1PNRA

Purine repressor-hypoxanthine-purf-operator complex
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
338
structure length
338
Chain Sequence
TIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAAYFAEIIEAVEKNCFQKGYTLILGNAWNNLEKQRAYLSMMAQKRVDGLLVMCSEYPEPLLAMLEEYRHIPMVVMDWGEAKADFTDAVIDNAFEGGYMAGRYLIERGHREIGVIPGPLERNTGAGRLAGFMKAMEEAMIKVPESWIVQGDFEPESGYRAMQQILSQPHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEVHPRLIERRSVADGPFRDYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords DNA (5'-D(*AP*AP*CP*GP*AP*AP*AP*AP*CP*GP*TP*TP*TP*TP*CP*GP*T
publication title Crystal structure of LacI member, PurR, bound to DNA: minor groove binding by alpha helices.
pubmed rcsb
total genus 118
structure length 338
sequence length 338
ec nomenclature
pdb deposition date 1995-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00356 LacI Bacterial regulatory proteins, lacI family
A PF13377 Peripla_BP_3 Periplasmic binding protein-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 1pnrA01
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1pnrA03
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1pnrA02
3NHZA 1A0OA 3QLVA 3LUGA 2MYUA 3S8QA 5IUKC 4TLLB 3KJXA 2R1JL 4G0MA 1LQCA 3H1FA 2FKAA 1LBIA 1R69A 1D4ZA 3B7HA 2FEPA 2ICPA 4GNRA 1D1PA 4KQ9A 4F8DA 3A3KA 3QEKA 1NXTA 5FBHA 3KLOA 3L1PA 4RK6A 3T38A 2TMYA 4QPJC 3RVLA 4ZJPA 2EWTA 1FFWA 2VUIB 4EY3A 2LYLA 1MVOA 4KFCA 2NT3A 1Z12A 1UDRA 4PICA 3TX6A 2KEIA 1QP7A 4XFKA 3GA5A 4RK7A 3FYMA 1IC8A 3OP9A 1URPA 4RY8A 2E4XA 1U2PA 2JVIA 1OSLA 4YLEA 2FSPA 3QK7A 3N0RA 3CTPA 3LUHA 3LUFA 1IIBA 2IPLA 2Q5CA 3IP5A 4KZKA 4ETIA 3F73A 5TQ0B 1KRXA 2GKGA 1L5ZA 2NZVG 3HZIB 5DLEA 1NTRA 1DRKA 4HNRA 4RZSA 3LISA 3O2QB 3OMWA 5DTEA 1ABEA 2LUOA 2BGGA 2X7XA 1E6MA 3QWGA 1MB0A 1NXOA 2PUAA 3C6QA 4YRZA 4MQEB 3C3KA 4FE7A 3EDCA 3URMA 4TMYA 2OR1L 3HV2A 1UTXA 3JPWA 4PYRA 3RZZA 4WWHA 2WRZA 3LUKA 1ZUGA 4RS3A 1J56A 3QELB 4GHJA 5CHYA 3Q9SA 3JXCL 4O8BA 4MYRA 4NQRA 4JP1A 6ABPA 4X4HA 1I3CA 4MCXA 4OBBA 5T7BA 1E2BA 2HPHA 3CZ5A 3SM9A 2LBPA 3EULA 5GOTA 5TE9A 5K98B 3QEMA 1HEYA 2LIVA 2ICTA 4EVRA 3QLUC 1NEQA 1SXGA 3L6UA 3LKBA 4S04A 1ZY2A 2H3HA 3B2NA 2QR3A 4UHJA 3T95A 3QLTA 3D02A 1ZHHA 3HZHA 1PNTA 3QYXA 4F8JA 5IEJA 4Z4FA 2YHBA 1LCCA 2AXVA 3OO0A 3NBMA 2MYTA 4MGEA 3SNKA 5JS2A 4D74A 5FWXA 5DKFA 4KK4A 4JQDA 3GRCA 3IDOA 2L49A 4RU1A 4O1HA 3CZCA 3IP6A 3JPYA 5ABPA 4O1IA 3TRBA 2ID7A 2JRLA 3QQ6A 3F7NA 3I09A 1XWRA 3LUJA 3RVRA 4CBVA 2PL9A 1FFSA 2PUGA 1ZH2A 3ZHMA 1Z2EA 3QX8A 4XLTA 2LYSA 2LPMA 3I42A 3HEBA 4YG7B 3KKEA 3N0XA 1EFAA 5PNTA 3N8IA 4Z5HA 2BNOA 4DQDA 3DNVB 3EQ2A 3RQIA 4PU8A 1X57A 2MEZA 1TMYA 2FW0A 2IV1A 4ML3A 4QYMA 5IBQA 3RVKA 5JNUA 3HCWA 5KQMA 1RPEL 1YMVA 2MQKA 2R63A 2FLWA 3H5IA 4O5AA 1DBPA 2O49A 3H1GA 4NDWA 1DCMA 3S99A 2P4UA 4S05A 2MYNA 3RVQA 4RY9A 2HINA 1Z2DA 5TPWB 1UXCA 9ABPA 1DW9A 2E4WA 2PIJA 1LJLA 5KQGA 2FEKA 4RSMA 1VLZA 3H75A 2AWIA 4RK1A 3Q15C 3VNAA 4LX8A 1POUA 3U3WA 1QPZA 1Z25A 1NXVA 1VRVA 3OLVA 3QLVC 3OQMA 1R63A 4FBIA 2GI4A 1NERA 4WUTA 4MR9A 3ROTA 4KMRA 4IMIB 4MS3A 1Y7YA 3CU5A 2GBPA 2ID9A 2JBAA 3DZDA 4KQCA 1JDNA 2KEKA 3BREA 4HYEA 1ZESA 4RK4A 3A0UA 3IVPA 4MS4A 4W5RA 4X4CA 3D1NI 2OENG 3W9SA 3C3WA 1QP4A 1JL3A 3ILYA 4ZPJA 2IYNA 2ZWMA 3FGZA 5BR1A 3HS3A 2PUBA 2WUSR 4Z58A 1NXPA 1RPJA 3LOPA 1ZZ7A 5CNIA 3FFXA 4E7OA 4Z5CA 4MR9B 1QQBA 4MS3B 4MR8B 2FMHA 1GUDA 4X4DA 3P9YA 4JAVC 3G1WA 1HF0A 1YVUA 4RXUA 3FMVA 3Q41A 5CNJA 2J48A 3BDNA 1TVMA 2EF8A 2GX6A 3JY6A 3LUDA 3OM0A 5IC5A 3SY8A 5KC8A 1GCAA 3DBIA 3GBFA 3BBLA 4MS1B 4F06A 4RKQA 4G97A 3MM4A 4EYGA 3OLWA 3MA0A 5TQ2A 1DZ3A 1OXKB 4Z4CA 1S7EA 2RDMA 5BRJA 1ZS4A 3RVMA 2LYKA 2O4AA 3KYJB 2CHEA 4UHKA 1EWVA 1VPWA 1NXWA 5I4CA 4YWHA 3IPCA 5EWJA 5TQ0A 4EVSA 4Q6BA 1X2LA 1F4VA 2FMFA 4F11A 3GT7A 4DN6A 3JVIA 3SCGA 4LE1A 1UXDA 5TQ2B 3FFTA 2LP4Y 2GRLA 1W25A 4RKRA 2BNNA 3TO5A 4HNSA 1WH8A 5FBKA 4N0QA 4J1WA 4MQEA 4RK5A 2O38A 4PU7A 1RZRA 3QX9A 1PRUA 3HM9A 4H3KB 2XJ3A 1JFVA 3F6CA 3O2SB 2VUHB 5EWJB 1FSPA 3HUTA 5KWSA 1Z15A 1MIHA 2JB9A 4KREA 1LCDA 1JFSA 4RY0A 1K66A 2FQWA 3MF4A 3QELA 3HSYA 3TMYA 5JS1A 4WXMA 5JNRA 2F8SA 5IULC 4EYQA 4RK0A 1YK1A 4G0YA 4LDAA 3H5OA 2KYRA 2LYJA 1DG9A 1JX6A 2NZUG 1PEYA 4H3HB 4MLCA 5IUJC 4PE5B 4X4GA 2FEWB 1DCKA 1ABFA 2AYZA 5KC9A 4ZMRA 3HDVA 5JNTA 3UUGA 2XIUA 3OLXA 2DRIA 2WMYA 3CFYA 1D1QA 3KTOA 1ZZ8A 1QO0A 4N76A 2XSDC 4NV3A 4EYKA 1OXBB 3NHMA 4E7PA 3K4HA 4Z4IA 4NCBA 1H9CA 4OLBA 2L18A 2HSGA 4G0QA 3TD9A 1A04A 4H60A 1JBEA 3H1EA 1GLGA 1PHRA 4PZ0A 1KGSA 1USIA 4TLMB 3RVJA 3O1HB 4W5QA 4KNYA 2EBYA 3EUSA 2CWDA 3LMKA 3I5AA 3LKVA 5IX8A 4X4FA 4JCYA 5CNKA 1DRJA 4YP9A 1RNLA 1XHEA 4EVQA 5TQJA 2GZUA 2LYPA 1AB5A 1APBA 5HQJA 4JA2A 3HXMA 1PEAA 1Z16A 1U8TA 2WB4A 3M9WA 4TN5A 3BRSA 4EYOA 5C5EA 2JVLA 1L5YA 3OMTA 5CNMA 3KXAA 5T3YA 3CS3A 4ETNA 2QXYA 1DC7A 2B4AA 1Y9QA 3BS3A 2M1ZA 2H8RA 2FN9A 4G0XA 4IILA 3GN5A 4I6RA 1GT0C 1PERL 1PNRA 3GWGA 1B00A 3Q7RA 4MR7B 3KSMA 1LJUA 2HQOA 5TPWA 3VNBA 2IPMA 3FYAA 1E6LA 4MQFB 3VK0A 2CROA 2PE5A 5E3JA 1USKA 2F8TA 3HVRA 2PMCA 3IPAA 4IRXA 5BRAA 3CLCA 3GV0A 4OLAA 2A9RA 1YS7A 1K68A 3UFDA 3IP7A 2E4VA 4G86A 1RZSA 2IDMA 4MPTA 4YO7A 7ABPA 3CLKA 3FFWA 1XHFA 1ZZ6A 1YMUA 3EAFA 