3QOXA

Dot1l structure in complex with sah
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
328
structure length
326
Chain Sequence
LELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMENLIDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTTQPMKLNTRPSTGLLRHILQQVYNHSVTDPEKLNNYEPFSPEVYGETSFDLVAQMIDEIKMTDDDLFVDLGSGVGQVVLQVAAATNCKHHYGVEKADIPAKYAETMDREFRKWMKWYGKKHAEYTLERGDFLSEEWRERIANTSVIFVNNFAFGPEVDHQLKERFANMKEGGRIVSSKPFAPLNFRINSRNLSDIGTIMRVVELSPLKGSVSWTGKPVSYYLHTIDRTILENYFSSLKNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone-lysine N-methyltransferase
publication title Chemogenetic analysis of human protein methyltransferases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 102
structure length 326
sequence length 328
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2011-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08123 DOT1 Histone methylation protein DOT1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.60 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) 434 Repressor (Amino-terminal Domain) 3qoxA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3qoxA02
3LBFA 3LCVB 1X1DA 3ORHA 3T7SA 1ZGJA 4EMSA 3TKYA 1RJGA 1FPQA 2Y1WA 1SKMA 2GLUA 2PWYA 2ESRA 5EQJB 3FPFA 3OFJA 1QYRA 5FTWA 2NXNA 3HCAA 2PVCA 3LHDA 4M36A 2HMYB 4CTJA 4RSRA 1DUSA 3DH0A 2AZTA 4HTFB 5C0OE 3DLIA 4FT2A 2VDWA 4B17A 5HILA 4QPNA 3UA4A 1AV6A 3GNLA 3PLAE 2ZBPA 1V39A 2JJQA 3BKXA 3Q7EA 2PX4A 3BZBA 3KQOA 1KPGA 4QVGA 4DKJA 3K6RA 3PB3A 4GOLD 5C1IA 5EVJA 1JG3A 1XCLA 2B3TA 3EVFA 5GM1A 3VC2A 9MHTA 5K01A 5T6BA 1FBNA 2P41A 3OCJA 3CJTA 3VYWA 4RTMA 3F4KA 1RJFA 3NWEA 3ELUA 2AOVA 4RTLA 1RI3A 2PT6A 5BW5A 2UYOA 1BC5A 3HA7A 1HMYA 1VL5A 1XTPA 2AS0A 2JH9A 3ID6C 4FSXA 4ER6A 5LQCA 4M7RA 4ER7A 4F86A 4AZWA 3NW9A 1NKVA 3TPZA 3KPWA 4K6MA 3T0IA 3A26A 3MTEA 3LX6A 1D2GA 4A6DA 3G2QA 4RVHA 3DP7A 2OYRA 2XBMA 4MHTA 3C3PA 2EJUA 5LQUA 2IIPA 1FJXA 4HG2A 1TPYA 3I53A 1XDUA 7MHTA 1D2HA 3DUWA 4DCMA 3LSTA 2Z6AA 3A25A 3FUXA 5DXJA 2BR4A 4E30A 2OY0A 3SXJA 3U81A 3REOA 3UA3A 2IGTA 2NNWB 2ZULA 3FTEA 5ICFA 2OO3A 5P8WA 3FPJA 3ER9A 3TFWA 3DULA 3FPHA 3Q87B 2HNKA 2WA2A 3HTXA 1N2XA 2ZW9A 2FCAA 4IWNA 1RI5A 4RTSA 1Q0TA 2CMHA 3E8SA 3MHTA 4KRGA 2EJTA 1I1NA 3PX3A 3PX2A 2EG5A 5FWDA 2ZIGA 5BW4A 3IEIA 1VLMA 3R6TA 4C08A 2F8LA 5EGSA 3PS9A 2ONYA 4HGYA 2JH8A 3M6VA 5DX8A 3E7PA 3G2OA 8MHTA 2C7PA 2Q41A 1WG8A 5DX1A 1G60A 2I62A 1KYWA 3GGDA 3I58A 5GWXA 3A7DA 1EJ6A 5E2AA 1FP1D 3EEOA 1M6YA 3BWYA 1P1BA 1YZ3A 4DA4A 3G5LA 2YR0A 4F85A 3P2KA 5F2KA 1L9KA 5HEKA 2VZ9A 4AZSA 3UJ7A 4XUDA 2B9EA 1NE2A 4PWYA 4Z2YA 3BWCA 4P7FA 4FS8A 3B3JA 2AR0A 4LECA 2GS9A 2XVAA 4IKPA 3DTNA 3G88A 3KQVA 4PINA 4PYKA 3FTFA 2CMGA 3CKKA 3HVIA 5DM1A 1Z3CA 5CCBA 4LWOA 5DM4A 2ZZKA 3UJ6A 1SQFA 4PYQA 1D2CA 1F38A 3TM4A 3NJRA 2AVDA 2NYUA 5HOQA 4DM3A 2UYCA 1I4WA 4BP1A 4EVIA 2JG3A 2JHAA 4FSDA 4U7TB 4R6WA 4E31A 1JG2A 2PBFA 2KW5A 3BGDA 3DLCA 3TRKA 5MHTA 4PYLA 1SVUA 5CUQA 4P7KA 1TW3A 3AWIA 3OU7A 4G56A 4LG1A 5FHRA 3E05A 1JG4A 3HVKA 4R8RA 3MCTA 4RTQA 5BXYA 5ICEA 3L8DA 3VSEA 1MHTA 5E9WA 3EGVA 3DMHA 5KQSA 2XYRA 2PX5A 3KQWA 3NWBA 3BKWA 2G8NA 4XUCA 3LKDA 5HIIA 5EEGA 3QOXA 4RVFA 3MCZA 5E1OA 2GH1A 4PGGA 5JUWA 3EVAA 4QQNA 3FRHA 2K4MA 2QY6A 3GJYA 5GIPE 1G55A 3NVKI 1MJFA 2ZVJA 4RTJA 2O57A 5D1HA 1JSXA 1O9GA 2YXLA 4GC9A 3DXZA 3O4FA 3M33A 2AOUB 4V0QA 4M38A 1YB2A 4BP3A 4XUEA 5HIMA 1NW7A 5CVJA 5EOVA 3CJQA 5DRYA 4GQBA 2HR1A 1VP3A 1KPHA 3FYCA 2OB2A 2IPXA 4QTTB 2C7QA 1YFLA 1IY9A 3LPMA 5IH3A 3EVCA 3UWPA 2B25A 4GF5A 3SM3A 2YUIA 3P8ZA 4KW7A 3GIWA 2BR3A 2VP3A 3BWMA 4KWCA 2IBTA 1Y8CA 5CVDA 2P1DA 4YV1A 3HM2A 4BLWA 3JWHA 3DXXA 3M6UA 4RWZA 5T64A 1UIRA 2NXEA 1EQAA 2QRVA 1U2ZA 3A4TA 3G8AA 1L3BA 3BUSA 4RVGA 5E8RA 3EVEA 4YV2A 2OPBA 2CKDA 5KQRA 5CD1A 4P7JA 3P71T 4EK9A 3RW9A 3I9FA 2V7EA 3SVZA 3G5TA 4KVZA 4RTPA 4RTOA 2PLWA 1JSZA 2P3OA 2R6ZA 4O29A 