1PNRA

Purine repressor-hypoxanthine-purf-operator complex
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
338
structure length
338
Chain Sequence
b'TIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAAYFAEIIEAVEKNCFQKGYTLILGNAWNNLEKQRAYLSMMAQKRVDGLLVMCSEYPEPLLAMLEEYRHIPMVVMDWGEAKADFTDAVIDNAFEGGYMAGRYLIERGHREIGVIPGPLERNTGAGRLAGFMKAMEEAMIKVPESWIVQGDFEPESGYRAMQQILSQPHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEVHPRLIERRSVADGPFRDYR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*AP*AP*CP*GP*AP*AP*AP*AP*CP*GP*TP*TP*TP*TP*CP*GP*T
molecule tags Transcription/dna
publication title Crystal structure of LacI member, PurR, bound to DNA: minor groove binding by alpha helices.
pubmed rcsb
total genus 118
structure length 338
sequence length 338
ec nomenclature
pdb deposition date 1995-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00356 LacI Bacterial regulatory proteins, lacI family
A PF13377 Peripla_BP_3 Periplasmic binding protein-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 1pnrA01
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1pnrA03
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1pnrA02
2LYLA 1K68A 1B0NA 1RXIA 3QELB 1JFTA 5KI6A 2E4YA 1JF8A 1LMB3 1JHZA 4ZMSA 2A9RA 1DWKA 3DLBA 3LTEA 3QQ6A 2MSKA 2Q5CA 1A04A 3GV0A 2HJ9A 1MAVA 1FFWA 1YMUA 3H5VA 2LYPA 1BAPA 3KS9A 3LUCA 3KG2A 4NDWA 3Q7TA 3SCHA 1JBEA 1M5UA 1ZZ6A 3LISA 2PL1A 2CSFA 5KWSA 4EYGA 4KNYA 3H1EA 3KJXA 1UDRA 3LUFA 1M2FA 1W25A 3LUDA 3O2QB 2ZWMA 3QELA 1QP0A 1GUDA 3GBPA 1E2BA 2P9HA 3SAJA 3EQZA 4MR9B 3IVPA 1D4ZA 1T34A 1Z12A 4IGAA 4XASA 3SNKA 4S05A 3KXAA 2L49A 1AU7A 1DRKA 3FFTA 3KYIB 3OM0A 1NXTA 5TQ2A 3T6KA 4PU3C 1CJGA 1NXSA 1NY5A 3E3MA 4MCTA 1DG9A 1XHEA 4WUTA 1PERL 2LYJA 3H1FA 5E3JA 5IUJC 3MF4A 4KPYA 2AW6A 2B5AA 4MR7B 5JNWA 5KC9A 9ABPA 4KFCA 3HS3A 3LUKA 2NZUG 1ZZCA 4G0QA 1ZZ9A 5IBQA 3BRQA 3DBIA 1L1MA 1WETA 2FQWA 4H3KB 1ZAYA 1JFVA 5FWYB 3W9SA 1GT0C 2ID7A 4ZJPA 2QR3A 4X4GA 2GWRA 5DKFA 5B3JA 2AWIA 4CBVA 2PE5A 3O1HB 2LUOA 3GBFA 1DBQA 4W5TA 4MLDA 4O1HA 3BREA 5HQJA 4TMYA 4IWRA 3EDCA 4GNRA 1YK1A 1RZRD 3C3KA 3OMWA 5DTEA 4OB4A 1B00A 1H9CA 2RJOA 4WT7A 2IOYA 2GKGA 4PU4C 1LBIA 2KYRA 3OLYA 1ZS4A 1Y9QA 1UTXA 3BS3A 1GCAA 1ZHHA 4H60A 4YARA 5CNJA 4J1XA 3RVSA 4F11A 3JXDL 1LJLA 1KMIY 1U2PA 2WMYA 3JPWA 5JNVA 1PHRA 1XWWA 1U0SY 1NATA 2PUAA 3OQNA 4NCAA 1ISRA 3HZIB 5CNIA 4ZMRA 2FXIA 4G0XA 3NNNA 3SY8A 4Y9TA 2V0NA 1MB3A 4MR8A 3L6UA 5C5EA 1MIHA 1AB5A 5TQ0A 3RVPA 4RY8A 1PRUA 4EGSA 3VNBA 4MLCA 2GZUA 2PMCA 3CNBA 3EAFA 2MSLA 4D74A 4OTZA 3HDVA 4MPTA 3NHMA 1Z2EA 4O8BA 3MMNA 2H3HA 4MS4B 3JXBC 3FFXA 2R63A 2F8SA 3A0RB 2FEWB 3H1GA 1QNLA 1LJUA 1NTRA 3HCWA 3N0WA 4QPJC 4N03A 1JLKA 3CS3A 3HZHA 5KQMA 3TRBA 2PKXA 5FBHA 4HNSA 1CEYA 2M1ZA 2JB9A 3FDFA 4ZPJA 3KTOA 1TMYA 3HEBA 2FJRA 3OQMA 4I8TA 4TLMB 5EWJA 5TPWA 1S8NA 3TB6A 3G7DA 1TLFA 3EQ2A 2M98A 4RK1A 3MYYA 4RXMA 2VYCA 4FE4A 3L49A 4XXHA 1R8JA 2E4XA 2QVCA 3BILA 5TPZD 4ETNA 1RPJA 1Z25A 4G0OA 4YG4A 4HNQA 4ETMA 2WJAA 3N75A 3I42A 3QEMA 2CHFA 2FQYA 5EWLB 5JNUA 3IP7A 2IUOA 3F52A 2PJUA 1YTUA 4KK3A 1BDJA 4KREA 1CQTA 2IKSA 8ABPA 3N8IA 4HYEA 1EWTA 3N0RA 4MQFA 4RKQA 2GI4A 3FYMA 4YO7A 2AUWA 3URMA 5HKOA 3JVDA 4J1WA 2JCGA 3UFDA 2FQXA 4FE7A 2PPXA 5ED4A 4WZZA 4MR7A 4MRMA 3RVRA 3TX6A 2AXUA 5JNTA 1ZY2A 2FSPA 4F12A 1GCGA 1TM2A 2HQRA 3ILHA 4OBBA 4PZ0A 5EWJB 4PU8A 3LUAA 4MS3B 1YMVA 3SG0A 2MYUA 3RQIA 1DJMA 2IDMA 2LBPA 2LYRA 3OLXA 5EWMB 3TD9A 2BNNA 4Z59A 1LBHA 4LZLA 3HM9A 2WB4A 3MLFA 4HNRA 4YLEA 5IEBA 2EBYA 5A7LA 4JOQA 4OATA 4PICA 4TLLB 3SQNA 2PUDA 1OCTC 2A9QA 3JTEA 4KV7A 2E4ZA 1NEQA 2FTKE 3FFWA 3HUTA 1RXEA 3T95A 1F4VA 1ZH4A 2AXVA 2FLWA 3HDGA 4B09A 3C97A 1UXCA 2E4VA 1TVMA 3RVNA 4O1IA 5BRJA 2XIUA 1LCDA 2H8RA 1KGSA 2JRLA 2N9UA 3JPYA 5BQ3A 1RNLA 3H6HA 2IPLA 1R63A 4XAQA 4Z99A 2MQKA 3L1PA 3KLNA 4JB2A 4Q6BA 3ROTA 2P4UA 3OQOA 1D5WA 1D1QA 3NNDA 2GRMA 2R48A 3CTPA 4MS3A 4IILA 4EUKA 2VUIB 3O9XA 3F6WA 1BDIA 5GQSA 1ZITA 3HUUA 5HSGA 3FYAA 4S04A 4RV5A 4EYOA 4MRMB 1ADRA 4UHKA 2HINA 5CNMA 3CRNA 1YVUA 2EWTA 1RZRA 4G0PA 2NT4A 4NQRA 4L4UA 2HQBA 2GBPA 1OXKB 5TQ0B 4IMJB 2JVIA 3ILYA 4Z9BA 4YWHA 5GOTA 4YV7A 1LK0A 3HK2A 4YP9A 1JWLA 3OP9A 2PIJA 1ABFA 3I09A 2MEZA 3LKVA 1MB0A 3OM1A 4DADA 2BNOA 3QYXA 3VNAA 3O75A 1WH8A 1AB6A 5C5CA 3IP5A 1ZDMA 3CHYA 4W5RA 2RGYA 2KEIA 1GLGA 1SXIA 3JXCL 1EWKA 2PUFA 2O20A 3RH0A 3SM9A 1QMPA 2KEJA 2VUHB 5IUKC 5KQLA 2AYXA 3S8QA 4I6TA 1QQAA 3KKEA 3ZHMA 4YCSA 2CWDA 1SXGA 1QP7A 1DZ3A 3JVIA 2FN8A 1USGA 1TJYA 4JAVC 2TMYA 4MGEA 3EULA 5IC5A 4FN3A 2MYTA 2IPNA 2QVGA 2XDYA 1HEYA 1PUXA 2YHAA 3LKBA 5BR1A 1QP4A 1EHCA 1DRJA 4G0YA 3O1JC 4IA8A 1FQWA 1K66A 1D2AA 5F64A 4DN6A 3HVRA 1FFSA 3D02A 3KSMA 4F8DA 2LYKA 1EFAA 3GYBA 4XARA 3BDNA 1USKA 4RSMA 1E6KA 1BVHA 2CD7A 1IIBA 3A3KA 3QEMB 5JNSA 3OMTA 3H5OA 4Z9AA 4JCXA 5BRAA 3I5AA 2QU7A 4OLAA 2LIVA 4MS1A 4N41A 2ZAYA 4X4CA 1DCKA 4H3HB 3TO5A 1JDPA 1W9HA 1D1PA 2JK1A 4F3TA 1NXWA 1C0EA 3HO1A 2JVLA 2MYNA 2AXZA 3NNSA 4ZYLA 4N0PA 4RK5A 2HSGA 1URPA 3CZCA 4WXEA 2R1JL 1OSLA 5DLEA 2NUBA 2WRZA 3CZ5A 1NXXA 1ZZ7A 3IPCA 3Q9SA 4ML3A 3A10A 3GL9A 1NXOA 2B4AA 3RVLA 1QPZA 4RS3A 1DC8A 2GX6A 1JDNA 1VLZA 3GA5A 3KLOA 4RK6A 2L19A 