3TRBA

Structure of an addiction module antidote protein of a higa (higa) family from coxiella burnetii
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
92
structure length
92
Chain Sequence
MRPIHPGEILAEELGFLDKMSANQLAKHLAIPTNRVTAILNGARSITADTALRLAKFFGTTPEFWLNLQDAYDIKMALKKSGKKIEKEVTPY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural genomics for drug design against the pathogen Coxiella burnetii.
pubmed doi rcsb
source organism Coxiella burnetii
molecule tags Dna binding protein
molecule keywords Virulence-associated protein I
total genus 28
structure length 92
sequence length 92
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 3trbA00
3SCGA 1RZRD 3QF3A 2D5VA 1ADRA 2FJRA 2BNNA 2PIJA 3LFPA 4I6UA 3UFDA 1JH9A 1QP4A 4F8DA 4IVZA 3QWGA 4GHJA 2KZ8A 3SCFA 1O4XA 1CQTA 3LISA 1HF0A 1Y9QA 4YG1A 4X4HA 1ZZ9A 1UXCA 1UTXA 1UXDA 3F6WA 1BDHA 1XWRA 2CROA 3BD1A 1DWKA 2PUFA 3KXAA 4YBAA 2XIUA 3F52A 4NDWA 2KEIA 2LYSA 2AXVA 2MEZA 2WUSR 1PRVA 1GT0C 4OB4A 3G5GA 2CSFA 4Z5CA 2AXZA 2BJCA 2JVLA 1Y7YA 3OQMA 1NERA 3QYXA 2XJ3A 1JFSA 1ZZ6A 1SQ8A 4X4GA 1JWLA 2KEJA 1AU7A 2EWTA 2IV1A 3OP9A 2GZUA 1IC8A 2IU7A 3CLCA 2ICPA 4JCYA 3R1FA 1RPEL 4PU4C 4Z58A 1S7EA 3OQNA 3OMTA 1OSLA 1POUA 4FBIA 2IVGA 2PUAA 1WH6A 3CROL 2PUBA 2MQKA 1BDIA 2B5AA 2L8NA 4YG4A 1WIZA 1X57A 1RZSA 2ICTA 3FMYA 1OCTC 2LYQA 2BNMA 2IVBA 3MLFA 2XSDC 2PUEA 1LCCA 1LCDA 3KJXA 3G7DA 3GN5A 1R63A 3JXDL 3DNVB 2XCJA 3HZIB 1NEQA 2A6CA 2R1JL 1RZRA 3U3WA 1QP0A 4GQMA 4MCTA 2IVQA 4O8BA 5K98B 1L1MA 2LYKA 4I6TA 4X4BA 1EFAA 2H8RA 3QQ6A 1ZAYA 2IUOA 4Z5DA 1ZZ7A 2O38A 4X4DA 4X4CA 3ZHMA 2WIUB 4J1XA 3ZHIA 2EF8A 1LLIA 1E3OC 1PNRA 4JCXA 2HSGA 4IWRA 4Y42A 2LYPA 2O49A 1WH8A 2BNOA 2O4AA 1B0NA 1R69A 1ZZBA 2LCVA 1LMB3 3JXCL 1QPZA 4X4EA 2AW6A 1QP7A 1QQAA 4PU3C 2KPJA 3ZKCA 3O9XA 1ZS4A 4IA8A 1WETA 2PUCA 2AXUA 3TRBA 2PUDA 1PRUA 4YG7B 3L1PA 4X4FA 1CJGA 2EBYA 2PE5A 3H5TA 4MCXA 3S8QA 2PPXA 3FYAA 2LYRA 1ZZCA 3CECA 3EUSA 3IVPA 3OQOA 3KZ3A 3GBFA 2HINA 4YARA 4X4IA 3BDNA 1PERL 2KEKA 1ZVVA 3D1NI 2AUWA 2LYJA 4JQDA 2OFYA 1ZPQA 2L49A 3RZZA 1JFTA 3JXBC 1X2LA 4PU7A 3GN5B 2GRMA 1RIOA 1DW9A 1PRAA 2PUGA 4Z5HA 3PXPA 2R63A 4Z59A 4I6RA 3BS3A 3FYMA 3VK0A 3F51A 4I8TA 2JCGA 1VPWA 2GRLA 4FN3A 2AWIA 5A7LA 1YSEA 2LYLA 2XI8A 3SCHA 2OR1L 4J1WA 1LQCA 1ZUGA 1QQBA 4PU8A 3B7HA 1ZZ8A