2AOXA 3MTIA 1F3LA 5K0BA 3GRUA 4QDKA 4FR0A 1L3CA 3EVDA 3FUWA 4U7PB 5BP7A 4DMGA 4PCAA 3ME5A 4IV8A 4QQKA 3CJRA 4CKEA 5EKUA 5K09A 4FZVA 5D1NA 2PXCA 3EMBA 5H02A 3GRVA 2HV9A 2NXJA 3C3YA 5K0CA 3AXSA 2I7CA 1X1CA 3GDHA 2H00A 2FYTA 3LDFA 2UYQA 1B42A 1G8SA 4RVDA 5EKXA 4CKCA 3KR2A 4RYLA 2AOUA 2IDKA 3KHKA 4PONA 1UFKA 1QAQA 4PYNA 1VIDA 2IBSA 3PT9A 4PNEA 3BT7A 4FGZA 3UJ9A 1ZHFA 3PFGA 3ERCA 2I6GA 2VDUE 4HC4A 3G2PA 3P9CA 5EPEA 1JG1A 2IFTA 3TMAA 5CM2Z 3OPNA 1KPIA 1NW8A 3SSOA 2XYVA 3EMDA 3O31A 3KQQA 2ZBRA 1RJEA 4AX8A 4DF3A 2UYHA 2OB1A 3G2MA 3LDUA 4RTNA 2AN5A 2O07A 3KKZA 3MQ2A 2GA9A 3THSA 1R6AA 1M6EX 3G8BA 1AF7A 2GB4A 1RJDA 2P40A 2YTZA 3P97A 4NECA 2AN4A 2H1RA 3KU1A 4GOOD 4P7GA 4PGHA 4Y30A 2PSSA 3CCFA 3LECA 4X60A 5FQOA 2ERCA 3NVMB 2PJDA 1O9HA 5DTRA 1NW5A 4YUWA 3HCFA 1X1AA 1IM8A 3IHTA 4AZTA 2NXCA 3P2IA 4PIPA 4EKGA 5B1SA 3S68A 4YUVA 3TOSA 4GUAA 2ZZNA 5E8JA 1R18A 4Y2HA 1WXXA 1VBFA 3DR5A 4DZRA 1N7IA 5FADA 4MQ4A 3H2BA 1KYZA 2DPMA 1SQGA 3R24A 5EMMA 1R00A 5E1BA 5T67A 1VQ1A 4PYOA 3OE5A 3LCCA 2QM3A 4CXMA 5K03A 5GM2A 3A27A 4RV9A 3KR0A 5EIWA 3EVBA 1KR5A 3WSTA 2JHPA 1G38A 1X19A 3TLJA 5DT2A 4MWZA 2G70A 2PXXA 2WA1A 4KIGA 4MIKA 2IDJA 3KPVA 3CBGA 3GRRA 4XCXA 3T7RA 1XDSA 3OZRA 3UJ8A 1X1BA 3V97A 1KP9A 2Z6QA 4KDCA 2VS1A 1BOOA 1R8XA 3K0BA 1JTFA 5GIOE 4V0RA 3T7TA 2IH5A 1EIZA 1JQEA 3O7WA 3PFHA 3NDJA 3R9XB 3CC8A 3GWZA 2QRVB 1Q0SA 4P58A 5LR6A 1RI2A 3HVJA 2B2CA 4BLUA 3V8VA 1YF3A 4FT4A 1WZNA 5FQNA 4HRAA 3KR9A 3EVGA 2OZVA 3KQSA 4X1OA 2P7HA 2JHCA 4F84A 1JQDA 3OU6A 4E32A 4RTKA 3BGVA 5K8VA 5DSXA 5M5BA 3FPGA 2P7IA 4PCLA 3OFKA 1NT2A 2OBFA 1H1DA 1FP2A 3LCUA 3P2EA 5CVEA 4YMHA 4OX9Y 2ZTHA 1P1CA 2I9KA 1NV8A 2PX2A 3C6KA 5FCDA 5DWQA 1SUSA 3FTCA 3GRYA 1DL5A 5FA8A 4E33A 2GAFA 4E2YA 4BY9E 3KPUA 3OZTA 1N7JA 2ZBQA 2P8JA 4YUZA 2HWKA 2XVMA 2HTEA 1L1EA 3PTAA 1R74A 3I5UA 3BXOA 3DMGA 2GPYA 1BHJA 3EGIA 4X61A 5F2OA 4E2WA 4PIMA 3OE4A 2H11A 3UJAA 2UZ4A 1JR4A 2YQZA 4WXHA 4CWAA 3I64A 5EC8A 5EEHA 4UOEA 1HNNA 3SMQA 3FRIA 3KQPA 5E1MA 5EZQA 2P3QA 3HNRA 2PV0A 1ZG3A 3DMFA 4GEKA 3UJCA 4C04A 4KIFA 3R0QA 1INLA 4AUKA 5JR3A 3FUTA 3KPYA 3B5IA 3NTVA 1VP9A 3JWJA 3P9IA 2PGXA 5LQRA 4GOND 5GP1A 4OBXA 1ZQ9A 3DOUA 2YXDA 1QAMA 3CGGA 1QAOA 3HCDA 1QZZA 5K0LA 4LWPA 3B3GA 3D2LA 3G89A 2FHPA 2P35A 5DX0A 2Y1XA 3SX0A 3HP7A 2ZIEA 3P9NA 1QANA 2AVNA 4KDRA 5U4XA 2FK8A 3RODA 2PWPA 3SSNA 1VE3A 3ELWA 4HGZA 4POOA 1WXWA 1XXLA 1WY7A 2B78A 4PYIA 5CVUA 10MHA 2ZZMA 5ERGB 2YX1A 1XJ5A 4L7VA 5IKMA 5DSTA 1XCJA 3MGGA 4H0NA 5FA5A 3FZGA 4X63A 3UBTA 5DLYA 3NMUF 3GCZA 5G02A 3C6MA 3LBYA 3R3HA 3B3FA 4HSGA 5FUBA 2XYQA 4EQZA 3LKZA 2BH2A 4R6XA 3UJBA 5EZSA 5DM2A 5FWAA 2YXEA 3GU3A 2G71A 3M6XA 1KHHA 2LD4A 4C4AA 4BLVA 5ICGA 3AJDA 2G1PA 3ELYA 3IYLW 3ANXA 2IH2A 2BR5A 4OBWA 4QTUB 3EVZA 1SG9A 5K0GA 3OZSA 2QYOA 5E9JA 4C03A 1AQJA 2OXTA 2FPOA 3EGEA 5LQNA 5CCXA 5EHGA 3PVCA 2P3LA 4RX1A 3HCBA 2O05A 5K0EA 5F2NA 5HIJA 2ZSUA 3FTDA 4C07A 3GO4A 2G72A 4OA5A 2FRXA 5E1DA 1PRYA 3NDIA 3TR6A 1DCTA 5KYGA 2C7OA 3JWGA 3DXYA 1R8YA 3AXTA 5DTQA 3SGLA 5EMKA 1G8AA 1P39A 1YFJA 4IV0A 5CVVA 4PYJA 2PKWA 2ZWVA 4M37A 3THRA 2EX4A 4YUYA 3JWIA 5KVAA 5K05A 4ER0A 3FUVA 3KQMA 2ADMA 3RIEA 4JXJA 3QOWA 4ZTBA 1ZGAA 5ICCA 4GBED 4HTFA 3GXOA 3KQYA 5FHQA 1UWVA 5LQAA 2A14A 3M4XA 4YV0A 1YZHA 2CL5A 5K0FA 3KR1A 2ZFUA 2V74B 5EMLA 1IXKA 3IV6A 5HIKA 2AOTB 5E2BA 4YMGA 2ZCJA 3LL7A 2ONZA 1RI1A 3E23A 4DQ0A 3X0DA 5GINE 2E5WA 4GOMD 3CVOA 2OKCA 4ATNA 4HH4A 3MB5A 4R05A 3B89A 2BM9A 3KPJA 3OU2A 3EPPA 5DXAA 4CTKA 2C7RA 1SUIA 1NBIA 2R3SA 3MERA 3UJDA 4YUXA 2VDVE 3G7UA 2PXAA 1L3IA 3LGAA 4E2XA 5CIYA 2NP7A 2YVLA 4C05A 2WK1A 3HCCA 4PYMA 1JQ3A 1XVAA 3SSMA 2CWWA 1NW6A 5LSAA 1ORIA 2Z6UA 5EIFA 4MTLA 4OQDA 3B7PA 4WVLA 5K0NA 1P91A 5DRTA 1KXZA 5EG5A 1G6Q1 4QDJA 4ISCA 4X41A 3HVHA 2NP6A 2O0LA 4RTRA 3M6WA 5C9ZA 4E70A 3QV2A 4ER5A 2PX8A 2AN3A 3KQTA 4R8SA 3UFBA 4DCGA 3HA3A 3A7EA 1RI4A 5HZMA 5LQKA 1XDZA 5GOZA 3MAGA 1KIAA 1AQIA 4OQEA 3BWBA 2ORED 2DULA 1VPTA 2FK7A 4EKIA 1ZKDA 2QE6A 3FYDA 1NW3A 1EJ0A 1TW2A 3GRZA 4AZVA 1WS6A 1EG2A 1M0EA 1ORHA 1JTEA 3FUUA 3TQSA 4E2ZA 4QVKA 1I9GA 1NBHA 4A6EA 5LQJA 5FULA 3HA5A 5HFJA 4ER3A 5E9QA 3M70A 2ZLBA 4GC5A 3TM5A 2EFJA 2N47A 5DM0A 3ER8A 3C0KA 2ZWAA 4FP9A 5DTMA 1PJZA 2PT9A 5EHIA 1NV9A 5EMJA 5KS2A 2BZGA 1YUBA 1OR8A 3BGIA 2AOTA 2PY6A 3LDGA 5K0JA 2IP2A 3ELDA 1BKYA 3HCEA 2IH4A 3FPEA 2AOWA 4C06A 4QPPA 3HEMA 2ZIFA 3SR4A 4OA8A 3UZUA 1T43A 5DPMA 3EEYA 3AY0A 2BM8A 1EAMA 1O54A 3VC1A 2O06A 3P9KA 3TKAA 4CKBA