2RDMA 3H5LA 2R4QA 4QYMA 3GN5A 3H5IA 4NICA 4W5OA 3DNVB 3N6VA 2PAFA 4LE0A 4RKRA 4RK4A 4WXMA 3LUJA 5ABPA 4N76A 1RIOA 1ZGGA 3RVJA 4Q7EA 4YS6A 4MQEB 3F51A 2O49A 2JBAB 2NZVG 4X4FA 5DGCA 1LCCA 2PUGA 1NXPA 1Z13A 3DZDA 3SCGA 3IPAA 4MQFB 2FMIA 4IVZA 3LMKA 3Q15C 3O2JA 5IEJA 4PU7A 1VPWA 1Y1LA 5JNRA 1FSPA 3KZ3A 1C4WA 3HV2A 4EYKA 4FB4A 3UKJA 3EGCA 3RVOA 4Z4HA 3PXPA 1PRVA 3ZHIA 3F73A 1JYEA 3LUGA 4Z58A 3EJWA 1EAYA 3VK0A 1LLIA 3JS5A 3BRSA 1ZN2A 3QLUA 4D6YA 3HXMA 1CYEA 4I6RA 3LFPA 2QW1A 3QLUC 2ICPA 3OO0A 4RY9A 5CNKA 2VK2A 2JVKA 1X2LA 4KMRA 3OMXA 4O5AA 4RY0A 5TPWB 2WY2D 5TQ2B 1SRRA 1SD5A 4Z4EA 1L5ZA 1OXBB 1ISSA 2OR1L 1KRXA 2X7XA 2QZJA 2IPMA 4KRFA 3UUGA 4LDZA 2QXYA 3GBVA 4P1ZA 1U8TA 2W42A 2A6CA 2OENG 3C3WA 4YRZA 1GUBA 2ID9A 3EUSA 3F6PA 4JASB 5PNTA 4Z4FA 2KZ8A 2RJNA 1XHFA 5B3JC 1NERA 3QLVC 2O38A 1DCMA 5FWXA 4F06A 4Z4IA 1E6LA 3H75A 5EWLA 5IUNC 2AYZA 4Z5DA 4MAAA 2NT3A 3OLZA 4G0MA 3TMYA 3LUHA 1E3OC 2WUSR 3ZKCA 2FMHA 2WWVD 3QLVA 2QSJA 1PNTA 2OFYA 2XJ3A 3DGFC 1CHNA 5T7BA 1P2FA 3H5TA 5FWYA 4PEVA 5IULC 4JA2A 6ABPA 4XLTA 1PRAA 1SQ8A 2A9PA 2LCVA 4QYWA 2LYSA 2MYPA 3D1NI 2O4AA 5KQGA 3C6QA 1JX6A 5KQPA 1HF0A 2FEPA 4E7OA 3FMVA 3QEKA 4JB0A 3EODA 1DW9A 1R69A 2PUCA 1U04A 2DRIA 3OLVA 4JQDA 3NHZA 4N0QA 2GRLA 4Z4GA 1Z17A 3CFYA 3MA0A 3OLWA 4IF4A 2FMKA 4TN5A 4ETIA 5HM6A 2A9OA 2BNMA 3QLTA 3O2SB 5T3YA 3M9WA 5D2CA 5JS1A 4YG7B 1QKKA 3NBMA 2XI8A 1UXDA 1DC7A 4RWEA 4G86A 3K9CA 3I45A 1RPEL 4EVQA 1MVOA 2FMFA 1Z16A 2WJWA 3KCNA 1SXHA 3RVQA 4I6UA 4EVRA 1O4XA 4RK0A 1DBWA 3RVKA 4Q6WA 3H6GA 1Z18A 1P6QA 1JH9A 1PNRA 3QX8A 4MQEA 5I4CA 1Z2DA 4KQCA 4L85A 4MYRA 4X4BA 4LE2A 4RU1A 3T38A 3K4HA 4Z5CA 1P6UA 2F8TA 1M5TA 4OG2A 4X4DA 2LP4Y 2D5VA 3CLKA 2J48A 3O21A 5DCLA 4YG1A 4EVSA 4G0ZA 3H5WA 3RZZA 4KZKA 2IVGA 3CU5A 1PEAA 1ZZ8A 3UK0A 3HJFA 2PL9A 2FVYA 1EWVA 3O74A 2EF8A 3CG4A 3QK7A 4NV3A 2JBAA 1DBPA 7ABPA 2ICTA 5K98B 1ABEA 3MQ4A 4NCBA 1ZH2A 3R1FA 3F7NA 4LE1A 3GN5B 2XSDC 1ZGZA 2CHEA 3IDOA 3LFTA 3QX9A 4WWHA 3QF3A 1A0OA 2KEKA 4XFKA 2CROA 1A2OA 1L5YA 1ZESA 3D8UA 3Q41A 3M9XA 4LRQA 3RVMA 4Z4CA 2BGGA 2FW0A 4JP1A 2KPJA 2LYQA 4GHJA 3P9YA 3S99A 3CLCA 4RDCA 1I3CA 2E4WA 4YBAA 1QQBA 3Q7RA 3B7HA 4W5QA 1DP4A 3FGZA 3DGEC 3MIZA 4KVFA 1YK0A 2HPHA 3CKMA 5EWMA 5KC8A 4FBIA 4W5NA 4IRXA 2PLNA 3CG0A 3N53A 3JY6A 4EY3A 1KRWA 2IPAB 1DCFA 1VRVA 4RXUA 1ZPQA 3F6CA 1ZVVA 4MR8B 4YGXB 3O1IC 1Y7YA 5FBKA 1USIA 3IP9A 3SCFA 5FWXB 1LQCA 3R0JA 4GQMA 1QO0A 3BBLA 4RXTA 3IP6A 2FN9A 1VKRA 4N47A 4OLBA 1XWRA 1J56A 1ZUGA 4X4EA 1BA2A 1YS7A 3A0UA 5TE9A 3E61A 5TPZA 2L18A 5CHYA 1BDHA 3Q7SA 4G97A 4KK4A 2HQOA 2JVJA 3OO1A 1X57A 2WIUB 2IV1A 3CECA 3MM4A 3BD1A 4MCXA 2H0AA 1JL3A 3FMYA 1WH6A 1JYFA 2QV0A 2FKAA 4LX8A 1Z26A 4PYRA 2IVBA 2E4UA 2L2QA 1Z15A 4KQ9A 4LDAA 5JS2A 4RK7A 2FEKA 1PEYA 2L17A 1FFGA 2XCJA 3GWGA 3KHTA 1POUA 3GT7A 6CHYA 1M2EA 3T8YA 4F8JA 4Y42A 4QICA 4MS4A 3ROFA 3G5GA 1WIZA 1U2QA 3G1WA 1ZZBA 3M6MD 1E6MA 2LPMA 4Z0NA 4GPAA 1P8AA 1APBA 2IVQA 2B1JA 1JFSA 3GRCA 4MS1B 2I6FA 3QWGA 3G85A 3KYJB 2MSWA 2PUBA 2OQRA 4IMIB 4JCYA 3LOPA 4UHJA 5TQJA 1F51E 3C3MA 4X4HA 4P98A 1YIOA 1YSEA 5IX8A 3B2NA 1S7EA 2IU7A 1NXVA 1RZSA 4M88A 1IC8A 4MR9A 4RZSA 4D6XA 4YR7A 2L8NA 3CROL 2R25B 3N0XA 2FLKA 2BJCA 3HSYA 3DLHA 2IYNA 1QO0D 4DQDA 4EYQA 2PUEA 1YS6A 3U3WA 4E7PA 4X4IA 2YHBA 4PE5B 2R47A 4Z5HA
chains in the Genus database with same CATH superfamily
4UARA 2AN1A 5FO1A 3C0KA 4G4IA 3C8MA 1JFTA 4BGIA 4KMOA 4M1MA 4BV9A 3T3NA 4ZMSA 4FGJA 5ISMA 3KDAA 3QBVA 1MZVA 3H1TA 4YAWA 4A27A 2WLTA 4L5AA 3ET4A 1XTSA 3CF4G 4GC5A 2FPPA 2P5TB 5JANA 4O3MA 1XKTA 4Y9RA 4QM6A 3F3YA 4NLLA 3WNCA 1SBHA 2EAUA 3W77A 5B1EA 1M5UA 1IJKA 2FGKA 4HQ6A 5I3CA 2PL1A 4DMMA 4DIBA 4KLNA 5JS7A 5JR3A 1P7PA 5JARA 2HNKA 3EYAA 3RJ5A 3ROMA 3VGJA 1PJAA 3BE6A 2EJBA 3VOBA 1CJCA 4L8GA 3ED1A 5FO0A 1T6ZA 4YDSA 3OHSX 4OKNA 1D4ZA 4F4FA 4N6NA 3CCBA 5JBQA 3KKZA 4UFOA 3RT9A 3HKEA 4ENRA 1NT2A 4PU3C 1TPYA 3E3MA 4ZJUA 2ZB7A 5IW8A 5ALLA 3LBFA 2B2NA 1Y80A 3O83A 2VWPA 5G0SA 4E6EA 4PNEA 3R3SA 4IM7A 3W5DA 3EPKA 4KPYA 2VF8A 1CW2B 1RC0A 2IYWA 5BXQC 4BV3A 1T8UA 3X3HA 1B2RA 4Z9YA 2GPJA 1U98A 2JNWA 3TI7A 3V1YA 1P9NA 2RC6A 1ZAYA 2QORA 5AVTA 3BKXA 2CSUA 2I29A 5DSZA 2XTZA 2W4QA 3TFQA 5BWBA 1MFZA 4BNYA 3PNYA 1PV4A 2YMMA 1M6EX 4UMDA 3GK3A 4W5TA 3UHOA 1IULA 4LXQA 5F1KA 2AQ8A 3ON5A 4FOTA 4JJEA 5FL3A 3T12A 5LYJB 2PWBA 1L4FA 1GPLA 1KJWA 1FYXA 2GKGA 3P32A 5TMBA 4BMOB 2R6JA 4UU0A 3U4AA 5I51A 1ZK2A 2FOLA 2FEAA 3MTGA 4ZA2A 1Z5OA 1KKLA 4FOPA 5CCBA 4PAGA 2PK3A 1Q7BA 1BHSA 4WKNA 2XLBA 3NDIA 1L4YA 3E5HA 3GLGE 3BB4A 3VAZA 3IVXA 1DDGA 2VJMB 2ZWAA 1CUHA 3C2QA 1XU4A 1GZHB 4K81B 2O7VA 5H82A 5CIQA 4ZRMA 3VRHA 2I7DA 5L3VA 4HJXA 3SJZA 3OJXA 3UMRA 2AS0A 2W6NA 3FSGA 3INYA 3G1TA 3NYQA 3AP2A 4MKZA 3SFVA 4ZTUB 3M82A 2JIZA 3EAFA 2QAGB 4RA9B 4E12A 1N0VC 521PA 4XRGA 1C7FA 1PV2A 3LOUA 4L7VA 1OLXA 1YC2A 4Y2XA 1F5SA 1H6CA 3K30A 4CT0A 2A5FA 3W7VA 1G6OA 5HJEA 1LRLA 3HCWA 5DISB 1U5BA 2MT9A 3CS3A 4RVDA 5IWAB 1VM6A 1DC6A 1BN6A 3PITA 3LW7A 3TDMA 4RV9A 2JJ2A 1QGZA 2CN1A 1UMBB 4S2EA 1G21B 5EWJA 1PJBA 3N2GB 5EHZA 1DULA 1Q77A 1TLFA 5JAUA 2PRJA 4YRCA 1L5QA 1XMVA 3ZDCA 4AFNA 4KE6A 4LYDA 4LZJA 4LWOA 3TRKA 5I01A 2X8JB 1JFFA 3DWFA 3IVAA 4HB4A 1ENYA 4EA8A 4Z1MA 3V3KA 2QQGA 