chains in the Genus database with same CATH superfamily
2D5VA 5JUWA 2BNNA 4F8DA 4IVZA 3QWGA 3SCFA 1Y9QA 4YG1A 1ZZ9A 1BDHA 2CROA 3BD1A 3QFIA 5GAGi 2XIUA 3NDBB 2KEIA 2LYSA 2WUSR 4Z5CA 2BJCA 2JVLA 1Y7YA 2XJ3A 4X4GA 1JWLA 2IV1A 3CLCA 2GZUA 3R1FA 1S7EA 3OMTA 1OSLA 2PUAA 3QOXA 5DSXA 2PUBA 5DTRA 2L8NA 1OCTC 2IVBA 4ER3A 3PE5A 3U3WA 4GQMA 1L1MA 5K98B 4X4BA 3DM5A 3ZHIA 4J1XA 2LYPA 2O4AA 1ZZBA 1QPZA 1QP7A 4ER6A 5DRYA 3A9XA 1PRUA 4YG7B 2PE5A 3H5TA 3S8QA 2PXFA 1ZZCA 2JQEA 3CECA 3IVPA 3M9LA 4ER5A 3GBFA 5DRTA 4EQZA 1PERL 2OFYA 2L49A 1JFTA 1X2LA 1RIOA 1DW9A 4DE9A 2R63A 4I6RA 3VK0A 2JCGA 3ME5A 2LYLA 2M4HA 1ZUGA 4PU8A 1ZZ8A 2YBDA 1RZRD 2PXEA 2FJRA 1JH9A 1QP4A 2KZ8A 1CQTA 3LISA 3TFLA 2HCNA 1XWRA 4ER7A 1DWKA 3KXAA 3F52A 2MEZA 1GT0C 4OB4A 3G5GA 1JFSA 2VEOA 2KEJA 3OP9A 4FBIA 3CROL 2XXPA 3UWPA 2B5AA 1WIZA 2ICTA 3FMYA 2PXLA 1DULA 2L1PA 3G7DA 3A9ZA 4MCTA 1EFAA 2H8RA 1ZAYA 2IUOA 2PXBA 2O38A 4X4CA 2WIUB 4EZIA 1PNRA 4JCXA 5GAHi 2LNMA 4Y42A 1WH8A 4Q2JA 2J7UA 1B0NA 1LMB3 2LLWA 3ZKCA 3O9XA 4IA8A 4DE8A 1WETA 3TRBA 2PUDA 4MCXA 2PPXA 2LYRA 3GZDC 2HINA 4X4IA 3BDNA 2V3CC 1ZVVA 2AUWA 2HFZA 3TEPA 4ER0A 2J7WA 3JXBC 4PU7A 2GRMA 5DTQA 3BS3A 4I8TA 3SCHA 2OR1L 1LQCA 1QQBA 3B7HA 3SCGA 3QF3A 2PIJA 3LFPA 1O4XA 1HF0A 3NZLA 1UXDA 2PUFA 2HCSA 2LLVA 1PRVA 2AXZA 3SX0A 3QYXA 1ZZ6A 1IC8A 2IU7A 1RPEL 4PU4C 3OQNA 2IVGA 1BDIA 2BNMA 4WVLA 2XSDC 1LCCA 1LCDA 3KJXA 3JXDL 1R63A 3DNVB 2XCJA 1U2ZA 3HZIB 1NEQA 1QP0A 3ZPXA 3OWQA 2IVQA 2LYKA 4I6TA 3QQ6A 1ZZ7A 3ZHMA 4EK9A 1LLIA 3VWSA 1E3OC 4IWRA 2O49A 2BNOA 2LCVA 1R69A 1QQAA 1HQ1A 2PUCA 2AXUA 2MXDA 3QOWA 4X4FA 3FYAA 3EUSA 2PXTA 4YARA 2FFHA 5DTMA 3G0TA 3R09A 3RZZA 2PXQA 1NW3A 4EKIA 4Z5HA 3PXPA 3MEJA 3F51A 2ODRD 4FN3A 2AWIA 5A7LA 2XI8A 2XXQA 4J1WA 3A9YA 2KEKA 1ADRA 3TELA 4I6UA 3UFDA 4GHJA 4X4HA 1UXCA 2PXPA 1MFQC 1UTXA 3F6WA 3GZCA 4YBAA 4NDWA 3GUUA 3OKZA 2AXVA 2PXVA 2CSFA 3OQMA 