2VYCA 1ZVVA 3GN5B 2RJOA 3CKMA 3LUCA 3Q7TA 4X4EA 4GPAA 3KHTA 1T34A 3UKJA 4EUKA 3NNNA 1QNLA 3MIZA 3F6PA 1Z18A 5HKOA 1BDJA 2FVYA 2QVCA 1SRRA 2OFYA 5C5CA 4QYWA 4L85A 2R25B 1M5TA 2B5AA 1ZZCA 1NY5A 1D2AA 4ZYLA 4LRQA 2GRMA 3QLUA 4YV7A 4W5TA 2PJUA 4RV5A 1U0SY 3H5LA 1ZZ9A 2JVJA 4FN3A 4MR8A 1USGA 3SCHA 2KZ8A 3CROL 2PUCA 1ZN2A 2N9UA 2AXUA 1WETA 3PXPA 3DGEC 4Z59A 3F52A 4IGAA 2A6CA 1JH9A 2RJNA 3GBVA 5BQ3A 4JOQA 1KRWA 4WXEA 1EWKA 4RWEA 3MLFA 4N41A 4M88A 1YTUA 4GQMA 4MS1A 3HJFA 2L17A 3K9CA 1BAPA 1PRVA 4ETMA 1NXXA 1P6QA 4G0ZA 4F12A 4LE0A 4KVFA 2AUWA 2BNMA 4I6UA 2IKSA 4Z4HA 1AB6A 3H6GA 1P8AA 3EODA 4YG1A 2B1JA 4XXHA 4Y9TA 1GUBA 4KV7A 3O74A 2RGYA 2CSFA 1Z26A 2JK1A 1ZGGA 3H5WA 4IF4A 1Y1LA 3ROFA 4YARA 1BDHA 1ZAYA 3BILA 3MQ4A 2V0NA 5TPZA 2LCVA 4N47A 2WWVD 3RVOA 3KCNA 3BRQA 4KK3A 2VK2A 3GYBA 1ISSA 4JB2A 1CJGA 2PLNA 2IVQA 2QSJA 4YBAA 2QW1A 4Z99A 2FJRA 3KLNA 4XAQA 1BVHA 4OATA 1BA2A 2E4YA 1O4XA 3Q7SA 3T6KA 1C0EA 2QU7A 4KRFA 3OMXA 3O1IC 3NNDA 4MRMB 3QF3A 1RXIA 1F51E 3EQZA 1ADRA 4RXMA 3T8YA 1JF8A 1LBHA 2LYRA 2OQRA 5EWLB 2PPXA 4PU3C 3OQNA 1LMB3 2IPNA 4EGSA 2L8NA 3A10A 1U2QA 1QP0A 1KMIY 2HQBA 3SG0A 1SQ8A 1XWWA 3O9XA 4I6TA 1PUXA 3NNSA 5B3JA 1Z17A 4JASB 5A7LA 2FLKA 2FN8A 1QQAA 1JHZA 4YCSA 2AXZA 1RZRD 2E4UA 3M6MD 3E3MA 3O1JC 1ZGZA 2M98A 2PKXA 2WIUB 3KG2A 4Z9BA 3KZ3A 1LLIA 2IU7A 3LFPA 4Z4EA 4NCAA 3OQOA 4RDCA 2PUDA 5KQPA 1ZITA 4W5OA 2XI8A 1DC8A 1RIOA 3KYIB 3HDGA 3LTEA 4X4BA 3JS5A 1JWLA 2I6FA 4IWRA 4XARA 2MSWA 2XDYA 3SAJA 4IMJB 1EAYA 1YS6A 4N03A 1TM2A 1JYEA 5EWMA 4MCTA 4Z0NA 4Z9AA 3EGCA 2QZJA 2L19A 3C3MA 3HO1A 3EJWA 1M2EA 1NXSA 1MAVA 2PUFA 3N53A 1BDIA 1E6KA 2D5VA 5GQSA 1DWKA 1QO0D 1Z13A 4DADA 3F51A 1B0NA 4G0PA 5KI6A 2L2QA 1CYEA 2MSLA 3ILHA 4MLDA 3TB6A 1OCTC 4RXTA 2MYPA 1FFGA 3N0WA 5EWMB 4IVZA 2LYQA 2QVGA 4G0OA 2FMKA 1L1MA 1A2OA 2IOYA 3RVSA 2FMIA 4MR7A 5IUNC 3DLHA 3O75A 1JDPA 3JXBC 5D2CA 4MQFA 2CD7A 1DJMA 1VKRA 3N75A 1D5WA 1TLFA 1U04A 3SCFA 3FMYA 4X4IA 2BJCA 6CHYA 2FTKE 3BD1A 3GL9A 1ZH4A 3OLZA 3H6HA 4QICA 2MSKA 4WT7A 4JCXA 3KS9A 1LK0A 1ZZBA 4PU4C 3I45A 3CG0A 3RVNA 2H0AA 4D6XA 4HNQA 1JLKA 1CQTA 3CRNA 3H5VA 3G85A 3DLBA 4J1XA 1M2FA 3OM1A 2WY2D 4Z5DA 2JVKA 2AW6A 2NUBA 4OTZA 3FDFA 3C97A 2KEJA 2FQXA 2IUOA 2HQRA 3QEMB 4YR7A 5JNSA 2ZAYA 4YGXB 3LUAA 4LE2A 2R48A 1YIOA 3UK0A 3CECA 1ZPQA 1ISRA 1MB3A 1QKKA 2AYXA 2PL1A 3OO1A 2QV0A 2NT4A 2P9HA 4OB4A 5DCLA 4F3TA 5HM6A 1DCFA 3G5GA 4OG2A 4D6YA 3GBPA 5JNWA 3R1FA 2KPJA 1EWTA 1ZDMA 2R4QA 1WH6A 5FWXB 4I8TA 1EHCA 1SXHA 1S8NA 1M5UA 2XCJA 3L49A 4Q7EA 2FXIA 4NICA 5KQLA 4LZLA 1JYFA 2WJWA 4PEVA 4FB4A 4L4UA 3O21A 4P1ZA 1SXIA 3H5TA 1C4WA 2A9OA 1GCGA 4XASA 5DGCA 1DBQA 2IPAB 1AU7A 2PAFA 3E61A 3RH0A 3N6VA 1FQWA 3MMNA 4W5NA 2JCGA 1P2FA 2FQYA 4Y42A 2GWRA 2E4ZA 1DBWA 3RVPA 3OLYA 1RXEA 3CHYA 4FE4A 2W42A 4B09A 3ZHIA 3HK2A 1DP4A 3SQNA 2O20A 1QMPA 3DGFC 5F64A 4MRMA 1CEYA 2YHAA 1JFTA 3IP9A 3R0JA 1YK0A 4Q6WA 5B3JC 4ZMSA 8ABPA 3O2JA 4WZZA 5HSGA 4KPYA 1PRAA 5FWYA 5ED4A 2HJ9A 5EWLA 3G7DA 1P6UA 4IA8A 1SD5A 4MAAA 5TPZD 2PUEA 4N0PA 1R8JA 1E3OC 3HUUA 1W9HA 3CG4A 3JTEA 2A9QA 3JXDL 4P98A 5JNVA 3A0RB 3LFTA 2A9PA 3MYYA 4YG4A 2R47A 1YSEA 3CNBA 4Z4GA 1TJYA 2IVBA 2JBAB 2WJAA 2CHFA 3JVDA 2IVGA 1NATA 3D8UA 3M9XA 1CHNA 5FWYB 1WIZA 4LDZA 4MS4B 4YS6A 3F6WA 4JB0A 5IEBA 3ZKCA
chains in the Genus database with same CATH superfamily
5FUYA 1BU5A 1N6LA 2HCSA 1U2DA 3RRFA 2P6OA 1FP4B 1KO1A 2A9VA 4G1BA 5LKAA 1BRMA 4DV4B 1TUGA 4MI9A 5TX7A 1HM5A 3H1FA 1G1AA 4HDMB 3V4SA 1QORA 3T1TA 2V0GA 3K8OE 2BFNA 4BB6A 4LDJA 3W8FA 3V8QA 3KJNA 1HT2E 1M2HA 2R44A 3MUOA 4MVCA 3ZHTA 2EFDB 1A4UA 3THXB 5JJLA 4QPJC 1NU6A 2AG5A 1ZM4A 5CW2A 3SS7X 4C5BA 2SKDA 1Y9ZA 2BKVA 3G49A 1FFWA 3NM6B 3UA3A 3RAPR 1TT5A 2F1IA 2GDJA 2RHRA 4CRWB 2VBCA 1POXA 2VNKA 1R0ZA 1BW9B 3CO0S 4KGXA 4MQBA 4NDAA 3WZ2A 4RK7A 4BEBA 5KQRA 4MCJA 1GQ2A 2O8BA 1XP5A 1Y6ZA 1U2PA 3N9IA 2QRQA 1WJGA 4L1KA 3G79A 2R5WA 1FX0A 3N0RA 3RYFB 3FFAA 3R3YA 1M1UA 1XVIA 2Q2QA 2IPLA 2I4OA 3C3XA 1NBME 3TS1A 4AZ3B 5JR3A 1FK8A 3DO5A 4HG2A 3FRJA 3SSOA 3NH9A 3G2LA 5ADHA 4XIGS 2C83A 4F9GA 1YA4A 4O4IB 5J59A 2O8EA 4C89A 3PUWA 2AI2A 4UASA 3VR3D 3QRWA 1TU0A 1UMDB 2JIMA 3BIFA 4MQ6A 2J0UA 4BECA 3IR5A 3LX6A 3BWVA 3B7GA 1YRWA 4CIDA 4TLEA 3AYZB 5ESWA 4CNQA 3ECSA 1PWYE 4XPIB 5AW6A 3AF6A 4PSDA 3HV2A 3V8EA 2ZROA 4DV1B 3BZWA 1CCWA 4KH0A 4XYBA 4OHKA 4R3NA 2CZCA 5J2TA 1A5TA 1VJRA 1YR7A 4ND2A 1J9EA 4NJEA 2V7UA 3I4FA 1X7WA 3SYLA 3S1AB 4QUAA 2VHZA 3KJHA 1R0XA 4MO9A 4D8UA 3KZOA 3U1VA 1HEYA 3RYIA 3EXG2 2M6LA 4YEDA 3FNQA 4CEIA 2O8CB 2PJDA 3AI1A 1Q1QA 4NXMB 3B5JA 3D02A 5ITZB 5DYGA 3QYXA 1H2BA 3GPIA 5BXQC 3C4JA 4QOIA 4OSPA 1XXHA 3U31A 2IYYA 3MWFA 3NBMA 2MYTA 5DX1A 3SX4A 1EUCB 4YT8A 5CDTA 2B8NA 2HGZA 4XRRA 3S40A 1GKYA 1DL5A 2HUNA 3I39X 4DOMA 2IITA 3WTCA 1MZVA 4B7XA 2YDXA 1EGHA 2HMVA 1SUDA 2DM6A 4TYWA 1Z6YA 3G5AA 1YR3A 2WP0A 2I1VB 3H1PA 2OBBA 2VO1A 4A8JC 2LYSA 2GZ3A 3MMSA 1IH8A 3AR4A 2XXQA 4XYMA 4OQXA 4R68A 3WHLA 3RWOA 3OT5A 4GUAA 1IRIA 3BCUA 3EXEB 4X20A 1L5HA 3TFWA 1CY1A 1QGZA 3LC2O 4TL6A 4D02A 4CV0A 3KO8A 2CL6X 2JF0A 4JP2A 2AN3A 3ZHOA 3FDIA 3B1JA 1EFLA 1WDMA 3WP0A 4Q1AA 2ZATA 1EMDA 3EA4A 4J2TA 4WZBE 2YW2A 2F9FA 4GGOA 1J21A 3SICE 1KY4A 2XUAA 1B6TA 4QQNA 2E4WA 3N2KB 