1S6YA 5JCPA 1TC1A 2EERA 4M8NE 1KYTA 5FEUA 3D9QX 5JVDF 3T0IA 1CRZA 1YTUA 2IYPA 1Z35A 2G67A 3CH5A 1CQTA 1NC1A 4HYEA 4PC2A 4J7CA 3R5HA 2DUWA 3KTAA 3GGDA 3LWNA 5K6AC 5IAOA 2QG6A 3TB4A 5HKOA 1TU3A 3E27A 2WHEA 1A8SA 3AF1A 1RJDA 1WUJS 3B12A 3BXGA 3R44A 4WZZA 4TUYA 5A4AA 1RMQA 1ZIXA 2H1FA 2PO5A 5CFOA 3K6SB 1AXRA 1CJKC 1G1MA 1YDWA 4TN1A 5AYVA 4F12A 3EYWA 1K9VF 5BT8A 2V5AA 2OCPA 2BKAA 3K73O 4OBBA 4OFZA 4Q03A 4CFSA 4R41A 1M1ZA 3QH4A 5EHNA 1LV8A 1OY1A 1WMAA 1CJBA 2MYUA 1JA0A 3DD5A 1DQPA 3V1MA 8ATCA 4QJ4A 5JMTA 3FDJA 3Q2KA 1Z5GA 4LDRA 2FE1A 1JHXA 2XQKA 3Q12A 1DKPA 1GFIA 2PV7A 3DHNA 5ALPA 1U7TA 1Q1AA 5BMOA 2KI5A 5HOEA 2ZWPA 3U0VA 1BEEA 1G38A 1DC4A 2OO5A 3T95A 1SCUB 1F4VA 1I80A 2F1KA 3FPCA 3WAJA 2OD2A 3GJ8A 2D13A 3IDSA 5CCXA 2X76A 1SKMA 4IIFA 3F98A 1H23A 1PW7A 3HWX1 4LPSA 4QLAA 1I1QB 1O58A 2J45A 1KO8A 4ITVA 1EUDB 3WOHA 1ORIA 1COWA 4DR1B 1N3BA 2D3WA 2YN4A 3EGDB 1V1MB 2NO6A 3K3PA 1XD8A 4RFSB 4AJ1A 4K9NA 5FUBA 4UZFA 1NMSA 2VNHA 2UZ1B 1VMKA 1J8VA 4LJ8A 5EUQB 2YYYA 3PHJA 1SG6A 3PIDA 2XTAA 2A5YB 3SNHA 5HFJA 2X2FA 2LNMA 1T2EA 1E4EB 3ZWDA 4Z49A 1IHPA 1KI8A 2JHAA 2WG0A 4TKUA 1JLRA 3BXXA 3L7LA 3K1AB 1PGNA 4LYHA 1EDEA 2PYZA 4GQIA 1C81A 5EN4A 3O8BA 3S40A 2H57A 4N49A 4L2IA 3HMKA 1I4TD 4R7GA 1EVZA 1GAJA 1LBTA 2I33A 1JJ7A 3DXZA 4H4CA 4KWHA 4OB7A 3THOA 3TMKA 2WSMA 1FMTA 4UE3S 1GU1A 3KHSA 2BT4A 2ZQ5A 1O0BA 3DZGA 2B5OA 2ZYTX 2H2HA 3E9YA 3EXAA 3SYNA 3J7TA 4KQMA 1C30A 3AEYA 2XQVA 4OHBA 1XNQB 3NWPA 1ISGA 2I3BA 1HNWB 2AZXA 1UZMA 5KVAA 1IDN1 4MQ4A 2JFBA 5E3HA 2XDYA 1P2GA 1QG2A 1PUXA 3CUSA 2GCNA 3EGEA 4IZ6A 4MRNA 2JS7A 1JZSA 2WUFA 5IDVA 1JZTA 3K70C 2Y77A 3O1JC 3TLJA 2AMYA 2Q28A 1QYIA 1E2LA 3DVAB 2ZZMA 2AH5A 2WEKA 1X1TA 1ZN9A 1NI5A 2FZVA 3ORSA 4OHCA 2PUHA 3ENKA 1UAGA 2CD7A 1IIBA 1WNTA 1N8SA 3MRVA 3PFKA 2CUNA 4UULA 3SJBA 4B4KA 4NMWA 4C4PA 3OMTA 4YUAA 4PLVA 2O4CA 1QBKC 4Z9FA 4ZU1X 3F5QA 1V47A 3ESBA 4PCLA 1U1GA 1GGKA 2AVDA 4UUAA 4BMDA 3VO1A 3IA7A 5K5EA 5KEIA 1K7CA 5DLEA 1DWQA 4NC9A 3IAFA 4XCXA 1QGOA 1XOIA 4LPKA 1W85A 5DH9A 2JIZD 4XA8A 1DC8A 4IDNA 1NVEA 1MO5A 3GA5A 5FULA 3I32A 1OU4A 2CLDX 5HS4A 3HCOA 3REQA 1Z37A 2BFOA 4UBMA 3N6VA 3N86A 2J0UA 3CVJA 2I65A 2E87A 1ADYA 2R751 3WXMA 1XLWA 4Q7EA 3BSSA 2BTQB 5K8TA 4BFZA 3VKVA 2BGNA 1PLLA 4PYIA 1NUSA 4CKYA 2CLMB 3C6MA 3L6DA 1P7ZA 1ZICA 1FNBA 1U8CB 3GRYA 3AMVA 1NWCA 1YS4A 3KWMA 5THQA 4PS1A 2Q0SA 3OA0A 1KHTA 2QRNA 3UKJA 1YSCA 1V8PA 3JWJA 2A92A 4HRXA 3VM6A 5K03A 3VK0A 2BGMA 3WGKA 3LL7A 3W5JA 1U5BB 2IYSA 2YUTA 3NHJA 4MLPA 4QPCA 5JMOA 1YGYA 3HRHA 1U2GC 3AV3A 3OMXA 2PZAA 3P9RA 5TLSA 3V8VA 4G4GA 3DMPA 4D4LA 2V0GA 2BEKA 5DIFA 3I23A 4AJ2A 3WRYA 3UFXA 4OD0A 2IW3A 4U2KA 2OENG 3LBAA 3MJEA 4DA0A 4GLLA 3RS0A 1ZM9A 4NE7A 4V3BA 4ZPXA 2D8AA 4X24A 1DSSG 5C37A 3TOVA 3HCRA 2O7RA 2P4EA 2I22A 4DQVA 1G7TA 2VTDA 4ZD6A 1O5OA 2FSGA 4TXNA 5AM5A 3COSA 2E89A 2ZYSA 3IEXA 4E1BA 5JSFA 1B0PA 2A4MA 4XEHA 3TFOA 2FK8A 2FMHA 4WA7A 3RANA 1XZDA 1VE1A 3HB5X 2PD3A 4KACA 2R7NA 3NO4A 5GONF 3H11B 2YWJA 5DF1A 3T0FA 2AI1A 4A91A 1FQJA 1WPRA 2DETA 4XOIA 2LYSA 1T8WA 2POQX 4AT1A 1V5WA 3I6ZA 3M0EA 3P97A 3CF6R 3IT1A 3V42A 3BIFA 3DVQX 3AY6A 4YCNA 5CVJA 4LMBA 1XO1A 4CLHA 2W6IA 4E7OA 5LP6A 1IZ8A 2ODTX 4E46A 3EDYA 1GL7A 1H0RA 1Y8QB 4X97A 1WMEA 4KXYA 4WK4B 2HZBA 3IDFA 5ITWA 1TCBA 3CPHA 3WIOA 1Z17A 2ODWA 1KI4A 1LC0A 4B2YA 4YPOA 2NP6A 1SQ0A 1T1SA 1P91A 4NMLA 3JALB 1PS9A 3HJNA 4OQMA 3CUKA 3L7AA 1DAPA 1VL5A 5AOBA 3LCUA 1TQDA 5D2CA 1HQDA 3SYKA 4PR0A 3MJVA 3ZV4A 1PR3A 5CTAA 5TGDA 4JLPA 3L4KA 3PPYA 5HP4A 3OCWA 3D7MA 3KVOA 4A8TA 1CRPA 2H18A 2IA5A 4D9MA 5DYNA 1OROA 3GZNB 4YRJA 3KPYA 2VQFB 1SVUA 3RVBA 4MVYA 2ZOSA 1MPTA 3CEJA 1SO8A 1X80B 3VX3A 4KQCA 1JEAA 1L2TA 3G2HA 3ZWMA 1QGAA 2EKBA 2ST1A 3T38A 4Z5CA 4NWIA 2ZIZA 3L06A 1AOXA 2WKQA 4FFBA 4MHOA 2GJKA 3QHAA 3BGSA 5FOSA 2EP8A 3T7JA 1OFIA 1G2QA 2PXBA 4M9CA 5B58T 1FOEB 2BR5A 3RO7A 3EXG2 1Y8AA 3UK0A 3TD6A 4HPWA 2ODNA 1ZONA 3O74A 1DWOA 1OFTA 4UNRA 2BGTA 3R9XB 4H77A 3PF9A 4PPNA 7ABPA 4P35A 5CBPB 3L1HA 1NVXQ 4R8MA 4ZU3A 1SWVA 2OSBA 2RHRA 1JR3A 4ZICA 4B31A 2H5EA 2IHKA 5B7GA 5KSOA 1E1CB 3ANMA 3MZ0A 1K4YA 2A0XA 4YMVA 2PXVA 4QFMA 2JFHA 4Z4CA 4D3YA 1B14A 1EM8B 3V4LA 5A7GA 2PKYX 1MT3A 2GPNA 1NDUA 1Y9AA 3V34A 1SBQA 3LHFA 2Q3BA 3HMQA 5DNVA 2GFHA 1XMXA 5FOUA 3VO8A 3A2NA 1DBIA 2VJAA 3ZEAA 1GLNA 2ZAOA 3U16A 2A94A 2IX9A 1ULTA 4IG4A 4IRXA 4OKIA 3DHVA 4RPKA 4ZKEA 3H2SA 1MO2A 3U62A 3KSBC 3K05A 3ZDBA 3O8LA 3ZNPA 3TGWA 3DCYA 2BMJA 2VDUE 1VFPA 4G01B 4HNVA 3D4OA 4UBJA 3BFPA 3D2LA 1PJSA 5JCXA 4TKLA 5F2KA 2RGNA 4HDNA 5BR4A 4KRYA 4XUEA 1OYYA 1PL6A 4EWLA 3CJRA 3DLCA 2GF2A 3A1NA 3WV5A 1HE2A 3F6SA 4B7ZA 5KX5F 3WNZA 1U28A 5A03A 2ZIVB 1QGED 3C5VA 4HWKA 4X9XA 5EKXA 2XB4A 4JJFA 1M2WA 5TPZA 1XTQA 2H59A 3QFCA 4Q9AA 5JCOA 2JI7A 4QOIA 4YLYA 5DTMA 4HQKA 3SSOA 3DTTA 2Q29A 2E18A 2O52A 5EXPA 3BMXA 2IYTA 4ESHA 1HE4A 2W70A 1W85B 3QW4B 3ZCSA 2YHSA 1Z5VA 2ZXUA 2IU6A 1S3FA 1EFVA 4OXXA 1OFUX 1U2ZA 1R88A 2B30A 4A0HA 5FOVA 2V9CA 1E0DA 2UYOA 4IYRA 4EBFA 2II6A 1S9DA 2WVHA 2XCIA 1FUUA 3UMMA 2DQSA 1J24A 2PX4A 4TYNA 4X6XA 4F2WA 1QX4A 2HAEA 5CB0A 3R9IA 3QWGA 1OLXB 3ELYA 4Y0VA 2HXSA 4KQKA 1DELA 3A1VA 2HRQA 3LOPA 3NFRA 1F51E 1UT6A 2OO5C 1EE1A 3G8DA 2G1AA 3CF0A 4LJ7A 4NAVA 5F5XA 4DLVA 