1NERA 3GZDA 1SQ8A 1AU7A 2EWTA 4EKGA 2ICPA 4JCYA 4HRAA 4Z58A 1POUA 1WH6A 2MQKA 4YG4A 1X57A 1RZSA 2XXAA 2LYQA 3MLFA 2PUEA 3NROA 3GN5A 1RZRA 2A6CA 2R1JL 4O8BA 4Z5DA 2PXDA 4X4DA 2EF8A 2HSGA 3NXHA 3JXCL 4X4EA 2AW6A 4PU3C 2KPJA 1ZS4A 5DT2A 3L1PA 1CJGA 2EBYA 2PXUA 3OQOA 2PXKA 1QZXA 3KL4A 3KZ3A 1QB2A 3D1NI 2LYJA 4JQDA 1ZPQA 3GN5B 1PRAA 2PUGA 3SR4A 4Z59A 3FYMA 1VPWA 2GRLA 4OBMA 1YSEA 3LQXA
chains in the Genus database with same CATH topology
3SCGA 1RZRD 3QF3A 2D5VA 1ADRA 2FJRA 2BNNA 2PIJA 3LFPA 4I6UA 3UFDA 1JH9A 1QP4A 4F8DA 4IVZA 3QWGA 4GHJA 2KZ8A 3SCFA 1O4XA 1CQTA 3LISA 1HF0A 1Y9QA 4YG1A 4X4HA 1ZZ9A 1UXCA 1UTXA 1UXDA 3F6WA 1BDHA 1XWRA 2CROA 3BD1A 1DWKA 2PUFA 3KXAA 4YBAA 2XIUA 3F52A 4NDWA 2KEIA 2LYSA 2AXVA 2MEZA 2WUSR 1PRVA 1GT0C 4OB4A 3G5GA 2CSFA 4Z5CA 2AXZA 2BJCA 2JVLA 1Y7YA 3OQMA 1NERA 3QYXA 2XJ3A 1JFSA 1ZZ6A 1SQ8A 4X4GA 1JWLA 2KEJA 1AU7A 2EWTA 2IV1A 3OP9A 2GZUA 1IC8A 2IU7A 3CLCA 2ICPA 4JCYA 3R1FA 1RPEL 4PU4C 4Z58A 1S7EA 3OQNA 3OMTA 1OSLA 1POUA 4FBIA 2IVGA 2PUAA 1WH6A 3CROL 2PUBA 2MQKA 1BDIA 2B5AA 2L8NA 4YG4A 1WIZA 1X57A 1RZSA 2ICTA 3FMYA 1OCTC 2LYQA 2BNMA 2IVBA 3MLFA 2XSDC 2PUEA 1LCCA 1LCDA 3KJXA 3G7DA 3GN5A 1R63A 3JXDL 3DNVB 2XCJA 3HZIB 1NEQA 2A6CA 2R1JL 1RZRA 3U3WA 1QP0A 4GQMA 4MCTA 2IVQA 4O8BA 5K98B 1L1MA 2LYKA 4I6TA 4X4BA 1EFAA 2H8RA 3QQ6A 1ZAYA 2IUOA 4Z5DA 1ZZ7A 2O38A 4X4DA 4X4CA 3ZHMA 2WIUB 4J1XA 3ZHIA 2EF8A 1LLIA 1E3OC 1PNRA 4JCXA 2HSGA 4IWRA 4Y42A 2LYPA 2O49A 1WH8A 2BNOA 2O4AA 1B0NA 1R69A 1ZZBA 2LCVA 1LMB3 3JXCL 1QPZA 4X4EA 2AW6A 1QP7A 1QQAA 4PU3C 2KPJA 3ZKCA 3O9XA 1ZS4A 4IA8A 1WETA 2PUCA 2AXUA 3TRBA 2PUDA 1PRUA 4YG7B 3L1PA 4X4FA 1CJGA 2EBYA 2PE5A 3H5TA 4MCXA 3S8QA 2PPXA 3FYAA 2LYRA 1ZZCA 3CECA 3EUSA 3IVPA 3OQOA 3KZ3A 3GBFA 2HINA 4YARA 4X4IA 3BDNA 1PERL 2KEKA 1ZVVA 3D1NI 2AUWA 2LYJA 4JQDA 2OFYA 1ZPQA 2L49A 3RZZA 1JFTA 3JXBC 1X2LA 4PU7A 3GN5B 2GRMA 1RIOA 1DW9A 1PRAA 2PUGA 4Z5HA 3PXPA 2R63A 4Z59A 4I6RA 3BS3A 3FYMA 3VK0A 3F51A 4I8TA 2JCGA 1VPWA 2GRLA 4FN3A 2AWIA 5A7LA 1YSEA 2LYLA 2XI8A 3SCHA 2OR1L 4J1WA 1LQCA 1ZUGA 1QQBA 4PU8A 3B7HA 