3B13B 2QTWB 4MUJA 1JU9A 4ND7A 4ZHQB 5I7SA 3J81k 5DM2A 3E9MA 1LLUA 2XXAB 5IFLA 1CJSA 1CERA 3HPQA 4RK1A 2YKGA 4K9DA 3RRXA 2BZSA 5F35A 3OZXA 5HJ5A 2PGNA 4CI9A 1O94D 4JITA 3C87A 3H3FA 3KQWA 5HZKA 1OAOA 1IY2A 4U7PB 2FOXA 1J2YA 1AU9A 4OGWA 3RBVA 1A1SA 4MW4A 3ROXA 5HUHA 2AFHB 2AX3A 4JP8A 3UVEA 2AN9A 4P4TA 3A3OA 5IM4F 2VAPA 1LPSA 3RYHB 2VPWA 1AV6A 5LUBA 3F96A 1OJ7A 3BXPA 4HGPA 2UUCB 4LOHA 2XTZA 3V3TA 3AJ8A 5A4DA 2I22A 2J7PA 1TK9A 4KOAA 4TM8A 3AEUA 2W4IA 3UPUA 1H5NA 5TDHA 5CG2A 1HF0A 1SIOA 2JCYA 3P2YA 4YQZA 4U5QA 2J4CA 3IR6A 1TVMA 1UCFA 4K8RB 4KSBA 3UV7A 5A4IS 3KHSA 5CB4A 4E4TA 1QWSA 1VC2A 3OQ1A 2YYAA 1ZK3A 5KSZA 3MRTA 2IYWA 4N12A 4XIIA 1GAEO 5B7NA 4RZ3A 3PL5A 1T6XA 2P9YA 1EGMB 1YJBA 3ETDA 1GUYA 3P9IA 1GQYA 1XMVA 3M34A 4D26A 1HX7A 3ANSA 3LE8A 4YCDA 1I3MA 3EHEA 5ELLA 1SIBE 3C6KA 2G5GX 5JFTA 1CNFA 2WLSA 1RRVA 2W5UA 3WISA 2PD4A 3CF4A 1V5FA 1CXZA 3GLSA 4Q1BA 1E2FA 3VBEA 2B6NA 1PEKE 4AY3A 2VSYA 1T9KA 1E79D 2QRGA 4I4TF 1EP2B 1HNXB 4B3MB 3FPSA 4LRTB 4AJIA 1U3FA 2IF0A 2GOYA 2EG5A 4RY2A 4RK5A 4B3RB 2R1TA 1KE1A 1GZ6A 2GEJA 1I1NA 4UXHA 5AK5A 2JCSA 4D98A 5H83A 5ICGA 2MU1A 3I28A 2QRMA 1F4LA 4PYKA 5LYJA 3NOOA 4D43A 5KYKA 4QHTA 4IOMA 3GNLA 5BSFA 3DDWA 1XF9A 4LQLA 3SJZA 3WWYA 3QELA 3OESA 1H2HA 2PKYX 4XPZA 2YFYA 4B0OA 5E2BA 1FPQA 4JEMA 1NRJB 1HXHA 3DJYA 3SOZA 4A0HA 3PTAA 4CIBA 3BXGA 1W2HA 2HRCA 5IUJC 3G2NA 2O3RA 2OCBA 5F2KA 4F2GA 1GNSA 1NURA 3O8QB 3T35A 3ASYA 2P0YA 2EFCB 4IQ0A 2D5AA 5JVDA 3OLXA 3TUJC 3OX2A 3W6UA 2PSJA 2QQ0A 3F78A 4GS5A 5G0UA 3NWBA 2OHXA 3MS2A 1X13A 1TO1E 5K4HA 1Y5NA 3ZNPA 2JLZA 1OTXA 5DBHX 2HL6A 2DWOA 2L18A 2PXFA 3EXHC 4GLOA 3H0EA 3ZOZA 3OE7A 3H6KA 4DQ0A 1IXZA 1KGSA 4JI0B 3JU3A 3LA8A 4NOMA 3CRRA 4CMAA 2B21A 1DV1A 5AJHA 3OFVA 2J3QA 1OOEA 5HRCA 2HJHA 4EYSA 2CWDA 2PZJA 3EW7A 4JT2A 4CQMD 2HREA 3SX0A 3V1NA 3EX7C 4X4FA 1FP1D 2CEAA 4UUAA 1S2DA 3UMFA 1XHEA 3FIUA 1VJTA 2GZUA 2ORVA 4LX0A 1PR5A 2H63A 4NBKA 4TTTS 5JYEA 2DXIA 1CEYA 4CM5A 5K0NA 2BEJA 2OKGA 3M82A 3SMVA 2JVLA 3WNQA 3TELA 1LEHA 4RH0A 2BHLA 3I0MA 1DC7A 2F1HA 2QQ5A 2ZG6A 2ZRIA 3KKQA 2M1ZA 3OEWA 4G1CA 4S1OA 2QTGA 3ABIA 4DXHA 1PZFA 4W8GA 4I6RA 2Q4RA 3HBMA 3NBFA 1XL0A 4MJ3A 3ZXIA 2YNMD 3OZTA 5HUQA 3CXRA 1N3YA 3GR6A 4DHEA 5ALPA 1UIMA 3I9MA 1USKA 1T3TA 2EKBA 5C0OE 4BLOA 4CUKA 4DMHA 1W4LA 5H59A 5CEJA 3GLIA 4M87A 3TJMA 3G8AA 3LWBA 4IXNA 2W83A 1DIHA 1Z0SA 1E3IA 2CL0X 1WXDA 4NMWA 2P41A 3RBXA 1HNZB 2ZVPX 4V1CI 5I5EA 5KNCD 1ZM3A 3G89A 3LM8A 1SEVA 2DPHA 4WLUA 4HZUA 1E1LA 3LYAA 4IZHA 4JJ4A 1QDEA 2B1IA 3ZQUA 3L8DA 5C37A 1O2DA 4OI2A 3GFPA 5I7RA 2JCXA 2AUTA 3TNFA 2CMFA 2ACVA 5JYCA 3OZRA 5IAOA 4LAFA 2NQ2C 2GRAA 1FFYA 1KK3A 4M1MA 4CGZA 3HCNA 2XA2A 3DGEC 2FP4B 2GWHA 2ZBUA 5KU1A 2XAAA 1OGJA 2RJNA 3IHLA 4QTZA 1V7ZA 3HCCA 4XKJA 3EWAA 3LW7A 2O7RA 2FN7A 2GBLC 4Y3UA 5IRCD 4NR0A 2CEKA 3K9CA 5CBPA 2F4NA 1J0BA 2E1RA 2HXYA 3DDNA 1JHVA 2B6HA 4CF5A 4TYYA 5FLEX 2ZIXB 3DOJA 1JHYA 1VHWA 3C1AA 3BG5A 2CJXA 3H6GA 5KYVA 2ZQ5A 2ACEA 2X9NA 3Q6MA 1YR6A 4ZTBA 3TZEA 4ENPA 2O57A 2JK1A 1U81A 3PWTA 3IJEB 2WV9A 4TL8A 4ZU3A 3UPDA 4I2NA 3MQ4A 3QWBA 2V0NA 1VKNA 3NRBA 3OH8A 1SURA 3NRCA 3RS8A 1OT5A 3BRQA 4DM4A 1V2HE 1Q1EA 1EBBA 2VAWA 3IAUA 4JGBA 3RANA 1L5RA 2XCOA 1SD2A 4R71A 2RB4A 3G2MA 4TSRA 5DLYA 5JG7A 2IFTA 2P2ZA 4TWZA 3QNUA 3ZWBA 1O5IA 3Q7SA 5B58T 2O5CA 2QU7A 4EJMA 3LY5A 1UFRA 4TZ0A 3EWIA 4X45A 16PKA 1VE9A 4AO6A 1MABB 1E3TA 4PS0A 4A6XA 3GNTA 4LDPA 3QUTA 1MORA 1O6BA 1YZVA 4XB1A 3LQQA 1NI3A 2PPXA 2IUFA 2YFQA 2Z83A 4WX2B 1LMB3 1NQTA 3ZKWA 1ZD1A 1N5DA 1ZYUA 2IC5A 4FHGA 4BLQA 2C57A 3FLMA 4FGZA 4BS9A 1KMIY 3H2BA 4JT8A 2A0KA 4JYZA 2QUAA 3BL8A 4AUKA 1ZK0A 2WM8A 1JJ7A 2RI6A 1JI3A 3F1KA 2P27A 2W2XA 1WXEA 5EQTA 3PCRB 1PDOA 4FI3C 2EOAA 2NLOA 1WD5A 2NQ8A 2GR9A 4G3XA 4YJKA 5F51A 5KNLA 2BFBB 4HO1X 1RJWA 3DFIA 5EUCA 1G7TA 3UUEA 3GVHA 3RODA 3M6MD 4HAWA 5CR9A 1BWPA 2DHRA 4U2GA 4TLDA 2IU7A 3GF4A 3LVRE 2RGDA 2WYHA 4QZVA 3GFQA 4ARVA 1RD4A 2RGGA 1Q1NA 1B0PA 4HGNA 1E58A 3KYIB 1RIOA 2ZVJA 4YMWA 2A1TR 3T4UA 3CTMA 3LTEA 2FFJA 4PU0A 2OESA 3VHXA 3QFHA 1T3SA 4LQDA 2GHRA 5DN6A 2FYTA 5J4LA 3OCYA 4XARA 2JFHA 4TQ9A 2G77B 3A70A 1JDSA 2Z2XA 5FDFA 3V7WA 3A31A 4A10A 4BO6A 4RIEA 3W7BA 4QLAA 5ALYA 4CMCA 1E6KA 1TT5B 2NTYC 4C0JA 2PR2A 3GLRA 4DV2B 3AUKA 3SKXA 4A6EA 2NX2A 3HLTA 3ZDDA 3IE2A 4GR9A 3QVUA 4F9TA 2QIPA 5B2EA 5I9NA 3AX6A 2R7AA 4H7HA 1VBKA 2H1RA 4FT2A 3KU4A 4MEAA 5IARA 1SCNE 5H16A 2OG1A 4MR7A 2CLMB 4NJMA 4ZGWA 3L7CA 1DAEA 3FWKA 1U2RA 1SC1A 1GT6A 2GCNA 3UF0A 3EFEA 3R09A 5A6SA 3K0AA 2GLUA 3MAAC 3NV7A 4PX2A 2C99A 3B8HA 3G1UA 3K2EA 5JQWA 1DINA 5TB5A 5B12A 4UAUA 1B43A 2BISA 1Z28A 5JROA 1ZW6A 1UBHS 3W6NA 2OM2A 1E92A 4UXJA 1ID1A 3I45A 4G6ZA 2H2FA 2GFQA 3S4YA 5CFOA 3H0KA 3MT0A 4IIHA 4GYKA 4IH9A 1TQDA 2C7VA 4XJXA 4QQKA 5AOCA 4NJEB 3VTFA 4CUJA 2I3DA 3E5HA 1X7WB 2HCFA 4CF7A 2NUBA 2XTMA 1E1MA 4UTVA 5ALMA 1D04A 2DHQA 2CXQA 2HQRA 1Z2CA 1ZIXA 1OWOA 2P2DA 4BLSA 3MPUA 3RYIB 5G02A 3ADKA 4U02A 2HKIA 4PLGA 4B87A 1O95A 4CEIB 1CUUA 2ZBRA 4BPBA 3KPVA 3NYIA 2XB8A 5HKBA 2GD2A 2AYXA 4IZOA 2YWRA 3OJCA 3BWBA 5DCLA 1XD8A 1GZHB 5IWAB 3L3BA 1XXHB 2IHVA 4J1TA 3U7JA 4DQLA 1W1UA 4RF4A 5LJIA 3QU4A 1ZDMA 4IJ5A 4JFRA 5JSHA 3FMFA 4RTLA 2KBEA 2Q5EA 3DR5A 2WJHA 2JFPA 2EW1A 3AHEA 