chains in the Genus database with same CATH superfamily
5KINB 3U4QB 4PY2A 3V4OA 1UJ6A 3GJRA 4L72A 1CLUA 1K66A 1AH2A 2ORYA 5AW3A 4RWEA 3HKCB 3RC3A 3RVNA 4JJZA 4M9ZA 4EKDA 4CHTA 4EUEA 2BHRA 2YVUA 1GKLA 4D79A 4M36A 5D5PA 4BHTA 1VMEA 1XNGA 1Y1PA 2DMRA 2Q5FA 4DLNA 5K3EA 4PU0A 2IVGA 3CB4A 1HYBA 4MAFA 4QGHA 3JQ8A 5A06A 4Q48A 4O59O 2VQ3A 5IBQA 3CIOA 1YA8A 3KFXA 2FXVA 3W3AD 1F6WA 2OFPA 1V1MA 2R5WA 3Q7EA 3KJXA 3KZVA 3WLOA 4QVGA 3MXOA 1ESCA 4FQ8A 4Y6OA 1JG3A 3EVFA 5GM1A 1EINA 4CF5A 4JQZA 1LW6E 4EB6B 2P41A 4OMDA 2BFAA 1RJFA 2OE2A 1IHPA 2O1SA 3AKCA 2WDZA 6REQA 3ISTA 1QHHA 2UYOA 1BC5A 3FMFA 1Z5OA 2ICPA 3CROL 2DECA 4A1FA 5I7EA 4WUTA 4ER6A 3ZBTA 5LQKA 4B6JA 3JQ7A 3MS4A 5AOAA 3I52A 1KAOA 3QEOA 1EX7A 4YP0A 3MTEA 4PFQA 1B2LA 2OZEA 3H7AA 3IOBA 2XY4A 4QM7A 1YXMA 4UC0A 3C3PA 1OHHA 1P3DA 2Q7OE 3KELA 4EW1A 3GZDA 1KIMA 5B4UA 1GARA 3WLEA 1WHSB 4HYQA 1LK0A 3T3GA 1ODTC 1GCIA 1U8FO 1WXDA 3T7DA 4Z6KA 2JAQA 3TSWA 3R5XA 4NCAA 4N6GA 4UEOA 2D6FA 1WXFA 2B8WA 2MOKA 3UT0A 1F20A 5HRUA 2O6HA 4MUHA 3FOAA 4LV8B 2ODNA 3N6RA 4F8DA 2QZPA 3OT1B 4PQRA 2ONCA 3K5IA 5FBHA 5FWDA 4BGVA 4N48A 4RK1A 4GT1A 5FV4A 3IEIA 1XMVA 1XL1A 4YG7B 3D3WA 5TLSA 4P4SB 1FB5A 3E7PA 4A6PA 2JAUA 3IELA 4GPAA 1WG8A 3C6BA 4C3ZA 4TOIA 5A7HA 4CN8A 4CV3A 1TNDA 2C8JA 2O19A 3E22B 4NCXA 3QTBA 1DG1G 1EJ6A 4WLOA 4EGQA 2V65A 3SJ7A 3JZDA 3QPBA 2I2WA 4KO8A 3ZZMA 4F8YA 2R8ZA 3UO8B 4F9FA 5C81A 3T34A 5ESXA 2OG2A 1WE2A 5BO5A 4ERXA 5EJFA 4BPBA 3UUGA 4UFNA 3CNNA 5A03A 3DWGA 3D4NA 1PR1A 4F2HA 4PINA 2XT6A 1M1YA 3GEGA 1NR5A 2BI4A 4YALA 5KBYA 1A9SA 2FOLA 1TCCA 2X6RA 3QX7A 2FMIA 5C7LO 2HCBA 2EDAA 4RFLA 3LV8A 2HSWA 3HI4A 1SQFA 1W581 3IESA 3L7JA 3RFXA 1CJTC 1FS4A 3TDKA 4LJSA 1IBCA 2QD4A 4XYGA 5EERA 2CYBA 3KZNA 4NL4H 2BCGY 1VCIA 2YXBA 3BX1A 1ULZA 3NHBA 4ZVVA 4OYLA 1G21A 4DMKA 4NYJR 4DLWA 2YNMC 1GRCA 2Z56A 2GZSA 1QYWA 2AFVA 4IY1A 1Z7EA 4WBXC 3FVTA 2V9ZA 5H82A 1X7YB 3OIVA 2QLTA 3JQCA 3N2KA 2O20A 1MOPA 1OKKA 1IM2A 5BXYA 2B4YA 3MW8A 1MG0A 3QFHA 1FTQA 2DKNA 4UUPA 4XGQA 1LLQA 1KWKA 2ONKA 2QT0A 3EGVA 3JX9A 5ALMA 3BMOB 1DP4A 5BNWA 4JN6B 3AERB 4OBEA 1ZNWA 3BKWA 1O94A 3NT2A 1CERA 2P2YA 3PG5A 1QVZA 3CW8X 4HWKA 2OD2A 4U0KA 1Z7GA 1P72A 3DGEC 1QU2A 3MGBA 5DCYA 2R5NA 5K45A 3SFZA 4JVOA 5IX8A 2WIBA 1NFQA 3H9JA 5EL0A 2XB9A 3IXLA 3SHTA 5KOJA 2O57A 1E8NA 1JSXA 2IYZA 2QUAA 2ZAGA 4XA8A 2PXFA 2AOUB 2BF7A 4KQKA 3Q6MA 3PXPA 1JA1A 1FK8A 2Y99A 1C30A 2ID7A 2Y1DA 4HFNA 2R6GA 1AHNA 2YFHA 3LSYA 1P5RA 5TJHA 2HQOA 2HINA 5EUMA 3HCOA 3IT3A 4LVUA 2QENA 4H4DA 4Q34A 5EMNA 4CYMA 3LPMA 2R1JL 1YFZA 2D5BA 2MSLA 5LZ4A 1AGNA 5ALNA 4UNNA 2WD8A 1NMEA 3EHEA 3OHMA 2XMBA 4IM7A 2OMEA 1EVZA 4CCAA 1LX7A 2HPZA 3GZ4A 2BFWA 2PHZA 1NPDA 1PNTA 4Q4JB 1Y8CA 4I50A 1XU9A 1YJXA 4HPWA 4RWZA 4H7EA 1Y1RA 3A4TA 3OIWA 1H05A 4MW1A 4WLFA 2I3DA 2JDID 3AHEA 3IQXA 4XE5A 3DFZA 2PTHA 1QO9A 3PICA 3H0EA 3BHJA 3CLCA 4FKMA 2OBLA 1PFYA 3CRQA 4N39A 1V71A 1WEKA 2ETVA 2G4CA 2GNOA 3B9RA 3G8CA 5JPIA 3OZCA 4R2IA 3GBVA 3IMCA 5DP2A 2J87A 2MT9A 3F3MA 1RYYA 3PXDA 3FUWA 3RVJA 3RWMB 3EW9A 2DY1A 2VPXA 4U7PB 4B85A 3JRXA 4DMGA 2MTBA 821PA 2BGWA 2YRWA 4EHFA 1NR1A 1SD1A 3IS3A 2ASVA 2I2BA 5FOTA 2F2TA 4FD2A 1FJHA 1UP6A 4XD7A 4J6EA 4X97A 3RC1A 2WIDA 1RAHA 3V3TA 4BE4A 1WHTB 2IV7A 1Z28A 5CURA 5K3FA 3AJEA 3OPYI 4D1YA 5ITVA 4ZC8A 3HYNA 2IBSA 4C30A 4KODA 3T38A 1B26A 4EIWA 4IDDA 5D3MA 3EEOA 