1PNRA

Purine repressor-hypoxanthine-purf-operator complex
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
338
structure length
338
Chain Sequence
b'TIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAAYFAEIIEAVEKNCFQKGYTLILGNAWNNLEKQRAYLSMMAQKRVDGLLVMCSEYPEPLLAMLEEYRHIPMVVMDWGEAKADFTDAVIDNAFEGGYMAGRYLIERGHREIGVIPGPLERNTGAGRLAGFMKAMEEAMIKVPESWIVQGDFEPESGYRAMQQILSQPHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEVHPRLIERRSVADGPFRDYR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*AP*AP*CP*GP*AP*AP*AP*AP*CP*GP*TP*TP*TP*TP*CP*GP*T
publication title Crystal structure of LacI member, PurR, bound to DNA: minor groove binding by alpha helices.
pubmed rcsb
molecule tags Transcription/dna
total genus 118
structure length 338
sequence length 338
ec nomenclature
pdb deposition date 1995-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00356 LacI Bacterial regulatory proteins, lacI family
A PF13377 Peripla_BP_3 Periplasmic binding protein-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 1pnrA01
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1pnrA03
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1pnrA02
4WZZA 4FE7A 5JS1A 1AB6A 4Z9BA 4ZJPA 4KQ9A 4OB4A 3EDCA 3U3WA 3H75A 4EYQA 4X4EA 2XJ3A 3RVOA 2PUBA 3RVPA 2AYZA 4MPTA 3QK7A 4KPYA 4RXUA 1QP4A 2CHFA 1Y1LA 1ZY2A 1USKA 2FEKA 3CNBA 4N0PA 5KC9A 4GQMA 2HSGA 3LISA 3CG4A 3E3MA 1DRKA 1T34A 2H3HA 3L6UA 2FMFA 4EYGA 1EFAA 1PRVA 4EGSA 1RPJA 1TVMA 4YR7A 3CZCA 1NY5A 1LLIA 1NXOA 3LFPA 4RZSA 4MR9B 4ZYLA 5KC8A 1Z25A 3CKMA 4MQFA 2LIVA 2EBYA 3Q7RA 1NERA 4MR8A 3F51A 4TMYA 7ABPA 4MR7A 1JWLA 3JY6A 1BDIA 1RNLA 3KTOA 3QX9A 4P98A 4RDCA 3T95A 4X4FA 1LMB3 3LUJA 3T38A 5HQJA 1ZITA 2JK1A 2GBPA 1ABEA 2ID7A 1E6LA 3HDGA 4MR8B 3IDOA 2RJOA 1ZPQA 1QO0D 1DBQA 2FXIA 3FFXA 5IULC 3QELA 1DP4A 1Z16A 5DKFA 3QWGA 2IPNA 1JYEA 1BAPA 3OLWA 1YTUA 4WT7A 1ZUGA 2FMHA 2W42A 2XIUA 4YG7B 1XWWA 4YGXB 1CYEA 3GBPA 3CRNA 3JXCL 1ISRA 3EUSA 1Z26A 2IPAB 3M6MD 4EVSA 3HK2A 4YCSA 2NUBA 1YVUA 5DCLA 5EWMB 1ZH4A 4LE1A 3W9SA 3RH0A 2IVQA 2LYJA 2A6CA 1ZZCA 3QLTA 4N47A 4D6YA 4ZMSA 4Z4FA 2LUOA 4W5QA 3T6KA 2XCJA 2I6FA 1SXIA 6CHYA 2JVIA 3VNAA 3KHTA 1TLFA 4O1HA 4F3TA 8ABPA 3BILA 1S8NA 1UXCA 2AXZA 3LMKA 3VK0A 4PZ0A 5EWJA 3OQMA 4TLMB 1WETA 5TQ2A 4DN6A 4LDZA 3A3KA 1HEYA 4JQDA 4RY9A 1RIOA 1DJMA 2JVKA 3QEMB 2J48A 2LYLA 4S05A 4JA2A 1UXDA 1EWKA 4ZMRA 1KRWA 3QF3A 2O20A 3FMYA 1JF8A 1GLGA 1QO0A 3MF4A 1NXXA 4H3HB 3HCWA 4NICA 1NXSA 4OG2A 4WUTA 2MYPA 3N0WA 3KXAA 5IEJA 3JVDA 4G0ZA 5KQMA 3OLXA 2R25B 1A04A 3LUHA 3TO5A 3LUFA 3HUTA 4EVRA 3Q15C 4KREA 4MLCA 2LYQA 4YS6A 1Z13A 4Z4IA 4QYWA 4X4CA 5A7LA 3FFWA 3JPYA 3UK0A 4I6RA 2FN8A 2IU7A 3UFDA 2LYKA 3NBMA 1X2LA 2QZJA 4MGEA 3JTEA 1L5ZA 4TLLB 5CNKA 5T7BA 4RK6A 5C5CA 1E3OC 1Y7YA 1EAYA 3DLHA 1JYFA 5IC5A 1JBEA 2QVCA 3C6QA 3H1FA 3CU5A 4X4GA 2PUDA 2MSKA 2QR3A 4XXHA 4Q6WA 3IPAA 5IBQA 3G7DA 4W5TA 2F8TA 3HJFA 1MAVA 5FWXB 2JVLA 1DBWA 4TN5A 4Z4CA 1C0EA 1LBIA 4CBVA 1P8AA 2KEKA 3UKJA 3G85A 3NNDA 3DBIA 3CECA 4ETNA 1RPEL 1GCAA 3KYIB 5FWYB 1K68A 3VNBA 2JVJA 4PYRA 4RU1A 5IUJC 4KFCA 3GA5A 4NQRA 3DGEC 2JB9A 4Z0NA 3BREA 3NHZA 4PEVA 2PIJA 6ABPA 5DTEA 4IMIB 2PE5A 4Q7EA 2FMIA 4IA8A 3Q41A 1YIOA 3A0RB 1JFSA 1ADRA 2FEPA 2AXVA 3IP5A 5BRAA 5IX8A 2GZUA 4D6XA 2E4WA 2CD7A 4JAVC 3KLNA 5EWLA 1E2BA 2E4ZA 5HKOA 2B4AA 2HINA 2AWIA 3SCFA 1BDHA 4X4DA 4KK3A 4MS3A 2BNNA 1URPA 2KEJA 1DC7A 4PICA 4Y9TA 3L49A 1IC8A 4JB2A 4PU8A 2FVYA 4IMJB 2D5VA 1NTRA 2LP4Y 5TQ0B 1LJUA 4G86A 3RQIA 2FTKE 4W5NA 3FGZA 3SY8A 4MYRA 3FFTA 3CLCA 3EQZA 4WXEA 4YARA 3RVLA 3LUCA 2FQYA 1APBA 4G0QA 1FSPA 2IUOA 2LYSA 1ZDMA 1AB5A 1CHNA 2M98A 4RK4A 2FMKA 5E3JA 1P2FA 4RS3A 1ZESA 4MS1A 1QPZA 1ZZBA 3F7NA 5I4CA 1BVHA 2IOYA 1Z15A 2NZUG 3C3KA 3IP9A 3N8IA 2L49A 2MYUA 1MVOA 2A9RA 1PNRA 1FFSA 4ZPJA 2H8RA 3QLUC 3EQ2A 3BBLA 3TX6A 2PUFA 2A9OA 3HUUA 4RY0A 4O5AA 1BDJA 4LZLA 4S04A 2A9QA 1JL3A 5KQLA 4W5RA 3BDNA 1U04A 4YBAA 3O21A 3MYYA 1LJLA 4J1XA 2PUGA 3CTPA 1C4WA 1J56A 1OXBB 5TPZD 1ZH2A 1TJYA 4NDWA 3G1WA 4WXMA 4B09A 1X57A 4RK1A 4MQFB 4FN3A 2R63A 1Z2EA 3MIZA 2IYNA 5JNTA 1DCFA 4KK4A 1U2QA 4MR7B 2XSDC 2GRMA 1GUDA 1W25A 4RXTA 3RVNA 5KQPA 4YLEA 2PUAA 1SQ8A 1F51E 2V0NA 1YSEA 4Z5HA 1DC8A 2QV0A 2IKSA 1Z17A 3QELB 2CROA 2PL9A 3QQ6A 3B7HA 3F6CA 3KG2A 3HS3A 2KPJA 2LCVA 4Z58A 3D02A 4LE0A 3N53A 3O74A 3IP7A 5BQ3A 2L8NA 1PUXA 2PLNA 3S99A 1VKRA 3LKVA 5KI6A 4DADA 4EUKA 4RKRA 2QVGA 2ICPA 1PRUA 4EY3A 3HZIB 3IVPA 3SCGA 3NNNA 1DWKA 3CFYA 3OLZA 4GNRA 5FBKA 1TMYA 5HM6A 3RVKA 1HF0A 5KQGA 3DGFC 4QPJC 1FFGA 4Z59A 5CNJA 2ICTA 5C5EA 1PHRA 1YS6A 3CS3A 3BS3A 1GCGA 1Z2DA 3LFTA 4Z9AA 5EWJB 1QQBA 5TPZA 3RVQA 4N41A 4LDAA 2FW0A 1P6QA 3O75A 2FQXA 4UHJA 1PRAA 5FBHA 1D4ZA 3KKEA 5TPWA 5TQ2B 3H5WA 1ZAYA 2P9HA 3O2SB 4G0OA 1YK1A 1QQAA 3LUDA 2GI4A 2HQRA 4XLTA 4KVFA 5KWSA 3HXMA 3CHYA 1ZGGA 3GYBA 1SXGA 1L1MA 3HEBA 2E4UA 1VRVA 3EODA 3LOPA 4ETMA 3OQOA 5JNSA 5PNTA 4P1ZA 4Z99A 1GT0C 2NZVG 3OM1A 3GT7A 2XDYA 1U8TA 2FSPA 2OFYA 1ZN2A 1JX6A 2PL1A 1KMIY 1I3CA 2R48A 4L85A 3H6GA 4ML3A 3NHMA 3QLVC 4EYOA 1MB0A 4YV7A 1W9HA 3IPCA 1H9CA 2M1ZA 5ED4A 3GBVA 4RK0A 3QYXA 2QSJA 4RV5A 1UTXA 3RVJA 3GRCA 3GWGA 1IIBA 3ILYA 1ZZ6A 3O1IC 