;  2IUO A;  3GTO J;  4FTH A;  3GN5 A;  1WH5 A;  2KT0 A;  4I6T A;  1BJZ A;  2M0C A;  1UG2 A;  3OOU A;  4M3B A;  3S1R J;  1UTX A;  2EZL A;  4QSH A;  2RAE A;  4M3D A;  2LR8 A;  3PO2 J;  1HLV A;  2HOT A;  2HOA A;  3ZOB A;  2NVQ J;  1B72 B;  1UXD A;  3B6C A;  1NEQ A;  3BDN A;  2FQ4 A;  4DZP A;  2DA2 A;  2JJ7 A;  1U8B A;  2R5Z B;  1IDZ A;  2LP0 A;  1UXC A;  3TW7 A;  3UFD A;  1ETV A;  2ELK A;  5F0H A;  3QPL A;  1MSE C;  3VK0 A;  4XIC A;  2WV1 A;  4GQM A;  3BR3 A;  3O9X A;  3TW6 A;  5IYC J;  5E3M A;  3GTL J;  1MBE A;  3CLC A;  3FIW A;  2XGC A;  2PUE A;  1K83 J;  2DJN A;  2FD5 A;  1A6I A;  2ME0 A;  4M3G A;  3UKG A;  5DS9 A;  3PXP A;  4DYC A;  1MBF A;  2JK3 A;  4B3A A;  5JLW A;  3HOV J;  2PUB A;  3JRE A;  1MBG A;  2MSY A;  3HDD A;  2KEJ A;  2ID3 A;  4JP0 A;  5IOZ A;  3TP3 A;  1O4X A;  5JLX A;  2LYP A;  2MW8 A;  2EH3 A;  2H8R A;  1RZS A;  1GVD A;  2HOS A;  3OIO A;  4XID A;  1APL C;  3BQZ A;  3S17 J;  1RPE L;  4YBA A;  2CSF A;  3JRA A;  4Z5H A;  3S8Q A;  1T33 A;  3S1M J;  4UUT A;  3ZHM A;  2XPU A;  2L8N A;  4JCY A;  2NVX J;  1GV2 A;  1Z77 A;  4YG1 A;  5EF6 A;  4XRM A;  2NOG A;  2O8K A;  3RZZ A;  2COB A;  1JJ6 C;  3G1L A;  4MFD A;  4I76 A;  2KEK A;  1U9N A;  2BNO A;  1LFU P;  4X4C A;  3OQM A;  5GP9 A;  1QVT A;  3ZQL A;  1JFS A;  3TED A;  2R63 A;  5IP7 J;  4RBO A;  1ZZ8 A;  4B4C A;  1RKT A;  2Y9Y A;  4FIS A;  2YUS A;  4I6U A;  1ZKG A;  1TWH J;  2LYL A;  3LOC A;  1ZGW A;  2Y30 A;  1DWK A;  1X58 A;  1MH3 A;  1FIP A;  2M8G X;  3FK6 A;  2IAI A;  2XJ3 A;  3PM1 A;  1A5J A;  2R7Z J;  4NDW A;  1JWL A;  1LCD A;  5GPA A;  4GFB A;  3WHB A;  2I10 A;  1FEX A;  3GTJ J;  4IA8 A;  4A3C J;  2CQX A;  4C2M J;  1IC8 A;  1YRN B;  3FK7 A;  3EUS A;  2TCT A;  2PUG A;  5C44 J;  3HOW J;  1VF9 A;  2OR1 L;  2EZH A;  3OP9 A;  5M5Y J;  2JVL A;  4D7M A;  1OCT C;  1JKR C;  5J1R A;  2EBY A;  2FJR A;  2O4A A;  3I4N J;  5IYD J;  5FKN A;  1IG7 A;  2LYR A;  4X4D A;  2B63 J;  4X1E A;  1ZPQ A;  4IHW A;  2LKX A;  2JA7 J;  3S2H J;  1DU6 A;  5E3O A;  1GDT A;  1BL0 A;  5C4J J;  2XSD C;  1BA5 A;  1ETO A;  2QF7 A;  1TC3 C;  2CQQ A;  3ZQI A;  5M5W J;  3R1F A;  2E1O A;  3TP0 A;  5F1J A;  2HDD A;  2XI8 A;  1WH8 A;  2LYJ A;  3SFI A;  2BJC A;  4YAR A;  1ADR A;  2DA1 A;  2L9R A;  2CJJ A;  4DYR A;  4C3J J;  1Y1V J;  4EEF G;  2PPX A;  5FKO A;  1MNM C;  3BQY A;  2WUS R;  2E2J J;  2GBY A;  4IHV A;  4C3H J;  4A3J J;  4MFE A;  1YSE A;  3O8G A;  1X2M A;  2JA6 J;  1G2H A;  4JX6 A;  5FKK A;  4IHY A;  2VUM J;  4ABZ A;  2AWI A;  2PUC A;  4Y42 A;  5FKL A;  1IJW C;  4BY1 J;  1ZVV A;  1JT6 A;  2X48 A;  3HB9 A;  3NAU A;  1DU0 A;  1F43 A;  4FN3 A;  3OSF A;  2MEZ A;  3H3V K;  2DA7 A;  2EWT A;  3BG5 A;  1NK2 P;  5C4X J;  1WH6 A;  3JXC L;  1R69 A;  4M3F A;  1HCR A;  1RES A;  2LLK A;  3DNV B;  4S0H B;  3K2A A;  1JH9 A;  2AXU A;  4IEJ A;  3VPR A;  2AXV