2O8CA 2ZJ7A 4TVBA 3EW9A 1DTSA 2R8BA 1OR8A 1UBNA 1NYQA 1NC3A 5L3ZA 1YRYE 1AMNA 3RG8A 3EZ6A 3ZXUB 2ZB2A 2E37A 4OHVA 2WD7A 5LMUB 4DSAA 2R8YA 2YV3A 2P2SA 2I5PO 3VTZA 2BFFB 2IUSA 1FS4A 2AWNA 1H2ZA 2V96A 4ZHQA 1MRNA 1A4UA 4ZO6A 1G6Q1 4D5EA 4KBYA 5KI6A 4L5BA 3IV6A 2ZCUA 4QUDA 1LMB3 1JN0A 1XDZA 4AKTA 2D1YA 2Z3ZA 4EB3A 2ZBDA 1SUCA 1T1JA 2AK3A 4D46A 2VAWA 3RTCA 3Q7TA 1I94B 4EECA 3D4LA 1KHHA 4RTKA 4JQZA 3NUQA 2BFFA 2GLTA 3FB4A 1R6AA 2I8CA 3E1GA 2EZ8A 2HK8A 3F6YA 3HWWA 4QRDA 1NG1A 4K6KA 4LWQA 3SIPA 2HIHA 3VZSA 2E9SA 4ND2A 2RH4A 2Q7OE 2G8LA 3SAJA 5GGXA 1T34A 3QSGA 1I1OA 3R74A 1VGRA 3KYIB 2FPIB 2A1TR 3PZBA 4Z7QB 4MWGA 4BBJA 5EEHA 1QU3A 3FUUA 2QLMA 3UH0A 1O96A 4MTLA 2PSHA 1HMYA 4KLZA 3VDQA 1E3WA 2GN9A 3W1VA 4AJ9A 2AW6A 3ISJA 3V4SA 2HDWA 1PVDA 2QA5A 1H94A 1L7AA 3IIEA 1T0BA 1AKEA 4IUYA 1CVLA 3JZDA 3U60B 4HH4A 5JROA 2OXCA 2WBLC 4L75A 3IAAA 1JKIA 4YCBA 4P3XA 2EFCB 2RGBA 4RNDB 1GCIA 4FR2A 3W2GA 1HSZA 2EX4A 1DBQA 3VR4A 1SMKA 1SOMA 4LJYA 1TZJA 3OZIA 4I4IA 4I55B 2AC2A 1M2NA 1RD4A 1Y1QA 2C9OA 3K0AA 5FOXA 5HJ2A 3RIEA 4B44A 4YPVA 2Q6LA 4L50A 1ZOIA 1GG9A 4G1CA 3BFVA 3LBIA 2I4NA 3SKYA 1KMQA 2PN1A 4OQNA 3R6GA 4P6VF 1YMQA 2V54A 3DUFA 2XBLA 3IUYA 2PX2A 1QYRA 3H8JA 4YARA 1NSFA 1EJ2A 2G28A 3UT0A 3IQHX 5KTYA 3OT4A 2FR1A 2OAEA 3ZPXA 2ALJA 1L4HA 4Q9KA 2O1SA 4BZWA 2REBA 5AKXA 1L5OA 3MILA 5FTNA 5HK8A 1PK8A 3SIXA 5L53A 1JG1A 2OXRA 4X92A 4G0XA 4CKBA 2R1TB 1UXHA 1CNMA 4URWR 3KV3O 1LEHA 2Z8XA 4AX4A 4CT5A 2FF7A 4G8CA 4IOJA 4ZKDA 1DJOA 2XMBA 3ZGVA 3PD7A 4QG7A 4ZREA 1ECBA 3HUEA 4N4AA 2AFHA 4MV0A 2OQVA 3ZKWB 5DM70 3K09C 2F48A 3VA7A 3I1JA 1MO6A 1N5KA 2WF6A 2A2ZA 4MPTA 1Z2EA 3MMNA 4H6XA 4MS4B 4TMTA 4KR9A 3T5CA 3W8RA 1E94E 5JTUA 2NN3C 1Q44A 4A16A 5AI5A 1PJ8A 2VSFA 3BK7A 3KXPA 3WKEA 5GZ1A 2HT6A 4CCWA 5KQMA 2FKNA 4CODB 5KNDA 5I7FA 1E89A 1EH5A 1EKXA 1Z5PA 9GPBA 4YRQA 1I2MA 3KZOA 1NIPA 4DNQA 1ZQ9A 2IV3A 2M98A 1Q6YA 1QFSA 2C9CA 2O48X 3A36A 3KDPA 1ARZA 3MNFA 4WW0A 4ZQBA 3PEUA 4JB8A 1N4AA 4C4ZA 4ARZB 2XF8A 1YE5A 2W2NA 5EKDA 2CL6X 4QODA 4YXFA 3WWZA 4LCBA 3WL3A 3PE4A 3WB2A 1SHLA 1YUMA 1VKZA 3V2IA 3D4BA 4BEJA 3JYHA 5C34B 4RTSA 3PUKA 2UU9B 3JR7A 5EWLB 1QTNA 1YU9A 5JNUA 2XI4A 1Y5IA 4OHPA 1IJFA 4I50F 3OPVA 5C80A 4WZAE 3RJZA 5KYKA 5DCUA 4A1FA 3D6FA 2GRAA 2HOQA 4CKCB 1GGJA 1A4RA 5DTQA 3CURA 4QUKA 4YP1A 5ED4A 2ZSHA 1HNNA 3IQIX 5E9AA 2JZOA 1D2NA 4FYXA 4R6XA 4KQHA 1WP9A 4HLUC 3KJIA 1NOJA 1HZZC 3TLZA 1J8MF 1XCBA 2VS1A 5DHFA 3GLIB 2GO7A 4B74A 1DJMA 2A33A 4WCFB 1RBMA 3DLHA 3MLFA 2PXTA 4I5DA 5JSKA 3KB8A 3S2FA 2BGLA 5TC4A 1PJLA 4D7AA 4N12A 5LYJA 3T9AA 1NFRA 1QZXA 2XWSA 5J2UF 1ZX1A 5BSGA 5AVQA 1RQGA 3TRFA 4IQFA 4CKWB 1MXHA 3BBPA 3C6BA 4D44A 1HFJA 1BW9A 2VNKA 5HTKA 3C97A 1FEZA 2YTZA 4LXUA 1TCUA 1MFQC 2AZMA 1XALA 1FRQA 3I5UA 3PB3A 3QF4A 2H8RA 2GAOA 3JPYA 1JHUA 2J09A 5DGHA 2BCEA 1IRIA 1SN7A 2ZYVX 1CQJA 5JG7A 5BMVF 2QD4A 5C4IA 2PL3A 4Z99A 3SXUB 2WHPB 3I2JA 3NJ8A 4TS9A 1H3EA 2O2JA 1JAXA 1Z3IX 5THXA 2GUWA 4B84A 2YL2A 4M38A 5DHTA 5T4FA 4RHTA 5JHHB 1L5RA 4UW9A 3GEPA 2F55A 4DBZA 4ZZ1A 4MHTA 1A1VA 1GPYA 3OWQA 2IE0A 2YIMA 5CNMA 4L02A 1NRWA 2A3RA 5JS8A 3VH1A 2GEBA 2DWUA 3OI7A 1XJ0A 5K8JB 4BCCA 2HA3A 2P30A 2P3SA 1AE1A 4L4UA 1X1BA 2B98A 1G7SA 1OX5A 3DEFA 4GRAA 4BBZA 3Q5GA 1BO6A 1WA5A 4Q4DA 1PZMA 1XMPA 3T7AA 5IABA 5LDHA 4PSCA 1G8MA 5FHRA 3G5AA 1ZWKA 2O2ZA 3HH8A 4NDNE 1QK3A 3C74A 2XJ9A 2OA0A 2XITA 3CHYA 2XA1A 2OHJA 2Q0HA 2ZRAA 3KPVA 3OHPA 2PUFA 3JD0A 1GQSA 5B64A 2E5LB 4KJXA 3UMJA 1ZLYA 2OV4A 4U6NA 1EWYA 2WFZA 3GVIA 2CWDA 1ZMBA 2A9FA 1SXGA 4RL4A 1KEPA 3VPCA 3MYRA 1VIVA 4HDRB 5AKIA 4X1KA 3H9BA 1PFWA 1AHPA 1PI3A 4Z2AA 4GOMD 1M8JA 4P84A 2YV4A 1DRJA 4PS0A 4UVIA 4W6ZA 3RAGA 4YAIA 4IA8A 2C5EA 1J07A 1D2AA 1E4YA 1N2OA 3H99A 3VU9B 5ALHA 2WAMA 2PZBA 2QGFA 1QGDA 3CX8A 3VZDA 4CR6A 4QQNA 3RYIA 2A30A 3K9FC 2P90A 3L6CA 1SHJA 3F5FA 1TEXA 3OMLA 1U3GA 2TECE 2X23A 3FLBA 1RZVA 2NU7A 2EWMA 2CVQA 2IL1A 2QU7A 1YR7A 3PR1A 4HKTA 2ZAYA 4EKEA 2ASVA 3I9NA 4GPTA 1OMOA 4G5FA 1FMCA 1TI7A 1P5FA 1TT5B 2VRCA 1U4OA 1QG4A 4LHYA 2Q6OA 1EYZA 2XUFA 5BOVA 4Z2YA 1Q12A 1ZK4A 4FK8A 4F96A 3CZCA 1HDIA 2XUHA 3IAS1 4NEGA 1CUVA 4C0QC 1WV1A 1NNLA 3FTQA 1CJTC 3Q72A 5TEVA 4B3SB 1E2IA 2HKIA 5CMLA 5EJGA 2VRBA 2VT3A 4FSDA 1HKUA 4TZ6A 3T7RA 4IFEA 3I53A 3M6AA 4QQFA 3T1HB 3LG2A 2RDMA 1KI6B 3T1NA 3F78A 1NR7A 4KW7A 1K8ZB 5FKJA 4DLPA 4ECAA 1NP3A 1BJTA 2Y1GA 2X9LA 1GPJA 1A5SB 3SBDA 3WIUA 2AOUB 5B53A 2OR3A 1N36B 1O6ZA 5JPDA 1ZN7A 2GJ9A 2BRUC 4A23A 4C7OA 3OTWA 2IYUA 1RMTA 1GZ4A 3FDXA 4BLUA 2QD1A 5B30A 3ROKA 4CMCA 3TVYA 1Z7GA 4EMTA 1RHKA 2G36A 5I9SA 3VYWA 5LLTA 3NXHA 3OOJA 4G2NA 1PWXA 1M0WA 1AV7A 3QBTA 4Z4HA 3PXPA 4MK4A 4PG6A 1W46A 1TD9A 4AZ0B 5K2MA 2CYBA 3BERA 5JQGA 3ZR4B 5IT5A 1EVKA 1TLTA 1TZBA 4E5UA 4BZZA 1M34E 3OBIA 4AKHA 5DM0A 4P3YA 4LCJA 2FZEA 3GF4A 4EOGA 1FW6A 2Y71A 4YR9A 1G9XA 1T5IA 3O3MB 5AVVA 1EK1A 4MWEA 3PUIA 1KR2A 1DE0A 2BKXA 4LY9A 1TIBA 5IJXA 5GJWC 4ALIA 2ZRDA 3K9LA 1U8TA 4KRFA 4PXAA 3ICOA 2PMFA 3PE6A 4FX5A 4ZFNA 2XXJA 5DBFA 5F77A 3HG7A 4MKRA 2VOJA 5FI1B 4NOMA 3OE5A 1VL0A 5BSWA 3O4GA 3LO5A 3O93A 5KTKA 2I6GA 3EVFA 2Q6IA 3ICVA 3B7PA 5U1PA 3OZAA 3CA8A 4PLGA 4KLCA 1V45E 2RBEA 2LV8A 3RJMA 3V4RA 1UXOA 4JUFA 3QLVA 2HDOA 1X7WB 3WJAA 2XVZA 1PT5A 