4X4HA 3TRBA 5JNWA 3K4HA 1DG9A 4Q6BA 2OQRA 1LQCA 3MQ4A 1ZVVA 3LUGA 3GL9A 3BRQA 3C3MA 2ZAYA 4J1WA 1M2FA 1USGA 1XWRA 1MIHA 1U2PA 3O2JA 3QX8A 4PU3C 2YHAA 4W5OA 3MLFA 3JXBC 2RJNA 3FDFA 2GKGA 3TD9A 2O38A 2IV1A 1DCKA 2BJCA 4XASA 4X4IA 1DZ3A 3TB6A 1KRXA 2LYRA 4XFKA 3HVRA 2JCGA 2MYTA 3N0XA 4IWRA 4I6UA 2EWTA 4RWEA 4PU7A 1ISSA 3IP6A 4LX8A 1QMPA 3QEKA 1AU7A 3HO1A 1ZGZA 4JCXA 3T8YA 2IPLA 2L2QA 5GOTA 4RKQA 1SRRA 5JNRA 2QU7A 3OLYA 3MA0A 4RK5A 2WWVD 5JS2A 2LYPA 2WUSR 2JBAA 3A10A 3ROFA 3I42A 2IVBA 5EWLB 3OP9A 3F52A 1FFWA 2L17A 2MYNA 4G97A 1LCCA 4D74A 4Y42A 3EJWA 3G5GA 4MS3B 3SNKA 2WRZA 1F4VA 3M9XA 2AYXA 4MQEA 4F12A 2XI8A 4F8DA 3RZZA 4F11A 1PEYA 4OLAA 3KLOA 2FEWB 4G0XA 3HSYA 1POUA 4OATA 2O4AA 3ROTA 5B3JC 4Z5DA 1M5UA 2R4QA 1NXPA 3JVIA 4KQCA 5CNMA 2FLKA 4E7PA 5F64A 1A0OA 1L5YA 1OXKB 2VYCA 1LK0A 2GX6A 3H6HA 4MS1B 4OBBA 2WJWA 4MLDA 4G0MA 3E61A 4YRZA 3LKBA 4F8JA 2LBPA 2PUCA 3FMVA 3KS9A 1RZRD 3OLVA 2BNOA 3EGCA 3ZHIA 3GV0A 2RDMA 3LTEA 3DNVB 3OM0A 1CEYA 4Z4GA 2GRLA 4JP1A 1P6UA 3OMWA 1BA2A 4E7OA 3D1NI 3H5OA 5BRJA 2JRLA 3OMXA 4F06A 1RZSA 2PPXA 3BD1A 2IVGA 1QNLA 2E4YA 5T3YA 2ID9A 3B2NA 2KEIA 2FN9A 1PERL 3GBFA 1CJGA 1JFTA 1R8JA 4MR9A 1NXWA 3R1FA 4Z5CA 1Z18A 3I5AA 1DBPA 4GHJA 2A9PA 3N0RA 3O2QB 4RK7A 4MRMA 2CHEA 2WJAA 3LUAA 4IVZA 3QLVA 3URMA 5JNVA 1QKKA 2VK2A 1GUBA 3EAFA 3SAJA 4MRMB 4IF4A 4N76A 2O49A 3Q7SA 5JNUA 3F6WA 5K98B 2OENG 5TQJA 1M2EA 3S8QA 2H0AA 4YG1A 2GWRA 3ILHA 1QP7A 2BNMA 2R47A 4NV3A 4I6TA 5IUNC 2NT3A 3H5LA 1WIZA 1RZRA 2OR1L 3JS5A 2FQWA 3M9WA 4M88A 3Q9SA 5EWMA 4NCBA 3TMYA 3GN5A 1PEAA 2Q5CA 3O1JC 3KYJB 9ABPA 3MMNA 1XHEA 2CSFA 1R63A 2QXYA 2PUEA 3N75A 1D1PA 4PU4C 3O9XA 3GN5B 4MAAA 3RVMA 2R1JL 4QICA 4DQDA 1RXEA 2MSWA 1R69A 4H3KB 3HM9A 4OLBA 4HYEA 4OTZA 5GQSA 3HZHA 5TPWB 2E4VA 2EF8A 3Q7TA 1VLZA 2WY2D 4JOQA 3C3WA 1B00A 2KZ8A 2E4XA 2PAFA 3ZHMA 1DRJA 2P4UA 2PJUA 3H1EA 2DRIA 2X7XA 1K66A 1JDPA 3QEMA 4QYMA 3SQNA 1JHZA 3I09A 4Z4HA 5TE9A 3DLBA 4GPAA 2PMCA 3FYAA 3LUKA 3SCHA 3C97A 5DGCA 3RVSA 4MCTA 3NNSA 1NXTA 2LPMA 2TMYA 3R0JA 2FLWA 2F8SA 1JFVA 2N9UA 1EHCA 4EYKA 1WH8A 1D5WA 3HDVA 1EWTA 2IPMA 4WWHA 2MEZA 3KZ3A 4YO7A 5BR1A 4IRXA 1USIA 3BRSA 4YP9A 1OCTC 1XHFA 3CROL 4FBIA 1OSLA 3O1HB 5B3JA 2B1JA 1B0NA 4KV7A 4O1IA 3OO0A 4XAQA 2RGYA 3DZDA 4JASB 2L19A 4UHKA 3UUGA 2AUWA 5CNIA 1JDNA 1Y9QA 2IDMA 4HNRA 2HJ9A 1D1QA 4JB0A 1YMVA 3L1PA 3H1GA 2L18A 3K9CA 1DW9A 4X4BA 4IGAA 1JH9A 4FE4A 4Z4EA 2QW1A 2ZWMA 4N03A 1KGSA 5CHYA 2BGGA 3QLUA 4FB4A 1ZS4A 4L4UA 4JCYA 5FWXA 4PE5B 3SM9A 3P9YA 4RY8A 2AW6A 4I8TA 4IILA 1S7EA 3OMTA 2KYRA 2HPHA 3ZKCA 1YS7A 3H5IA 4EVQA 3F73A 2NT4A 2MQKA 5FWYA 3CLKA 3KJXA 5DLEA 1E6MA 1FQWA 3SG0A 4RXMA 2VUIB 1NXVA 5IEBA 1WH6A 3FYMA 1LBHA 2HQBA 4NCAA 1ZHHA 3EULA 3N6VA 1MB3A 2FJRA 4MS4A 1CQTA 3H5TA 4XARA 4KRFA 3A0UA 4ETIA 2JBAB 1UDRA 3H5VA 3MM4A 4MS4B 1RXIA 1O4XA 1M5TA 5D2CA 1ZZ9A 1DCMA 2MSLA 3CG0A 5IUKC 5ABPA 1ABFA 3I45A 3KSMA 4KZKA 1E6KA 4YWHA 2FKAA 1NATA 1VPWA 2WMYA 2VUHB 1PNTA 3HV2A 4MCXA 2WIUB 4HNSA 1LCDA 4MQEB 4N0QA 2B5AA 1SXHA 2YHBA 4KMRA 4KNYA 1NEQA 1YMUA 1EWVA 1SD5A 4LRQA 1Z12A 5TQ0A 4YG4A 3OQNA 4O8BA 1TM2A 1QP0A 3CZ5A 4HNQA 3PXPA 2WB4A 4G0PA 4H60A 3RVRA 5HSGA 2PKXA 3F6PA 1ZZ7A 3JXDL 3D8UA 4RSMA 4G0YA 1YK0A 3OO1A 1JLKA 1ZZ8A 2HQOA 1A2OA 3KCNA 1U0SY 1D2AA 2AXUA 3JPWA 4LE2A 2CWDA
chains in the Genus database with same CATH superfamily
3PGMA 1QG0A 3WSVA 2ZIZA 4CMCA 3Q11A 4E88A 4X84A 3MERA 3L9XA 3RVPA 4PLGA 4WLNA 4DCGA 3W3AA 1RI3A 4ITRC 3NKVA 4O63O 3RKSA 2H4JA 2AX4A 5BMOA 2HSGA 4EJSB 2CXPA 1HOTA 1LJ8A 1XQVA 3E7PA 1K8YB 3HYNA 5AKYA 3ZE0B 5C80A 3TCKA 5GJBA 1GT6A 4LSZA 4U2KA 1SCQA 2H2GA 4IOKA 2Z5GA 2Q1SA 1V8PA 2NO9A 3ONFA 2JEYA 3QVMA 1PG5A 4DTIA 1OLSB 4B33A 3N9IA 1MA0A 3B6KA 2P4HX 1XDUA 1NERA 4I1SA 1G5TA 4LJ9A 4X6UA 4FSXA 1E2BA 5ADWA 3PXEA 1RAHA 5DXAA 4EMBA 4LPKA 1ZITA 3TGWA 1ABEA 3HFJA 2IWRA 3U26A 4RBNA 1RPTA 3R5HA 5IF9A 1M33A 2EGUA 1QO0D 2FXIA 1DBQA 4TROA 3FFXA 1F6DA 4CV2A 5GOZA 5IULC 5HUJA 1LLCA 3IMCA 3NP9A 3DR3A 2HFKA 4NQZA 5DKFA 4WNCA 3A6GA 3C7CB 3I23A 1XQYA 2Z5LA 3OLWA 2V7GA 3OSUA 1Z4JA 3K9GA 4G2NA 4J3FA 5AKEA 3EVDA 2VKQA 5LB4A 3ZJ4A 4GM0A 4EI2A 1RJEA 3I34X 1BXRA 4RJLA 5A05A 5EWMB 5A7FA 3Q0IA 2HDWA 4BIIA 1WKVA 4PC7A 2XD9A 3FPHA 3HM2A 1TD1A 3KSRA 3ICQB 1TIPA 1BXRB 2X4IA 1T8WA 4NL4H 3M81A 3SCZA 1W4CA 1V9SA 4PIVA 4W5QA 1HDOA 4L0QA 1KKLA 1XAHA 4LOAA 1TLFA 1I3NA 3AB8A 3O8OB 3GP3A 3O9ZA 1KQPA 4UDYX 4B3BA 5IVPA 4J91A 1G9TA 2IZOA 1QX3A 2NV6A 2XNJA 3MRSA 4WFJA 3A37A 3BE5A 1YBVA 3FOWA 4DSAA 4RY9A 4NPHA 1ECPA 1Z07A 3EOZA 1OLXB 4X6LA 3A9XA 1LS1A 1VE9A 5DM70 3TDKA 1YE5A 1CR4A 1MEJA 2M6KA 4CDRA 3W5AA 5GGXA 4C2UA 1E8MA 1BVYF 4HV4A 3OTIA 3CKLA 1J7KA 3W0LB 3RE1A 2OTCA 1J8MF 3ST7A 4DQDA 3NT5A 5EQJB 2GT1A 2R6AA 1HMPA 3N0WA 4WOKA 2FGKA 4P3OA 3USES 1PFYA 4XGRA 3BK2A 3LUHA 2J33A 4INOA 5G4LA 2OWEA 4RO0A 1FDRA 4OAPA 3RFFA 1J7JA 5A7LA 3FFWA 4JYZA 4I6RA 3DBVO 3LF1A 2QX7A 1T0PA 4MH0R 3UFDA 2P6PA 5TGTA 1NNSA 2IELA 2XIJA 2GESA 3NTQA 4W82A 5AJVB 5IMSA 2IEZA 3NDIA 1IY8A 1V3TA 1L5ZA 1SN7A 1K4MA 4JX9A 1D6MA 3WGQA 4BKMA 4K8OA 2RH4A 1CQZA 2KWIA 5B5SA 1Y7YA 1IIRA 4GNKA 2Z6VA 3ZDXB 2QVCA 3C6QA 5G40A 1T35A 5AKHA 3M83A 4WESB 2PUDA 3ABQB 1W7AA 2EKBA 3HBLA 1KEVA 1FP7A 1ARZA 