4HC4A 2JEOA 4M6WB 3TWOA 2PH5A 3P9CA 1IJEA 1ZIDA 4G36A 3TD9A 1VBMA 3WLIA 4BL5A 4DLBA 5DHUA 3NASA 2VPPA 3ZIAD 2XYVA 3KQQA 5KTKA 1UXGA 2LXNA 4IUDS 1SC3A 3RWBA 3ZHBA 5IJWA 4Q19A 5G3ZA 1A50B 3TOVA 1E5LA 1SQ0A 4XH9B 3L4BA 2CF5A 1PP4A 1N5LA 4OHFA 1X7WB 4RETA 5EQDA 3AF0A 1R0SA 1BWRA 2AN4A 4R2XA 1X80A 1P7WA 1SC6A 3Q1LA 3VZQA 4KBYA 5CTJA 1O9HA 3O8DA 4PGFA 1BX3A 2D5CA 3SFTA 4EA6A 1WUYA 3L7IA 4MW0A 1BGWA 4WCFA 4G0WA 1EFKA 4JT8A 2VXBA 1SU4A 4W9NC 5H4HA 5SZKB 3BDNA 4Y2HA 1V5WA 3KYJB 1O8CA 2HCRA 2ECPA 1WKCA 2DETA 1KO8A 1QTQA 2NACA 4EKYA 3CPHA 1TO2E 1DQYA 2Q8PA 1Z06A 1WXEA 2VEOA 1SIOA 1WIZA 3WJAA 3KC2A 3MOIA 3U5TA 1VI5A 1ZI9A 1MQ9A 3WTBA 4PZZA 2LLWA 1F06A 5EZ6B 4I46A 5GGYA 3R76A 3GFBA 3VI4B 2PKEA 2GN6A 3ZKWB 4B43A 2PZAA 1D9XA 2JFYA 3FFWA 3HDQA 3KWFA 4MGEA 4PZPA 3TW0A 4D43A 5CXQA 5KNBA 2ZJ4A 3DMTC 2XCSB 3CBGA 1DHTA 3T7RA 4S24A 1O4XA 5A2GA 4IQFA 2PEYA 4LHZA 4RO0A 5T8KA 1KBOA 1YJ5A 2BTQB 2VS1A 3K0BA 3ESYA 3O4IA 5GIOE 3X1DA 3DCNA 4GW3A 1CQPA 2IITA 4HQNA 4QOJA 1HFEL 1EB9A 3Q0EA 1XPRA 4ZO8A 4QATA 4UVHA 2JFUA 3C5EA 4X4BA 2HZ7A 3KB2A 4I9GA 5CT4A 4Y1GA 4HRAA 4NFYA 1NN0A 4X1OA 2OT3B 3L6EA 2ZIXA 4K8OA 5CCEA 3EWAA 2OGUA 3UY4A 1FLVA 3LJKA 3LLVA 4D2IA 1I7DA 2O23A 2ZSDA 2WHYA 2WICA 4KSYA 1LI7A 1T9HA 3IV9A 2HJVA 1FX0A 4C6SA 1NT2A 2D4HA 3EY9A 4GG1A 1T5TA 2WUDA 4LBVA 3D6AA 3THYB 4V3BA 3HUEA 1LQTA 3C3XA 3FROA 2B3DA 4JFAA 4JY7A 5EP1A 3WBFA 5DNCA 3QE9Y 1IN1A 4PR0A 1ZNQO 3O38A 3EA0A 4OLAA 2A6PA 2IWRA 2C4UA 1TCUA 3E70C 3VYSB 3F9CA 5KOHA 3Q1KA 4QPDA 4BNDA 1W75A 5F2OA 4X1IA 1ECCA 3OE4A 3BHMA 1H2BA 1QR6A 4CQMD 1O0SA 1UKVY 4P9NA 1E4YA 1Q1NA 2VOEA 3BWDD 3KSAC 5K6TA 1PFKA 1TMKA 1W0CA 1YJQA 4KCGA 4IRXA 4FFRA 1C41A 1RHKA 2HA2A 3MJ4A 5TGZA 4C1BA 2BY4A 3BK2A 2XUZA 4WVFA 4W4TA 5ALTA 4DQUA 1G8GA 2ZR0A 1F2UA 2H8GA 3L0BA 2O8BB 1MFPA 1WXIA 1U5BA 3FCSB 4GOND 3WGNA 3BXXA 3LL4A 3MC1A 4BVHA 1FE8A 1DNPA 3N0XA 4I55B 2YXDA 4OGKA 4D3SA 1DAMA 2EZ4A 5FJIA 3OJXA 4J7XA 1XD8A 4AMZA 1M1XB 2WB4A 2AZXA 3I9KA 1U90A 1TECE 1EFRD 3NOQA 4LCJA 4QXRA 4F3KA 4M60A 4AO8A 4ZI2A 1OA0A 1I3OA 2IZ1A 1SJ9A 4JT9A 4Z3KA 1QQ6A 3AR5A 1PG5A 3QA9A 1THGA 5G1PA 3FOEC 4IIJA 1U4NA 16PKA 1RE1A 1H94A 3LQYA 2AC4A 3VUFA 2GK4A 5K5EA 3IDFA 4O4LB 3VH2A 3OA2A 1LLDA 2L2QA 1J2TA 4RLQA 1PRUA 2ID9A 3F5MA 4X1KB 5FUBA 1XZPA 3A3PA 1C0IA 3WL8A 3CINA 4NNJA 4NG4A 4LV6A 3DLPX 4U7FA 1ZGCA 2EU8A 3PHIA 1HYHA 2VNSA 4KIJA 2EYQA 4EEKA 3DC7A 2JLZA 4OBMA 5E9JA 6LDHA 3U7EB 1X7HA 3P26A 4US0R 5E6SB 2FZEA 2DR0A 1MNAA 4ND8A 4F5DA 5CCXA 4RM3A 3BWEA 5A4DA 2D59A 3CTPA 4P4LA 1VGQA 1E3JA 1P33A 2P8SA 3BJMA 4RY2A 3UC9A 3WY9A 3TECE 4YRRA 1W88B 4OSEA 4U9IS 1YR6A 1GNTA 3F3KA 3NKLA 3QXHA 3R7FA 4EKEA 2AG5A 2IYTA 2QX8A 1Q1EA 3BXZA 4PFSA 1F2TA 2GD0A 4RCVA 1QO0A 4Q1DA 4W1QA 3VYRB 5HX7A 3ZLJA 3N2LA 3T61A 1FNCA 4FI3F 3MT9A 3G9QA 4L5YA 4C3OB 4LDJA 1HXHA 3KALA 1M66A 1BW9B 3G0GA 1JX6A 3QMVA 3ZCXA 3ST7A 2ZT6A 3ZCVA 4XLLA 1MAUA 2ET6A 2Y6UA 2VP2A 5SY4A 1M10A 2HUNA 2F1IA 2HRDA 4ON9A 4HXFB 5K0FA 2JI6A 1AQ6A 1J56A 3AY7A 3BIFA 5E2BA 4CQLB 2AW3A 4UHHA 1LXCA 2J3HA 3IQEA 1EUDB 3WWDA 2UVDA 1Y1KE 3ZVKA 1DBSA 1UXCA 3UWSA 2Q2NA 4L51A 4N5MA 4URYR 4DLKA 5KTNA 1U3CA 3EXG1 5KYKA 5ED0A 1POXA 4UVIA 3PX7A 5NLLA 4BX0A 1MKYA 1XN4A 2R5FA 4RPHA 3ZU3A 3NYRA 4S12A 1JJIA 3IO5A 1L3IA 5K8UA 5CIYA 4DR4B 3I5AA 4Q39A 1E0KA 4GZMA 1ZFNA 2IHKA 4PZ0A 4AYWA 4AJPA 3SSMA 5LSAA 1SA0A 2RCYA 2DRIA 4XJXA 1FUYB 2C2XA 2VJYA 3EC2A 2RGXA 3EC7A 4D9GA 3WJ7A 5JJLA 2ANCA 4M3NA 2QB5A 1L4MA 4ZARA 3DAHA 5GZ3A 2ODEA 3IRVA 2O0LA 4KN5A 1ABEA 4NCKA 4V0SA 3S5UA 1FYFA 1K8YB 2WSLA 4DUPA 5JS6A 1ICEA 4UPDA 2GTHA 2ZRHA 3I9V6 4DQXA 3D3NA 3RU3A 3ROKA 4OHKA 1N36B 3V8EA 3RSZA 2FPPB 1F12A 3OCUA 1XZJA 4HP8A 4YLEA 2A5GA 4DOMA 5IZ4A 3G5GA 5JYCA 3I9NA 4D3DA 1E3SA 4K1XA 5AT1A 3TQSA 3F73A 2QTVA 3IE1A 1U7ZA 3F6YA 1CVIA 3C3BA 3RABA 1RLTA 2IDZA 2EERA 2OEPA 3PFFA 5DM0A 4MRRA 4EI7A 1TC2A 4X71A 3V33A 4N7JA 5EXDA 1NV9A 2Z5VA 