3DZHA 1L7MA 2H2IA 3D6VA 4E1VA 2FETA 3FJYA 3OQ6A 4MRSA 3UMGA 4LZLA 1Z37A 2CUTA 2E55A 3D2AA 4UVIA 4YI3A 221PA 1C4WA 4TMWA 1RM5A 5BN1A 5K8LA 5DI9A 5B3KA 3JQ8A 1SHZA 3PIDA 1Z8DA 4KV9A 1X1AA 3GEDA 4HAXA 1L5HB 1ZN7A 1GO2A 1JXQA 4X20B 6GPBA 2E4ZA 5REQA 2HNAA 1D07A 1JIXA 2WYUA 4IUBS 2Q1XA 1ZN8A 3KLPX 3PQ5A 2DERA 3ZHIA 1L4KA 4OUDB 4PZDA 4RYLA 4R8MA 3IQXA 2BGTA 1QMPA 2VXYA 3IOYA 3SQNA 4O2RA 5CLGA 3MOGA 3AEYA 4FJ2A 3HB9A 4E15A 3OJWA 1OGIA 2CDBA 4KPYA 1FFCA 3GQBA 3JZFA 2TRSB 4H15A 1E61A 1V9LA 2QUKA 3VYVA 1OROA 1FFEA 1RKXA 1E3OC 4BNGA 4QC2A 1YDGA 4HDQB 5DT2A 4P98A 3RU7A 3UGKA 3M89A 2YFKA 3Q5DA 4INJA 3ZCPA 1YSEA 2Z58A 1YKSA 4NF2A 1O3YA 3DT6A 2ZVQX 3NRJA 5CXUA 4H59A 4MPRA 1Y9DA 1MZPA 1CNEA 1G5TA 1E0AA 3ZR4B 4GOMD 3BTOA 1E8DA 2GZDA 3D5QA 4AG3A 2CT8A 4JUCA 3K71B 2H7CA 2QN3A 2XDAA 3CWQA 4HNHA 1H2ZA 3UW1A 4CF3A 1RIFA 3FKSA 1NJSA 4HTFA 4M22A 3O3MB 4KFUA 2BCGY 1O0SA 2PRJA 3X2SA 1VM6A 4J7XA 4M1OA 3ZE2B 2JGDA 2ZBDA 3ZY6A 1EXDA 4DR7B 4IIYA 3MGGA 4O4HF 4BKPA 3D6NB 3U4QA 3GCXA 3SVZA 1YZHA 1D1PA 1YQXA 3P9SA 2HIGA 2WEKA 1IZ8A 4YRCA 5HZHA 3RVLA 2GCIA 2ZPUA 1Y3AA 3ACBA 1MVOA 1ONSA 3ONFA 1Y8RA 5DBOA 1SBZA 4Y67A 4JBGA 2D4HA 3QPDA 3WK8A 4HF7A 1CVIA 3B3JA 4IV0A 1Q2XA 1Z5WA 4LYYA 5EJ8A 5KTOA 4Q3AA 5B4TA 1ZBQA 5HMLA 1ZGJA 2FSPA 3BIOA 4W82A 4GC5A 1WMFA 4RD6A 4BC0A 3EARA 4PXSA 1OSNA 1ZXBA 3WTBA 4I6JA 4UULA 4G9EA 1RT9A 4E94A 2LVBA 1J25A 2C95A 2X9QA 3RF6A 4MCHA 4UBNA 5KSPA 5HNKA 1VJ1A 3DE0X 4XUEA 2LUOA 1UK8A 3ZWQA 5C1PA 2PD6A 2FSUA 2R1TB 5K45A 4FE7A 5HDBB 2NAPA 3HBLA 4GPBA 1ZGBA 3QHQA 4WLEA 1HNWB 4M1YA 2IP2A 1UZMA 4KEAA 1MB4A 5CPBA 1NLFA 2X8LA 5D1HA 5CVVA 1WS6A 3AR6A 3PJFA 1J56A 3QELB 4LY9A 4E30A 4PSUA 1TAHA 1ZUNA 1E0DA 3P20A 2KX7A 2BEUA 3P0HA 5FH9A 2ZAGA 3VZSA 4EEXA 1U2SA 2I2DA 6AT1A 5TE9A 5EJAA 1T29A 2NYUA 1VL1A 2Z08A 3DMHA 5GAGi 3E22B 3GGGA 3PDIA 3QEMA 4HVLA 4LJKA 4DCSA 5JV5A 4R0NA 2ZYSA 1KJNA 2VWPA 5JVDB 1NEQA 1Y3CE 2BLNA 4PLYA 3EZXA 4B4UA 3OPQA 5BRNA 3FFBA 4UHCA 2V9ZA 1J09A 3K5HA 1QRSA 3TZHA 1ONNA 4BBZA 4R6WA 5KBYA 2J5BA 4LY0A 1J0CA 3WL6A 4KE8A 1PGNA 2IT1A 2XVYA 1FYEA 4W5HA 4P83A 1SU7A 4LV8B 2Z1DA 1DKOA 2R7KA 4JQCA 3N59A 3AWIA 4JGGA 1QZXA 3QWFA 3LUJA 4NZPA 4E11A 2JAWA 3ZY4A 3W2TA 2O2GA 1SCQA 1QYCA 3C1TA 3R9IA 2AGVA 2CXRA 2D1FA 4PZ9A 3N8HA 3ZE8A 3EQ7A 4EG0A 3AL2A 3A25A 4DMCA 1UKEA 5JASA 4NQZA 2XSZA 4PV7A 5BT9A 4ZODA 4CL2A 1X57A 1I7LA 2GN6A 2O1EA 1WZCA 2X1LA 5E6SB 1H6AA 3KJEA 2J0VA 4HJRA 3TLMA 5KOJA 2PXBA 1ZVQA 1OB5A 5EKTA 5F9FA 4YHHB 3AUTA 3AVUA 2ZJ7A 4PINA 2VYVD 1BSVA 4FC6A 4XLZA 3MUNA 3E8SA 4G5SA 4JODA 2O6HA 4J16A 1EFRD 1IN4A 4GM1A 3T1NA 4EW3A 2PMBA 2WKSA 1UXCA 2IHKA 4GKBA 3ZV5A 4Q19A 5FLYA 2PWPA 3B82A 1AGXA 1TEHA 1VI6A 1WZIA 3AHCA 4QRIA 4U7DA 3LQFA 3RSSA 1L5VA 2YJ3A 3GLIB 4IM7A 1H8EA 1NSFA 3KLMX 4QJ4A 5EN4A 4GOOD 3OQMA 5LDGA 2GEFA 1X3LA 4Z1MA 4B80A 4F7DA 3X1WA 3WWZA 3EZGA 1KY3A 4B4VA 1IBLB 1JAZA 2X5KO 4JP3A 1KI3A 4TVBA 1K1EA 3S5JA 3EOBI 4JQZA 3OAAA 1FLDA 2EW8A 2QL9A 2BAGA 1R0KA 1U8ZA 1NKVA 4GGMX 3BHNA 2QG6A 3A6HA 5BW8A 1YB7A 3IV7A 1QKJA 2JBWA 1NR1A 4HWKA 1JNXX 3UG6A 1VCMA 5LXTB 3L5OA 2WAOA 3MSCA 4FFPA 1F2VA 3IO3A 4K03A 5AMXA 1P44A 2VQSA 2RHHA 3GCDA 1TQ6A 3IQHX 4F85A 5AJUA 4XWOA 3UPTA 2JJYA 3WB0A 4BKUA 4AQ7A 4UOQA 2IJGX 4MINA 2NU8A 5KC8A 3BBLA 2V5AA 4H31A 1XZEA 1CC1S 3DZBA 3D7LA 2WYOA 2IX9A 1GL7A 2BMJA 2D5CA 1T4MA 1DZ3A 4M0KA 1YVPA 1J6UA 5JPIA 1RABA 2JIOA 3EVZA 1ZS4A 1W76A 4JCOA 3CVYA 1JJIA 4J0DA 2P9CA 1P4HA 4OBWA 4ZOAA 1MOZA 3D59A 5JRJA 3C3PA 1EKXA 1M6NA 4MJXA 1NE7A 5LZ4A 4O0LA 5CDUA 1T4BA 4WLNA 1WRBA 5IBCA 4OHBA 2BFMA 4HDAA 3IVAA 4XWYA 4Z3DA 3SR0A 3TQOA 4C30A 2BNNA 4L6AA 1Q44A 1YZNA 2CNLA 4KVGA 5FQOA 3GC6A 4ARIA 2C84A 1PT9A 5IAKA 3TIIA 4FE3A 2DQSA 1RLTA 1T9ZA 2CV0A 2I3ZA 4KQWA 1LQ2A 1PKEA 2A78A 2NZWA 1GPWB 4RKFA 4F2DA 1YU9A 5JCJA 5LLTA 4AD8A 1E2LA 4HLQB 3ZWNA 1MOSA 1K06A 1O58A 2AKYA 5JCOA 2ISCA 1N2JA 3L7AA 4EYQA 5FA5A 1DX9A 2NZUG 3GJ7A 4JVNA 4DQKA 4TUYF 5EFOA 4I1VA 1XVLA 2FEWB 1AOXA 2IYEA 1XZNA 3TH5A 4CI0B 1ACLA 5I9IA 5I4BA 3X1XA 4L27A 4DWJA 3ZE0B 2BPOA 3HG7A 1RMYA 4ZCMA 3ZGZA 2A0WA 4HNVA 3GMIA 2R79A 4KQJA 3SLGA 4FD3A 4BIIA 4OO3A 3CLHA 1CSEE 3C8HA 3D4PA 4Q02A 4Y7DA 2GM4A 2C8KA 3CYFA 4IHQA 1NPYA 4JJ6A 5LCXA 3VHXB 4DQVA 4I81A 4J16C 3ZWAA 3L1JA 4IGIA 2FEMA 3HB5X 5DU2A 5FUXA 3AQ4A 1I9CA 1IZ0A 1ZJ4A 4AJEA 1N34B 4ICIA 2Y6VA 4TXLA 1QLHA 4LRXA 3R7WA 4DT1A 3BKWA 3VVCA 4N82A 2ZKLA 1MJGM 1HFWA 2VFAA 1WD7A 3PNVA 5D3KA 4QKQA 4YRLA 3QKRB 4PG4A 1QYWA 3DVQX 5H1YA 3S0JA 3T15A 3ZZUA 5HQJA 4CT4B 3RT9A 5HM8A 2WF7A 1ZD4A 5HS6A 3MUFA 4A73A 1TDJA 2QQEA 2QX9A 2CVHA 5T3YA 1ACJA 3CS3A 1O94C 4JBLA 4RD0A 4RVFA 2FN9A 3NFRA 1NVEA 3AVWA 1PERL 3JZIA 4NJMB 2IZ6A 2ZB3A 2GF0A 1E5QA 1ULSA 4MR7B 3AR8A 4DQUA 1WXXA 4WI1A 8OHMA 1E89A 1QDLB 3T3IA 4OHCA 4J1SA 2C2GA 2JH9A 2NXEA 2P1DA 1OYOA 4HQFA 4K0RA 4RZIA 5A6SB 1SPXA 3NANA 2CVZA 2GJSA 2EP8A 1R8XA 5B64A 3HADA 2P2SA 1XTBA 2ZR0A 3DHNA 2QB5A 3ET5A 5DYNA 3HP4A 5CDFE 3GN5B 2PGLA 1II8A 1SCUA 2DTEA 2RG1A 3IDSA 4M1WA 2C9BA 5CFQA 3Q5EA 1CUZA 5KKCA 2P0AA 1QH1A 3NP7A 5K4GA 1ICEA 1QAMA 1B6RA 3GJRA 4IJKA 1CIVA 5JD3A 4DDKA 3ZE7A 3VAAA 1SRRA 1KSFX 3SSNA 1Z7GA 1RZVA 2HDOA 3Q9UA 3R5SA 3VNVA 4JVSB 2V3VA 5GONB 1PR3A 2J5KA 2BMDA 4LRYA 