1VJ5A 3BH7A 1Z3CA 1NURA 4RESA 1CHNA 2BKEA 1HOTA 3H5TA 3D8HA 4RWZA 3ZXIA 2FSFA 2PBFA 3NBAA 4XUGB 1Z74A 2J6BA 2JJ1D 4JBXA 3K4PA 2Z09A 5KJ1A 2HK7A 4MVWA 5FAXA 2PM8A 1JUDA 4JXZA 1CIPA 2WINI 4RCZA 1U04A 1PX0A 2PH7A 4JR1A 4P2BA 2JFWA 2QTVB 4ZOEA 1ZR2A 4ZQIA 3QU7A 4IDQA 1EXVA 3G7NA 4TTJA 3VHRA 3K1YA 1N5DA 4IF4A 2AR7A 5D3ZA 3ZDYB 4D97A 2A9OA 2H3EA 3C45A 3D1LA 3D5QA 1Y42X 1YTLA 3ISTA 3NRJA 2XRYA 2PKWA 3NT2A 4NH4A 3S7ZA 3DMFA 3MS7A 1KEWA 3NALA 5FXMA 3G2KA 2UZ4A 2Q8NA 5EUBA 2O8CB 3AETA 4HFJA 4ZGGA 2DP4E 1VCOA 2B9VA 4C06A 2ECKA 4BX2A 1PG5A 1ZM2A 2VFAA 4I6UA 1X7ZA 5F51A 5T8KA 2W98A 2X77A 3ZHQA 4IJ6A 3KQVA 2ZRFA 3OZTA 3DV9A 3UVEA 4G1BA 2DX7A 4JUIA 3X2SA 4V0SA 1E18A 1ORDA 2ASEA 1B76A 4W8GA 4I4LA 1RQRA 4I9UA 4R54A 2EBFX 5H3LA 1MA0A 1MR3F 2GPWA 3CLKA 2J48A 3JVEA 4GIBA 2IYZA 1MAAA 2IYVA 4ZC8A 5IAEA 1BOOA 1YWGO 1IJEA 2GMWA 3WO0A 1G55A 1UXGA 3H4MA 1VMAA 1KSJA 3AUFA 1A9OA 3GLTA 4ROTA 4XGRA 3ZVRA 3DOIA 3UJ3X 3G59A 1IUKA 1AT1A 1YC5A 2P0AA 2PFGA 1LU9A 2PL9A 2WJVA 4QQKA 2GZSA 5J5AA 3S2ZA 2NWQA 4C43A 4RKEA 2BKVA 1EWVA 1T6BY 2JGRA 1IY0A 1DADA 1SCIA 5HA5A 3T61A 5KC9A 3TJZA 4C0XA 4EG1A 4LI3X 3D3QA 3OT1A 4R31A 3RDPA 4FYPA 3I9FA 2G7MC 4M49A 4X1YA 5KJCA 1YHYA 1NIJA 1U8UA 4LE1A 1VMIA 2HBYA 3LC7O 3F47A 4MHSA 4KR0A 2DFDA 3ADKA 4JS0A 2DFTA 2IXEA 2Q5OA 3B13B 4INAA 4BGEA 4FOSA 1I2BA 1ETUA 3A9ZA 3H2KA 3IO5A 3JQ9A 5G41A 2EKDA 2Z5LA 1EGQA 4Y67A 5DNYB 5IT9A 5MFZA 3ZIDA 3QTBA 5KVSA 3DLTA 4YBAA 1N78A 3R3XA 3GCZA 1R27A 3AEXA 3FGZA 4GI2A 1CNEA 2VHUA 3V7WA 3PXEA 4XYEA 2JJYA 2DH5A 2XMSA 4EQ6A 1O94C 1G5RA 3TZCA 5TT0A 4EFDA 2HRCA 3V7UA 1JXOA 1PZFA 1AUVA 2H1VA 2WJ4A 3Q7PA 1A7UA 4MUNA 2WMNB 4Y7DA 1RXUA 4FFDA 1E1KA 3GT0A 4UTZA 4D9HA 1Y5MA 4GQMA 3B9PA 3OU6A 4D4GA 5A5GA 2GSWA 4QSHA 4LYJA 5IMBA 3H2JA 1C1HA 4AYTA 3PUWA 3QVOA 4HWTA 1BHJA 1W75A 5KWEA 4KXLA 1M9NA 2HL6A 2L18A 1JVSA 4CCYB 1EM6A 4RSRA 4GDFA 2XTJA 2Z2IA 4HY3A 5AI0A 3R9XA 4JEMA 3ZGXA 3MM4A 3CECA 2DQYA 2WNHA 4XGNA 2FOIA 1QDLB 4WIAA 3PQCA 3ME5A 1B1CA 2W2KB 1JIIA 3FNIA 4OQYA 3TKYA 4B48A 4IXNA 1MUUA 1QFXA 2F3TA 3FWHA 2ETXA 1NYRA 1PQ4A 2CMFA 4KZPA 3L7IA 1NVBA 1SXJB 2RAFA 4J0JA 5AR1A 1G3IA 4I4NA 4FILA 3T4EA 2EZUA 1E6MA 3B1YA 5FI3A 5HS6A 2JAQA 3IQDB 3WNQA 1ZMRA 4LISA 1M2VA 5CU7A 5D3MB 2HMUA 4YB8A 3H7AA 4RVGA 4DQ0A 2J3MA 4PZDA 4EH1A 3ZCVA 4EYSA 1Z8DA 4FFSA 4JC8A 4NHOA 4R8LA 3H1AA 1RRKA 3AVWA 3PXDA 5F1OA 1Y81A 2Q21A 4HQOA 4AAYA 3AHIA 1FFAA 4DSNA 5DRTA 1AN9A 2C84A 4WTOA 2IU7A 3FRHA 3SK0A 2CFOA 2FRXA 3D64A 1PFKA 1IC8A 2GZ2A 4D6XA 3B8EA 1UMDB 4B3RB 4L1KA 2G88A 1JG3A 3RNOA 3QI7A 1NJ5A 1YKSA 2VHEA 2IIVA 5JD3A 3G5UA 2H0RA 3F6BX 1UODA 2ZJZA 5DB4A 1AN0A 1R4NB 1ZC3A 3W1EA 4J94A 1RXIA 4IX1A 1ESCA 3GPCA 1DWPA 1U2TA 4G0WA 4M86A 3EEIA 3T9EA 5JHGB 1NWHA 1DWKA 3EZNA 3LTEA 2MSKA 3H4IA 2CXOA 3DEYX 3HWSA 3IPRA 4DWVA 1ILWA 1JAIA 2UV8A 4Y6PA 5DN9A 2HWKA 3GNSA 3KJZA 4W9NC 4YP5A 1N92A 2Z5VA 3E4DA 1CF9A 1GEEA 1JKXA 3T9CA 4Z1OA 1ZMXA 3JWHA 3PCXA 3MLBA 2ODAA 3KU4A 1J1UA 3MRTA 3DEZA 4C5BA 1RW4A 1JZQA 3RIHA 1KZGB 1GUDA 1P3DA 1FYDA 3G8YA 1AG9A 1UPFA 3LIIA 4JROA 5DX0A 3PKZA 1K6MA 3VYSB 2A86A 3OM9A 1AU7A 2L49A 1DRKA 3E5MA 1CFJA 3DO5A 3HXPA 4FYYA 3VMFA 4CTOA 2X0RA 3R6DA 4EG5A 3FYTA 5KNBA 4MCTA 4JC0A 3QKSB 4N8EA 1PERL 5IUJC 1JLMA 1RJGA 5T67A 3WG9A 5IAKA 3ASYA 1VMEA 1VLVA 4QULA 1GNSA 1L4NA 2P65A 5DM1A 4F7DA 3ZVLA 3PUVA 3OZBA 4GPBA 1TTTA 4EHJA 2G4LA 1XF9A 3BHMA 3GHHA 3F4BA 4JIGA 2QR3A 5F1PA 2NPFA 1KH3A 4BKPA 2RK6A 2X8LA 2IOFA 4RELA 1YZGA 1JIQA 2WHYA 3LT1A 4A6XA 2V5UA 2PU7A 5FCDA 1H2BA 4IIUA 5D3KA 3MWEA 3FYUC 2BI8A 2QTTA 4J0HA 3E9RA 2HPVA 5JCJA 5BYAA 5HQJA 3VGPA 1XPJA 4UD2A 4MRAA 5J43A 4I36A 1LBQA 1GGMA 4F4IA 1Q57A 1ZEMA 4FVTA 3V4OA 1M5RA 1GNPA 2IYXA 3K5WA 5EQTA 3BS3A 1K08A 1RHJA 2CJYA 1GRNA 1MGOA 2OAP1 3DOHA 3KBBA 1T6XA 4KCGA 4U7PB 3RYHB 3K0CA 2YIJA 1WDWB 4DFDA 1M2HA 4DIEA 4KYTA 2LRHA 4CL2A 4M0CA 4HRVA 5I9IA 2VEOA 3MB8A 3L8CA 3ZN2A 5LA6B 2RKBA 1K27A 1LS6A 4PZUA 3SY8A 1OAAA 2FDXA 4Y9TA 4CM4B 5ALFA 1L5WA 3NATA 8GPBA 4PC7A 2OFXA 4F8YA 3NKFA 3LP5A 1PRUA 3U4CA 1XTVA 2WSSD 4GHWA 4GYWA 4EEXA 3D0RA 3CNBA 4HVLA 1MJHA 4O63O 3KM0A 4HD8A 3NDJA 1T25A 1W0JD 1Y7TA 2CMGA 3TCKA 3THXB 2P62A 3LYLA 3PCRB 1NBMA 2FZGA 4XTRA 1Y0BA 1D8TA 2VO1A 3QVJA 4BTVA 1N1DA 4Q15A 2WFMA 1LLCA 1SBZA 4QOHA 3AI2A 3L40A 1Z7WA 1X80A 3AVQA 4HR7A 4RANA 2O8FB 3K8OE 1BXGB 4PZAA 4OGLA 2IS4A 4L22A 4V2UA 2BHLA 2QN3A 4PSUA 1AK9A 4TQGA 1Z34A 3LDFA 3W0LB 4EA6A 1E9BA 2VYCA 3BK1A 5BOSB 2ZIEA 2EARA 2LKDA 3HR7A 3ZQKA 2AOTA 4M1QA 1G63A 4P93A 1EK0A 1JQDA 1P4AA 3A1FA 2I2XB 2ZPAA 4UEOA 1OGIA 4DMHA 3VKFA 4EG0A 4W5WA 1W6RA 4K2AA 4YY3B 1LNSA 1DBVO 2CHUA 5DNDA 5A0FA 1YR3A 1HNXB 4HFMA 1EWTA 3AEZA 8LDHA 2JAXA 2PD6A 5HTOA 1TAHA 5EE0A 1FNSA 2FSSA 4GNKA 1HQ1A 2QPLA 2R44A 4HAZA 3L2OB 3OQBA 3S1LA 1B0UA 2RI6A 1T3ZA 2QN2A 3MMXA 2AF4C 4LZOA 4BFYA 2GN1A 2QM8A 4JJZA 5DI9A 5EE9A 1LBSA 2I91A 1K8QA 1OI3A 3JYNA 3DE3X 4LXHA 1KO1A 2PQ6A 1IK4A 5HZMA 4IYJA 4KVZA 1RWKA 3PNSA 5KHAA 3HR4A 4E51A 2IDMA 3UJPA 1W88B 1YONA 1DTWB 4PHHA 3RUPA 1KFCB 3KOZA 4R0MA 4JVNA 1V26A 1OI7A 3Q7EA 4YLEA 3GUZA 2FG5A 4PICA 4W7IA 4DY4A 1AS3A 5JAQA 1R8SA 3AWDA 3RABA 1HDYA 3SQNA 3VZRA 2JLRA 3WL5A 3U09A 4L8YA 5JZMA 2FTKE 3OIUA 3P45A 2B37A 1AF7A 4NDZA 