1H3EA 2FPUA 4JJEA 1E8DA 1M1ZA 1GL7A 2X1LA 4D9CA 4D4MA 3SLGA 4HT3B 4F5ZA 1IBRA 2V4MA 4IDEA 3QHQA 5SICE 1Z5PA 2I2XB 1JHPA 2ZRGA 4OLJA 3VAYA 2HLDD 4Z5CA 1RWWA 4NENB 4QDTA 3TTUA 4F4UA 1EK2A 2GM3A 2Q29A 3W9SA 4FGSA 1QRUA 1MO2A 2QTFA 1X3LA 3SKYA 5A02A 1XTKA 1JHUA 2JLWA 2PT5A 3FNGA 4OJMX 1QYRA 5CX4A 5ED4A 1RKXA 3H8JA 5CAEB 4K46A 1OGYA 3NVDA 2DX7A 4O0MA 1CUCA 1T3SA 5F52A 1ODKA 4MUFA 3DEAA 1VKHA 2GSWA 1HGXA 1IN7A 1VKJA 2C2OA 2QI9C 1KDPA 5BRNA 3RVMA 3DYIA 4C76A 5BN1A 3KQOA 2P62A 1GZHB 2XQFA 3FYHA 4DKJA 3QM1A 1P17A 1IY0A 2G88A 4CKXA 4DHWA 5JNVA 2WF9A 2L8NA 1A5SB 3EDMA 4AY6A 4K3UA 3OCJA 2NV2B 4ESEA 1JIIA 1H65A 3SDBA 3EPJA 3FSGD 1TKCA 1J8QA 3BQNB 4BB0A 2IXAA 1SBNE 1RI3A 4CMGA 2ZUUA 1CQIA 5IVDA 1UMCB 2J4DA 4MROA 1CNMA 1CR1A 1Z39A 1X38A 1SWVA 2BEVB 3RKUA 3W2FA 4YMVA 1J2EA 2IUOA 4LISA 5KX5F 4NFLA 2P75A 3T0IA 4V0KA 4BATA 5HP4A 4ZT3A 4FHDA 1TF7A 3QE3A 3U40A 3USCS 2ORVA 3SEQA 2H2FA 1GT91 5LD2B 4ND6A 1X0VA 4J07A 2Q46A 5DH9A 2HWWA 3AP1A 2P4SA 3DO6A 4QZVA 5JFOA 1ESZA 2EGUA 4RJIA 2ISCA 2AEEA 5KTOA 5G4KB 1VPWA 3CGWA 1AB5A 1UXKA 2D1YA 4FYMA 4QBKA 2O2IA 4XCVA 3A4VA 2O8DA 2AX3A 1JRLA 2NNWB 3K2BA 3RV3A 2CDAA 4ARAA 5TIIA 4AWBA 1DTEA 3NG1A 4OATA 1MBZA 5THKA 2ZW9A 3KT0A 1AG9A 1YZUA 1CZNA 4WDQA 2YMMA 4R41A 1J22A 1G42A 2XODA 3X1KA 2MYUA 1MTZA 3BOSA 4EY7A 2XMCA 4G0OA 1M2JA 3JYNA 4JC0A 2REXB 4ZT2A 3CO0S 4UQOA 3OOEA 1T8SA 1C3LA 1DHRA 4DIDA 3HFRA 3H9CA 1U7WA 1W59A 5CA0B 1AKUA 2FUCA 1BH6A 1KSJA 3WO1A 2B4AA 2AN1A 2AL7A 1DW9A 2D2FA 4WLUA 4YMLA 4OLBA 1OH6A 2PN1A 1ANKA 5CM9C 1KMMA 4ZOQI 1K68A 4UBKA 7GPBA 4FFBA 1K7CA 1I3CA 1PT7A 1U7OA 3GEEA 3L8FA 3DFIA 4WLEA 3H13A 5HF8A 1B0AA 3RRZA 4DA4A 4J0JA 5AYVA 1AKRA 2I33A 3T8YA 1BMFD 5KX5B 4NCIA 1D3AA 2Z58A 4E21A 1PRAA 2AG0A 2WJGA 1GUYA 2JI4A 2AR0A 1G6HA 3NM4A 4M7OA 4JI4B 3QVKA 3IPYA 3JZMA 4FONA 1PERL 3HVIA 3I83A 4MUKA 4N5DA 4ZVKA 5HKKA 5CCBA 4QOGA 1C9YA 5ERXA 1T4DA 5A3RA 1SU8A 2X2EA 2YBEA 4PYQA 1ZU4A 4MARA 4CMEC 4RL4A 1Z8NA 2VHVA 4PZLA 4ND5A 4OHBA 4HDSB 4I2NA 4P3NA 5AI0A 4BMXA 4E31A 1M73E 3OVMA 5IVKA 1SFRA 1Z6AA 4JOQA 4P38A 2LYJA 1U3VA 2R1VB 3HRHA 4IFBA 1E2HA 2QTGA 2QX4A 2PGDA 5JBQA 3ZJTA 4B76A 3OHSX 1TL7C 5TARA 3OZDA 1B6GA 1CRWG 3E05A 3GFRA 4IDHA 4YP6A 3ZLBA 7MDHA 2G0TA 1Q84A 3W2EA 5E9WA 3CONA 3PXAA 4PHFA 5HF6A 4HVCA 4GRAA 3GP3A 2W6JD 5I7AA 4JJ4A 3M6FA 1I2DA 2FW8A 3O1HB 4EDHA 2WD7B 1FP6A 2AMLA 5TV2A 2PZJA 5F7ZA 3ZTYA 4QREA 3AEUA 3MWJA 2QU7A 3A1WA 2XLCA 3BCSA 4DG8A 3THXA 3OJ0A 3EVAA 4QQNA 4BBJA 2ZUEA 3GJYA 3VNUA 1JVSA 3OE1A 1TMYA 5JXJA 2H3HA 2YOGA 4DM4A 4EHNA 3GJ6A 4RD4A 1W0KD 3MM4A 4MTCA 1IEQA 4J0DA 4BLPA 3CX6A 1ZD5A 1O9GA 4K0RA 2BSQA 3DA8A 1O89A 4HDMB 4DKXA 1FDRA 3V4LA 4D0GA 4XUEA 2OFFA 5C5EA 5JAIA 3TI9A 1I0LA 1J5XA 3B8HA 5FTKA 2A0XA 4ZU3A 1Y33E 3CNHA 4J7UA 5AM5A 5JSFA 1TEZA 2GUWA 2PK3A 3KJQA 2VPYA 2XUQA 4TS9A 2AYZA 5CTAA 2V4ZA 4Z99A 2JRLA 5FO0A 1YR8A 3WMRA 3R1IA 3Q3GE 3WNVA 1R15A 5K4AA 4PRYA 1NN5A 4FYYA 3L9WA 4JYAB 3CLSC 2HF8A 2Q28A 3QUAA 1W4ZA 3F6EX 1AGXA 3BWMA 1PDOA 2WKSA 3L4SO 4K7JA 2P1DA 4K6CA 4O4IF 4YDHB 5HKBA 1RM3A 5CDUA 5AIAA 1CUIA 4S1VA 4ALIA 5B3AA 3QQPA 3GT4A 5BVGB 2NUPA 4W82A 1S96A 4C6RA 3FZQA 4XAQA 1TAQA 2Z1MA 3VOSA 2BFDB 2EZUA 4JLVA 1Q2UA 2RKOA 3CV3A 5LBUA 5DNWA 1ND6A 1XMPA 1F8GA 2NO1A 1O03A 2QRGA 1XAHA 4K40A 5AMXA 1XCMA 4O29A 3CG4A 3V6LA 4EZBA 4O5OA 4KZPA 1UKCA 2UUCB 1NNEA 2PG3A 3N53A 3GC6A 4GX5A 4S2EA 5LZ5A 5JVDA 4TMYA 4TWJA 2ILVA 1U9ZA 2A1TS 4KE8A 4XFJA 3P0FA 3FPLA 1CB7A 2AFHA 1MO5A 4KXWA 4AF7A 2GFHA 3B85A 4AZ3B 2PXCA 5CB4B 1B6RA 2WOJA 4HO1X 2NXJA 4LGVA 3W6PA 4CT5A 2HHHB 2AHRA 3KK0A 2X0FA 2VHZA 2C96A 4CKCA 4O2BB 3L7BA 3N6VA 3M3DA 1R4MA 1QTNA 5C80A 4KACA 2VUUA 1RAGA 4L8YA 4C0BA 4CCSA 2PJRA 2HSGA 1C3XA 1XCGB 2X42A 1XZIA 2QM8A 2FFBA 1TTHA 1B73A 1R9MA 2NO0A 1NSYA 2VP4A 3D4BA 3H4IA 4K81B 2LIPA 3ZLVA 2ISSD 2J7PD 4Z4CA 4JJKA 4LZPA 3TLCA 1TGYA 3O31A 1BVHA 1R6XA 4H7HA 3LH5A 3QEKA 3LDUA 3NT4A 4CEHB 