4DM3A 4J4BA 3EVTA 1JE0A 2WICA 4LRQA 1BGWA 2AR0A 2XUDA 3MERA 3O8LA 4YPVA 4RV5A 4Q6WA 5B6IA 2C4VA 3NHPA 4Z4IA 1FFXA 2VP2A 2X3YA 4RGVA 5LB4A 2AXUA 1WETA 1M2VA 3L7LA 1U28C 2A6CA 3RW9A 1JBKA 1EVYA 1I30A 1R4ZA 2ZSUA 1JE1A 1XYYA 2EQBA 3LVQE 1KY5A 3NZEA 4HUJA 4RDIA 2DUUA 1QHYA 2JLSA 1E99A 3D0OA 3IT0A 3NJRA 4PYNA 1DUIA 2L17A 3AKYA 1Y5LA 1TRKA 5FBZA 3OF3A 4UBIA 3ZGNA 5J4KA 1WSDA 1NT4A 3GGDA 4YI5A 5EQJB 2Q7DA 3ZDFA 1YWGO 5CVUA 4Q3KA 1QGYA 1VLLA 3NONA 2IS1A 1EDZA 2IBMA 3JWIA 4GMGA 1Z5ZA 1QBKC 1Y89A 1KNXA 4TOIA 4QGSA 1EB9A 2QGFA 2W6NA 3JQ8B 2R4TA 2UYQA 4JLSA 3LGXA 3B9BA 2B5VA 4PQEA 2OCDA 1AURA 4KR6A 2EXXA 3I8OA 2LGJA 5REQB 3RSZA 3A2KA 4IHJF 1WSWA 3OE1A 1GA6A 2NADA 3FNRA 3KLNA 5EZQA 4OF4A 1BVHA 2OSVA 3UATA 4R84A 4ARBA 3FZEA 3BPSA 4H1UA 4ZT4A 3RTBA 4KRFA 1MO4A 4GECA 3NNDA 2DP4E 3RT7A 4N65A 1Y6GA 1GTSA 1NF3A 4YIKA 3CF6R 5JY6A 4YGYA 1JS1X 5C7LO 3C43A 2JLUA 3CN7A 3GQBB 2J59A 4F0JA 1REQA 2DAPA 3JARB 5EJFA 2FNAA 4EGSA 3RBAA 4PNHA 1VQ1A 1T3GA 4XOIA 2W2OA 5BR4A 4KR7A 3QVXA 3A3YA 4LG1A 5DGXA 4BQFA 1O0BA 4C05A 2GPJA 3ZK8A 4DDTA 3RRBA 1W4AA 2QL6A 2O3UA 3TCKA 1RI2A 1UQTA 1ZGZA 2FWPA 3H2ZA 3I64A 4TTVA 4AN4A 2M6KA 1OIXA 5DEOA 3MWLA 1KJYA 2QN6A 3IPXA 3NDPA 2QT9A 4HTFB 2I6XA 3DB1A 4I2VA 4RDCA 5K3AA 3HU3A 2VHEA 4R9VA 5KQPA 2JGDB 3H2SA 4X60A 3U4QB 2QQGA 3PGVA 3HDGA 4G2TA 3EDRA 1P3Y1 4KQFA 4QQFA 1IG0A 4CF6A 5CLFA 4B7UA 3KUDA 4EG4A 5IZCA 4HDKA 4KKXB 1JG1A 3ONWA 4UVDA 4MCTA 1S89A 1IUNA 1Z08A 4D92A 2CKDA 4MWSA 4XR9A 5CCEA 2I71A 1M2EA 2YNMC 3ILVA 1Z4LA 3B5IA 1CR4A 4BZQA 2D5VA 1Y8RB 1IAQA 3W2IA 1YVEI 1GEGA 5KI6A 1PT8A 5DVZA 1OZGA 2HA0A 2QD2A 4EBFA 3AFNA 4NE2A 4EMBA 4YIHA 4D0LB 2I65A 1U1EA 4HGYA 3R7SA 4UCFA 3LC0A 3GT0A 5MGNA 2TMGA 2REQA 2FB9A 4H08A 4U2KA 1U8AA 5A7HA 3PKIA 1GAJA 1V96A 3KYCA 3DCNA 1V1MA 1WY7A 1YVDA 4JFAA 4N6OA 1R74A 4RMIA 3TUZC 1D5WA 2IY7A 3UJ3X 3QF7A 2ET6A 3FMYA 3GRKA 4GOND 1PAUA 3PE6A 4WAUA 2A67A 4WNAA 4YB8A 1NQXA 2FTKE 3Q3HA 4ZTUB 1ZH4A 3OLZA 4OJTA 2I6TA 2XOKD 3HNRA 3OX4A 1G20E 1DJPA 1L5GB 2HW8A 1AKUA 5J40A 1GZ7A 1DC5A 2R6ZA 4NK4A 3HJAA 4Z6KA 2VRBA 1LBTA 1XDZA 4E0BA 1PL7A 3EASA 1ZUNB 2ZIGA 4GD3Q 2VOEA 3D2CA 3LIPA 3OM1A 4FZRA 2JVKA 1IXRC 2HF2A 3BE5A 5G4KA 2ZPAA 4HGRA 1WZUA 2BI7A 4TWBA 3DBOB 1JRLA 1YSCA 3N8GA 3HY6A 3QEMB 3SEQA 1MW8X 2ASVA 3O8DA 2ABWA 1TM4E 1M33A 4HD8A 4NEHB 6PFKA 3BWXA 1ZRMA 1YIOA 2EWMA 1JJFA 1WB5A 3A6GA 4X6XA 5DCUA 2I80A 4B8YA 3WV4A 2QSUA 4ESHA 3HRIA 3MRSA 2A35A 4KXYA 1KR2A 2DTXA 3LT1A 2ZE5A 3A6FA 1RYBA 1XZDA 1UBEA 2CMKA 1IZ9A 3K32A 4OG2A 2PN1A 3R1FA 3VU8A 3CPHA 1MCZA 1UADA 1KZ4A 2JGEA 3N2GA 4UTRA 1S8NA 4W1RA 3FGPA 5AQEA 3ZHZA 2I66A 5T3UA 3MB5A 4AQDA 4AUEA 3CLRC 1NASA 4BJ6A 4E5VA 4G67A 1SWWA 3DFFA 2P8JA 1R0BA 4IS3A 4US1R 4DLTA 3RAGA 5BYAA 1DBQA 3IKJA 1PBTA 2ZZKA 2AK3A 1GL9B 4QNNA 1KYQA 3KFXA 3IRUA 4LPSA 4X7PA 1P2FA 5TRTA 3M5PA 1YQEA 5P8WA 2XIQA 3FTPA 3C6BA 4ZYTA 1E1NA 1AQJA 2PVPA 2OP1A 1YCHA 4GXQA 4NARA 5EZYF 3O8NA 4TM7A 5GY7A 1XGKA 1W4CA 2EKQA 3EMBA 4D9CA 5B3JC 5IXJA 1T9GS 3RHFA 1DQZA 1HE1C 1W0JA 2VQDA 1DV2A 2FHPA 2GF2A 3E48A 4LRWA 2BMFA 2QZ9A 2OV1A 3B9QA 1ODFA 5CIQA 4IA8A 2X13A 2WT9A 3IUNA 3BJIC 4X6LA 1S02A 3DTVA 3EVFA 2F1RA 3ORRA 4Q3OA 5CA0F 5HKKA 3MGKA 2IK8A 2HLDD 2H1VA 4YDQA 2BI4A 2QN8A 4X92A 3WL3A 3GLHB 3AO0B 2JIRA 4M0EA 7GPBA 5TMDA 1O6ZA 4MUFA 4UMFA 3T7RA 2B1GA 3EVCA 4ES6A 1PD0A 4Q2JA 4XFKA 1JG6A 2HMWA 1GTZA 2JLRA 3U1TA 2GT1A 4L8FA 5LA6A 4MWEA 2P2CA 4TLLB 4LFBB 1FMCA 2EF0A 2JQEA 5EZ5A 3HUFA 1H2FA 1SKYB 4M0FA 3ZLUA 1XFDA 2ZTSA 4MV3A 1TM7E 2ICPA 2RCYA 5J47A 1HSZA 1SKQA 1JG7A 1XELA 4HCJA 5TC4A 4DCOA 4CKZA 4KAAA 3HKCB 2ATEA 2C42A 5DTQA 2XYRA 4OEHA 1LBQA 4RK6A 1U90A 5B37A 3HKEA 3CRZA 1C4XA 4JENA 1RCUA 1XRQA 4RDXA 1Q77A 4KLAA 5EJ6A 3IKLA 3HKDA 1UDRA 4DGQA 1YCDA 3FPFA 1ODJA 1UJCA 2FRDC 3P9RA 3R3XA 4BX3A 2QT1A 1E5DA 2X5NA 3I6MA 1UFQA 2B4QA 1AZLA 2BZ1A 3RTEA 4HB0A 3L6BA 2A5FA 4V0NA 3QVWA 2QTTA 3LQ4A 2IXGA 1N92A 1OMOA 3RG8A 5GVSA 2DKOA 1Z68A 3DKPA 3K72B 4MAMA 3A32A 3E4DA 4MA0A 1IY8A 1PYGA 2LKCA 1E32A 1J07A 1KJZA 4HNTA 5AVTA 1E20A 4C04A 3ZPXA 1OR8A 4ZAGA 4A03A 3EPJA 1H9AA 2CDAA 3GA7A 5FPPA 2X7XA 3BMCA 5M29A 4M0PA 5EGNA 1FDOA 4EW1A 5BN4A 2PUAA 1LX6A 1VYVA 1XTSA 4C3OB 4YRZA 4P93A 2PBLA 3WSTA 3M4JA 1JIKA 4XUCA 1G9XA 2VZEA 4KODA 4BTLA 3H8VA 4J29A 4V0QA 2O14A 2IV2X 3PNQA 4G01B 3HXOA 3G0TA 1M10A 3LUKA 1Z83A 4NDNE 2QRKA 4DEXA 2C5AA 1LTHR 3JQDA 5IAEA 4ABYA 2VKQA 4GHJA 4PYJA 5CHYA 3TE7A 1Z0UA 3LY9A 4O8BA 2J3IA 1CJUC 2FUKA 4Q48A 4R05A 5H7XA 2YMQA 5I4IA 4UVEA 3VSDA 3S5UA 1KOFA 4EHHA 1GTJ1 4FNOA 5HX7A 4ZEOA 3F90A 1BDBA 3OWHA 3C3YA 4N5IX 1CRQA 3DF9A 3W1WA 4ZV7A 2WE8A 1V47A 1N2CB 2IYZA 3OQVA 3B2NA 2FUG1 3HU5A 1D4OA 4OCZA 1CP2A 1ZMRA 4I9HA 2AV6A 4UDXX 1B2RA 2QMQA 4YFYA 2I5PO 1CUSA 1CE8A 2W8ZA 3AJDA 4YLYA 4DIKA 4MGEA 2J5QA 4NHOA 4TWAA 4ZVTA 4FOSA 2AN5A 1FLVA 4IIGA 1OKKA 4M8SA 2L49A 2HXSA 3NPAA 3R7AA 1MC5A 4MKZA 1AMNA 4QUHA 4JYCA 3BUSA 4MHSA 5TLSA 3WYGA 4HHEA 1N0VC 2R87A 1JHRA 3ZHMA 3R7WB 4BVGA 4DT1B 4ENUA 4RD3A 1XI2A 2LPMA 4JJEA 1A9ZA 2FFQA 2BF4A 3AMVA 1SB8A 2C82A 3KKEA 3NEJA 3O4RA 3HV0A 4CCAA 1VPDA 3QY0A 2A5DA 2CB9A 2CFTA 4DKXA 2NYVA 2VUSA 1MPTA 3M7IA 4FILA 3VI4B 3HCWA 1BHSA 1TJ5A 2WSBA 3H86A 1Q1ZA 1ENPA 3B6EA 3W1VA 4EKYA 