1ZZ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SCG A;  1RZR D;  3QF3 A;  2D5V A;  1ADR A;  2FJR A;  2BNN A;  2PIJ A;  3LFP A;  4I6U A;  3UFD A;  1JH9 A;  1QP4 A;  4F8D A;  4IVZ A;  3QWG A;  4GHJ A;  2KZ8 A;  3SCF A;  1O4X A;  1CQT A;  3LIS A;  1HF0 A;  1Y9Q A;  4YG1 A;  4X4H A;  1ZZ9 A;  1UXC A;  1UTX A;  1UXD A;  3F6W A;  1BDH A;  1XWR A;  2CRO A;  3BD1 A;  1DWK A;  2PUF A;  3KXA A;  4YBA A;  2XIU A;  3F52 A;  4NDW A;  2KEI A;  2LYS A;  2AXV A;  2MEZ A;  2WUS R;  1PRV A;  1GT0 C;  4OB4 A;  3G5G A;  2CSF A;  4Z5C A;  2AXZ A;  2BJC A;  2JVL A;  1Y7Y A;  3OQM A;  1NER A;  3QYX A;  2XJ3 A;  1JFS A;  1ZZ6 A;  1SQ8 A;  4X4G A;  1JWL A;  2KEJ A;  1AU7 A;  2EWT A;  2IV1 A;  3OP9 A;  2GZU A;  1IC8 A;  2IU7 A;  3CLC A;  2ICP A;  4JCY A;  3R1F A;  1RPE L;  4PU4 C;  4Z58 A;  1S7E A;  3OQN A;  3OMT A;  1OSL A;  1POU A;  4FBI A;  2IVG A;  2PUA A;  1WH6 A;  3CRO L;  2PUB A;  2MQK A;  1BDI A;  2B5A A;  2L8N A;  4YG4 A;  1WIZ A;  1X57 A;  1RZS A;  2ICT A;  3FMY A;  1OCT C;  2LYQ A;  2BNM A;  2IVB A;  3MLF A;  2XSD C;  2PUE A;  1LCC A;  1LCD A;  3KJX A;  3G7D A;  3GN5 A;  1R63 A;  3JXD L;  3DNV B;  2XCJ A;  3HZI B;  1NEQ A;  2A6C A;  2R1J L;  1RZR A;  3U3W A;  1QP0 A;  4GQM A;  4MCT A;  2IVQ A;  4O8B A;  5K98 B;  1L1M A;  2LYK A;  4I6T A;  4X4B A;  1EFA A;  2H8R A;  3QQ6 A;  1ZAY A;  2IUO A;  4Z5D A;  1ZZ7 A;  2O38 A;  4X4D A;  4X4C A;  3ZHM A;  2WIU B;  4J1X A;  3ZHI A;  2EF8 A;  1LLI A;  1E3O C;  1PNR A;  4JCX A;  2HSG A;  4IWR A;  4Y42 A;  2LYP A;  2O49 A;  1WH8 A;  2BNO A;  2O4A A;  1B0N A;  1R69 A;  1ZZB A;  2LCV A;  1LMB 3;  3JXC L;  1QPZ A;  4X4E A;  2AW6 A;  1QP7 A;  1QQA A;  4PU3 C;  2KPJ A;  3ZKC A;  3O9X A;  1ZS4 A;  4IA8 A;  1WET A;  2PUC A;  2AXU A;  3TRB A;  2PUD A;  1PRU A;  4YG7 B;  3L1P A;  4X4F A;  1CJG A;  2EBY A;  2PE5 A;  3H5T A;  4MCX A;  3S8Q A;  2PPX A;  3FYA A;  2LYR A;  1ZZC A;  3CEC A;  3EUS A;  3IVP A;  3OQO A;  3KZ3 A;  3GBF A;  2HIN A;  4YAR A;  4X4I A;  3BDN A;  1PER L;  2KEK A;  1ZVV A;  3D1N I;  2AUW A;  2LYJ A;  4JQD A;  2OFY A;  1ZPQ A;  2L49 A;  3RZZ A;  1JFT