4NS4A 1Z8HA 2DLNA 1C9MA 4H7IA 3U7QB 4QGGA 4YG4A 1MUUA 4G5OA 2MINB 4FD3A 8ADHA 2PSSA 2IHZA 1NOIA 1QJCA 3RTDA 3HY4A 4QU8A 2FEPA 5A4IS 2NXCA 2FEWB 4Y98A 1V16A 4ZICA 3O93A 1RZ3A 4EUNA 2BGMA 4O4JB 3AVWA 1MQ8B 4HEQA 3TLAA 1PVDA 1OTHA 1SQGA 4NLLA 3SEAA 2ZJBA 3KP1A 2FPGA 1QHSA 3Q5DA 1EE2A 1YS1X 3OPYB 3EPHA 1O7JA 3GR6A 3TFLA 1JYSA 3FKQA 4OMUA 4YA6A 5FBLB 3SOPA 3IUPA 3DPIA 1GQYA 2IHTA 4O2AA 1YKFA 4MWZA 4EYKA 1ZWLA 2FQQA 2C7BA 4MSUA 4NZMA 4OH1A 5K6AA 5IKPA 1ZPQA 1CR6A 2OFOA 1EA5A 2C7GA 2OYSA 4KKXB 2JJMA 4XX1A 3N9IA 5LXTF 4DCPA 5L3VA 1J21A 1M2FA 2QE7A 1ZU5A 3HWSA 1Z4OA 1WZUA 5JALA 3B1JA 1NDHA 2C82A 3HJGA 1IOWA 4YJGB 4G1UC 5HQ3B 3ZD7A 4X54A 5C37A 1X74A 2IZ6A 5A7GA 1TCBA 2QIPA 4MKHA 4ZHQB 4FYPA 3WNDA 1J8MF 4Q21A 2XUJA 5BYKA 2H1WA 2PYDA 3A3NA 1JHOA 1UM8A 4F2DA 2R00C 3GLSA 3BGVA 4TVBA 5CB8A 1F8XA 4PCLA 2JLAA 2OBFA 2ZI3A 3O3NB 2R751 3OH8A 2BRUA 4LJLA 4OI4A 4RY8A 5EP2A 2BOVA 5KQLA 1T6XA 2VXCA 1MRZA 5ECWA 3TN7A 2YHSA 1MOZA 3IR5A 4D56A 2C5GA 2O3RA 4A15A 1BTOA 1TK9A 4JJAA 4NV0A 1SUSA 5DWQA 5B1HA 1DL5A 4NBLA 4E33A 3ZEIA 1DMSA 4EG8A 5JWOA 4M54A 2UUAB 1OY1A 3R09A 1UR5A 2HSEA 2HWKA 3QKRA 2XVMA 1TF2A 3BIJA 1F0YA 3VVBA 4IUCS 2XAUA 1U7HA 4BP3A 1E2BA 4MYRA 4OQPA 1QV7A 4I6RA 4AY4A 4FFVA 3ITNA 3ADDA 1W85A 1AB6A 3WLTA 4EENA 1BROA 4N47A 4E5SA 4QLBA 3ESDA 2JGJA 3RUHA 4Y3UA 2N0SA 5DMXA 5BNFA 3T0FA 1JWBB 3U2QA 4R51A 2WIFA 3QX3A 3TQQA 5EJEA 2WW8A 4KIFA 2GM4A 2X0EA 1TD1A 3VHRA 1ZZEA 2HQ1A 1TB4A 5YASA 1D09A 2ZE6A 1JHYA 2CNLA 2PBZA 2AUTA 3CEJA 3AEKB 4WAUA 2GPBA 3TE7A 5KSYA 1HZZA 4JNKA 2GHIA 3BWVA 1ZQ9A 4DQVA 1QH0A 2QY9A 4UDOA 1QAOA 1QCDA 3U56A 1DEAA 3LC7O 4CKWA 1ZONA 1NHWA 1XRQA 1P4AA 1RVV1 2FHPA 1O5IA 2EAUA 1Z36A 1P2UA 2RHHA 3IXMA 3LC0A 4ICIA 4OXQA 3DOIA 2H0QA 2F00A 3GCXA 4ZVRA 4II3A 3Q9LA 4AXXA 3H75A 3U6BA 5J4HA 1ODLA 1W0JD 2I8CA 2D1FA 5DVZA 3T3IA 4BJ6A 3WDMA 4XVUA 5DTEA 4F7WA 3B1FA 3F7OA 3V9PA 1WU7A 1LTQA 3BFPA 3JQ9C 1VYUA 3EAQA 3VX3A 4PANA 3A9CA 2EX1A 1DC3A 4EQZA 2J7UA 2V7GA 2P69A 1X1RA 5K0TA 5JJIA 2OCYC 3ZHOA 1QIEA 4F97A 2VT7A 3M6XA 3AGPA 1C4XA 1JFVA 1KHHA 4ZALA 4U5XA 4EJSB 5CW1A 4J3JA 3O4VA 1HMPA 2B7CA 1N0HA 1NDUA 2XBLA 3MIZA 2C3OA 4PLCA 2FX2A 3HO6A 2JRCA 1AQJA 1CZRA 2A78A 2OXTA 2QRZA 4X4CA 1D1PA 4QUJA 3NBQA 4W99A 2FA9A 3GGSA 3PVCA 4Y9SA 2PUEA 2HU8A 2JPDA 1P0IA 3MG9A 4M4SA 1JB9A 5LDGA 1LDYA 1MAWA 5IKOA 1YNOA 1B8VA 2VC2B 4GKVA 1P7VA 3J80A 3L6CA 1QVAA 1P4GA 1E6LA 2HHAA 521PA 2VP0A 1K7FB 2VQSA 4B79A 1QHGA 1Y8RB 2I6TA 2XCOA 3BE4A 1MHPA 4F8JA 5CDFA 3DBRB 2B0CA 3EARA 1KP3A 3E84A 1C7IA 4LXXA 3SQMA 1IL0A 4TMFA 1XROA 2YYZA 5KTTA 1H1LB 1T0BA 3NATA 5LM3A 2HBQA 3O84A 2IYWA 5IF3A 1HUQA 4M89A 4ARCA 1UBCA 2AFIA 1RQNA 4FVTA 4REOA 5CH5A 4LYAA 4EY5A 1D7AA 2PYZA 3ZW9A 4NESA 4KSCA 1XVUA 2G67A 4NAUA 1Z62A 3R8CA 2H4HA 2I7DA 4H3KB 1Y7TA 5GINE 1ORRA 1DOHA 2C4MA 2YWDA 1UXDA 3R0JA 4R05A 1VE5A 3I76A 3I73A 4WPGA 4CTKA 2F48A 3HKDA 1CQXA 4JEMA 1YGPA 1TVMA 4HVLA 5AVUA 3L6UA 1XBTA 3WGMA 4A0SA 4CLOA 4LZZA 1XKTA 3DTVD 2PXAA 4G2NA 3UC5A 4LX8A 3WLHA 1VIMA 1TJ4A 2AK3A 4D8UA 1E89A 3WDLA 2BEWB 1PEYA 4RK5A 3GYGA 4KJXA 1FMCA 3JS5A 3KKOA 3I1IA 4IF4A 1D6JA 3TZHA 4L78A 3A6ZA 2ZRPA 5JG7A 1LSOA 1VSVA 4M1ZA 1G6Q1 2FN4A 4ZDKA 3TVTA 1VE7A 2AA3A 4J1TA 1KJIA 3N8NA 4E70A 1YMVA 4PSKA 3AG5A 1FRFS 3WLJA 3DZDA 1RI4A 2R62A 3IVAA 3LXMA 4MKGA 4MLCA 1IY2A 1KQPA 2A1IA 4WCDA 5FPKA 1EDDA 3LPCA 1GCAA 1UBOS 4HAOA 4UUQA 4DLZA 1YUMA 2IYPA 1YKGA 1IB6A 3KQKA 1JP7A 1TW2A 4J0EA 2XOXA 4XSGA 2VJOA 3V1TC 3C3CA 5C8VA 4K8RB 4K1LA 3PPWA 1CYDA 2OYCA 5M29A 4AG3A 1S9HA 1VPLA 5EKSA 3EBPA 1K6EA 4M53A 2ZLBA 4Q15A 1IXSB 4CR6A 1WSAA 2EFJA 2N47A 4GEGA 4N3NA 4A26A 4DWJA 2QN8A 1PJZA 1QHHB 2PT9A 1JA9A 1GNSA 4OFZA 4TVKA 5D8DA 5EHIA 3V1MA 3VVCA 4PXSA 5EMJA 4EABA 1HDRA 3ENVA 3IOEA 4L16A 4EM6A 4MVJH 4J03A 3CIFA 1V8DA 2EEZA 3A4LA 3JQ7B 4CL2A 1QDEA 1C4KA 1COWD 2O2YA 1O1YA 3U62A 3EQ9A 3FPEA 2OZLA 5I45A 1NM5C 4PQGA 2GDZA 3BZUA 