2C04A 2PXUA 4TS1A 2PWAA 3RJZA 1DBWA 1XR3A 5EPUA 2A33A 3S3TA 1R3DA 3DE0X 3NMUF 2IY7A 5ALKA 3HVJA 1SPXA 2ZLBA 1P8AA 1A76A 3IXLA 3FFBA 2XOKD 4R1OA 1YI8A 1B41A 2BEWB 2JVJA 3AKCA 1V2GA 2F3PA 5ALMA 1I9GA 4I3GA 1KXJA 3KR2A 1KKUA 4FHFA 6LDHA 4JV5B 5LUAA 1UJ6A 2V65A 4JB8A 5DHTA 3U2QA 5B55A 3MINA 1PJ4A 1XYGA 2QTVA 3LPDA 3QUSA 3AM3A 4CM4A 2ZSBA 3A1CA 4CL2A 3M5CA 4DCTA 4LJSA 3AVPA 2G1UA 2HMWA 2VT3A 3GZTB 3VR6D 3L06A 1BGXT 5AKLA 3N5KA 2C95A 3T4PA 1EDEA 2BFBB 1L4GA 3FRIA 3IDSA 4I4IA 5EWLA 4CM4B 5CVEA 4PLHA 3PE3A 2BFEB 1EWQA 2AWIA 1KI1A 4HPJB 4ZT6A 4XIGS 1PR6A 1CR0A 2IJGX 8AT1A 3M2PA 4BVFA 4ZOAA 1LV8A 3Q2KA 1QHFA 5H1YA 5IN4A 1ULTA 1VLMA 2DLDA 1DC7A 3L6RA 2PEYA 4UARA 3MC1A 5FQOA 1BRMA 4EENA 1Y98A 3ZNNA 3I3OA 1QTNA 2YXBA 3IEVA 4F04A 5EZQA 2WYVA 3HPRA 1TKCA 1XJQA 2V3VA 4FZVA 4MB0A 3PU6A 5TQ0B 4BX9A 5G1NA 5BUQA 1F8FA 4GR4A 3UMSA 4ZPXA 3A3PA 3U7JA 3TZQA 2CC2A 2X4DA 4D9NA 2GEJA 2YN2A 3H2BA 2YS7A 5IH7A 4FZ3A 1AO3A 1VIVA 2NO4A 4S1NA 5DHPA 3VUEA 3E8MA 3CR8A 4B3TB 4C87A 4YHHB 2ZT6A 2QN1A 1H6BA 2O05A 1A5BB 2PGOA 3IP9A 3MAGA 3N8IA 4ZVKA 4BX0A 4HNAA 1ZL2A 5H9VA 1YR2A 1OAKA 1VPDA 2BCJQ 3UAGA 1Z8FA 2A67A 2VNKA 2ZZMA 4FKBA 2JLWA 4O4LF 5A9RA 1A2KC 4CEHA 2GHQA 4HNAB 4DR2B 1KI3A 1NLFA 2I8LA 1U7HA 5HA5A 5HFAA 2I7DA 1Y9JA 3RUAA 1WA5A 5CLGA 4BLVA 5L4LA 1OH6A 2J7PD 3DCIA 3EOBI 5IZCA 4EFKA 4CEHB 4D43A 2NXNA 3R4VA 1VDZA 3FVQA 3RDPA 3F49S 1OPXA 1TMKA 2IYNA 2ZUFA 3MBIA 3JQBA 4MVJD 2EARA 2Y0PA 3ITEA 2FP4B 2JLVA 1RWBA 1HX7A 3WJ7A 1NR7A 2BKAA 2FE4A 2VAVA 4JGIA 2X0FA 3ZIUA 4C4PA 3DFUA 5IWAB 1RCFA 4I1VA 2NWQA 1IY1A 1YASA 3P4UA 1RPZA 4HAWA 1AXGA 3L7AA 3I8XA 4TT3A 4XB1A 1ZISA 3VHRA 4ARBA 3QQ6A 2A3RA 4N4AA 1B8UA 3IIIA 3JZMA 4KXMA 1CNMA 2HIHA 4BWFB 3E9DA 3UJ3X 3L1HA 2QVXX 3QU4A 4FYJA 4M0FA 4E1AA 4YQZA 2O2SA 2ZJ7A 3VX3A 1UMCB 9LDTA 2QJOA 5JRDS 1FYWA 4H1VA 4PGHA 2OLKA 3U4HA 1C30A 5KI6A 1NI5A 1C4KA 1VI2A 3R3HA 2BBTA 1M0EA 4XQ0A 1JA9A 1P4HA 3DZKA 1VLVA 2MMCA 3SCGA 5IXJA 1DTEA 1FIUA 3EIXA 4CKCB 4WACA 3AHJA 4JROA 4I5FA 3ENKA 3B52X 3L04A 3NH6A 4GZMA 3BSFA 2WJHA 5KHAA 3A6ZA 1A50B 3O2SB 1VMDA 1YC2A 4RETA 1RAGA 2AOTA 2DFVA 4G4IA 4AX8A 3PQ3A 4H7FA 1Y8QB 4OYYA 5K6AC 1SKAA 3GYBA 5FOWA 4BFXA 1LNZA 1L1MA 5I5GA 3TBFA 4NFLA 1EX7A 1Z36A 4Z99A 2B0CA 4AYWA 1T8UA 2Q6IA 2QIOA 3D7NA 3I01M 4D80A 2G25A 1D2CA 1KR2A 2XZTA 3M70A 4EYSA 1H8EA 2XYRA 1A9RA 1S7GA 5FLXA 3RV3A 1KJYA 1D2MA 1GL3A 4LNUA 4ZEXA 4UXIA 3IPCA 1J70A 2GVDC 2C4TA 1NP7A 3D3EA 4JJIA 3ROZA 5BN3A 1LDGA 2Z6UA 3M6WA 4MDEA 3MJVA 1V4NA 2AI1A 1XRPA 1EX6A 2FZLA 4LNUB 1COWA 3P71T 5AJXA 2QYOA 5CA0A 2NZ8A 4MUNA 3GJ7A 4CUJA 5EE1A 2IZZA 2XBUA 4K9NA 4QT0A 1YDFA 1KAMA 1H0KA 1X7DA 1E6CA 3ROEA 1GTZA 4XYEA 4YIKA 4J1WA 5FHQA 4MUHA 1F2TA 1WPGA 1GYRA 2YHAA 5J5VA 1J5PA 1QGUB 5E2AA 2DFLA 3GOHA 5ECDA 1W0KA 4E5MA 4G0VA 4Q2JA 3E7FA 3OHMA 3AJDA 5JSZA 1W5FA 1MO6A 2ODWA 1T9GS 3MK31 1DAHA 3N0XA 3MTGA 3LZ6A 4IKEA 4R9SA 4BMPB 2H1SA 5LU9A 2R8XA 5KVVA 2BP7A 2GHIA 3NHUA 1LTKA 4DR6B 1EFHA 3R40A 1KSHA 3ORSA 5I6DA 4URVR 2OO3A 2FQ1A 5ALLA 1KP2A 2MR5A 3NBFA 3GY0A 1IN6A 2BP7B 2OBNA 2ZSIA 3B9QA 4LVOA 4DGSA 2P2GA 3I42A 4MW9A 3ZQ4A 4N18A 3N8DA 3VU3A 4ENWA 2B37A 4N5NA 1G19A 4WGFA 2J9XB 4OH7A 3UOWA 4DOMA 1Q0SA 4UUMA 3JD1A 4V3CA 1AHNA 3HVHA 4LI0A 5CX4A 2DWUA 1MH9A 3PFWO 1K3UB 4G0XA 3T3IA 1E9EA 4Q9IA 3T1VA 1POUA 2X2EA 4ZCPA 2JHAA 1T1GA 3P0HA 3TYXA 2GPTA 4Y1FA 4B40A 4L51A 4DA0A 5CNMA 3PD7A 2CHQA 2RHTA 5BWOA 2P5SA 2X23A 1RWVA 1PZGA 2IU6A 2PIAA 1OE0A 3ND9A 2QEQA 3SLRA 4L9WA 3T7KA 4HRVA 3ZK9A 4BECA 4OHYA 5CIYA 2W71A 2WHEA 1JSCA 3EXFB 4MLDA 5CD1A 2QLLA 2WJVA 1QBKC 1F4LA 2QN9A 1VJ5A 2GUGA 3ZKWB 3A8TA 1T6XA 1BCSA 2Y0CA 2RDMA 4YONB 2R6ZA 1EUDA 2IDJA 1GVNB 1REQA 1I6LA 2YRXA 4J0IA 3IDFA 3IT2A 4J0DA 4ER3A 4U7JA 2X42A 3X2FA 1U80A 3CIOA 4QDXA 1JWAB 4RTPA 5C31A 2FZ5A 3F5SA 1QHYA 3MGAA 5EE3A 5JLJA 1EUDB 3L8EA 2KEIA 2JPDA 3IPXA 4L72A 3IR5A 4NCXA 1MX1A 4XM2A 5AKGA 5FI1B 4B9AA 4E13A 1P17A 1R8JA 1ZRNA 2V5UA 2PXBA 1GNSA 1CSEE 2V7XA 4KXLA 4N0MA 4DV2B 3MTQA 1M8GA 2A9PA 2WIBA 3TUZC 2O0MA 2QTMA 4C4RA 1HURA 4UE2A 3I9V6 4GOND 2IXAA 1LI4A 2AFIA 2HN9A 1B8OA 4KE7A 2VNIA 1J49A 3H6KA 1ADYA 3PXUA 3ZWXA 1X74A 1A4RA 3E82A 2YWBA 3Q10A 4K46A 4JUDX 3MXOA 4UTOA 4W99A 4JT4A 2IW3A 3V48A 2O1WA 4MV0A 5KDOA 3TAXA 3VI4B 2AFIB 2JFYA 3IRUA 3OFNA 1X9HA 5ITVA 1I01A 1FZQA 1TU0A 2DFKB 4TMWA 3DS8A 3H5LA 4YAKA 1PL0A 3NW9A 5LQRA 4NCBA 1CRLA 1O9BA 2AOWA 4YMLA 3QEJA 5JSKA 3EVZA 4IDOA 1Y4SA 3QENA 1VKOA 2ATEA 1QG2A 2O7NA 3OPVA 1PJ2A 3N75A 4YYZA 1FRVA 4ZAGA 3FUWA 2BF4A 3IPYA 2RI6A 1E3QA 3FMGA 2VP6A 4X65B 5C3MA 3S1SA 4OLBA 2QUZA 3IQFA 3IQHX 2ZRHA 2V58A 4UU8A 2HXSA 5KVQA 4ZOCA 5CAEA 1GUFA 5JCPA 3CEAA 3ZTTA 1B00A 2PAFA 1XMIA 3DJYA 3ZK8A 2P11A 1CWUA 4WK4B 1K66A 3A1EA 3HACA 3X2SA 3AEUA 4DE9A 1NY6A 1XWFA 2G88A 2WVAA 1T9AA 3G5MA 5CAEB 2WAXA 3ZWDA 3IUPA 3S1AA 1KZ4A 1YB2A 3QEOA 4EPWA 3HDTA 4X1IB 5BWNA 1N3BA 4DRYA 1G2QA 3H2SA 4XDYA 2Q6TA 3GLTA 3L7JA 5D8DA 3E3NA 5DBOA 4ZCMA 5CBKA 3W05A 2FLWA 4EUNA 2X15A 1K89A 1AMUA 4YDRA 3OG9A 1XCLA 4FW8A 3KSBC 1I3MA 1H2BA 1V6CA 2FX2A 2IUYA 3AR2A 1Q19A 3A6KA 4AS1A 3HG7A 4KRGA 1EHIA 2IL1A 1RP1A 1PK8A 2PQ0A 5AUPB 4M89A 2R97A 1X87A 5AIAA 5DP1A 1I51A 4O1IA 2ETXA 2HA4A 4EF6A 3IUYA 3JWJA 2YINC 1FNSA 3D2LA 