3L02A 2MYNA 4ARAA 3LLMA 3VHLB 4EX6A 1JIVA 1AT1A 1Z2DA 2IUYA 2WMDA 3ABZA 3NTQA 1K4YA 2G7MC 4B2IA 3HP7A 3IX7A 5KTMA 3KHKA 2QA5A 1YI8A 3IXQA 4WNIA 4RSMA 1D03A 1UZAA 1TGVA 1VMIA 3IKVA 821PA 3OTGA 1W5BA 1Y5IA 3HB7A 4G8BA 4CODB 1VRVA 1ZJZA 3A6LA 3PA6A 4IJUA 1PX2A 3ESAA 1II8B 1SCUB 1MENA 2L0XA 3DBLA 1SWVA 1LBEA 1C0PA 4MS3A 2BFFB 2GDZA 2ID9A 3GW8A 5GAJA 4YP6A 1MDFA 2KEKA 1QH1B 1A4XA 2BKXA 2EZ8A 3HPRA 3K9WA 4O2AF 5D51S 1NHWA 4MITA 4V0KA 1GDTA 4MS4A 1NVFA 1SUFA 3EC7A 2G1JA 4LVNA 5EXPA 3H11A 4D9HA 3WB1A 1F1BA 1T1GA 2K7FA 1HC7A 5EXSA 2B92A 2JL1A 5ALHA 2UV8A 2C20A 3SHQA 3D0QA 3SKYA 3HLKA 3H19A 1V4VA 5GJVC 3S8MA 1NZJA 4BEJA 3G1WA 2AH5A 3FM9A 3V6LA 4N3CA 1ZHOA 1HEIA 3A1SA 5CXQA 5L40A 2OXRA 2DHCA 4WEQA 4FLFA 4BLWA 1Z0ZA 1OREA 3BTUA 2CKMA 2JJ2D 3DL2A 3GDOA 4KXQA 4L8GA 4DLWA 1Q2UA 4G1FA 4N48A 3CINA 2JASA 2W2MA 1TU4A 4YP5A 5GGXA 1BU8A 2CJPA 4CG1A 4RQTA 1N5LA 4HI0E 4EMUA 3RTCA 3BD7A 5G3YA 4R1OA 1HRKA 2BVNA 4O59O 4GPEA 2OUIA 4U2FA 4BLVA 1H23A 3OC0A 3SZLA 1MD9A 3U61B 1E0JA 5CB0A 4EG7A 2ZSIA 2C00A 2GBLA 5E1BA 3VQTA 1A7AA 2FSGA 4PTZA 2HMSA 1Y81A 5B55A 3QKSA 1TAUA 3KD2A 1M7GA 3ZI7A 3MCWA 1AS2A 3L6OO 4ISBA 1PT6A 1VZ3A 2JHGA 1U4NA 4JR1A 1Z5UA 3ZQ4A 1IEWA 1KAEA 5BV2P 1W25A 2F59A 1WKBA 2XE6A 4IDFA 2Q2OA 1IHDA 1VZ2A 1TIBA 2O38A 2PA3A 4PU7A 2JIZD 3CLTC 5SZKB 3ROPA 4GQBA 4XJSA 4CMGA 1W7AA 5A0VA 1G63A 5EWJB 5SV2A 2WAYA 2OL4A 1E66A 1Z15A 3F3MA 4Q4HA 2NXNA 2A14A 3DPSA 2P2GA 4BBAA 1GG5A 2VHQA 1REQB 2XDWA 1S3SA 2ZJOA 4HMQA 4XWTA 3QWHA 4LGVA 4R2XA 4D3SA 5CM9C 1Z4NA 3EZYA 5IULC 1UOOA 1YDWA 5ALSA 1F9EA 4BFVA 2W2QA 3GIDA 4LK2A 1MG0A 1VCIA 2R97A 3V42A 2O48X 3O4VA 1UBMS 1KARA 2P35A 4TXHA 1P7VA 3C24A 2W0SA 5JDCC 2X6QA 1ZH6A 5U1PA 4YMGA 2VHUA 1A82A 1D4FA 2V6JA 3SVLA 4WVFA 4ZRDA 2EHDA 2PGOA 2QXUA 1JZQA 1GCUA 1LUAA 2B9EA 3HJGA 3NHMA 1T0BA 4IXWA 3VUEA 2I67A 3I52A 2IQIA 4JMLA 3CR8A 2NVUA 3S44A 5LOVF 2PWZA 3J7AC 1NUUA 4F38A 1CQIA 3MAGA 1DBRA 4JI3B 4ZZ2A 1FFAA 2YRWA 2XT9A 1EE9A 2HCBA 3LY7A 4BP9A 4CG0A 3L8HA 2D2XA 3CSDA 1EK6A 1AB5A 5IJ0A 5KNDA 3T3EA 4TSFD 2YASA 5YASA 1CS0B 1EINA 3GFTA 5LZ5A 1DWUA 1P4SA 2HLHA 3H2HA 2WLTA 3MYRA 4RHXA 3BVPA 3H8SA 1A96A 1MC8A 1MQSA 4RZUA 4F60A 1XEFA 3OQJA 3ORHA 3LT2A 4B31A 1RQGA 3FA2A 3KYCB 4L0QA 3UAOA 1I5RA 2O1XA 3FYAA 1J7JA 1V1MB 4CWAA 4YC7A 3HR8A 4ZREA 5I7AA 3AVTA 2HBZA 3TW8A 1RQRA 3O9VA 3WQSB 2NU9A 4AP9A 1WY5A 2YVKA 1K68A 5BRAA 4AIIA 1WPXA 1UC9A 4BV2A 1Z56C 1E98A 2E89A 4LHEA 1JJAA 1Z47A 3GB9A 2JFGA 3L4BA 3L8EA 4W9MC 2I6GA 4FR2A 3ZZ1A 4FMCF 5JDIC 2CK3D 1E9VA 5CA1B 5J63A 1SVSA 3INGA 2QN1A 4WUVA 1BROA 3DAGA 5G4KB 1Z4IA 2CF5A 4EO4A 3B1ZA 4PRZA 3V48A 5C3UA 4U9UA 4ZI2A 4DXDA 4P4GA 1AO0A 1RYDA 1DXQA 1USGA 3D8UA 5IEBA 2N9UA 2XB2A 5KIAA 4RPCA 3LOQA 4D25A 1D6MA 4D9EA 4XDHA 5A4JA 4K46A 1G2PA 1RS0A 3M1IA 4Z7QB 5DPMA 3PWKA 3S81A 4MRPA 3RI3A 1GILA 4BV8A 5CPFA 3N2GB 5I48A 1B3BA 1NXXA 3M3PA 2ZRNA 4KVFA 2X0EA 1P2VA 1UPUA 4D3DA 1KIMA 3M6LA 4C01A 2YHSA 1AB6A 1P8AA 1L8LA 5DBIA 2Q28A 5I9LA 4JLUA 3TEJA 2Y1FA 5C31A 3VTKA 4ZT7A 2Q1WA 4IF4A 4R16A 3FY4A 3ND6A 3I01A 3GMSA 2GK6A 5JPCA 4CW7A 2EBHX 1QO7A 4WY2A 4MP8A 2H2WA 4H6VA 4U2DA 5TPZA 3IMGA 2WWVD 1KSGA 5AI6A 5A4AA 1D1SA 3RUEA 2VP9A 4DDMA 4C1BA 4XWGA 4NBNA 5C1OA 1QIHA 2V8BA 3ND7A 4RHYA 4XDZA 2IVQA 3WYNA 3G0HA 1YS1X 2RGXA 4RAQA 1U2ZA 4A8JB 3BMQB 1TZCA 4OATA 2JHFA 4IKPA 1FUKA 2E4YA 1WZ2A 1KQGA 5B3LA 2EG9A 4OY3A 1JTFA 3E0XA 2WWYA 1VCNA 3EQZA 3K4PA 4FDAA 4P0QB 4F6CA 5DX8A 2FP3A 5J2TF 3SBDA 2MCFA 4B3JA 5KMGB 1ZD5A 4RVUA 4ESVA 5EPUA 5C8YB 1DPGA 2XV1A 1TIKA 1VKJA 3A4VA 3GZJA 1VLQA 4NAUA 1O89A 5KVAA 1NJ5A 1U2QA 1WX1A 1XQYA 2PO5A 3DTVB 3NGLA 5AJTA 5IW8A 1XWWA 3T3HA 1RTKA 1PGPA 4M4SA 2PK3A 1Z06A 3A7DA 3K30A 3L8GA 4BCCA 4N3AA 3EUWA 2GEKA 3QVMA 4LI0A 3VX4A 1N75A 4NP6A 3GD5A 4QYTA 5J2UB 5BR8B 2D1RA 5A9RA 1RZRD 1PLKA 1XCBA 4L28A 5IKEA 2M98A 1DOZA 3DE2X 4FU0A 3DNMA 2BN4A 3CEHA 3ZV6A 4EAQA 2ZULA 5IJZA 1KC1A 5G53C 3EG5A 4W5OA 2QRZA 1BNCA 2JFWA 2BY4A 3M70A 4YAUA 3FYHA 3MRVA 1L3BA 1WCIA 2Q99A 4G37A 4IWRA 4EP1A 5G2OA 3C3JA 2NU6A 2J4FA 4UBMA 3R6TA 4NZ9A 5FOSA 4O4JA 3MW8A 1NW8A 5SY4A 5CVCA 2II6A 3PC7A 2GUWA 3RS9A 1W44A 2D3TA 3UC9A 2WD7A 2O3TA 1Q15A 2OEPA 2Q3JA 3OU7A 2FK7A 3LUPA 4URXR 3WLPA 2VPYA 1FDWA 3BA6A 3PUVA 2XUJA 4HTAA 2FFBA 1LWNA 4FMDB 3H9CA 1NBHA 4EHLA 5EWMB 3Q3CA 3ZDRA 4GMFA 5F5XA 3GEEA 3T7TA 4EABA 4ER0A 4YUAA 1LDGA 5JQGF 5LKRA 1UDCA 3GK3A 4EB3A 1TJNA 3RS5A 4MYSA 4ZWNA 3HRKA 5DRTA 1WNFA 3GJ8A 3M81A 3AFGA 3FNBA 1ZZGA 4AKHA 1VKRA 5BWLA 1DFHA 3BMCB 3TTVA 4EDFA 5J1TB 3J81A 4FFOA 4EHIA 1TK2A 1JXAA 1Z34A 4Q9IA 1J8VA 1N4AA 3VZBA 5EVCA 3NATA 3AI2A 5JJBA 4RM3A 3KEMA 5F4ZA 1CULC 1MB2A 3PFHA 5AK6A 4IPTA 2O2YA 3L7KA 4BGVA 1YB4A 3IFSA 5ITWA 4FWTA 1QHEA 3BH7A 1DO2A 4NJOA 3GLTA 2RE8A 2RBGA 1RAEA 1YUBA 2X4IA 3G85A 1Q0TA 5J4YA 4I1IA 1U6IA 2AW6A 4FHEA 2HO4A 2NV6A 4L50A 4KN5A 3WL4A 4DBVO 5ILOA 4I50F 5L7YA 2XTJA 2P68A 2D1YA 2PIDA 3FHCB 1IJFA 3L9XA 3M1YA 1N5RA 4WY5A 4ZARA 3V4RA 4LE2A 5BNFA 3UA4A 4J0EA 3NG1A 4F3NA 4ZEVA 2F00A 2PFGA 2ZT5A 3NT2A 4ITVA 4N8EA 3OO1A 1W4BA 2QV0A 2QLMA 4LYHA 4RS4A 3MILA 3GJYA 4Q4JA 4WE3A 1KQFA 2AUNA 3WGUA 1YKFA 4R54A 2IEDA 9ATCA 4Z0TA 2J46A 3RUPA 5GAHi 4K86A 2QS9A 3ZCTA 4F4HA 3L4JA 3LHKA 2C88A 4DXAA 