3FDIA 3QQ5A 1TQ2A 4DILA 1HQYE 4NU0A 1O54A 2XNJA 1GGFA 4UZFA 1FDWA 1XQXA 3VWSA 1KI2A 3ZIDA 5BRAA 5IUJC 1T0PA 5ECDA 1AHIA 3E4DA 3SQNA 1EKXA 2OR1L 3WQRA 1ZZBA 2C4WA 4NK4A 4RZ2A 2ERXA 2PWYA 2EFDB 1N3BA 1ZUHA 4GPD1 2CLHB 4OOFA 4RHXA 4WRRA 5L8VA 4LMBA 1VDZA 3FPFA 1PKEA 2Z8XA 2AGVA 3MYYA 3NHZA 3EF0A 4RF5A 2PVCA 3S2IA 4HPJB 1NT4A 1QIIA 1DXOA 1X57A 2HMYB 5FT9A 5IHPA 2QMZA 1ZX1A 2B8NA 2VYQA 2X76A 3DH0A 3M8KA 3BL5A 2M1XA 4FMDF 4B17A 2GBPA 2CFRA 1RW4A 2E4UA 3FAKA 2C8LA 3PC6A 3PLAE 5IT4A 4L6IA 5EIBD 4QARA 3D3WB 1UKEA 2FSVC 4V2IA 5DYGA 4PN3A 1NVWQ 3O6VA 1ZP6A 2BW0A 4H4EA 4K6OA 1WB4A 3FLEA 4AB1A 3WA6A 5T6BA 3TFQA 5BV1A 3MMXA 4OHPA 4FXPA 3AY6A 4IRMA 3COYA 2YQ5A 4JODA 3BD9A 4CHGA 1SBCA 4AKGA 3BSSA 2BUBA 3G2KA 4Z1MD 4H0FA 4NNPA 2NZUG 2YXNA 3ID6C 1VXRA 2DUNA 4C01A 4EDFA 1QG0A 1M72A 2OO5C 4U63A 4O3MA 4YJ2B 3GV0A 3N76A 2EV9A 3CZPA 1SBQA 4B31A 3F9IA 2XUPA 5JDCC 3NZEA 1D2GA 5BSWA 3SSAA 2LE0A 3ZTTA 4DIEA 1D6MA 1J97A 3ZBPA 5BT9A 2OVBA 3LKVA 1ZOPA 4CF6A 1CYEA 1Q91A 4YFYA 4G5FA 4KFSA 4ZEOA 1XDUA 4YRTA 1DFIA 3UWMA 1XZAA 3LSTA 2RAFA 4L22A 4YRFA 4PAWA 3UA3A 4UTXA 3WHLA 1H22A 1YRWA 1BXZA 1Y4UA 2ZULA 3HFGA 5DLPA 2HY7A 2LWIA 1M0SA 3ZK7A 1R4NA 4I50F 1N0VC 2O2ZA 1UFVA 2HNKA 1O4VA 4Z0PA 3SVLA 1XZBA 5TDHA 3LUGA 3N2KB 4M0UA 1KSFX 3D2CA 1G2OA 3SC2A 1I1NA 1FRVA 4UHCA 1YZNA 5FWNA 1XNRB 4MMZB 3LQ2A 4J90A 1V41E 3CXUA 2WIUB 1DU4A 2XX3A 4IEFB 5B4TA 4Y6GB 1CUJA 5BQXA 3AGQA 2GVDC 3LA8A 3NH9A 2WFZA 1XZQA 4Z9AA 3QYXA 3IIKA 1XVTA 1UJMA 1CQJA 1KYWA 2QHXA 4JJFA 2P77A 5F4BA 3OCXA 3KVYA 4EQ6A 4DSTA 1RYDA 4XX0B 3NR2A 4BTVA 2Q7XA 2BDUA 3F5SA 5KOJB 1EK5A 1GTMA 1YZ3A 1W5FA 1X7GA 2H18A 2YR0A 3JRWA 1PNRA 1OTYA 2Q50A 4AJHA 1MB2A 4P3YA 1AKQA 1T3HA 4YXWA 4AZSA 2W71A 4PIVA 4Z2YA 1O77A 4MAMA 3R7WA 4P7FA 1PQ4A 1IU9A 1C30B 4MKZA 4U02A 3PRYA 3RS0A 5BMVB 5IZCA 1T1GA 1XF9A 2A0FA 2MU1A 5KU7A 2SECE 2P5YA 3G88A 3CKKA 3DKPA 5BSFA 4G1MB 1Q15A 1XZEA 2F8TA 1OBHA 3NKVA 3IHKA 4CIWA 5KKCA 3KSDO 4CUZA 1WZ2A 1PEDA 2FQWA 2BM1A 2JGAA 3C6QA 3WAKA 4RD1A 1HDGO 4OGGA 2YL2A 3BD8A 1CJCA 1XDGA 1NMSA 2IYVA 1IHOA 2KW5A 1IE3A 3SHWA 3IX7A 3AVUA 4K9SA 3QPUA 5HTOA 1SVUA 5JQGA 1ECBA 2GERA 2IC5A 1GA4A 5DU2A 4JI0B 2ZYDA 3AWIA 5CH3A 4H7DA 3A1VA 2V58A 4NP6A 2B2NA 2KQUA 3L6OO 1JG4A 1QRTA 3OQ1A 4ND4A 2LYQA 2V5VA 3FA2A 5C1DA 2RJNA 3FCEA 4UAJA 1ZEMA 2IV1A 2O5RA 3DHYA 3HDTA 1P3JA 5H59A 5JMWA 1OU0A 3VUEA 4QGFA 1LLCA 1MR3F 1QFJA 1Z45A 1BE6A 1B0NA 1HV8A 2HUPA 2RB5A 4MA0A 4J8PA 4G23A 1II8A 2DQYA 3C1OA 1C3VA 1UK7A 4BNYA 3ZS9A 4DMFA 3FRHA 5J2UA 3A37A 4BO3A 3F4LA 2RC5A 4D99A 2VSNA 4YRIA 1C4OA 5HHTA 3GLFB 1PWEA 2O8CA 3DXZA 4OP2A 2RHBA 4S1PA 2V4UA 4M1QA 4V03A 2IUTA 3BE5A 5K3FB 4D4LA 1LF5A 3M9XA 1DIAA 2DPHA 2WP8J 4YCNA 3TG2A 1DC8A 1ILEA 4JU8A 3FMIA 4YCBA 3K35A 5EWJB 1SVOA 3KQUA 3N2YA 3IP9A 4X84A 4F6RA 1CY7A 1OWOA 4TTAA 5JDIC 1VLZA 4D0RA 4ROSA 1NQVA 5B5SA 2YUIA 3VJLA 5JISA 2IOYA 4PLGA 5B1EA 2BC9A 4W8OA 1GDDA 4ZQGA 3EIWA 3H2GA 1X80B 2DZDA 4MUXA 3LM8A 4PSUA 1QRDA 2P6UA 4CIXA 4RGQA 3FDZA 4RSMA 5EUBA 4TXLA 2OPBA 4G4SP 2GARA 2VVTA 3AR4A 3I6QA 1TZMA 1X9GA 2DOKA 4M0KA 1AOXA 1XWIA 1ZNYA 4XOUA 1XT6A 1BFKA 3AB8A 4YYZA 2FJUA 1H0HA 1KDOA 2E1RA 1R66A 4KVZA 4GSYA 4TLLB 1LDGA 1Z6ZA 1ZLYA 4TQUS 5B3JC 3QNWA 4OAQA 1GEEA 1F3LA 2J9XB 3ENNA 4CKYA 1V0JA 4YMTA 3ZXSA 3GNSA 5M2QA 5C1PA 2XW6A 4L50A 2Y0DA 3L3BA 4LCBA 4NTZA 4PLYA 3WBJA 2ZITA 5IYZB 1DQNA 3IOCA 4JI3B 4FDLA 1E18A 1KE2A 1QFSA 4TXNA 3LWNA 1EJ2A 1G5RA 4KXXA 4ZAVA 3TSZA 2FUKA 2ZI5A 4GECA 2UYQA 1P29A 2WY2D 1TMOA 2QLNA 2ACVA 3DVQX 2YUTA 3PR2B 4CIVA 4XM1A 2ZWPA 1KZGB 1RM4A 3UJ9A 4IXWA 4GNRA 3UJ3X 4B3TB 2ZIUB 1ZRSA 1NN1A 2WMYA 3DD5A 3LLUA 2O4AA 2ZIXB 1EP3B 3ZCQA 3DNFA 3NONA 1E0SA 1UEJA 3ASYA 1HNXB 3DMPA 1DO8A 2I4RA 4AMVA 1C7ZA 4JEHA 3ZVMA 1R6VA 1FX0B 3K4PA 3SZ3A 1V8OA 3FR7A 1UF9A 2FFJA 3H05A 3OI7A 2KEJA 3RU7A 3O2QB 4GOOD 3AI3A 5FQOA 5CG2A 1R0YA 1FUUA 2QW8A 5AHXA 1TA4A 2VSQA 1L5QA 2C9CA 