3MRVA 4UNPA 1E5TA 1TW3A 2JAOA 2OORC 3NVAA 4M1EA 3ZE7A 3L1PA 3PFFA 2L18A 5FKJA 4NE9A 1ISHA 3K5WA 1RQXA 4TRMA 4LFCB 3WDKA 3WVNA 1E2FA 3OECA 4CF5A 2RB4A 3FZNA 4ZQIA 4ASUA 1YNOA 4EY6A 5C7OO 5FWXA 5LIPA 1CD5A 3H8SA 1SHJA 4RY8A 1MO4A 2VSOA 3DV0A 5CR9A 2LZ0A 5K8VA 3FPAA 2AZDA 4CMBA 2Y6VA 2J9GA 2C0QA 3K0FB 5DHUA 4BP8A 4CU2A 2WILA 3PNVA 3SG0A 3SNHA 1O5TA 4FNMA 5CB8A 4XWAA 3VR2D 3AWIA 4KSCA 1E1QA 3ZQKA 2BDEA 1C1DA 3TDMA 2CXRA 1MB3A 3HZOA 1CQTA 2OMKA 3FYUA 5J23A 2GN0A 4EB0A 2OV3A 2WZDA 1CNEA 4ETIA 1N5KA 3BA1A 4K1XA 1NVDA 5AXDA 1XK7A 4V0SA 3ZDCA 1NR5A 3DF9A 3STXA 1M5TA 2AR0A 1V48A 3C5WP 1TIBA 2COEA 4QBKA 3FYUB 4R83A 3UB2A 1I3OA 3WIEA 1SWWA 2Q3LA 2VP5A 4YWHA 4YVFA 5DSZA 1GLNA 4ZQFA 3I2KA 3LW8A 3UVEA 3GLGA 4EO9A 3TIGA 3KUCA 3KFXA 3LY7A 4Q4DA 4DMCA 2PWPA 2PJRA 3BC1A 4UU0A 3T7CA 1HDEA 1NVWQ 1U94A 4WXHA 1E2PA 4YASA 4DUGA 1TM4E 2A1TS 1EWVA 4BN0A 3BMQA 2CMDA 3TVDA 1G20E 4S0XA 1ZXBA 3H04A 3U9LA 3FYHA 5AD1A 1CULC 3CEPB 1UEXC 4MUBA 4RVHA 2DR2A 4GI5A 3UT5A 3QE9Y 3BMQB 3FSEA 2VJAA 1I36A 1UKCA 1DEHA 1LQUA 2HQOA 3GT0A 3T5BA 4CN9A 2GRAA 1CZLA 3NM6B 3SXUA 1WVGA 5IC6A 1VA4A 3U3WA 5NLLA 3AXTA 4DRXB 1VL5A 3TBKA 1BHQ1 2Q29A 3H8VA 4KC0A 4RXUA 1SCDA 3RHTA 4ROSA 4DNQA 4Z86A 3AESA 5EMMA 4PLPA 3X2EA 5CHEA 4M0DA 4D4LA 4UHCA 3O8QB 3MLAA 3G2NA 4FDLA 4EGSA 1IQPA 1NE2A 1N6NA 4OOFA 4X5OA 4OUKX 5LMUB 4EP1A 4BQEA 3B6MA 1QK3A 2RH5A 4IGEA 5JDCC 4DA7A 1E3DA 3I2JA 1H8HD 1W36D 2EP5A 3L6CA 4KFRA 2CZCA 3DEIA 3QX9A 5JPDA 1JLLB 4IFEA 4X4FA 1AHPA 3MHPA 1BE6A 1W5SA 3TW0A 3ZGXA 1XVIA 5K8LA 1CLUA 4Q9AA 4WKGA 4PO8A 4IXDA 1A7KA 4Y9RA 2FFJA 2ZI3A 4CM3A 5F12A 4PC2A 2N47A 3CEHA 5IWCA 2IPNA 3R8CA 3NU1A 5JD4A 3WYAA 1A69A 5AVZA 4BGVA 2PUVA 1ADFA 4N8SA 4YGXB 3PYXA 2QROA 1E7RA 2VH5R 4ZODA 2C8JA 3FDJA 1RC0A 2P75A 1FJXA 3PHJA 4BJ3A 1ZJ5A 2BFCB 3ZLVA 5JH7F 2YZGA 2O3UA 1NM5A 3L40A 4NVRA 1U3VA 1X7XA 4ZJUA 1Z4KA 3PPIA 3AC0A 1VE3A 5TB5A 3WNCA 4TVKA 1OFTA 1VBNA 4B5LA 1JHUA 1NW4A 1W4BA 4FD2A 4LCJA 1KYZA 1PFQA 1SXIA 2FETA 2F1KA 2Q2VA 1V6AA 3BILA 1X7XB 3BKWA 3G5TA 3PGKA 1JEAA 4FMDF 3T3OA 1VHTA 1ZRHA 5H81A 3HJNA 4HEA1 5BN5A 5EESA 5TQ2A 3D8HA 1BQ3A 3S7TA 3TI7A 1G6HA 4JQDA 2NYVA 4O4LB 4P54A 4C1NA 4RTOA 2Y1EA 1SCAA 4HH1A 4QDJA 1FDOA 3EVCA 3IQWA 1Z75A 3UF0A 4YXFA 3NONA 3FMYA 1Z62A 3A31A 1V5WA 1E0KA 4MEBA 3EYAA 3ONNA 2F4VB 3KXAA 4Z4QA 2H1VA 4Y9SA 4X90A 1Z4MA 1WB9A 2HH9A 4JVOA 1GP2A 3TPCA 3UYKA 1DV1A 1IUOA 2O23A 3NKFA 1I0IA 1VGRA 3Q15C 1L1EA 4Z8XA 1NBAA 3ANNA 5I9MA 1HQKA 1DIRA 4QBIA 1BMTA 5F5XA 5HIKA 4RS4A 2HLPA 3EZLA 3SDSA 5HHTA 5SYAA 1Q2XA 3L82B 4MICA 3E22A 2PG3A 4FMCB 2G9QA 3W8NA 4P4LA 3UAZA 4UVDA 4DV5B 3ZJUA 3EZNA 1U4NA 4U3JA 1O87A 3ASUA 3D6TB 1S9HA 5EVJA 2DWCA 2C7OA 3GJ0A 3DZGA 2D7DA 1EBBA 2I1LA 3QVGA 1F8GA 1FU8A 4EPVA 4UNIA 4Q1AA 3VOAA 3HJFA 3U9SA 3GI1A 3IHLA 4NESA 4WJKB 1KMQA 1V1RB 4X7MA 1N2XA 3UV3A 4EY5A 3V8QA 4BMNA 3O0TA 5EXTA 1Q15A 1QFMA 1MAUA 1XRJA 2VHQA 3OJFA 3QVGB 4KCGA 4OU5A 4I3FA 1FW8A 3V4RA 3K70D 3NNDA 4CVNA 1CUWA 3EMBA 3CECA 1IU9A 1EGHA 5EJIA 4Q1DA 1MIOA 3DD5A 5JECA 3RODA 2CF6A 4GPZA 2I66A 3Q88A 1O57A 1N2HA 1SNYA 5I9TA 1KVQA 1QH0A 1H5QA 1HE5A 3WQQA 1NYRA 4AN0A 1YZFA 1PW7A 1NURA 2HU5A 2NYUA 2VNJA 4II3A 4R2IA 4RV9A 4POAA 4B6RA 4YLYA 3OX3A 3ZD6A 3ZVLA 2PUHA 4ZV9A 1UPCA 2P3LA 1U9IC 2OCDA 4C43A 4CODB 1S1MA 2K7ZA 3T0FA 1CDZA 2FOIA 2MU1A 3C6MA 2WTBA 1YQTA 2YUIA 3EVNA 4QC2A 5HF6A 4BNTA 1XV5A 4G37A 4YRLA 2W6JA 3OZXA 5I8WA 5A9TA 4G23A 3ZNPA 3BDVA 2VH2A 2YMPA 1IC8A 3V1YA 2K2QB 2FVYA 1I7SB 1D0SA 3DAGA 4D3FA 4MI3A 1AKWA 3A6PC 1HQYE 4EZBA 2QL6A 5BSWA 3WYBA 3QNUA 3FM9A 4G4GA 1NVXQ 3WMGA 1S02A 1YB7A 2LYSA 5DM2A 1AB5A 3PS9A 3VTAA 3LBYA 1MC8A 1ZESA 1R0WA 5T41A 4ZK6A 1U0NA 1CZKA 1ESNA 5JFOA 1KVUA 3F5MA 4X63A 3WLPA 2I65A 4OB8A 2QUJA 3QJYA 4LJ8A 3WWPA 2YVLA 4AZ0B 1P29A 1L7DA 4JLUA 5CYFA 4PAQA 3EZYA 3I8OA 2WWYA 3IUBA 2A0KA 4DDMA 2UYYA 1JL3A 2UYHA 3KPVA 1UKVY 2F1HA 3RJTA 5DGIA 4QDZA 4BNNA 1OXBB 4B09A 1QBGA 3NROA 1GZ5A 1ZH2A 2X8WA 2FN3A 1X57A 2JFGA 3OF2A 4FYXA 4WCFC 3UFBA 4BASA 5B7NA 1BMFD 2YOGA 4YA6A 4EPTA 1UP7A 4PHFA 5AVKA 4DHEA 5JAQA 4GL4A 4LZAA 4YDHB 1L5OA 4FYYA 2PUAA 4YGYA 3AI7A 4HLCA 5DULA 2JGIA 4A6DA 3T94A 3ZWOA 4JZKA 4JUIA 3AVWA 2IQ5A 1ZD5A 2AFHA 3MS4A 4ZO7A 2IDKA 4RENA 1NX6A 5ETJA 4H1UA 3RKRA 4BKOA 1VRWA 4BS9A 5I7HA 2O8CA 1YIAA 4KWCA 4XR4A 2ZB4A 1CVLA 4W6QA 2C5AA 4RVGA 4CFZA 3DUFA 1MGOA 4RJJA 1Q3KA 1CCWA 2I6UA 5FR2A 1ODJA 2XCOA 1M1YB 1HM5A 1ZW1A 2F1OA 2OCGA 5FV7A 3ACDA 1IE3A 2UU9B 2ES4A 5DDIP 1W0CA 1TZJA 4WY5A 2NUAB 2A1IA 3ASYA 4P38A 1FW6A 4QLAA 2O0LA 2V6JA 5EEHA 2HY7A 2YIVX 2WYOA 3PZRA 1G3MA 1Z4IA 3ERCA 1BHJA 4QPJC 3OWXA 1AQUA 4QFBA 1VPVA 3V1UA 2K6GA 3ENNA 4URWR 2X76A 2XNSA 4CQMA 5A02A 3QUTA 1Q1NA 2EFJA 3OX1A 3C3JA 3CMCO 1MPXA 1R0KA 5B12A 1L8OA 4MPPA 2WTUA 4ZTZB 2JGMA 2V0GA 3FE2A 3FROA 4QYTA 2GJ9A 3B89A 4OXIA 4CQMB 2EF1A 2PMFA 2Z2XA 2HQRA 1EQAA 1R6TA 3B12A 5FPHA 4F72A 5F77A 4X44A 2J45A 2J67A 1UC4B 4ZZ2A 1Z0DA 2ZI9A 3AOGA 3DBOB 3G0OA 3HKDB 1TX4B 2QMZA 5CT6A 4Q66C 2FPLA 1M9NA 2XITA 1QH9A 3WNDA 3B1KA 3SYNA 1E2EA 2QM0A 2CXQA 4B4WA 4H2DA 4X7BA 5DYNA 1NG9A 4EHFA 2OFYA 3IP8A 1P74A 5E4YA 5A5DA 1F9EA 1L0BA 1YNSA 2AWOA 1Y7PA 1R6VA 2VYQA 4UM8B 3NVKI 1S2NA 3PDJA 4KTTE 2RHDA 2XSZD 4QG3A 2BMDA 