A;  3JXB C;  1X2L A;  4PU7 A;  3GN5 B;  2GRM A;  1RIO A;  1DW9 A;  1PRA A;  2PUG A;  4Z5H A;  3PXP A;  2R63 A;  4Z59 A;  4I6R A;  3BS3 A;  3FYM A;  3VK0 A;  3F51 A;  4I8T A;  2JCG A;  1VPW A;  2GRL A;  4FN3 A;  2AWI A;  5A7L A;  1YSE A;  2LYL A;  2XI8 A;  3SCH A;  2OR1 L;  4J1W A;  1LQC A;  1ZUG A;  1QQB A;  4PU8 A;  3B7H A;  1ZZ8 A; 
#chains in the Genus database with same CATH topology
 2D5V A;  5JUW A;  2BNN A;  4F8D A;  4IVZ A;  3QWG A;  3SCF A;  1Y9Q A;  4YG1 A;  1ZZ9 A;  1BDH A;  2CRO A;  3BD1 A;  3QFI A;  5GAG i;  2XIU A;  3NDB B;  2KEI A;  2LYS A;  2WUS R;  4Z5C A;  2BJC A;  2JVL A;  1Y7Y A;  2XJ3 A;  4X4G A;  1JWL A;  2IV1 A;  3CLC A;  2GZU A;  3R1F A;  1S7E A;  3OMT A;  1OSL A;  2PUA A;  3QOX A;  5DSX A;  2PUB A;  5DTR A;  2L8N A;  1OCT C;  2IVB A;  4ER3 A;  3PE5 A;  3U3W A;  4GQM A;  1L1M A;  5K98 B;  4X4B A;  3DM5 A;  3ZHI A;  4J1X A;  2LYP A;  2O4A A;  1ZZB A;  1QPZ A;  1QP7 A;  4ER6 A;  5DRY A;  3A9X A;  1PRU A;  4YG7 B;  2PE5 A;  3H5T A;  3S8Q A;  2PXF A;  1ZZC A;  2JQE A;  3CEC A;  3IVP A;  3M9L A;  4ER5 A;  3GBF A;  5DRT A;  4EQZ A;  1PER L;  2OFY A;  2L49 A;  1JFT A;  1X2L A;  1RIO A;  1DW9 A;  4DE9 A;  2R63 A;  4I6R A;  3VK0 A;  2JCG A;  3ME5 A;  2LYL A;  2M4H A;  1ZUG A;  4PU8 A;  1ZZ8 A;  2YBD A;  1RZR D;  2PXE A;  2FJR A;  1JH9 A;  1QP4 A;  2KZ8 A;  1CQT A;  3LIS A;  3TFL A;  2HCN A;  1XWR A;  4ER7 A;  1DWK A;  3KXA A;  3F52 A;  2MEZ A;  1GT0 C;  4OB4 A;  3G5G A;  1JFS A;  2VEO A;  2KEJ A;  3OP9 A;  4FBI A;  3CRO L;  2XXP A;  3UWP A;  2B5A A;  1WIZ A;  2ICT A;  3FMY A;  2PXL A;  1DUL A;  2L1P A;  3G7D A;  3A9Z A;  4MCT A;  1EFA A;  2H8R A;  1ZAY A;  2IUO A;  2PXB A;  2O38 A;  4X4C A;  2WIU B;  4EZI A;  1PNR A;  4JCX A;  5GAH i;  2LNM A;  4Y42 A;  1WH8 A;  4Q2J A;  2J7U A;  1B0N A;  1LMB 3;  2LLW A;  3ZKC A;  3O9X A;  4IA8 A;  4DE8 A;  1WET A;  3TRB A;  2PUD A;  4MCX A;  2PPX A;  2LYR A;  3GZD C;  2HIN A;  4X4I A;  3BDN A;  2V3C C;  1ZVV A;  2AUW A;  2HFZ A;  3TEP A;  4ER0 A;  2J7W A;  3JXB C;  4PU7 A;  2GRM A;  5DTQ A;  3BS3 A;  4I8T