A;  2GRL A;  1VI0 A;  2DMT A;  1LFB A;  5EYR A;  2NVY J;  1H89 C;  1IRZ A;  4X4I A;  3HGG A;  2LY9 A;  2E2I J;  2ECC A;  2ICT A;  1ZAY A;  3ZHI A;  2CUE A;  2VKE A;  1H88 C;  3M3Y J;  3S15 J;  1MBJ A;  3E7L A;  1QQB A;  4J1W A;  1VFC A;  2D5V A;  2O9L A;  2XPW A;  4W97 A;  2XGD A;  5M3M J;  1GV5 A;  1XC5 A;  5IPA A;  3SJM A;  2EF8 A;  1WCM J;  2ECB A;  3G7D A;  4JCX A;  1JUS A;  2AUW A;  3ZQH A;  4IVZ A;  3H5T A;  1SQ8 A;  3CRO L;  3BR6 A;  2XGE A;  2LCV A;  4PU8 A;  1GT0 C;  2JA5 J;  3CEC A;  2MG4 A;  4DZJ A;  1MH4 A;  4F8D A;  1OFC X;  1SAN A;  4XK4 A;  1AKH A;  2K9N A;  5E3N A;  2P81 A;  2Y31 A;  1D5Y A;  5M3F J;  4Z5D A;  1IV6 A;  2IVQ A;  1BW6 A;  1B8I A;  1WPK A;  2XB0 X;  4D5F A;  1PRU A;  1RR7 A;  3HOU J;  3F51 A;  1JUP A;  3HOX J;  2JCG A;  2L0K A;  2Y2Z A;  3F52 A;  2R5Y B;  3B6A A;  3F0C A;  1RZR A;  1BDH A;  1EFA A;  2R0Q C;  2PUF A;  1QVU A;  2K40 A;  3KZ3 A;  1ZZB A;  2IVG A;  3QF3 A;  3JXD L;  4I6Z A;  5EG0 B;  2CUF A;  1LCC A;  4MLO A;  2HXO A;  2KDZ A;  4YG4 A;  3QPS A;  1SFO J;  2X9D A;  1AKH B;  3LIS A;  3MN2 A;  5K7H A;  1JGG A;  5F08 A;  5IOY A;  5C3E J;  1ZR2 A;  9ANT A;  5BNG A;  3G5G A;  1ZUG A;  2WIU B;  1HOM A;  2EQR A;  2LYQ A;  1QPI A;  3G1M A;  3JRC A;  2X6O A;  4UUS A;  3LSR A;  2PUA A;  4J19 A;  2HXI A;  3DEW A;  4C3I J;  2YU9 J;  5IP9 J;  3GTM J;  3U3W A;  2DMU A;  1XG1 A;  4X4B A;  4D7N A;  3QWG A;  1TWG J;  4MCT A;  3Q0W A;  3ZKC A;  5J1Y A;  2YS9 A;  5FJ8 J;  3LNQ A;  2IVB A;  4XRS A;  4M6V A;  3RZO J;  3LSP A;  5DTD A;  3JRF A;  5GPC A;  3BR1 A;  3S14 J;  4PU7 A;  1UMQ A;  2O49 A;  4DW6 A;  3BTJ A;  1T56 A;  1QQA A;  3IV5 A;  1JTX A;  2FJ1 A;  2XPV A;  2L49 A;  1LE8 B;  2AO9 A;  3WHC A;  2KZ8 A;  1PER L;  1XS9 A;  4Y52 J;  3O8H A;  5HOD A;  4PU4 C;  4JX5 A;  1WIZ A;  2CRG A;  3HGY A;  3A03 A;  1ZS4 A;  2ICP A;  3DCF A;  2ME6 A;  4IHX A;  5M5X J;  3I4M J;  2HSG A;  1MBK A;  1X2L A;  3LFP A;  4HNV A;  5J1U A;  1POG A;  3OQN A;  3QYX A;  1K61 A;  2R5Z A;  3HOZ J;  4NDL A;  3K7A J;  3LSG A;  3SCF A;  3CQZ J;  1U9O A;  1OJL A;  5K7Z A;  1LE8 A;  1X57 A;  3S1Q J;  2XRL A;  1HDD C;  3HOY J;  3HM5 A;  3IH4 A;  2JMW A;  3JRH A;  1WET A;  1H8A C;  1VPW A;  2O7O A;  4FE7 A;  1JTY A;  3NAR A;  3GBG A;  3A01 B;  2NS7 A;  5IYB J;  4I6R A;  3IVP A;  1IDY A;  4A93 J;  4D5C A;  1OSL A;  2G0E A;  3G1O A;  1B0N A;  3C2B A;  1ETY A;  4A3D J;  2AW6 A;  1GUU A;  3GTK J;  4JQD A;  3M4O J;  3ZQF A;  3IH2 A;  2WB1 N;  3Q3S A;  1RET A;  3S2D J;  2Y0S N;  2WAQ N;  1JFT A;  5A7L A;  2LTP A;  3JRD A;  2FX0 A;  2OFY A;  4DYQ A;  4O8B A;  4MCX A;  4A3K J;  2M9H A;  3MLF A;  1PUF A;  2H1K A;  2PIJ A;  1ITY A;  3S16 J;  4QTR A;  4I8T A;  1I6H J;  2DTZ A;  3RQI A;  2L7M P;  3BT9 A;  3RKQ A;  3SCG A;  1ETX A;  1Y1W J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...