1VMKA 2Z6QA 2VTBA 2XR1A 3GBVA 1RYNA 3INTA 3L18A 3B9BA 4FYKA 4RVDA 3T35A 2BGWA 4YX9A 5MDHA 1ZZ6A 3SM3A 4BFVA 2V9ZA 3O1IC 3EW7A 5JCOC 4ER7A 5FBWB 2VTBB 1GPMA 5HFNA 5F9HA 1SUBA 1FSSA 5FFFA 4DQKA 2M1XA 4CIYA 2GEUA 4CLXA 1Y3IA 2PXDA 4W8HA 2VXYA 4BEBA 5A1JA 1MIHA 1UBGA 2VRCA 4IEFB 4RPIA 4JL8A 2M2IA 3D5EA 2QB5A 4L15A 2ZAIA 4RF2A 4G24A 3X1DA 2B21A 1KY5A 1UC5B 4AVYA 1MG5A 5KQLA 2O38A 1G38A 3OIGA 1G3QA 2V7EA 2WOJA 3OOWA 5DEOA 1ULZA 4I6UA 4YP6A 4NX2A 1PF7E 2NTVA 2HWYA 4JJ6A 3GZCA 1ISSA 1CUHA 1K5PA 1XKTA 1H22A 2EBUA 3KAQA 2VDPB 3LBIA 4IIVA 4QFCA 13PKA 4QNNA 3QBVA 2X6RA 2YJTD 1TZ2A 4NSNA 1LSSA 3JATA 4Q37A 1XTIA 5JS2A 1QB8A 3D1JA 3MEQA 1P2DA 1KERA 3UCXA 3DPSA 4RKFA 1XT6A 3IEKA 4TYPA 5TVGA 4EAAA 3OP9A 5SICE 3VSEA 2GYYA 3K2QA 4FFRA 4A2CA 3DMFA 3CWCA 1PP4A 4XYMA 1EJ6A 4D81A 2C88A 1XVUA 4XFDA 1Q11A 3FHOA 4DMKA 5CEFA 5I4IA 1FMFA 1U0RA 3M0EA 4B32A 1N5DA 4IJMA 4ZCIA 2DECA 3GK3A 4DRZA 2G09A 4QBGB 5KU1A 5A5EA 4EARA 3AJEA 3KEFA 4WNAA 2OHVA 5AMXA 2BZ0A 2A7QA 4AXXA 1JEDA 3AERB 3VGJA 3X1MA 5K0GA 5IVIA 2CLLB 2FSSA 2RHOA 5TXGA 1QR2A 3A1DA 1K9VF 1CZOA 4NS1A 1A0OA 2XNKA 3ENVA 2O8EB 3MCTA 4OM7A 4U5XA 1MVLA 4DPKA 3FTQA 1N2GA 1SQ5A 2WUGA 2PXKA 3KQMA 2B3DA 1QFZA 3ZH2A 3OICA 5B6JA 4OSPA 1G8HA 4B2YA 1X80A 3T41A 3OPYA 3SHTA 3ZDQA 4EABA 4MKZA 1QAMA 4F4DA 5AJHA 1KHHA 2P5UA 3EGCA 4KO2S 1JR3A 1N0UA 5K2OA 1XQ1A 2VQ3A 2YOFA 2GRLA 1UBJS 2WAAA 4ER0A 1IQ0A 1Z8DA 1W88B 3BZUA 5A3JA 5CLFA 5GAHi 2RONA 3Q0EA 1LC3A 4ESOA 2GJ4A 4A6EA 3GBFA 1ICEA 1ZJYA 4KLRA 1M2GA 4UNSA 3JQRA 3D1VA 3PCRB 1T1SA 3UK7A 3RS0A 1AX9A 1DBPA 1FP4B 5BRNA 2H06A 4BMCA 2O5EA 4I4CA 2IXEA 4P33A 1K6EA 2NV2B 2WG2A 2PX6A 3B48A 2VR1A 3VZSA 1FDUA 3AFNA 2CE2X 1OREA 1EA5A 3V8NA 1YF3A 1ELOA 2EZUA 2G1AA 4BAUA 2CGEA 3B3AA 4FDUA 3O7MA 2B3TA 2QMOA 1NRXA 4DDWA 2E6KA 1Z47A 2GM9A 3DBRA 4FNGA 4UCQA 1UXJA 3HWSA 1DQSA 2GWRA 3B2EA 3TLCA 1O89A 3R7WA 3D3NA 2QMUA 1KVRA 4AY5A 2O8CB 4V3BA 3DBRB 1TJ3A 3QUAA 4BKPA 4MGKR 5JZSA 3MTEA 2WSBA 3N2LA 2X13A 3EC1A 3R7WB 4CCSA 4QIHA 1L7XA 2RSLA 4IIXA 2ISQA 5CVDA 4AJKA 3M49A 2GN6A 1IB6A 1KO8A 3O3CA 4TUYF 1X86B 1ODCA 3QOFA 2J0UA 1R6XA 3DOIA 3FG9A 5DXFA 3TWOA 4QICA 2MSWA 4JLMA 4PSUA 3C3CA 1TL7C 3EEQA 1KEPA 3K5PA 3ITKA 2D74A 2AG0A 4NG4A 2AXQA 3B3QA 4MVWA 1SXJD 4DCNA 2J0UB 1SBTA 1V3QE 2R1VB 2WJPA 3P4YA 1XRQA 2YWJA 3FHJA 1TADA 1UFVA 2NZJA 2PT5A 5G3YA 3VZRA 2W00A 1JDPA 1MKYA 2WAMA 3AEKA 3EUEA 3NWJA 4WK6A 3ZVRA 4YJFB 2SHKA 1JKXA 2PMCA 4GPAA 1TM3E 3NTOA 4KOEC 4IP0A 1Q95A 3OOSA 1G8SA 3KQSA 2W2MA 4MLPA 1M75A 5FTKA 3QMVA 2I34A 3AEKB 3RO7A 2W5UA 3N0TA 4S1TA 5KYYB 4II2A 4QTXA 4U4AA 3WLMA 2OHXA 3D3WA 1X9IA 4NU8X 2ZITA 2I4NA 5I7AA 3FX2A 5EP3A 2ZJ0A 1GPAA 2PQ2A 2JFBA 3SX0A 2C5HA 2QNBA 4ZHQF 2VJPA 4OHMA 2UVPA 3IPLA 5FHRA 1E3LA 3TEFA 1UQRA 4JBYA 3TLGA 4FEEA 2AUWA 2CV2A 4F9EA 4H7KA 3IB3A 2GR9A 3N2NA 3PWZA 3GELA 2Z2YA 5AR1A 3ICCA 4Z5XA 2PCJA 1ETUA 1DDOA 5JH7B 1T0UA 1DIOB 1TO6A 3BFKA 2Q21A 4MUGA 4L4UA 4IX1A 1E7YA 1CIJA 2VLIA 1WMSA 2RKOA 1ODIA 3CRW1 2HCNA 2C2HA 4PE5B 5LBTA 1DTWA 1S7EA 2YQ5A 3BJRA 3JQAB 1WV1A 1NYLA 5THQA 3KZXA 2RGDA 5J59A 1XCOA 4INPA 5CCEA 5FWYA 1U2GA 3B1YA 1NQUA 4FMDB 3ND6A 4YAWA 5DLEA 5ARCA 1DTWB 4Z7OB 4KX3A 4JVSB 1TK3A 3BM5A 1X19A 1ZHHA 2GARA 4TMXA 2ZRAA 3GRVA 3UT0A 1WIWA 5T4EA 1DLJA 3EF3A 3B78A 3WK5A 3K09A 1P1FA 4H35A 4CQJA 3WK6A 1GAQA 4QWWA 1B6TA 3P9CA 4XYLA 4DQVA 4YBRA 3EFEA 5E6SA 5EL0A 5CDYA 3QA9A 2HDNB 6YASA 1CDOA 1L5SA 2IYLD 3KSMA 3L7DA 3Q5GA 1BW9A 4WBXC 3EC7A 2WMYA 5AVXA 1FLVA 4MYUA 1DKPA 1W6RA 1JG7A 2J3MA 3BJEA 3GGCA 1HZZC 1EA7A 1QLWA 1UDCA 2G80A 3TLBA 4XRRA 3S5UA 1JW9B 2I7TA 3NAZA 5JQWA 2P77A 4BAZA 3UV7A 1L4KA 1P1RA 2A4KA 1Q0TA 2FHPA 4IS2A 2J0VA 2VF8A 3K0BA 4K9QA 1SUCA 1FU4A 2B8JA 2WB4A 2C4MA 1VZ3A 3C6KA 4HYQA 1Z6TA 4BBAA 4OX9B 2NMVA 3HXLA 2AIRA 4Z9YA 5HWSA 1YK0A 4BHTA 3KCNA 1BDMA 1QIMA 4JLOA 1SR8A 3S29A 2L69A 2HYIC 2FWMX 1EZ4A 1G6OA 3BFVA 2TMGA 3BTUA 3K0CA 2CLMB 1DUIA 4FS8A 4UDXX 5D3MB 3QY9A 4DXAA 3P0RA 4BXOA 5CFPA 1YAHA 3ZUPA 1XUOA 4ENVA 2OZLA 3OOJA 2GK6A 4MHOA 5ITZA 3W9UA 1JKFA 2YICA 2HSZA 4Q4LA 4RDIA 1USKA 1SQ6A 3VYUB 4GQMA 3Q9NA 1U31A 5DK4A 1FMCA 3EA0A 4KV9A 4IJKA 4RQTA 1PUJA 5E4TA 1SELA 5ITZB 1NGSA 3CCFA 1LEHA 5IAGA 1NOKA 4IJUA 5HZHA 5LMNB 1NW7A 4AP6A 1L7NA 1UODA 3RUFA 2LIVA 1QYXA 3NXKA 3MS2A 3MMXA 1N0HA 3TNLA 1RNLA 1NMZA 4AP9A 4P98A 3K5IA 4PYMA 5AT1A 2IEGA 3FPKA 4DLTA 4BEWA 2FRXA 2GBPA 4QO7A 1A8PA 3ZV6A 3ZLTA 5GZ1A 4L16A 1G7TA 5KWIA 2X19A 4WKNA 2IEDA 1ECCA 2HHJA 1JBKA 3CE6A 3KRTA 5JLAA 2XWJI 3V6LA 3MMSA 1T3LA 1M8JA 3MCVA 3QYJA 3HCRA 3T5AA 5K01A 1OWNA 2ZIXA 3AEQB 2EJWA 3IUQA 5AM5A 5J2UB 3UYLA 1K4KA 1YL7A 4DA6A 3LT5A 3HK2A 1RLUA 4KN5A 3QMMA 2FZCA 1ZM9A 4EJ0A 2DC1A 4URUR 4XPIB 3W9YA 9MHTA 2PSJA 1GPJA 2VK1A 4MYSA 3PQ7A 1PNQA 2ZIXB 5H3CA 4DA8A 2A6CA 1ZZCA 3HP1A 2P9CA 5CDSA 4FHEA 3UCFA 3OY2A 1CY8A 3CR7A 3RRZA 4UBNA 4V39A 3V1NA 2PV7A 4AWBA 3DB2A 2REOA 3HCPA 4DMUB 2BI4A 3LQYA 2IC5A 2DHEA 1VIYA 2CNOA 2Q6OA 4WKBA 1X7WA 4C6RA 4LMAA 2DH6A 4Z3OA 2ZYAA 2D2XA 5KIAA 2RGUA 1VM6A 2XNDD 3T99A 5KJCA 1RZUA 1HEYA 1RWNA 3A04A 1TAHA 4HGRA 2HPAA 4ZEOA 1SKMA 1X7WB 2HIMA 3P9KA 3V1TC 1IOWA 4DY6A 2WIKA 2CNWD 2FZWA 4GQBA 4X97A 4PO1A 2GJ8A 3ZX4A 2XZPA 1YS2X 4Q18A 4MRPA 5BQOA 5HK9A 5JC8A 