3PFFA 3J7AC 5HBRA 4AF8A 2E4VA 3WBBA 1RAEA 1SZCA 2WM8A 2Y0EA 4ARZA 4UUBA 5JYCA 4QO8A 2QMEA 3I39X 1XTRA 1T15A 3HCEA 3Q0TA 3EH1A 1KGSA 5JXGA 3D0KA 5KYNA 2JPDA 3ZWAA 3QUQA 2HHJA 1E7SA 2O6HA 1L5VA 2YFHA 1DAEA 2AHOA 3B6JA 5AUPB 3L8EA 3K9WA 3PI7A 3M6FA 4G1FA 2RBKA 4RAOA 4EUKA 3H04A 5KBYA 4MP3A 2CZGA 2J9RA 2V1XA 4IIHA 3HTXA 3CZ4A 1MV8A 3ZGNA 2XTNA 4TROA 1B6GA 3OE4A 4HGOA 5HKKD 5B2ZA 5EIEA 4EF5A 2AUMA 1GUAA 4R9SA 5CDYA 1KH1A 2B34A 2FZ4A 2GA8A 1JDBB 1TK2A 3MSCA 4QUEA 4M3NA 3RC9A 4FUQA 4Y2YA 3VKHA 1Q1GA 5G4KB 4LFCB 2OQ2A 4K28A 1JWLA 3N2EA 5IC6A 3VNAA 3O75A 5CEJA 3ETEA 3MPUA 2NXNA 3HBNA 3PWKA 2IXAA 4W5RA 2RGYA 1FZTA 4HQNA 4RGYA 3VR3A 2P7HA 1SUBA 2QAJA 3RH0A 4AY6A 1J99A 1K6EA 1J0CA 4HZGA 3KT3A 2RGGA 3WB0A 1BE6A 1OX4A 3FSGD 4JLNA 3BL5A 1BN7A 4MGEA 5LP6C 4DKXA 3LKBA 1HK7A 1YDHA 3CZMA 5CLIA 3A70A 3ZDEA 2GK3A 1P4SA 1WEKA 3C7DB 4AMBA 3WGYA 3AVTA 1EFRA 1U3VA 5F64A 1US8B 4AKIA 4F8DA 4HN9A 3WP0A 4CGYA 2XNDA 1N2CE 3BDNA 1MPXA 2CXXA 3W34A 2ZRIA 4EVIA 1F2VA 1H6AA 1TRHA 5AJYA 1R6DA 3CLSC 4JKYA 3GMDA 5JQGF 3PGKA 2PSFA 4CIDA 2ZRQA 2BV3A 4NU0A 3IAEA 3HJGA 5A3VA 2WD8A 1D1PA 2JK1A 5SZIA 4EPTA 5A0VA 5KYWB 1Q7EA 2VWHA 1J0XO 5LDGA 4MITA 1U1FA 2LNDA 3DOUA 3GC6A 1EDZA 4M53A 4GMHA 3RBAA 1LLFA 1HV8A 3IPCA 2DY0A 2RKWA 4Y6GB 4EW1A 3Q3CA 1G7RA 1F12A 4PCAA 2DF8A 1VPEA 2RHHA 1FP1D 4DV2B 4UHEA 5ALZA 2D1QA 4BX0A 1Y9EA 2WUGA 1DRUA 2JAUA 2CDBA 1K2VN 1TUEA 1YCGA 2FPGB 4ENQA 3QF4B 4JLWA 1NKTA 2E5WA 4B3TB 5ITVA 4MMYB 4YJGB 1GUFA 5DXAA 3NS7A 1XQWA 3T1QA 1JQEA 3WK8A 1PQPA 4DCSA 5LD2B 4J0GA 1S89A 4PPGA 5K4AA 5E7JA 2EJUA 4IVZA 4KBFA 3DE5X 3OQ1A 5IEJA 1Y1LA 2G6BA 4D8WA 5LMCA 4YJKA 4YECA 1XMQB 3IUBA 1PRYA 1VPVA 4CKXA 4E2YA 3W5AA 2G70A 1SC9A 1WKVA 3OEEA 4V2IA 1GSOA 2BFNA 1TVKA 2YJGA 2OTCA 3ETJA 4KDCA 4BAZA 4HWSA 4E2FA 1J8QA 3IILA 3OZ7A 4MJ7A 4QGBA 5K3FB 4D0LB 1EU1A 2K7ZA 4O4HA 5B1DA 3TTYA 4B4VA 1LZLA 4ENSA 5A3RA 4JI2B 3GLSA 2QL7A 3KVVA 4O5AA 3HR8A 1Y4UA 3D0QA 4CMBA 4ER6A 2WT4A 4R84A 3ABSB 1ISSA 3EZGA 4KWCA 4PC1A 5C53B 5IJWA 4ZDKA 2DHRA 2P77A 2A9KA 1GRCA 4P54A 1R8QA 1DC5A 2YJ3A 1ZAKA 1WMSA 3N9IA 4EO7A 2ZW9A 4YP0A 5B3JC 3HP4A 4HCJA 4ZEVA 1O0SA 1DCMA 5FWXA 1E1MA 1YZFA 3C6KA 5REQA 4CKZA 4FGLA 1X1AA 4FEYA 4UXJA 3QWHA 4ZAVA 5K0JA 3UEOA 2IUUA 4V03A 3C1OA 2Q6TA 4RLQA 5IS2A 1E3OC 4QUGA 1BYUA 1ODKA 2BM8A 1K7FB 1VSQA 1GPDG 1NBHA 2P9JA 2B7CA 3IBYA 2OFYA 4KI0A 3K94A 2PWZA 2QG4A 3MQFA 4MV5A 4GWGA 2NVWA 4R7TA 1VKJA 1PRAA 1FPQA 2HXYA 4QYWA 1IAVA 5IANA 3FGNA 1XAHA 3UV3A 3FN4A 2P9QA 4G5QA 4M8LA 3DV0A 3KZMA 3MEQA 1E1YA 4Y6LA 3V32A 1E3EA 5I3ZA 3NHZA 1B3RA 1OTXA 4DBVO 1LI4A 1FP7A 1LDEA 5B3KA 5HIJA 3NXKA 5DLDA 5MN5A 4MWSA 1QCYA 3PPWA 3NTOA 2I62A 3NP9A 3TH5A 3BSWA 4MVXA 5DOZA 4QTYA 1DEHA 4YAUA 4IFIA 2X42A 2DCUA 3SQOA 3HJCA 1QX3A 1K4MA 4AWAA 4FINA 1NBME 1UP7A 2I6UA 3ETHA 3NI2A 1G7CA 1VYVA 3AEKA 2OV6A 1QFYA 3TR0A 2C3OA 4PLHA 5C32A 1EUQA 3OFVA 1CY8A 2ZRCA 3TELA 1LWOA 5AW9A 4EHFA 1QH0A 1AVTA 5TJ9A 3QOXA 4X4DA 3WLRA 1ZMOA 1A9PA 1GTL1 1PGQA 4G0NA 4OGFA 4U5XA 4DLXA 2QOEA 1PFYA 3OIGA 3AKEA 3R6LA 1Z4QA 1VCHA 1YQWA 3FOFC 4AZ0A 2JFUA 3O92A 3OZCA 3CWQA 3PC3A 3ANLA 2GBFA 4P4UA 4WE3A 3HBFA 5CHEA 2H1CA 1I4WA 4M37A 5D84A 4J0FA 1YZLA 2NUAA 4J2HA 2CXPA 4Q34A 4W8OA 2AR9A 4F4JA 5HE9A 4HATA 3SXPA 4MVJE 3SLGA 4FYIA 3GN5B 1T5SA 1EFTA 3RQSA 4CF3A 1QHGA 3G23A 1OLUA 4FHCA 4L4ZA 4UFNA 1Q0LA 3A6DA 4XFKA 3GPBA 2O0MA 3G8CA 4CF4A 4N9QA 1YRHA 3I0MA 4EG3A 1E6WA 4UJ3A 4S1WA 1UKZA 4KE9A 3H2YA 2LYQA 2GN2A 2H6EA 2VYFA 5J2UA 2W6QA 1NLFA 5AOVA 1Q91A 3PJEA 3EQ7A 2QPAA 5H4HA 1PS0A 2C20A 1E98A 3GR6A 2F43A 2N1BA 1GYRA 4BNKA 1E5DA 2BYTA 1J0DA 3LP6A 3LL4A 2XNSA 4YYEA 2CK3D 1OH7A 3TTXA 1MO4A 1XXHA 3LA6A 2ZRGA 1ZP6A 1JSRA 3MMSA 1XWFA 2AQKA 4RVFA 1ZCBA 4YJDA 1B0AA 5EEGA 1KJ9A 4A6DA 2G1JA 2WM9B 5HQ3A 2QMUA 3PD1A 1TVEA 2C78A 1UC8A 1GQYA 3D4IA 3SEQA 4B73A 3BPSA 4QXRA 1XMSA 4DA8A 5AKHA 2IOFK 3SIWA 1BW9B 1MHTA 1SAYA 1VKRA 4BMNA 4M1OA 5H3HA 2PQMA 3E3NA 4GE3A 4E4TA 4J1NA 1YE8A 3I01A 5BWNA 1HKHA 1TMKA 2FUEA 3ICQB 1YT5A 1K3FA 3U4HA 1RADA 4KK4A 3BTVA 1U8EA 5HCIA 1KOLA 4IIDA 4NR0A 4EKNB 4DCVA 2WIUB 3ECCA 1T8RA 2XKJE 4CDRA 4LY6A 3FMYA 5BW5A 1I2AA 1ZI6A 2VBFA 2G83A 4NU6A 4IHKA 4RHXA 4LHZA 1RP7A 1E58A 1G16A 3HLYA 3W3AA 1T35A 2ZRBA 1POUA 4U2FA 5IMSA 1ORVA 4GRIA 4KN5A 3AZPA 2XYRA 1K7SN 4V0LA 1Z6TA 2ES4A 2H51A 2HEIA 1Q83A 3DPUA 3WICA 2WFLA 4M1KA 3RLIA 3CKYA 1X77A 3UMBA 3WNBA 4HBGA 5FTLA 1LRKA 4F21A 1APBA 1FL9A 1OXMA 3JX9A 3N2ZB 1XEXA 4KXFB 2ZEJA 5DEIA 1AS0A 1TQ6A 4KSBA 1CY7A 2XF2A 3DBRB 4Y1EA 2VN8A 3OJEA 4WDRA 1GM5A 1WQ1R 4JGBA 4R16A 2F9LA 3RGGA 2DR2A 4ENVA 2VTBB 5KX5B 3W2HA 3CPEA 5CLFA 4F4CA 2X2PA 1P8JA 2X7JA 1PTKA 3INNA 5DHSA 4KNWA 4P3NA 4NYMR 2L8NA 5FORA 3GZDA 1T6YA 1JDJA 3A2MA 1UOEA 1NNSA 3MJHA 3QOFA 4R98A 3A1CA 3AWIA 1ENPA 5HPYB 3F67A 3QV2A 5G40A 1QYWA 3LCJA 2RCYA 2WU4A 2XZDA 8AT1A 3MGCA 2FZ5A 4J7UA 5B6IA 2Z9CA 1RIIA 5DYGA 2P35A 2C03A 5K0GA 1AY0A 3NGMA 4JQCA 2O2DA 1S7GA 3WXBA 3UTDA 1UDWA 1MAVA 1WTAA 5LQJA 4DR6B 4JY7A 4MO9A 4EW3A 4TV8A 4GEGA 5ESWA 1SHZA 2I1VB 1GL9B 2ZRMA 3DE0X 2VH1A 3QKWA 5GP1A 4DEVA 5I7EA 2IT1A 2HRRA 3E9EA 4D4KA 4NENA 5HIAA 1SBCA 4P5DA 3T9FA 1C8KA 2OSVA 2XXQA 4A2WA 5AW0A 3ZLBA 1OC2A 1FFHA 1ZNXA 3PFNA 3A27A 3RSOA 5DBGA 