1Z4JA 2WM3A 4KO1S 2OLKA 2ORIA 5IKOA 3JATA 3WLRA 1TLTA 1EK1A 2AX4A 2BOVA 4QJ3A 3FCSB 2C5FA 3CO5A 3N28A 1Z4OA 2WJWA 1EE2A 4RGQA 2P5UA 1DC4A 4UCQA 3EIOA 1Z6ZA 1OF1A 4BQPA 1E1KA 4GZ5A 1TC1A 3K7EA 5KAMA 2ZCJA 1MC1A 1AU7A 1SVWA 3D3QA 4FYPA 4BKRA 4P7KA 3EXHB 5DCYA 1CUGA 3TDKA 1OFTA 2SKCA 3T1QA 2WVGA 5ALGA 1NR5A 1DBWA 1S96A 4KE6A 2BGKA 4CCSA 3K0CA 4OB6A 2W93A 4Q4AA 5FNVB 1C41A 5MN4A 1ZU4A 3HK2A 4OAOA 1JHMA 1ODCA 2GEBA 2ZIZA 3AF0A 3N8NA 3CVXA 2OP0A 4HL6A 3E3NA 4PPNA 1VA4A 4PM4A 2D8MA 4ZMSA 4E32A 3ROZA 3ZCVA 2CDNA 2VNSA 1E6UA 2NSHA 4PLVA 4Z86A 2HJ9A 1NLYA 4F46A 2WJ6A 1HT0A 2P3LA 3WLJA 2O8VA 4E5NA 3GZDA 4HVCA 3NV9A 2EBUA 4HEJA 2VHYA 4P0TA 5AW5A 2QMZA 1FU4A 1PG2A 2AZMA 3JAKA 4MRRA 5IMBA 3U4CA 4DJEC 1QHNA 4ETWA 4I4NA 4QPZA 1YFLA 3R7LA 1BD3A 4L9SA 1O08A 1SPBS 5DMHA 2IVGA 3GIWA 2I6QA 2Z4RA 4LISA 4P35A 4Q3CA 4TV9A 1AKVA 4MS4B 5TMPA 2ZJ2A 3UH1A 2V3WA 2PMEA 4TV8A 3AHDA 3U3DA 3ZKCA 2XEDA 3H11B 3MJ4A 4DREA 4L02A 2JJMA 1INLA 1GYQA 4Y2TA 3H1AA 3LAWA 4EGFA 1KEKA 3OX1A 4MW0A 4F6RA 3HMQA 4GE0A 4P2GA 4EDHA 1P1JA 1XV5A 3DEFA 2ZUUA 3LWNA 1BJRE 1LDEA 4Q5IA 4EKIA 2X9VA 2X2EA 3DNPA 4HKTA 5AK0A 3N6XA 4PG5A 3QVLA 4PZLA 4LY6A 5HIJA 4M9RA 5H02A 4L51A 4Y7CA 3UICA 2ZFUA 3P4XA 2VTBA 1E4VA 3K1AA 4HH1A 1U7UA 3G0IA 4V3BA 1YE8A 5CLHA 2HU8A 4DUGA 4FONA 3P45A 3OPMA 4FHDA 4JLNA 4MVJH 1ZXXA 4QQ8A 4RFSA 5BNZA 1D6JA 3YASA 5FKJA 4AWBA 1FXWF 4KNVA 3LHDA 1XO1A 2EGGA 3AF1A 3ZHVA 4CMEA 5U4XA 4QXOA 1YL6A 2UVPB 3K1JA 2VNIA 3QKSB 4EMSA 3A6ZA 3ICPA 3ZYCA 2BKUA 4QGGA 2CE7A 1B8NA 1KMHB 2VJPA 3ROKA 3RLFA 3HZIB 2C2HA 3O2NA 4FN4A 5FBRB 5TVGA 2YV3A 4R6XA 5DTEA 4UEJA 1W8IA 2FZKA 2H1FA 3U60B 2XMQA 3QXHA 3DP7A 2QTCA 4TQUS 4ASUD 1U0NA 1U2TA 1W75A 3AOEC 1U3TA 2ACKA 2GN0A 3F3SA 2BHTA 3OIVA 4YP0A 5U9CA 1PUJA 2I1WA 3PU6A 3QUCA 6REQA 4Q4HB 4X24A 4MUAA 1AVTA 1MNAA 2PLWA 3BK7A 1TRHA 2WRZA 3KOXA 3CN9A 3KVNA 3DWEX 3V2IA 1BQ4A 1ZR2A 3DOUA 3QOFA 1YDHA 4NH0A 3DFMA 2B8JA 4LF8B 3WQBA 3LHSA 1PR9A 1DIOB 3KQQA 3RSCA 3EOZA 3CZ5A 4BU0A 5CH5A 5JMPA 4ZV9A 1WU7A 2GYWA 3T94A 3UJAA 4JSRA 2IX3A 3L6UA 2OK8A 4I9FA 4G89A 1BOFA 5ES3A 3NDIA 2YC4C 4KCGA 4Z4FA 3JQBC 4WZAB 3BOSA 2J9GA 1TAGA 2YHBA 4CTNA 1U7TA 2AXVA 1UF9A 3JD4A 4HX9A 4UUPA 2OT3B 3A1UA 3ZIAA 2NVUB 2LNDA 5JXIA 1PKXA 2H4FA 1PJ3A 4EGJA 1CQIB 2CNBA 3ESXA 1ILEA 3BWYA 3K1YA 4IUDS 3VPGA 4DA8A 5FPSA 5HJ7A 1SG9A 3DV2A 3EPRA 3LX5A 1CLEA 5KEIA 3AR9A 3L79A 8ADHA 4KPGA 4D3YA 5IJ0B 4ZN6A 2UKDA 3R44A 1E7YA 1FIUA 1K3TA 4DMFA 5M04A 4CLRA 3C41J 1XMSA 2INGX 2VTVA 2MQKA 5IAAA 3I05A 3I1FA 1NVKA 1YR1A 1PG5A 1N5IA 1JHAA 5DBGA 2O49A 1JSRA 1LRLA 2XRMA 1E1CA 1ZKMA 2NO0A 3H1GA 1V1RB 2R6R1 3PHHA 4EJSC 2ZTHA 4MVJA 4M1KA 2HINA 3VO8A 4A7PA 5DMXA 1HI9A 1OLXA 1T6NA 4RA9A 5D1NA 1TLLA 1YBFA 2Z5LA 1QCCA 4MQLA 5FTWA 3MJRA 4IIJF 2NU9B 2H0QA 3U7QA 3ZH9B 5JD5A 1NRWA 1ZG3A 3LA6A 4MIKA 1RWVA 5E0KB 3KL4A 3VMMA 2XMZA 5EKDA 3EAQA 4B73A 2V1XA 2YV5A 4CETA 3O9ZA 4OJQA 3VR4D 1E6WA 3BWMA 4KQCA 3TLKA 1EUDA 2YWFA 1YQUA 3GP5A 2HFJA 2AWNA 3LDHA 1SQ5A 4B9EA 2ZRPA 1XKTA 5ER9A 2BGRA 2E5LB 1QZ3A 2IQ5A 2JFFA 2PYIA 2RH4A 2PRKA 4WECA 3RB8A 4EFMA 3IUPA 4DMRA 2M32A 1ISJA 3ZS8A 1HOTA 1W52X 2PXAA 3JVEA 3G0GA 2G6TA 4GICA 3TSYA 3VTZA 3DZCA 2C9MA 4JAVC 3W5IA 4B74A 1LI5A 1NNEA 5CK4A 3FMIA 4XDYA 1M2KA 1MN6A 1CHDA 2A4MA 4K9LA 4DLBA 3HN6A 1YDMA 1CTQA 1Y3FE 3JY6A 2FR1A 3LUDA 2PXCA 3G2KA 2Y4OA 3S1SA 3DBIA 4EZEA 3GYGA 4G25A 2XXJA 4YONB 1KVSA 4KYVA 5F4BA 3SHOA 3WO1A 4LRSB 3QE2A 3W8DA 1RXYA 5EA2A 4RH1A 1K6MA 1U28A 4M46A 4IXDA 2CUKA 2IXTA 4AS2A 5F9MA 3OQPA 4L8YA 1F2UA 2DG2A 3Q1LA 2UYGA 1NA5A 2IUSA 3VZRA 1YQGA 4EJFA 5C53B 1GDDA 5E9AA 2WFLA 1HK7A 3CWZA 5TQ0A 1ND6A 1QUEA 1EG2A 4BLPA 5L8VA 4QSHA 3R76A 1ZAKA 3P0IA 2F67A 3E7DA 3I12A 2LP4Y 4YJFA 3DMFA 2ZJ5A 1R88A 5HFJA 3UB4A 1H9BA 2GA9A 4AF7A 1A8UA 4LKRA 4TXNA 1RZ3A 2EJVA 3T5DA 4ZVNA 4QU5A 1WPGA 1GAXA 1DT3A 1J5EB 4HS4A 2DFPA 1FNBA 1A97A 1XR3A 4L0DA 1PRUA 1KYVA 1CQZA 4BLUA 4LSWA 1MEEA 4IRUB 2PXUA 2OV2A 1ZWKA 1A2KC 3ZWYA 4PAWA 1LCDA 4HRXA 4FBLA 5DNUA 1DOAA 5T57A 4KAFA 1W94A 4DSUA 1KYXA 3ESQA 1YU6A 4PANA 1ZRSA 4UUNA 3WK9A 4YV2A 3LY8A 4PZCA 3L7JA 3BEDA 1R16A 3AYXB 3L1KA 4WFIA 1J2UA 4JIGA 5AVJA 4WA7A 5T8KC 3U37A 5FULA 2HO5A 1M66A 3BFVA 5EJ5A 5L3SA 2RGUA 5FUQA 1Y5MA 2WMYA 4ITRC 4URFA 2PX0A 1ZZ8A 1QO0A 4QFMA 3ZVNA 5LNK1 3D2BA 2FPPA 3JZMA 1U7XA 1JR3A 4EYKA 3OETA 2IH2A 3DV9A 1QQ6A 3DL4A 3K4HA 1H9CA 3BFKA 1L4UA 2W2LA 2X86A 1GA1A 1P9WA 1RWXA 2HBQA 3GJTA 1JBEA 3H1EA 3TD6A 2QMOA 2PT9A 3LBYA 2NU6B 1KF0A 1AA6A 1HL7A 4KNYA 1VGVA 2J3HA 2DQ4A 3HWWA 4H7EA 3TBKA 4YV0A 5C5DA 2VJKA 2O9JA 2YICA 5I7FA 2UUAB 4KQEA 3D3KA 1J99A 5AK3A 3NIDB 1OXXK 2XKJE 4M0MA 1OILA 2WD7B 4ZCQA 1M2WA 3WLOA 2HPVA 3CZ4A 1NUTA 3ZTWA 4OL9A 5SY6A 1AK9A 1UPXA 3R8CA 4EYOA 3OMTA 2W2VA 1ZS9A 4AJ1A 2J7UA 3RAJA 1X86B 1K89A 4BVAA 3L93A 2ZLBA 1YR9A 3F7OA 3GH1A 3V00A 3KALA 1DJLA 2DF8A 2DTDA 1B73A 1JPUA 3VNBA 1WB6A 3H5RA 1RAAA 5JSZA 3VK0A 1RP7A 3CVWA 2QX8A 4D0RA 3KJQA 3IPAA 4TWRA 1UKZA 2OFPA 1D8TA 2CLIB 3ITKA 3IQEA 3MQ2A 1P9NA 2JK0A 3U9TA 1NUHA 3CE6A 4XSVA 2YIMA 4C5AA 2BUCA 4QTXA 4PAMA 1ZZ6A 1I6WA 3DV0B 4YCCA 3HGQA 1QTNA 1YJCA 4FGWA 4IDEA 3QU2A 4PTYA 2Y71A 2FZWA 2JJ8A 4GP9A 5LXTF 2DUJA 3C1UA 3MIZA 5PGMA 3QUSA 1JW9B 4HAZA 5JT1A 