4UTRA 3I28A 3N2KB 4Q3CA 2ZI4A 3AJAA 4WLVA 3QMPA 1UMDB 4DG8A 1GADO 2A9JA 4X1YA 2FWNA 4UTNA 4B3MB 4YXWD 3NTUA 1PVVA 3TH5A 4IQ8A 1EK5A 4HUTA 3K6KA 1HLPA 3K9HA 5KJ1A 1RWWA 1FXSA 4FB5A 5T7BA 4X1YB 1KK2A 2Z57A 1EAYA 4KJXA 2RHLA 2EFHB 2HX1A 4CL8A 3PC4A 1XMQB 1CY1A 2K4MA 2SCUB 4I6JA 1RIFA 4JBIA 3ND8A 5J5CA 1MAVA 3T3PB 4REMA 4AO6A 2ZKLA 3U4DA 1RRPA 1EDZA 2CMFA 5K0JA 4QGFA 4NZYA 2AR7A 4PF1A 4KXWA 2D2EA 3DDOA 3C1UA 4RLQA 3GD5A 1J22A 3MGKA 3AI3A 3M8KA 3ZDBA 2NZ2A 2PZMA 3TELA 3AONB 4YCJA 4OH1A 3HR8A 4YJHA 3E3OA 4U7PB 3BSYA 2HWUA 4UUPA 1QIIA 1FK8A 2XUHA 3G1TA 3ELBA 1YJAA 3OA0A 2V97A 3BWVA 3PFNA 4GBMA 1M6EX 1QOQB 2ZTUA 4IA8A 1KE1A 3UJPA 1PJLA 1GN8A 2V3WA 2Y1LA 3NVDA 2C4HA 3HP7A 5IX8A 2EFEB 1UJBA 3PWKA 4MCIA 4HADA 1C7RA 3A28A 2I1VB 1GTJ1 3KLNA 4I5DA 1P4SA 3KR1A 2CMKA 4LIPD 3CKYA 3DVSX 2J87A 4OP3A 4YAJA 4MS3A 3TKLA 1LTQA 1RRGA 2AG8A 2OBBA 5ERYA 1I1NA 3VU1A 4EGAA 5JJ5A 2B8NA 3KEQA 4WEOA 2AW3A 4RHTA 1XMJA 1Z5PA 3NRJA 1AM4D 3AP3A 1Z2CA 1TFRA 1FSGA 5AW9A 3SS9X 3IDAA 2B8TA 4I50F 1RC8A 2BFOA 2HHLA 5A6SA 4G5HA 3ZDAA 4G86A 1Y81A 1DXOA 1Z5OA 3NFYA 1ZGHA 4D4KA 1AGYA 1C8VB 1GQRA 2DLNA 5EINA 5ALIA 4POOA 1Z82A 1R15A 2JH8A 2VJOA 1ULUA 1ZDMA 4KWHA 4RK4A 3K31A 1VIDA 3WIUA 4RS3A 1JHVA 4HWTA 5CFMA 3TPZA 2HJHA 3KSUA 5EMJA 1EVEA 1KZYC 1Z15A 1E3JA 4OI1A 4AIRA 4EHDA 4FI3C 3ADBA 2PRSA 4US0R 2JI4A 4FGLA 3ROQA 2HEGA 5LJIA 3TG8A 2H8RA 1WG8A 4LC0A 2RGAA 4XX0A 5KB3A 1TLTA 5GINE 4J43A 1IYZA 4DREA 3NX4A 4LZLA 5KPJA 1GTG1 2WU1A 5KOJA 1DAEA 5EXXA 3TBHA 2HJGA 5C8ZA 3CTPA 1PGOA 1CZUA 1U90A 1DPFA 3D9QX 1WO8A 1CQJA 4ZCQA 3T7TA 3U81A 1JA0A 1PK9A 5CUQA 5A4MS 1TJNA 1OKKD 4FN3A 1B3RA 2WKQA 5F5NA 4C0BA 1DCFA 4KK4A 3RS7A 1NNI1 1ZSNA 4W8OA 3VDRA 5KHLB 1W4LA 1GZ4A 4DR3B 1N3YA 1CQJB 3RVNA 1UJ2A 1I2DA 3IXMA 5UKDA 2VAMA 3NYIA 3VMFA 1KVTA 1SQ8A 4RULA 3OA2A 2ZIFA 3MJ4A 1QWOA 3RAJA 4Z5HA 1L1RA 2OCIA 4MUIA 4GLOA 2VRWA 3KJGA 4O59O 1WW2A 2P1DA 4DYVA 4N3BA 1UH5A 4U7DA 2Y4OA 1CFJA 5H5JA 3CEJA 1XZLA 2QX4A 3ADPA 3D2BA 3ABSB 3E9NA 1VSUA 3FWNA 5KUTA 4L02A 2KPJA 3KX2A 2WF5A 2GPSA 4LE0A 5AVYA 1VP3A 5GAGi 2JCSA 2PANA 4XPZA 4OI4A 1HI9A 4HG2A 3GJXC 2N75A 5JG7A 2VRNA 5BNWA 3RYHA 2UYCA 2IYZA 4KQHA 1G55A 1U8XX 4P22A 3SFTA 4P7FA 5J4HA 1KEZA 4KLNA 2JBWA 4F85A 1CV2A 3RYCB 5HTKA 4CEJB 1Q14A 2EKPA 2ATCA 1GCGA 2JLRA 4MQLA 5EUQB 4ZO8A 2O0KA 5TPWA 4CIWA 1CUDA 2ON6A 1QIJA 1PWHA 1WUKS 2NQTA 1BFUA 1UK8A 1QO9A 1YS4A 1U2TA 2LCIA 2P9HA 2XQJA 4FR2A 2CF5A 4JLNA 3HXMA 4A26A 4KVFA 3F7OA 2BMJA 3LG2A 3DL0A 1WOYA 1EWYA 3NDPA 2YYYA 4JIMA 4PLYA 2PGLA 1FVFA 3QVWA 4EB8A 1DADA 3N1UA 2XXAB 4DCCA 1OYYA 1G5PA 2FSPA 1QV6A 2QAGA 3GZDC 5G1PA 3F4LA 2R48A 4Y2YA 4A2PA 5K4HA 4XI9A 3QLVC 2R6DA 4EB6A 3HYSA 2ZXFA 4ZVLA 2M1ZA 2QN2A 2ECFA 5H80A 4DQLA 4XW2A 3IIJA 4IKOA 1WSAA 3SDZA 1N77A 2JKVA 2W2LA 3VVCA 3VJMA 1YJ5A 1OT3A 3TRBA 1AOXA 2IZ6A 3FUCA 4Q39A 1NLUA 1MJ5A 1DV2A 2Q3HA 1H4QA 1FUEA 2WD9A 2CLSA 3GWZA 3TGLA 3C8DA 4M0EA 3I6ZA 3WISA 3DWEX 3HABA 4PANA 3FOZA 2PH7A 4TUYB 2GLXA 1N7GA 2HWWA 1VOTA 4FOLA 2BJCA 1OA1A 3VWSA 4C4XA 5FJJA 1PJTA 2AMYA 2PLRA 1QIEA 3CUUA 1J20A 3F7TA 1H69A 4X94A 3P27A 5DV9A 5EZ6B 4AY2A 3SC4A 2NXJA 3B9PA 2ZZKA 3BK1A 1P5HA 4FFDA 4IVQA 5C4GB 3L0IB 2DULA 3W2HA 1V11B 4BP9A 2C2ZA 3ADOA 2EP8A 1XTJA 2CLHB 1R8SA 4PNPA 2WWVD 5EFOA 3JQ8B 5DB4A 3NBQA 1MENA 2UYQA 1QO7A 3HLTA 4ZXFA 4A1OA 4DL9A 1VTKA 2GCOB 2QAIA 4ZHQA 3FWZA 4MVJE 1FFWA 2VYFA 2WHQA 3IJEB 4MKXA 1HDXA 1YUMA 3P94A 4EA8A 2GXUA 1MC1A 1W59A 2GOYA 3G5GA 2W90A 5EMLA 4D6PA 4ZHQB 1Y89A 4FDVA 4JLSA 2OFXA 3T0GA 3GBSA 4QO8A 3LSTA 5KS2A 5AJWA 2WTEA 3ZBTA 1JE1A 1EPUA 3KOYA 3ZJTA 1XLTC 1NUAA 4E11A 5REQA 4C7JA 1U9CA 3LX8A 1Y6FA 5HCIA 3WRYC 3P4XA 5BSHA 1SO8A 1P0FA 3UM9A 2X8LA 4PG8A 3KWLA 1Q1EA 5REQB 2Q5QA 1L5YA 5FLYA 1C7JA 2DHRA 3GZNA 3HYCA 3H87A 1NF9A 4NDZA 3GGJA 1V2HE 1OHHA 4MOWA 2P7HA 4UE6A 5JJCA 2AFVA 2XDWA 1DINA 4F71A 4B3CA 4DEYA 4YP5A 3DM9B 3F46A 1KFEB 2VSNA 2R6GA 2BNOA 3EEIA 1AUPA 2VN8A 2D06A 5CPBA 3HBMA 3GEMA 1OGIA 1CS0B 1MRNA 4W5JA 3ZLBA 4MWZA 4HP8A 3CR3C 4IR7A 4OJMX 5CTJA 3D1NI 4BFUA 1SCBA 5BRJA 4LFAB 1RZSA 4U1RA 4NOKA 2QUHA 1I14A 1Y37A 1UWLA 2YYZA 5SV2A 1FL9A 3AO0B 2PNJA 1FNMA 1SHKA 3RSLA 1JAZA 3TW6A 4XJTA 4X64B 4ZDIA 1QH8B 2CVPA 1HMYA 1RWQA 4N3CA 3O2QB 5HCUA 2GAOA 3FZEA 1ODLA 1UCFA 3GVHA 3UPDA 1JXAA 1VG0B 4LBWA 5L3RA 2XA1A 1C41A 4TVSA 5CX1A 4HQOA 2I4IA 2W11A 3C14C 4C1BA 1O94C 3B1FA 2ZCJA 1P45A 1EFDN 5EIWA 5J4YA 3S8QA 2Z08A 2WB2A 3CEMA 1Q0PA 3U4QB 5H3LA 2RH8A 2F90A 5CX1B 3TUIC 1W30A 4RTLA 4OBXA 5G0UA 4F3RA 3E0QA 5B2EA 1FNNA 1UFQA 5EPEA 4CUZA 1DMSA 3AT1A 5I4BA 5GZ3A 3U17A 3RT9A 3MMNA 1NJ6A 4DJEC 4JXXA 3UKDA 2F9MA 3HU2A 4BB6A 4RELA 3O3NB 4Y2RA 3TQOA 1M2WA 4GL2A 5K0LA 2POQX 5T67A 4X95A 4Y6OA 1AKEA 3AF1A 4TVBA 1ZD2P 1Z7WA 2DSTA 3JWGA 2ZAGA 4FHDA 1GQYA 4DGQA 4DCMA 2H1OA 2FDCA 2LR0A 3D4NA 3H1EA 3HB0A 1YCDA 1BXGB 2Q5FA 3PEUA 4EB3A 2XHEA 2J4FA 4FFBB 1E9AA 1CY7A 1EVLA 2C9YA 3PNSA 4BB9A 4CLOB 5IAOA 4QKQA 1YHZA 5JAPA 5BOSA 5CCBA 4RYDA 1GQFA 1ORIA 3NRBA 1HZJA 4GP7A 1D5WA 2ZWPA 1U2DA 2CKDA 2IPMA 2XDAA 4URFA 5JFTA 2QD2A 4XFJA 1AK2A 2WM2A 4NFSA 4RVSA 2Z8YM 3M4NA 1XTQA 4W7IA 5TS2A 3DAHA 5TGZA 3I9FA 4OXRA 3TF5A 1W8IA 2BEUB 5P21A 3VO2A 2VQFB 5BSEA 2ZJ4A 1G20B 3JWPA 2JLQA 2DUNA 