1WPQA 3PVZA 4Z7OB 1BRMA 2FA9A 2X2OA 3CMCO 4TV9B 4BCBA 3KXKA 4CI0B 2PVSA 3QE0A 1BCSB 1J5XA 2QIPA 4YRTA 4CMEC 4MRPA 2Q5QA 5JNWA 4L07A 1DXOA 2OLJA 3R24A 4TKMA 7AT1A 3IEPA 1Z6QA 2X22A 2X1HA 2GF9A 5KOYA 1ZZ9A 3C6XA 2A5JA 4HZIA 1X7HA 3DTNA 1HDEA 1WETA 4EK9A 1W93A 2JD2A 2PXFA 4H3KB 4G5XA 3R7WA 1PD1A 1UKBA 3LBHA 3UMCA 4B3JA 1E59A 2VA8A 4ZJPA 1NF3A 4JL6A 4Q0MA 3VUEA 1GPWB 2ZLBA 4B33A 2V7BA 3SZGA 2Z2ZA 3G5TA 3PUZA 5ILGA 4OQZA 2IEGA 3E5NA 3DLPX 2I87A 3HEAA 2W2LD 4BNUA 3LT0A 2JLCA 3ZDQA 1UKYA 2RAVA 4ALKA 3UJAA 1DZIA 3IAS6 5E3IA 1Y9QA 1K7YA 2RONA 3OTHA 4ISBA 1YRLA 2JIQA 3LP8A 4JSYA 3ROQA 3TNJA 1YA6A 1QONA 4YN3A 1K5GA 3LECA 3WGGA 1KMIY 3C16C 4JFRA 4AUNA 3I2YX 1PHRA 4RTRA 4LSWA 5HYVA 4DV3B 4P0QB 1XRPA 5CDUA 4NCAA 1VL8A 5JZVA 3EFEA 2PGNA 3GCXA 4IQ0A 5L4SA 1VJDA 4UQPA 4ZTZB 2PFKA 4A8PA 2IYLD 3RUIA 1O89A 2JLUA 2FNAA 4NMHA 3P4UA 3VJRA 3EWAA 3QSYA 2NSDA 4NFHA 1FXWF 4UBIA 3I9V6 5CH8A 3ETGA 3U49A 3WYEA 1RP1A 4C4YA 1A88A 2QM0A 4CN9A 3HBAA 1Z5ZA 5I45A 1F0PA 3NHMA 1R0XA 1CWUA 4UAJA 3JXBC 3ASVA 1HI9A 3FFXA 1UEIA 2H65A 4WL0A 1LSSA 1O8CA 3N6XA 221PA 3GUUA 1THMA 1WUIS 2GERA 2XYPA 2ZJBA 3IUNA 3KOOA 3OJWA 4LTDA 5AM1A 2Y6UA 1XB2A 4CR7A 3U7GA 4MH0R 1V8FA 3GA7A 2P6NA 2ZJ0A 3CCFA 1P62B 3KTOA 2O8VA 2FW6A 4N40A 1EXMA 1GYQA 3CF2A 3QFRA 4YASA 5K99A 2W8BA 3N6RA 5COBA 1GP2A 3OICA 3E53A 3FM9A 4WCFC 1L6RA 5KO2A 4RXMA 4WJKB 3EIQA 3PK0A 3EXHC 3K8YA 1UKEA 4GYJA 4D9EA 5A4IS 2RC5A 1WXQA 2BLLA 2J0EA 1G8KA 1VIMA 2XSZD 3BFXA 4Y2RA 4BECA 1IPFA 3L0BA 4L0QA 4DGQA 3O26A 3AVXA 2VPXA 5G53C 1KI2A 5D6OA 3H9UA 4I1IA 4P53A 2P3LA 1C9EA 4YXWA 1G8PA 2V6MA 3F52A 3T9DA 2FPPB 3AESB 4QLOA 3CRQA 3RIYA 8ABPA 3HC7A 4KREA 3O3CA 1SA0A 1J33A 3K6JA 3N0RA 2C83A 1FU4A 4C21A 3P9KA 3HP7A 1RHQA 2VJQA 2GRUA 2GBGA 3V4ZA 1Y6GA 1YH3A 2W7TA 4ZAWA 1C3VA 1OZAA 2Y68A 1XP5A 2Q0XA 1PYDA 1VMDA 2C4TA 3CZ9A 2PXQA 3ENQA 4L16A 4PRYA 3LQRA 3S8MA 2XXAB 3R5SA 4X90A 4AKGA 1DQNA 2AG8A 4ME6A 5EQDA 3RQIA 2QYOA 1T4DA 3UUWA 4OOEA 3UZUA 1G3RA 4EMSA 1NVDA 4D9IA 3NFYA 2OCBA 3Q7QA 4HNRA 3J81k 2IY9A 4C0JA 2EBYA 5A7LA 2WWFA 2PXKA 2PLRA 4V0MA 4DLKA 3VPSA 5K1ZA 3I5MA 2VXOA 4R71A 2HREA 2JAHA 3ENVA 3G6KA 1C0IA 2FLWA 4GOKA 4B09A 5I9BA 3AR7A 3KBOA 4IO1A 2OFWA 3WGMA 1JJIA 2OZEA 1IOVA 1QHYA 3TFWA 2QLLA 3TNFA 5BOSA 2TRSB 4EPWA 3GEGA 4KIJA 2XIUA 1DXYA 4UNPA 4CHTA 2HT1A 2X5JO 2Q8QA 5LQDA 1XNHA 3FYDA 4LY3A 1RNLA 1Y7HA 1LS1A 2HNBA 3L4BA 4JA0A 3RYFA 3TTTA 4PCVA 1RI1A 4GSYA 5T8KC 1S02A 2AB0A 4PVDA 2YXDA 3MIIA 1GARA 1N1MA 2OG2A 3PUHA 3QXGA 5DTIA 3OIWA 3QIAA 4C04A 4C05A 3WDLA 2M32A 4ZODA 2G5PA 1N2GA 1OE0A 1PWZA 1BD3A 2FEMA 2PUVA 3MGGA 1G8FA 2FDCA 2BF7A 4OYYA 4B87A 3EXFB 1FYEA 1WXWA 2DUUA 3CRNA 1GYPA 1ZPDA 3HN7A 1EJ6A 2KBFA 3PRHA 2GBPA 4CNBA 2YFKA 2Z2JA 2ZUWA 3F6RA 3B5IA 4URYR 4PGGA 2CDAA 1A50B 3NIGB 4LNHA 4RIEA 4B46A 4PLTA 1P0PA 4Y0AA 2XWBF 1G4UR 2Q1UA 3NP7A 2CCJA 2WTEA 1HWYA 1X39A 2JLXA 1V95A 2HJHA 4DTCA 2GXSA 5FLXA 3ZBUA 5TV2A 5K0SA 4I6TA 1WW2A 1NMYA 3ZK7A 5FTJA 4HLNA 2IHJA 3IOYA 3NTQA 4H7KA 4JAVC 2VJLA 3EPHA 1E9FA 4FN3A 1K6XA 2W71A 3JQFC 5AHWA 5KOJA 2QVGA 1Y1KE 2VDRB 2YHAA 4TWAA 2CFTA 4XB6B 3PE5A 2JIRA 5CP8A 1EHCA 1U7ZA 2J46A 5FV7A 3L8YA 4WLEA 4YT8A 3HCDA 2HY7A 4PR3A 5CBKA 3O38A 1HC7A 1NE7A 1EK6A 4FTWA 1WHSA 4GX0A 4Q5IA 3I72A 4QPDA 3GYBA 1PUIA 5LUBA 4AN1A 5J5VA 3VSEA 2YJ4A 1BQEA 2F4NA 3QEMB 1KKUA 1XBTA 3H5OA 1M2VB 1O2DA 2WM3A 2VSOA 3NR2A 4M7RA 1I10A 4M76B 1NM5A 3KJNA 1JDSA 3O8NA 5EZQA 3HN6A 2TYSB 4R2LA 2BM1A 2PWPA 4H16A 1E8MA 4MGZR 2GAFA 4EGCB 1PR6A 2AXEA 3IURA 4LVNA 2OB2A 3CZ5A 4W8HA 5JO0A 1JEDA 1CZHA 2HA6A 2I7CA 2IEYA 2XV1A 2DKOA 3EVNA 5AVZA 1NDQA 1JDNA 3P2IA 1V3VA 3QLEA 4OAOA 2ZDQA 2L19A 2XUZA 3WLSA 3OY2A 3U1BA 1DNPA 1JE1A 3EMDA 4ZI5A 2HDHA 2P5YA 3DCIA 1VB5A 1FXUA 3PNBA 3PQ6A 4C29A 2PAFA 4RKRA 1Y7IA 2HMWA 1RIOA 1CY0A 2CZCA 3RSLA 3RWMB 2BDTA 2WWGA 5A5VA 4D80A 4DWWA 1SXPA 3R3YA 1GG2A 1CZUA 1FJXA 3DWGA 1C14A 1SCUA 2PUGA 1GGFA 1NXPA 1OKKD 1U0EA 3F1LA 1OZFA 2G72A 3ZW7A 1XXHE 1MP0A 3M3HA 5DYIA 1PK7A 2AV6A 3IB6A 4ZVUA 2FPMA 5JNRA 4YMHA 2ODQA 2IELA 2BHRA 3QXXA 2OGWA 2HW8A 2J8ZA 4FWIB 3NHKA 5BSKA 5ENZA 1OYOA 2NVUA 2EJTA 1NJSA 3DYVA 3THSA 4BFXA 5BR8B 5EERA 1C41A 3LKZA 1L5HB 4DDMA 1B0ZA 1SUEA 1NP6A 5LZ7A 3EBOA 1TGVA 4PGMA 1X94A 1A96A 1CB7A 1SD5A 2D4HA 2QD5A 2YC4C 4JT9A 4WADA 1ADJA 1V2HE 3UF0A 3CVOA 2OD9A 3G0BA 2GCGA 2XA2A 4LDZA 3HU5A 5IF9A 1W0JA 2YXBA 3T5AA 2VHWA 1PGOA 4YRZA 4TYWA 5AJVB 2FZKA 3GU3A 3CNHA 5I8PA 3C3JA 2QTCA 3TQQA 2GILA 4ZCIA 1WRBA 3B5JA 3D7KA 3ZE9A 3A6EA 1PR9A 3DEIA 2D3TA 1F4LA 1XN4A 2GJSA 2P9ZA 2R9VA 3OOWA 1BXZA 4G0MA 3UW1A 4YUYA 5DGDA 5J4VA 1ORWA 3ZKCA 1XCJA 4Y2UA 2QSJA 2HXGA 4B47A 5ICCA 1N0HA 2I71A 1JU3A 3QENA 3JALA 4Q16A 4QSMA 4URHA 5LR6A 2WU8A 2Q1WA 3CLUD 3KQYA 5DCWA 3SEAA 3DAYA 2UXDB 3MERA 3ZI4A 1C1XB 2GZ3A 2WD7B 5HE8A 4EJSB 1JKJB 4HSEA 1EZ4A 1THZA 2YWXA 1OF1A 2AD1A 3IKJA 3KZVA 3PNPA 4IJVA 4RADA 4DM3A 1AKTA 2DERA 4GSKA 3A05A 3MA0A 4PTYA 5L7WA 2PNFA 2HK6A 1ZM3A 3AR2A 5HM6A 4FXOA 4C5AA 3QLTA 2OZVA 3X1KA 3M9WA 4NK4A 2I4OA 1RYEA 4F1JA 1RC1A 5KPDA 5JS1A 3EC1A 1QKKA 1UXDA 2RK4A 1R0ZA 4G86A 1XZFA 3OECA 3I45A 3NIDB 1QRTA 4PWYA 5JASA 1X2EA 4QVGA 2QMOA 5B1SA 4X44A 2BELA 3QFSA 4IUBS 1YUNA 2QUJA 1OBOA 4RC9A 2VZEA 4QGHA 4OHMA 