A;  3SCH A;  2OR1 L;  1LQC A;  1QQB A;  3B7H A;  3SCG A;  3QF3 A;  2PIJ A;  3LFP A;  1O4X A;  1HF0 A;  3NZL A;  1UXD A;  2PUF A;  2HCS A;  2LLV A;  1PRV A;  2AXZ A;  3SX0 A;  3QYX A;  1ZZ6 A;  1IC8 A;  2IU7 A;  1RPE L;  4PU4 C;  3OQN A;  2IVG A;  1BDI A;  2BNM A;  4WVL A;  2XSD C;  1LCC A;  1LCD A;  3KJX A;  3JXD L;  1R63 A;  3DNV B;  2XCJ A;  1U2Z A;  3HZI B;  1NEQ A;  1QP0 A;  3ZPX A;  3OWQ A;  2IVQ A;  2LYK A;  4I6T A;  3QQ6 A;  1ZZ7 A;  3ZHM A;  4EK9 A;  1LLI A;  3VWS A;  1E3O C;  4IWR A;  2O49 A;  2BNO A;  2LCV A;  1R69 A;  1QQA A;  1HQ1 A;  2PUC A;  2AXU A;  2MXD A;  3QOW A;  4X4F A;  3FYA A;  3EUS A;  2PXT A;  4YAR A;  2FFH A;  5DTM A;  3G0T A;  3R09 A;  3RZZ A;  2PXQ A;  1NW3 A;  4EKI A;  4Z5H A;  3PXP A;  3MEJ A;  3F51 A;  2ODR D;  4FN3 A;  2AWI A;  5A7L A;  2XI8 A;  2XXQ A;  4J1W A;  3A9Y A;  2KEK A;  1ADR A;  3TEL A;  4I6U A;  3UFD A;  4GHJ A;  4X4H A;  1UXC A;  2PXP A;  1MFQ C;  1UTX A;  3F6W A;  3GZC A;  4YBA A;  4NDW A;  3GUU A;  3OKZ A;  2AXV A;  2PXV A;  2CSF A;  3OQM A;  1NER A;  3GZD A;  1SQ8 A;  1AU7 A;  2EWT A;  4EKG A;  2ICP A;  4JCY A;  4HRA A;  4Z58 A;  1POU A;  1WH6 A;  2MQK A;  4YG4 A;  1X57 A;  1RZS A;  2XXA A;  2LYQ A;  3MLF A;  2PUE A;  3NRO A;  3GN5 A;  1RZR A;  2A6C A;  2R1J L;  4O8B A;  4Z5D A;  2PXD A;  4X4D A;  2EF8 A;  2HSG A;  3NXH A;  3JXC L;  4X4E A;  2AW6 A;  4PU3 C;  2KPJ A;  1ZS4 A;  5DT2 A;  3L1P A;  1CJG A;  2EBY A;  2PXU A;  3OQO A;  2PXK A;  1QZX A;  3KL4 A;  3KZ3 A;  1QB2 A;  3D1N I;  2LYJ A;  4JQD A;  1ZPQ A;  3GN5 B;  1PRA A;  2PUG A;  3SR4 A;  4Z59 A;  3FYM A;  1VPW A;  2GRL A;  4OBM A;  1YSE A;  3LQX A; 
#chains in the Genus database with same CATH homology
 3SCG A;  1RZR D;  3QF3 A;  2D5V A;  1ADR A;  2FJR A;  2BNN A;  2PIJ A;  3LFP A;  4I6U A;  3UFD A;  1JH9 A;  1QP4 A;  4F8D A;  4IVZ A;  3QWG A;  4GHJ A;  2KZ8 A;  3SCF A;  1O4X A;  1CQT A;  3LIS A;  1HF0 A;  1Y9Q A;  4YG1 A;  4X4H A;  1ZZ9 A;  1UXC A;  1UTX A;  1UXD A;  3F6W A;  1BDH A;  1XWR A;  2CRO A;  3BD1 A;  1DWK A;  2PUF A;  3KXA A;  4YBA A;  2XIU A;  