5BNZA 1G2IA 2IDMA 3PXGA 4NBLA 3U62A 1ST2A 2VIIA 2DTXA 5CU7A 2Q49A 1ISGA 1QGYA 2FFRA 4FE4A 1TEVA 3RLIA 1MLDA 2YY5A 1K0UA 1OBOA 3AI1A 1WB4A 4NYMQ 3S2FA 2IHJA 5AW6A 4CEIB 1NV9A 4I8TA 1XA3A 2HUNA 2C00A 4UVGA 1KI9A 1JVSA 3BWEA 3EXG2 3K32A 2FWJA 4GD3Q 1PCXA 4PV7A 3OSZA 1E89A 2NT4A 1NFQA 4GI3A 5J4LA 2DPYA 2E18A 4EW6A 4WDQA 1C2YA 1M6NA 1VHWA 2VUIB 2XCIA 3KO8A 3R5SA 2VQSA 4PBRA 5A4IS 3T3DA 3UMMA 1RM4A 2HQBA 3LCCA 5ALTA 3SP1A 1RYHA 1CT9A 1MQAA 3ZGVA 2FWPA 1JHXA 2FSVC 2AOUB 1K2WA 5C7IO 5LQNA 1SG0A 1OLUA 2YDYA 3L4JA 2QVBA 2ZRKA 2IP2A 2OCXA 4TQUS 3NANA 1PLLA 3VPAA 4J6EA 4XWTA 1RXIA 4C0KA 2HC9A 2WV7A 1Y80A 2UUCB 4UKDA 3QU9A 4CM7A 1PJSA 4M9QA 3AW8A 3EQ6A 5EIHA 2W0SA 2DR3A 1A72A 3FZYA 2ZVJA 2V7PA 1C5KA 3GVPA 3O26A 4OHPA 5K8UA 3CLSC 5AK0A 1RM3A 3UJBA 3WAGA 1RCUA 1EUYA 3X1YA 3ABZA 2XY4A 3D0KA 4CKEB 1C3EA 1YHNA 1E18A 2VJMA 2PX3A 1VXOA 1QPGA 2H7CA 3IOCA 4J7UA 2EJVA 1V5GA 2BISA 2OEPA 2B82A 4LGMA 4QPZA 2BYTA 3DH0A 2QRGA 2YNMD 3MT9A 3OFJA 4G0YA 2ZTSA 4GI2A 4XIJA 4YAFA 3OT4A 1FNDA 3ILXA 4QNMA 4RA6A 3BORA 2ZIVB 1RKQA 4S24A 4XA8A 1YR7A 4CR8A 2RD2A 2GYUA 2BM8A 4OB4A 2R9VA 1GUZA 1XD2B 4KN8A 3JD4A 1XEXB 4WXYB 1L4YA 4EJMA 1JB1A 1XNGA 1UBCA 2AYZA 3A6JA 3OJCA 1AXEA 2TRSB 3AIIA 3GFTA 4QBHA 4EI9A 1TGYA 3GRUA 2CL0X 2VPTA 1K63A 1NOJA 1LLDA 3BA6A 4I81A 4OD0A 3KT0A 3CNEA 3CG4A 521PA 2H3HA 1JEQB 1SC4A 3MEJA 4R3NA 5FD8A 1NFRA 3MG9A 1LI7A 4GEGA 4YR7A 2Z8YA 4GP9A 3P7MA 3S7ZA 3AETB 1RT9A 3L43A 3WBJA 4RD6A 3S2EA 2ADMA 4W9NA 3D8RA 3F3YA 1PT7A 1BS1A 1E7SA 1T1EA 4M36A 3QFHA 4BNGA 2ONZA 3OJ0A 1OI4A 1EHYA 2OXFA 2QRPA 3WMXA 2VLBA 4JP8A 1NQVA 4OKNA 4I50A 5AXCA 2JAWA 4FCTA 5HS4A 2X8JA 1ZPQA 4HH4A 4A0HA 3RB8A 3CX6A 3P9PA 3QXHA 1TVKB 1ZM2A 3A9SA 2I2CA 4I50B 4ZTUB 2X8JB 1MDFA 1TKRA 2NSDA 1XWWA 3AX6A 4WI1A 2Y1DA 5DGHA 2IPAB 3EDMA 4WADA 2NO0A 4BZXA 2DPHA 2ZJZA 1UFOA 2NUBA 1RIIA 3PFKA 1XZQA 1A9PA 1JAHA 5T6MA 3L46A 4R1QA 3UMFA 4EUSA 3ADKA 4EG4A 3M6VA 3KJNA 3W04A 2ZATA 4YV1A 5FUVA 4EBFA 3VYTB 1P4AA 2DYKA 2PU5A 2YWGA 1WOMA 3LCMA 3ZU4A 1UXCA 4JC0A 5IXYA 1Z34A 4BNDA 2RHRA 4J1TA 3MWDB 3Q85A 1W0JD 2FK8A 2I4RA 3PKJA 3BHJA 4KVAA 4MUEA 4XTRA 4DN6A 1QB2A 1RI1A 2X1VA 2JIZA 4NATA 3U4GA 2J48A 2J9FA 1IOVA 3A6EA 4NTZA 4DR1B 1KGDA 3ZIAD 4M0PA 3LO5A 3AIMA 3SSOA 4EG0A 4ZAYA 1N9ZA 1W44A 1C9KA 2SBTA 2H2WA 3WGHA 5IZCC 5BR8B 4IYJA 4CE6A 1QS0A 1DJOA 4UU7A 1V16A 1AV6A 1U7PA 4JX8A 3JQBC 3OUUA 4FUTA 4QDTA 1G2PA 5FNVA 3GP8A 1E1MA 3LUPA 2NNLD 2IVFA 2AJBA 3HL4A 4L75A 3IIMA 1EDDA 3M3HA 5EP4A 4D0RA 2ZBQA 1RI2A 1Z2OX 4DZRA 4JJ7A 1VYTA 1X1EA 3UA3A 3E9QA 1BX3A 3TEMA 3DLHA 2ZRLA 1E0SA 1GZUA 1K7SN 1LDEA 3PIDA 3QVKA 3WFIA 3ANXA 1CRZA 4YI5A 2ZT8A 4LGVA 4N5MA 4CGYA 1Y9AA 3Q6NA 1MNAA 2X9QA 1K06A 1M0TA 4I6EA 3ZVNA 5H0IA 4KXQA 2Q41A 4AY3A 4YJGA 3GRAA 1G17A 3G23A 3LT0A 5DWVA 4DYHA 3NIDB 3HFRA 1QZTA 1Y8ZA 1MABA 1Q74A 1P2GA 4X8OA 1QORA 2J46A 3FYTA 3R3UA 1LXCA 1QP8A 3U80A 3VJLA 2WSMA 1W46A 2Y92A 3DDUA 4P7BA 5BVGA 2B1QA 2B2CA 3W5VA 6ABPA 2UZ1A 4G4SO 1OYOA 1MO5A 2PX4A 2WBLC 1Q21A 5GJVC 1XJ0A 3UZUA 1MABB 4NZOA 1ADRA 4DARA 3P96A 5DOVA 2J3JA 1OXXK 5LP1A 3OWHA 5BVGB 3ELYA 3IHWA 4M53A 3H86A 2FMTA 2AX3A 4B3FX 2E4ZA 5I9IA 2V6MA 3AUUA 4HX9A 3UPUA 3UH0A 1LPAB 4YUWA 3ZVMA 4V0KA 3RIYA 1T9BA 4PGAA 3RUDA 1GPNA 4NMMA 5B7GA 4LJLA 2JEZA 2OYRA 1XN1A 2PQ6A 2A2ZA 2JGJA 2IITA 2ZRBA 4R71A 1HFJA 3PPVA 1PL7A 1B3BA 4B4UA 1IWPB 1QGZA 3WL4A 5J58A 3D1LA 1G16A 2IPOA 1UDAA 3G6WA 3LUCA 4EMSA 1DC3A 4MX8A 1F0PA 2XZDA 6Q21A 1QR6A 5JARA 1RYEA 2WQZA 4EUFA 1NBOA 5FFMA 2G6TA 2OQIA 1CU1A 1ZBDA 4Q9NA 3UPTA 2PZGA 2X7HA 1IN1A 1CUCA 3N39C 4TV8F 4XCXA 2IOYA 4PHCA 3UH1A 3FVRA 3LOQA 3NS7A 5HMLA 3WIVA 1PBNA 2ZAMA 4BPRA 3E1KA 5AIBA 2FSHA 3GLRA 2BBOA 3HN7A 4NONA 5BW5A 1RHQA 3JX9A 4QTZA 4PM4A 1MZPA 3TX6A 3H5NA 1KY3A 4N8DA 4MO2A 4TMVA 1BDJA 5B7QA 5AHKA 5KWJA 3W6UA 3SVZA 3RBZA 1CLEA 4KQ1A 1SH7A 1IWBB 2BGMA 1LJLA 3A1TA 3MYYA 4TQAA 1FFAA 1P3DA 4LWQA 4W1RA 5CJJA 3H13A 3T7EA 4TQGA 2C3PA 3V7WA 2P6NA 4J29A 3O7WA 5TJ9A 3SPXA 1XDWA 4GSYA 1AUVA 1AIPA 2H8GA 1U2RA 4MR7B 4DV4B 5FORA 5LLSA 1CUFA 3AF6A 5CRIA 4K40A 2I3AA 2BPOA 4ARSA 3EUFA 3DZFA 4BNKA 2NUTB 2Z1MA 5TARA 2H63A 1R4NB 3GQBA 3UWKA 1SEVA 2Q2OA 3NHBA 4G41A 1XZGA 5U4XA 1KO7A 4IHJF 2BCEA 2NX2A 1F8UA 3ON5A 5M3BA 1A9ZA 4R5MA 4RJTA 1DWPA 4WKCA 3GQBB 4DZTA 2BMWA 3I2YX 2Y1WA 2R6CA 5HBRA 4EOGA 2I03A 2J3HA 2DQZA 3WMWA 6ADHA 1X1SA 4PG5A 2JLZA 4PXSA 3A4IA 1XXHE 2AW5A 4NZ9A 4RH1A 4DADA 3E5HA 4RKRA 1SQSA 2P4QA 3BBPA 3QBTA 4J0CA 4EY3A 1CJUC 4C30A 1TA4A 4TWRA 1DJPA 4GNRA 4A6PA 2OHHA 2V6FA 1IY0A 3FZGA 5E38A 4TTJA 3BMOA 4ABTA 1EUQA 3SQDA 2QD5A 4K9RA 2J5XA 4FILA 2OBFA 1OU4A 5LB2A 3L9WA 3A9RA 3WGNA 3WA6A 2IGBA 2P6MA 4P4SB 2IHUA 2ZSHA 4KO1S 3WKCA 1JQKA 1WCIB 4LSGA 4GQAA 1YK1A 3X1ZA 2GI4A 4FFLA 2VDJA 1U1DA 3FR8A 4JGBA 4Y2XA 3WK8A 3QRWA 4V0LA 2G67A 3JW8A 4G4JA 3BTSA 4Z9FA 5CM9C 1DI0A 2ST1A 5FI5A 3VH1A 3WHKA 4ENQA 5DI9A 3GYGA 3VU9B 2XXBA 2CLIB 2ZUDA 5F73A 2Y99A 1HA3A 3OOEA 3AVVA 3KNZA 4QTYA 4O29A 5CK4A 5DT9A 3ANLA 3JQ7B 4WAUA 3FBWA 3R3SA 2AUTA 3SZLA 4FBLA 3AP1A 3GAMA 2I76A 3CUWA 4MUKA 2H2IA 4B7XA 3TGPA 4RTRA 1ONBA 1Y7TA 1C7EA 4ZVMA 4XLLA 1CK4A 4D8VA 5T6BA 1NVTA 3UN1A 2QN6A 4R8KA 3CUTA 1N6PA 2QGNA 3KJFA 1E9BA 4AI6A 2JDIA 1GU1A 3FY4A 4Q6BA 