1SG6A 1NYRA 3IE1A 1NI4A 4A15A 1JQLB 3D6AA 5AW7A 1PT7A 3RHSA 5LDHA 3RU2A 4RV9A 2PH1A 3IQZA 1X8KA 2YUIA 4G5XA 1RBYA 2JA1A 4HC4A 3E7WA 1YT5A 3U7GA 3ZVMA 1NUPA 3MJEA 3X1ZA 2JVJA 3GQVA 4GSYA 1ZN2A 3KX2A 3HXLA 3ZGVA 3F52A 4U63A 4XTCS 5JSUA 4PR3A 4EF5A 3WYAA 1C29B 4ILKA 5BWOA 4ZC1A 3OZUA 2PBRA 1I7PA 3QU7A 5BSTA 2J09A 3D7NA 4U6SA 8AT1A 1P6QA 1U0JA 4NS1A 3ETGA 1ZIOA 4I6UA 1ZUWA 3AGPA 4QARA 3NORA 1X14A 2SBTA 4U7FA 3SP1A 4W99A 1QRAA 1KZ1A 1W30A 3IGFA 3NHBA 3AR2A 8LDHA 4K9SA 1TNDA 2IIQA 2A9KA 3OTHA 3BM5A 3OI7A 1AY0A 2BLLA 2OFWA 1YL5A 3TLGB 4O08A 2FEAA 5DM1A 2P4QA 1XCJA 4YAKA 4LYFA 1NJ6A 1CJGA 1Y1QA 2CHVA 1L8AA 3ON5A 4B46A 1BE8A 4QPDA 1YRLA 4Q03A 4Q4AB 1BGVA 4N1AA 5F78A 4M55A 3QVTA 4AN0A 4W7SA 2VPIA 3T6KA 4HWGA 1PJCA 2W6JA 3LQ1A 3OMXA 5JAZA 1A7KA 2VUTA 3CEJA 3IPYA 3OZWA 1ADRA 1Z6XA 3CZAA 4BGDA 3I0NA 1P0MA 5LB2A 1SM4A 2ODWA 2VJLA 4RMHA 3TZBA 2VSOA 1ISPA 2XUPA 3NAMA 3NHLA 4W9NC 4WKOA 2L8NA 1I6KA 3EC2A 5ERGB 1MFQC 2IODA 5I3CA 5BSVA 2D2FA 3G3EA 3JAKB 3MGCA 5B3JA 4LXTA 1GT91 2Z57A 3KSDO 2P78A 4OHPA 5AESA 3AR7A 2Q5FA 5E7JA 5EKXA 4B44A 2EZTA 1YJQA 3OFSA 4TV9B 1WUTA 2WUVA 4ZD6A 3WIBA 5C51B 2GKSA 1Z3CA 3WMFA 3DLAA 1CUVA 3U3XA 4G5RA 4EUNA 2L82A 3G7SA 3JWGA 3OQOA 4B40A 1H1LB 2PXTA 1U4OA 2Y2UA 3NWPA 4F6RB 2OCXA 1Z5OA 2MIIA 4WESA 2R60A 2Q4TA 5LBUA 3ADOA 3THOA 1VIVA 3C8UA 1M0WA 2BKAA 3I83A 1HE5A 2MSWA 3I9NA 3MCZA 1G5FA 1HDZA 3EDOA 4HPWA 1JR2A 4N03A 3KE9A 4PFSA 2QUZA 5AVOA 4WCFA 2VTBB 2IDJA 3AV0B 4RHFA 5I4KA 2PUFA 1LD3A 4IX1A 3EBOA 1UPFA 1EVZA 4YNBA 1TA0A 1AF4A 2DJ5A 2IYUA 3O84A 2MSLA 3RC1A 2E4AA 3GEPA 2A6PA 1L1QA 4RPKA 3HSKA 5LBTA 1R8SA 1KDTA 1L1MA 2V4UA 2ZBEA 4XVQA 3RVSA 3BQ9A 2IGBA 2FRDA 2EKZA 3UV3A 2XCRB 1NP6A 3WGYA 3IILA 4BP3A 1PTJC 1BEEA 4UZFA 5E8JA 3W5BA 3N75A 1KJWA 4CLOA 4OQ4A 4YRAA 1SBYA 1J33A 5IN5A 2Y1CA 3OE4A 1G9TA 4YDHB 1VHQA 1STOA 2BJCA 4O8ZA 4RTPA 1ZCBA 4D3XA 4PC1A 3PNSA 4XB2A 5GZ3A 6REQB 3WZLA 2CLLB 2YL2A 3A9UA 4ON9A 2Q4DA 2I7XA 1YFKA 1UDXA 1VKOA 1W6UA 1XWFA 1UT8A 1JLKA 5ED0A 2NPIA 4K9PA 2KMLA 2V5VA 4Z0HO 4QXRA 1QGUA 2X6TA 2ZRFA 3FVTA 3L84A 3DMTC 1YULA 1K4KA 4MV8A 1N3BA 1BH6A 3CZPA 2IV7A 4HFMA 4YR7A 1IEVA 3OKCA 3TPCA 3K70B 1JG2A 2G1PA 4AICA 3MFQA 5CLLA 5FLKA 2R48A 4A8JA 3IUEA 4NU0A 5DASA 3KTDA 2F17A 2MDTA 4DCPA 4J0CA 4EHKA 2WSSD 3PEEA 1T2AA 4GWKA 4M3NA 3EPPA 4D6YA 2JDIA 5ICSA 3BZUA 5INTA 1N5OX 4H7JA 3FF4A 3HYTA 5DW3A 3WLHA 4EUSA 5FCDA 3G82C 3HACA 1GU7A 2XBLA 3AF3A 3I0ZA 4HVAA 4EMTA 1DJNA 1TCBA 2RK6A 5A3VA 1U1CA 4Y9SA 1RM3A 2QK4A 3ENVA 3GFOA 2ETXA 2NSYA 2LD4A 1AUXA 4TS9A 4K40A 2QRVB 3GFSA 4YA6A 4C21A 1L7AA 3TLCA 2JCGA 4BFCA 1PWEA 1CETA 1JQJC 2EFYA 4G8CA 1GTL1 4LYDA 5IKPA 1R12A 2AOVA 1B1AA 2RG7A 2BH2A 3M2PA 1SCBA 1FY2A 4MLPA 3PSAA 4E09A 3GHHA 1AS0A 1ZH0A 2XODA 1E1CB 3D9QX 3IALA 2ZWPA 1XQ9A 2Q6LA 8ABPA 1KC3A 4GE3A 4MGKR 1ZCFA 1BS2A 3BFJA 1RC0A 1VJDA 2QPTA 2IEBA 3CUUA 1AIPA 3LOUA 5KSWB 3PITA 4DSNA 4JVOA 2JLBA 1P1CA 4K3VA 3U7QB 1A8QA 3WDLA 2ZRGA 3ZHQA 2CXNA 2DWQA 4LHXA 3A0RB 3LFTA 1VMEA 1W35A 2FPXA 4TMFA 3ICQB 1XKXA 2PZ8A 3MRXA 1Y8AA 4AMGA 5F2EA 5KZMB 2IH5A 3PFKA 1L5OA 4XH9B 5T67A 3BXZA 3U0VA 1EUDB 1RJFA 2Z2ZA 5IM4A 4KO3S 3AF5A 1CHNA 1OBOA 3RT1A 1DGQA 2OQIA 2PKWA 4YS6A 5T6BA 1KERA 2OKCA 3WKDA 5IWCA 3ZDQA 4RKWA 2ZRDA 2UU9B 5I9SA 4BJHB 5LZ2A 2J3JA 4KJXA 1RIIA 4G0MA 4B6PA 1GRNA 2X5OA 2R85A 2C2KA 1RXCA 2WIKA 2D5BA 4PLWA 4XCQA 4E08A 3IJRA 3MCAA 2VHTA 4PZYA 3SD7A 3TKYA 5IN4A 1M5RA 1NUAA 4CDNA 1XVVA 2RHLA 3LCJA 2Q1UA 2B1RA 4BJ5A 5HXAA 3T9FA 3TW4A 3ZD6A 2MXDA 2C9ZA 3KEFA 1N6KA 2JLXA 1K7XB 1I2DA 2LYLA 4KFCA 1ECPA 4MUHA 3TX6A 1M34A 1RMQA 1S2MA 1VCOA 3EDMA 3GA5A 4ND5A 3FYMA 4TLMB 3AUFA 2ZAMA 3RSGA 3V7NA 3O83A 3HJBA 1Q74A 4EPTA 3DWGA 3O3OB 1JDBC 2DULA 1G6Q1 1T15A 3AI7A 5GZ1A 1RBQA 2WFLB 3B12A 3E18A 1EG7A 2P69A 1UXGA 1ZUD1 5TQ0B 2GKGA 3HVIA 2WPDD 4FYWA 4I4TA 3RWMB 1UPTA 3AR3A 1DRKA 2FWBA 4P4LA 1POWA 4BC1A 4EF4A 5FHQA 5I51A 1OZHA 4OK3A 3TUIC 4F1KA 2C59A 5CH8A 1QU2A 4R41A 3U19A 1AKWA 2Y67A 1TA4A 2GUGA 1EFDN 4MO2A 1LC3A 1N25A 2PNFA 5TEWA 3GZCA 4G65A 4IVRA 1BJTA 1BG6A 1KFCB 4P4NA 1YD7A 1M9NA 4MXDA 4PLPA 4KR0A 4RGBA 3F4LA 1NNUA 4JUIA 3L0BA 3L7DA 4O4LF 4TVSA 3A4IA 2ZYRA 2AOTA 1NMXA 3VMFA 3MUEA 3K9GA 2Z2IA 1XTUA 1O6GA 2YOHA 1WVMA 1AUPA 5A62A 5K98B 2AHOA 3NHUA 3AL3A 5BP7A 1IOVA 4BXOA 1KR5A 4Q1DA 2Q3BA 4X1IA 3RIGA 5L3SB 1UJNA 2H3HA 4RTJA 2BGWA 1NIJA 1CY4A 5M2QA 3UXYA 3IBCA 5IEJA 1Q6ZA 2FPPB 3E9RA 1OH8A 5EMLA 4J94A 4RULA 5JBQA 2QWXA 1MJHA 1G7RA 4P4UA 2J08A 4QDXA 4D74A 1HE4A 4C7OA 3FPAA 3BWCA 5JDCA 3ZXSA 4EY7A 3P2OA 5AKXA 3VU1A 1F6BA 2P4HX 2ZSKA 1NBAA 5KPJA 1MJ5A 2ZRHA 3FWZA 2PUGA 2FDRA 4ZCPA 3N0VA 4YYEA 5FPQA 3HSSA 2QEQA 3QENA 4XLTA 4YG7B 1ONPA 2E82A 5ESXA 4ARZA 2WA1A 1RI1A 3L0YA 5PNTA 2IUEA 1EE1A 4MYTA 5IVKA 5AI0A 4M83A 3L18A 3GAZA 1TCCA 4RTOA 2Z04A 5C1DA 1XKLA 4JLMA 3QYJA 1SHTX 2C2BA 4JBYA 4R0MA 4Q47A 1YMVA 5BNTA 4MHOA 3NASA 4R1SA 1XRSB 5HE8A 1I7QB 1R00A 2P4UA 3SWWA 1WF6A 4TRRA 2NGRA 4DQXA 1QTRA 3B3GA 4TRMA 3WLKX 4CM7A 1P1FA 4I55F 2NTVA 1V8FA 3PD0A 1NJGA 1OVGA 2GAJA 2VBGA 3O0TA 2XDQB 1Z45A 1A1VA 1WDTA 4A9AA 1C3JA 1FDRA 3PFBA 3TRFA 3D1LA 1G0NA 4EB0A 1U3UA 5C4MA 2OCGA 1VSBA 3LHFA 2VJQA 2K6GA 3JWJA 2YYSA 5E1DA 3VR6D 4D2IA 1J0XO 4RV4A 1UMC