3F52 A;  4NDW A;  2KEI A;  2LYS A;  2AXV A;  2MEZ A;  2WUS R;  1PRV A;  1GT0 C;  4OB4 A;  3G5G A;  2CSF A;  4Z5C A;  2AXZ A;  2BJC A;  2JVL A;  1Y7Y A;  3OQM A;  1NER A;  3QYX A;  2XJ3 A;  1JFS A;  1ZZ6 A;  1SQ8 A;  4X4G A;  1JWL A;  2KEJ A;  1AU7 A;  2EWT A;  2IV1 A;  3OP9 A;  2GZU A;  1IC8 A;  2IU7 A;  3CLC A;  2ICP A;  4JCY A;  3R1F A;  1RPE L;  4PU4 C;  4Z58 A;  1S7E A;  3OQN A;  3OMT A;  1OSL A;  1POU A;  4FBI A;  2IVG A;  2PUA A;  1WH6 A;  3CRO L;  2PUB A;  2MQK A;  1BDI A;  2B5A A;  2L8N A;  4YG4 A;  1WIZ A;  1X57 A;  1RZS A;  2ICT A;  3FMY A;  1OCT C;  2LYQ A;  2BNM A;  2IVB A;  3MLF A;  2XSD C;  2PUE A;  1LCC A;  1LCD A;  3KJX A;  3G7D A;  3GN5 A;  1R63 A;  3JXD L;  3DNV B;  2XCJ A;  3HZI B;  1NEQ A;  2A6C A;  2R1J L;  1RZR A;  3U3W A;  1QP0 A;  4GQM A;  4MCT A;  2IVQ A;  4O8B A;  5K98 B;  1L1M A;  2LYK A;  4I6T A;  4X4B A;  1EFA A;  2H8R A;  3QQ6 A;  1ZAY A;  2IUO A;  4Z5D A;  1ZZ7 A;  2O38 A;  4X4D A;  4X4C A;  3ZHM A;  2WIU B;  4J1X A;  3ZHI A;  2EF8 A;  1LLI A;  1E3O C;  1PNR A;  4JCX A;  2HSG A;  4IWR A;  4Y42 A;  2LYP A;  2O49 A;  1WH8 A;  2BNO A;  2O4A A;  1B0N A;  1R69 A;  1ZZB A;  2LCV A;  1LMB 3;  3JXC L;  1QPZ A;  4X4E A;  2AW6 A;  1QP7 A;  1QQA A;  4PU3 C;  2KPJ A;  3ZKC A;  3O9X A;  1ZS4 A;  4IA8 A;  1WET A;  2PUC A;  2AXU A;  3TRB A;  2PUD A;  1PRU A;  4YG7 B;  3L1P A;  4X4F A;  1CJG A;  2EBY A;  2PE5 A;  3H5T A;  4MCX A;  3S8Q A;  2PPX A;  3FYA A;  2LYR A;  1ZZC A;  3CEC A;  3EUS A;  3IVP A;  3OQO A;  3KZ3 A;  3GBF A;  2HIN A;  4YAR A;  4X4I A;  3BDN A;  1PER L;  2KEK A;  1ZVV A;  3D1N I;  2AUW A;  2LYJ A;  4JQD A;  2OFY A;  1ZPQ A;  2L49 A;  3RZZ A;  1JFT A;  3JXB C;  1X2L A;  4PU7 A;  3GN5 B;  2GRM A;  1RIO A;  1DW9 A;  1PRA A;  2PUG A;  4Z5H A;  3PXP A;  2R63 A;  4Z59 A;  4I6R A;  3BS3 A;  3FYM A;  3VK0 A;  3F51 A;  4I8T A;  2JCG A;  1VPW A;  2GRL A;  4FN3 A;  2AWI A;  5A7L A;  1YSE A;  2LYL A;  2XI8 A;  3SCH A;  2OR1 L;  4J1W A;  1LQC A;  1ZUG A;  1QQB A;  4PU8 A;  3B7H A;  1ZZ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...