5G4KA 2J07A 4QFMA 1PFWA 3ETEA 1MB9A 3CW2A 1P73A 2V4ZA 4P2GA 2AN9A 2VDRB 4PSVA 1UOQA 3LJKA 1LWNA 3DOJA 3BZWA 1NXQA 2D5AA 1JE0A 3JXBC 3FDFA 4ONEA 4L3OA 2NZXA 4E94A 4TZ0A 1VLJA 1DZ3A 1H6CA 2PNFA 2LYRA 2WSSD 3NOVA 2MYTA 4KACA 1G1MA 4MUFA 1QDEA 1TCCA 3PFBA 1GTSA 2VNAA 4EJFA 4MP6A 1YZKA 2VWGA 2D5CA 1U81A 4DIDA 3BWBA 3T8YA 1NVVQ 2YJGA 3BH7A 2E82A 4OU4A 5U9CA 1T3SA 1RLTA 4G1BA 2JEOA 4RK5A 3DEZA 4NBVA 2RBGA 4P7KA 1MFQC 2JBAA 1O6FA 5JVDA 4HWRA 1CY0A 2WTAA 3DMHA 3E9MA 1P7PA 2AI2A 2F1IA 2C03A 1D1SA 3NT4A 1WY7A 1HTTA 9LDBA 3PQ2A 2W6OA 3CW9A 3B8EA 1XELA 3W2FA 3MUNA 5EJ5A 1P5JA 2GEFA 2QQ5A 4I5GA 4OA5A 3K9BA 1K08A 2JA1A 5JRJA 3HJBA 3KXLA 4IJ5A 4R68A 1L5FA 1UADA 2GA9A 3O3OB 4EY8A 4E08A 2Y1CA 2WU4A 4E3ZA 3D3KA 1E7MA 1M5UA 1PU2A 2ZFUA 2PPLA 3E5NA 4KJZA 4YRIA 2AN3A 5BMVA 5FNZA 4K2HA 1N3IA 2QPTA 4TKUA 5HTOA 4V0RA 2ZUVA 3FGOA 5DIFA 4PYNA 4I4LA 3KQNA 4JK3A 2M32A 1AS0A 2JGFA 4NBTA 4GE3A 3VR3D 3ZYZA 2OESA 5HJEA 2JG3A 3R9WA 4W5WA 2QTRA 3HSKA 4MS1B 4YDQA 1SB8A 3KOMA 1UK7A 5CLIA 2O8BA 3EPPA 1QF7A 2RGRA 4NAUA 4ND7A 2YFYA 2Q8PA 1VE6A 4GOXA 4ZVOA 1BYIA 1NMYA 4KH1A 3PR3A 2Y0EA 1GR0A 3LTEA 3R8FA 2C3OA 3ZGLA 2FG7C 3GEHA 2M4HA 5K99A 1GGJA 1N57A 2WT8A 2C2KA 3TB4A 3BD1A 1WZ2A 4LXYA 5KNBD 1K5HA 1Z2PX 3HNOA 5JY6A 1N2EA 1TU4A 4MVJF 3N05A 4D99A 1R8QA 1TA0A 3FYUC 1NDUA 1L9XA 4HJXA 1G2OA 2HCBA 3MBKA 4A27A 2WWGA 2PLAA 3UK6A 3SIWA 3QVSA 3DXYA 3FNRA 3GHYA 2AWNA 3R0IA 4MKRA 3CJRA 1V4VA 2H5EA 4P4TA 2VO1A 4BJ1A 4N76A 2FRDA 5IANA 2Y27A 4AMVA 4LXIA 1TRKA 5TQJA 3HRKA 2EZ8A 5BVHA 2HA6A 4A4DA 4QOFA 1SB9A 2C5BA 5ICFA 1IUNA 3TOCA 1WIZA 5DTQA 1XTZA 2QXTA 3DEJA 3KU1A 4K3UA 4XB2A 1R0XA 3TFWA 1NNEA 1PEAA 5DBGA 3EUWA 5DE3A 3OE5A 4WZ6A 1EX1A 1CJTC 2ZPTX 4HBZA 3STHA 5JQGA 3BXXA 3EEOA 2I29A 3MXTA 4TTTS 1OJLA 5F33A 1NVVR 4H77A 3ROMA 1BD3A 2BGLA 2QDKA 3RTDA 4C3ZA 3O9XA 1X1TA 1Y34E 1Z4NA 5CCDA 3ADDA 1H1LB 4MAAA 3H9JA 2GFHA 1U6KA 1J21A 5JQGB 5DNYB 4RZUA 4IFTA 1ZC4A 1X38A 3THRA 5JPCA 2QY9A 2GN4A 3OZIA 3D6FA 1R0RE 1MR3F 3C3DA 1JV2B 3GJQA 4QYMA 3SQNA 3I09A 4M83A 4D44A 4Q3BA 5F23A 2VPZA 4J2HA 1SZPA 4JYCA 1NBMA 4U7GA 1UXGA 3IMEA 1R5OA 1T0BA 4BQRA 5ARBA 5DNAA 1TF5A 2TMYA 4NMLA 1EKXA 1NT2A 4EFLA 4AYTA 1GNPA 4EYKA 3U3JA 1GCIA 5IKOA 3K1TA 2QM7A 4BMYA 1FDIA 1QOZA 4JYMA 1OASA 2XA2A 3RYTC 3MCWA 2V8OA 2Y1OA 3I1FA 2H3EA 4RZ2A 2JAXA 3S70A 1GGMA 1QTRA 1RJWA 3OKZA 2YWEA 5TDHA 3BG5A 2B30A 4NV1A 4UHKA 3UUGA 4ID9A 3TUJC 4LBZA 1U9YA 4M1ZA 1XNHA 2HFZA 3VPCA 1P5RA 1HE4A 4HUQA 4Y3UA 2YJ4A 4YALA 3TMKA 1OXMA 3L6DA 4CZ2A 1KGSA 3RRFA 1Q44A 4C0QC 3USCS 1XA4A 4CYMA 4ZGBA 3DR5A 4OQFA 1GFWA 3TQRA 1QRTA 2C3MA 4F45A 4KIGA 1NM5C 3F71A 4UNQA 5HUHA 3LA8A 1C9YA 5EHGA 3TLEA 2Y2UA 1IXKA 4F0JA 4LI3X 1RHRA 5JSYA 3GJ8A 4C5AA 5ICCA 1YFKA 4YK7A 4EELA 5FTMA 3EARA 2ZJFA 3QFRA 4TM7A 5CVTA 3LBAA 5KNDA 2B34A 5J1SB 4F2GA 1JLSA 1YFJA 4UULA 4L3VA 1JQJC 1IM8A 1QJCA 5ELMA 5DTRA 1E2GA 3ZK7A 2VNSA 3HVKA 5DM60 1RZ3A 3P97A 5K8CA 4IQGA 1G8FA 5HOEA 1PVOA 4OGGA 4BLPA 4FDAA 5LLTA 3AQ4A 1RVV1 2XT9A 1FP2A 1TEHA 2WIJA 5C9ZA 3LDGA 2X0NA 4DANA 4Y2JA 1QFYA 4PTYA 5TEWA 1TQHA 1VPWA 5CPFA 2VUHB 4EHKA 2Q9BA 1PFVA 3U09A 3AVUA 1EZZA 4G01B 4Q4AB 1XEFA 1M2KA 1Q92A 2WI8A 4HGQA 4DV0B 5GV7A 4N0QA 5H3HA 3WHIA 4P3NA 1PV1A 3RTGA 4C0SA 3RTBA 5F1KA 2J3DA 3EGVA 1Z63A 3OAAA 2HO4A 5JXJA 2IH5A 2YFQA 1IBSA 3DTNA 4EEZA 5M2QA 2OXTA 4GXTA 5D86A 2ZPAA 3IEUA 4MKHA 1I32A 3U7IA 3FPCA 3PYMA 4LE2A 4AQ7A 2AD1A 4KWTA 2ORYA 4PU0A 7MHTA 4DG9A 2QLNA 3KQHA 4QXQA 3ED1A 3HB7A 1V43A 4K9LA 1A1SA 2PZBA 4Y2QA 2ZJYA 1Y1LA 3J7TA 1XK6A 1SXJE 1XZKA 2Y71A 4P92A 4ZO4A 3WDMA 3HTXA 3PEYA 4GU5A 1MNQA 3OCUA 5AM3A 1NU8A 2CFRA 4PPFA 3KWMA 3USZA 5IVHA 3B1VA 1W29A 2KQUA 5M7EA 4ZYLA 1B8VA 3IV6A 4GYKA 1EB9A 3TJMA 3RQSA 1R5NA 5DBFA 3EFOB 3G0BA 2R1TB 1XALA 5A71A 1L7AA 3ZE2B 5BXYA 5E7MA 1XNQB 1Z5WA 2DLCX 4I46A 3GP5A 3WWCA 1E6LA 1S4MA 2XB6A 3FPLA 2WPNA 2XVMA 1CUJA 2NTJA 2Y8EA 3E7WA 2QQEA 3A7DA 3LYHA 3PGLA 2QR2A 3HU1A 3EMVA 3LXMA 4MV4A 2J3KA 3RYFA 4JYBA 4AJNA 4IDNA 5JXWA 4LTNA 1NQTA 4QODA 4H27A 4IUCS 4W1PA 3EMKA 3WZ2A 4C7VA 1B6GA 1EVKA 4LAFA 1YHYA 4EHHA 4F97A 2P0AA 2RAPA 3DMDA 3SJBA 3ZWWA 1IN5A 1NJ8A 1Z7YA 4JJFA 1T6BY 2CEKA 3IBCA 1UXIA 1Z4LA 2HBQA 3IOBA 4CM5A 1NNUA 1T36A 3H1AA 4IDBA 4L5YA 5DVZA 1IVSA 1M0SA 3N2GA 3WK4A 1ULHA 3V6MA 2QN8A 2YWCA 4ZMSA 4TV8B 4Z4FA 5IW8A 5L9AA 4DJ5X 3T6KA 2I6FA 2IHZA 2XMDA 5KSZA 3QIAA 2A58A 3R0XA 2OPHA 2DWOA 4H6PA 4D9BA 4ZDWA 4EEXA 2OPBA 3WNVA 1E77A 2ERCA 3N2GB 4MWBA 3I1IA 4TLMB 1LVHA 1RYBA 3PIRA 5HK8A 1BOFA 4N9WA 1NUQA 4MWTA 3T3EA 1U1IA 3IBGA 4EHLA 2V1UA 1GARA 2ZK7A 1P3Y1 3KPWA 4P53A 1U65A 1HFEL 4AZWA 3IULA 3FCSB 4R1LA 1EWKA 3DFZA 3FVVA 1UJ5A 1JF8A 1FTQA 1E3WB 1QO0A 3MF4A 3P9XA 4OXXA 4NICA 4WUTA 1YBFA 2UV8A 4Z9XA 4G0ZA 2FZVA 5JTTA 2IVZA 1WMFA 2Z83A 1QRUA 4RHUA 4LOKA 4PCAA 3MAAC 5JZOA 3TNDA 3ORFA 1J06A 3CLTC 1DC4A 4JUAA 4KQWA 3E9RA 4WCDA 3IBFA 1PV2A 2IU0A 4P5DA 4R1NA 4DQ0A 4IHJB 5MN4A 3RSZA 1BEUB 4K6MA 4H4DA 2WYIA 3O5AA 4INZA 4C22A 2OLJA 2I3GA 1GAEO 3A25A 3PNMA 5DWQA 4K28A 4QULA 3NTVA 3DL7A 3E2PA 2CFOA 4P9NA 5I01A 3WLLA 1VKNA 1RM0A 4B31A 1U28A 2QTBA 4YCCA 4IH9A 5H59A 4BDTA 5KTYA 5CBPB 4CV0A 4AN1A 1VHQA 1WCV1 3IT3A 3UUWA 3C16C 4W5HA 5C8XA 2C7GA 3NHRA 4RD4A 4FD3A 1WCYA<