1PJZA 2DEUA 3RF6A 2B7LA 3G3EA 4TMFA 5TGTA 5LL6P 2H2DA 1U4NA 4IVQA 4RZIA 5ALTA 3T1OA 1KK0A 1X3LA 1REQB 1BNCA 5C3UA 3GRAA 2XD4A 2CBGA 3CLRD 3EGIA 5LZ9A 3GH1A 4YAEA 3G0OA 4MWBA 2Y1KA 3LM8A 5DCLA 4YRPA 4OI1A 1N0IA 3AVPA 3OD5A 4F2HA 3NB0A 1V25A 4J4TA 4V24A 3SF8A 5FAKA 3I52A 5FJJA 2P6OA 1TRKA 2TS1A 3OZWA 3HJFA 4L76A 1OILA 1XXHB 2AFHB 3B1XA 1C0PA 1SB9A 1SVIA 2AOTB 3EZXA 2ZRNA 5CRIA 1JJVA 3SR3A 3DE1X 2K5UA 3HQ4O 3JQQA 3MOSA 1CEQA 1RYNA 3PC6A 3UJ8A 2BFAA 2IZ1A 1T1EA 2RHOA 4LKOA 3RRZA 4D82A 2K4MA 2YZ7A 1GG5A 1ZGZA 1W2GA 1BQ4A 1F0NA 3G2IA 4MYDA 3LHSA 7MDHA 2ZFUA 2X8JA 2N47A 2R1VB 1OT5A 3D8UA 4O4JF 3QMPA 1T13A 2FHPA 2DBYA 2OO7A 3HVUA 1NVUQ 3SYMA 3R20A 1RTTA 4G4SP 4DV4B 1DIHA 2KPJA 3DUFB 3UWKA 1KFEB 1JT9A 2HUPA 1M1XB 1N2JA 3B9BA 3Q7RA 3TL2A 3V2UA 4KDEA 2HWWA 3UJBA 1XKLA 3FTNA 3C39A 3WKDA 3DGEC 5KYTA 1EESA 1V7PC 1UBOS 2QTGA 3HBJA 3HJAA 2A0WA 5KOJB 2HGZA 1EUZA 3OE1A 3QWFA 2W58A 3CYFA 1OTHA 2I67A 4GU5A 1F60A 1MQ9A 4X95A 2DULA 3WLNA 4RYLA 4ALJA 4NPAA 5ANRB 4J1TC 1XIVA 2CUTA 1COZA 1P2VA 3RIXA 3RK1A 1E9SA 1USIA 3IP9A 1ZK1A 3UJNA 4BE9A 5LJIA 4BLOA 2FFHA 3KWJA 4IGFA 1YB7A 4RXTA 3U61B 1GNVA 5INTA 3DE6X 1RZ3A 2PZLA 2W6PA 2E48A 2ZRHA 3EIWA 3W5UA 4E0BA 5SYAA 1ZUGA 1AK2A 1WNFA 3U3ZA 2I3ZA 2AT1A 5F2EA 3REGA 3A0UA 2I2DA 3KFVA 3H5NA 4C4OA 2Z83A 2PYIA 3ECAA 1DPFA 1GFZA 1JPUA 1XTJA 3N87A 4JBYA 1W47A 3EGOA 4KIUA 1ZRMA 4Q4CA 1VKNA 2B92A 1X57A 1VYUA 2IV1A 3BMCA 5H83A 4MCXA 3OJFA 4BNTA 2PQ2A 2YNMC 4CG3A 1EG2A 5E0KB 3OUTA 2BP7B 1G8JA 2NX2A 1X7WA 3W4KA 3DDCA 2GVNA 4DE8A 4US2R 4KSCA 4MV7A 4NBUA 5HILA 4ARAA 1C9MA 3ZE8A 1RI2A 5IAJA 2W48A 4FB5A 2C5BA 1U2QA 1TT5A 2EW1A 5L7YA 2Q7DA 1OA1A 2BD0A 5ECDA 1C9JA 3R8XA 2W00A 2CFSA 1W19A 5BN5B 4RD6A 2YOFA 4Q18A 4HGPA 4IUCS 1P8AA 5CLQA 1ZXXA 2FWBA 4EGFA 3HFGA 4F5YA 3Q2OA 4IJMA 1OV4A 1W8IA 2RGXA 3A3OA 3CX6A 4JCYA 4DBLE 1Y1TA 2IHUA 3NOOA 2AN3A 2Z1DA 3C3MA 4ZVVA 1KY4A 3E9QA 4MWDA 5SY4A 4ZOQI 4NPCA 4F5EA 4PX2A 3T7KA 5EMKA 3DFZA 4R81A 5EGNA 1QOQB 1UIRA 3BB1A 2D1FA 2HO4A 4WK0B 1RZSA 5BN4B 2ENWA 4YRRA 5C8XA 3N05A 3NTVA 2YZ2A 2YXEA 4TZTA 1C1DB 5AJZA 4YR7A 4LZAA 2P9EA 3NDBB 1FLNA 3ZZNA 1SVNA 2ZJ6A 3VBCA 1KAMA 3D2BA 3N3AC 3BAFA 5E6UB 1XVIA 1NW5A 3HXKA 4TL6A 1MQ8B 1XTUA 3JQ7B 3QELB 3RTDA 4E5SA 5AVXA 1S1CA 4BNMA 2X8AA 1KJIA 4DWJA 1QOZA 2DWCA 3KWFA 1QGYA 1ULZA 1WVIA 3NTLA 1PT7A 1UWCA 2HJ9A 4IDEA 3ICWA 4XWAA 4YJ3B 2H08A 1R4MA 2O9JA 3H5VA 4ILEA 4MUXA 1QE3A 2Q9AA 4QXQA 2HBRA 3UCFA 2OCYC 1ZUD1 3BRWD 1MD9A 4N8SA 1LQTA 5EXXA 2O06A 3M34A 3E22A 3DPIA 4GPIB 3FX2A 1T5TA 1SNYA 1GAXA 1RLJA 4YEDA 1OFUA 3CN9A 1UMCA 4ZYXA 2IVZA 1JHPA 2ZZKA 1W25A 5FNVB 1BWQA 3NLLA 5K3FA 2FJ0A 1XZQA 3QELA 1A97A 1E2BA 1VHWA 1GQFA 2NZWA 2C54A 1B43A 2C2GA 3JQRA 1V7ZA 1NVKA 1UJ5A 1VHQA 2YN2A 4OQLA 4UNNA 4UVDA 4JWTA 4WAUA 3T6KA 4CQLA 4IV5A 4DSOA 4UE6A 2ILTA 5L4LA 4TXLA 4A6EA 4M60A 3TS1A 2ZI4A 2D0DA 1BEUB 2G0TA 5LU8A 1VDZA 3JARB 1NHWA 5B12A 2X19A 5EY5B 2V74B 2QVBA 4KFTA 4PNHA 1JHRA 3ZHBA 3WP1B 5CFQA 3OQJA 1LQUA 2C95A 2C2BA 3DZHA 3KAPA 5H68A 1K0FA 4EARA 1ONSA 2FP3A 4HXEB 1XMIA 1JXMA 4UNSA 3H9GA 3HB9A 3AM3A 3IE0A 1WB4A 2QE6A 3T52A 1N6IA 3QOWA 3GBFA 5IJ9A 2P2YA 4KJZA 4RZ3A 1FC0A 4IV8A 2ZUVA 2KQUA 1Y6JA 5AK4A 3RSHA 4YCCA 3R2JA 4FN5A 4Y2PA 4TSFD 4JMPA 5COAA 4YPFA 4L3VA 2JRCA 1PL0A 2WAOA 4IHQA 4J2OA 4PHTA 1U9JA 3AUYA 2Y8EA 2JLYA 4RW0A 4GYKA 4J0EA 4ZN6A 3OLYA 1ZS4A 16PKA 1JXQA 2VK4A 3IBGA 1R9JA 5BW8A 5B4UA 2VYVD 3AKCA 2QUBA 2YZNA 3O91A 2PRKA 4AVYA 3AM4A 4P7GA 2E21A 2XVMA 5JNVA 1U2PA 3EPLA 2NP7A 1NVGA 2AA3A 3CZAA 3GFSA 2RJ3A 1IIRA 4I0WB 1VE7A 3K0HA 4FNMA 3GNTA 4J8PA 1Q2UA 4RF5A 2OPBA 4TSKA 4IXMA 2FXIA 4PLYA 3UB4A 7REQB 1P5RA 1Z8NA 2SKCA 3NUZA 1PSWA 5HMMA 2CNLA 2VJDA 2DCMA 3A04A 2ONZA 3FR7A 3IEUA 3UAYA 3WMGA 3AFGA 2JQEA 2ZSBA 4E2XA 5HZHA 1VJRA 4CF6A 2ZETA 4RVUA 1OOEA 5GINE 3ZVKA 1HQYE 3ZHZA 3FUVA 3CNOA 3W8NA 2ZITA 3U0BA 4DQKA 2F8LA 4EJMA 4H35A 5LSAA 2ACEA 3AESA 3WLOA 4JJ8A 1TECE 1VHDA 4HUQA 1GTZA 4TVSA 3TSOA 1ZGAA 1ZISA 2VDJA 2P3OA 3ZHYA 1T6NA 3WKBA 2WNSA 2XAAA 2EQ5A 1QNLA 5C5IA 2OZLB 1JLKA 1UWLA 3L7YA 3BSYA 5DYTA 1NLZA 2R1VA 3PHGA 1EDDA 2JB9A 1GU7A 1V41E 1FTWA 3AB3A 2A67A 1SXJE 2QIOA 2I3GA 3JWIA 3PLRA 4N7MA 1Y6RA 4ZGBA 1WCYA 4GLJA 4GO1A 4GOND 4MUFA 5EJ5A 1HDZA 4RENA 3FMFA 3G7DA 3TB6A 1HM5A 1X9IA 1MZPA 1Z0KA 4DXHA 1YB6A 3PR3A 1GPH1 1YZQA 2FI1A 2R8XA 1XD9A 4MI9A 5KNBH 4YG4A 4C9BA 4GKAA 3UHAA 4TGLA 4EDHA 5CR9A 1M6VA 4FCVA 3I42A 3QEMA 3NHUA 1Z6XA 2HADA 1GDTA 2VTVA 2GN8A 3CTMA 2X5KO 1ZINA 3N8IA 1NVTA 2ZB4A 4RJLA 2ZDHA 3AFHA 4HS4A 3K09A 5L45A 4D9KA 1QRSA 1U31A 2P2DA 1ML4A 5LZ5A 3ADDA 4MR7A 3K8ZA 3R41A 3L9XA 3NWJA 4NE9A 1IOWA 1U3TA 2RGCA 2ZJAA 4KN6A 1V16A 5TARA 1D9ZA 4TT8A 4BXOB 1NX9A 3ZE7A 3NZEA 4FIZA 3DL0A 3PGLA 4L6IA 3L6BA 4HXFB 1CUXA 3I2KA 2PY6A 1WZ2A 1VSTA 3VU0A 3LY7A 5KTTA 4J0KA 2C94A 3FFAA 3OEHA 4NECA 1EQ2A 721PA 5KAMA 4YAJA 5DSTA 2F43B 3L84A 1U0LA 1FTYA 3EXEB 2I9PA 3M6XA 4Q3KA 4YRNA 2EJCA 1EP9A 4M4SA 3U7IA 3ZE0B 4AYWA 5SV2A 3OFND 5KU7A 2SBTA 3RRNA 2PUDA 4YMWA 3ZU2A 1RABA 3GJSA 3WRVA 2R97A 2X1MA 1VGQA 2VUUA 4L4RA 1R4MB 2WK1A 1RLOA 2NUTB 3H0KA 4AICA 1G1AA 4EAAA 4HO1X 5JBNA 3JYPA 3U7JA 5KNCA 3HBLA 1NUAA 5DGIA 3TM4A 5LOVA 4N39A 2FVXA 2XYHA 4DLAA 4QNNA 3QWIA 1P72A<