2QA5A 1Z7BA 2QM0A 3OWQA 1UC5B 4F71A 4N8DA 1E99A 3AHHA 3OQBA 5JNSA 3K0AA 2ZZNA 4FU0A 5E8JA 4PBRA 3WK9A 2VA9A 4BNDB 1Y0BA 3MRTA 2ZPTX 4QX6A 2GUGA 5EMMA 1SIUA 1LF0A 4US2R 2IOQA 3X44A 3VC3A 4ZRNA 1E2MA 2BGNA 4G0YA 4G9EA 4TXJA 5ITZA 5H8WA 1G20E 1KY4A 4ARVA 2H5JA 3AV0B 4Z7OB 1YE3A 3D9QX 3RK1A 2Y4OA 1A9QA 1EEXB 1KMQA 4XGNA 3X2SA 5I3CA 3FOZA 1J1ZA 4B2PA 4KQXA 3FHJA 2GD6A 5FBQB 3E1KA 5AJWA 2R97A 1POWA 2OG1A 3IO3A 3RVRA 3MJTA 1U5BB 3T7TA 1FFBA 1JMVA 2XHEA 1W4RA 3CC8A 3OOYA 4KQMA 4CU2A 4WLVA 4ZPJA 1FFXA 3WK4A 2LUOA 3TLBA 4FFDA 2HJWA 4MGKR 4EUFA 3U1BA 3QF3A 2QJRA 2DUWA 4NY1A 1B2RA 4RABA 2CK3D 1TYBE 1SBHA 2A4KA 3GGCA 4EI2A 5COQA 5I47A 2IELA 4ZZ0A 2QTLA 1CNFA 2HRCA 3KV3O 2X5XA 2HPHA 4BEJA 2H7CA 3OQIA 1H1DA 4CPDA 5CVEA 1P1FA 2GCGA 4CQNA 1PFVA 4IIJB 2H9IA 1OYYA 4LW8A 1GVHA 2OM6A 4FB5A 2ZTHA 5I7RA 5FI1B 3V7YA 3FHOA 4Q82A 3DL7A 3R5JA 2ABWA 5I48A 4JBGA 3L82B 4UXHA 3EIXA 4YG1A 1R88A 1TM7E 2HTEA 3A0RB 1BJRE 3QPDA 3WLFA 3H17A 1FUIA 1K9VF 5H9WA 2VPZA 2BP7B 3BXOA 1WABA 1Y5MA 3SBEA 3ZXYA 3ET5A 3K0FA 2II6A 3HG7A 4HOYA 2AUWA 621PA 1IB0A 4N3BA 1YDGA 4QFCA 1C3JA 1VKRA 3G68A 4UOEA 5MN5A 2G09A 4JROA 3S1SA 1UWLA 1NXSA 3PPXA 3DMFA 4BZWA 3UGTA 1M1UA 3HJBA 4ND8B 3TNJA 3PIDA 3Q9UA 1MJNA 2H2IA 1ZUGA 2VO1A 2HNBA 3LY5A 2AI1A 3NTVA 1WW8A 2LCQA 3RVKA 5JATA 5K7SA 2ALJA 3SCHA 3BIWA 2CV2A 2IVBA 2J3MA 1A77A 1X7XA 4D9IA 1I51A 3PI7A 3I23A 3WXMA 2VDNB 1IRIA 3NH6A 1OFTA 3OOWA 4BRWA 3DCJA 3ZHXA 3GA7A 3HUFA 5JBNA 4OQMA 1F2TB 1GXSA 2BV3A 2I78A 1F7VA 3QBVA 1JTVA 721PA 4ZCSA 4INZA 5FUYA 4Q5IA 1I7QB 1KZYC 1EFTA 2FE4A 2V6MA 2ZIEA 3D2AA 2CYAA 3MJRA 3DDOA 3PNQA 2VHYA 4IL5A 5EZ5A 2ZJAA 3IBGA 1GA1A 3QXJA 1OAOA 4ESVA 3H4TA 5DGXA 4L7VA 4OQQA 2X2FA 2DJIA 2AX4A 2AZDA 1S2LA 3K7EA 3FZGA 4EUHA 3RKSA 1FRQA 1P9WA 4X63A 4IVQA 3A28A 3SM9A 4V0NA 2ZYRA 5HG0A 4JUAA 5JSYA 2Q3JA 4LXHA 3B3FA 2FSGA 3BCHA 2I6SA 5L4SA 4ALLA 5H9VA 3AM4A 4PSAA 4DJAA 4IZHA 4PO1A 1HT3A 2VHEA 3HWRA 1FRNA 4I8DA 1VI6A 4JLDA 4QXAA 1Q6YA 3O3CA 5EP4A 2YV1A 4FINA 2EG9A 4HBGA 2C2MA 2JAXA 1Q16A 2JBHA 2R7KA 3UJNA 1O6BA 1SA0B 5KJCA 4U5QA 3FFAA 1NURA 1THZA 1FVHA 4Q1FA 4HN4B 3TIXB 4D81A 4Z5DA 4CODB 4UM7A 3DNVB 3RC9A 1TUGA 1BCRB 2Q5LA 1B4DA 1KZ7B 5BSMA 4TV8A 4GR5A 1IMJA 4OXNA 4RHTA 2FW7A 3ITKA 4KOEC 3TR6A 5KYGA 2TMKA 3HYLA 3WGLA 2W4QA 4P54A 3Q7RA 3WSWA 1P39A 5LOVA 2R11A 5D6NA 1CULC 1B8OA 1KJ9A 2GJ9A 1IBKB 2QVZX 3G9XA 1XA3A 1N6KA 1TKRA 1VLQA 2COEA 2EX4A 2IU3A 3A06A 3MRXA 4P35A 1RYZA 3UW1A 1Q0QA 3R5FA 2CJFA 3K0KA 1F5SA 4GOJA 3RH0A 4UHFA 4B44A 1TAUA 2HXGA 1KI4A 3PGKA 2IOFK 2PZMA 3IH5A 4IWYA 4NMHA 4CM4A 4EY6A 5A4KA 1D2NA 1FFGA 1P61B 3DBHA 2O0HA 5G2OA 3KKEA 1J42A 4MVJM 4NF2A 3PPIA 4PFKA 4YV0A 1C2TA 2BMJA 2I1LA 3OTHA 2PT7A 1BDMA 1JEYA 3OP4A 5K2MA 4MKXA 4BNIA 1GPLA 2ONZA 3S44A 9LDBA 1TOAA 3KYIB 2VTKA 2O8EA 2IYSA 4GOMD 5AKHA 1MENA 1JKFA 4YT5A 3WLQA 2R44A 4QO7A 2G5TA 3CLRC 4GXNA 5EYPA 2GF2A 4R98A 1GADO 1LQCA 2R3SA 2R8YA 4QBIA 4AXBA 5C1OA 3IILA 2X5NA 3HB1A 4QFDA 3K71B 5AK6A 1TYZA 5ENDA 2VA8A 3ML1A 4QNNA 1VSTA 1ORIA 5CDGA 4MTLA 4D0NA 4MVYA 2VSXA 4B6FA 3T3OA 4EHJA 1P9OA 3TQHA 4FS3A 5ALJA 1ZHHA 4ISCA 4G8CA 2E5FA 1ZMOA 2ZCUA 2DBRA 5JZSA 1OW3B 3TCNA 2AR7A 1XEAA 3SYMA 3ADKA 2I1VB 5A5GA 1HM5A 1WSBA 3P2OA 5LZ9A 2J3QA 3ONWA 4TTIA 4EAQA 5B3KA 4ZOCA 2FZ4A 4GMGA 2G17A 1AUQA 1BO6A 2ECQA 1EI9A 3FZEA 4G1BA 4IIFA 5BW6B 4II7A 4KFUA 4WKBA 1M2VB 3ETNA 5AW7A 3TG8A 1M6VA 1KQNA 1XPOA 4G4JA 5IVPA 4NR0A 3OFNA 1D8TA 5FULA 2IXEA 5FL7A 4ER3A 1NIPA 2B4RO 2D7CA 4LTDA 5LDDC 1Q7CA 4ILKA 4QOHA 2J45A 4JXXA 4G5GA 1Y7PA 2GYYA 1CQIB 4MP3A 1K5DA 5D5QA 4KL8S 1RIIA 3FYUA 1DO2A 2H2HA 4LOIA 3F98A 4WACA 1OSLA 2WM8A 1TD9A 3M6IA 5AHRA 1W0JA 3LYLA 2R60A 4ALKA 2O8FB 2C2BA 1GSIA 2J8ZA 2VCHA 3UZUA 3WGYA 4YO8A 3DOHA 5SYMA 1P6UA 2QV7A 3CZ4A 3ZVNA 1U1GA 4HNGA 5L7YA 5A71A 2EBFX 1QIDA 3B1KA 4TWIA 4AULA 4PC7A 1WTCA 2NG1A 3LD9A 4ZEMA 4ZCTA 1B1AA 2AXUA 3BIOA 3PT5A 4R7GA 3QUSA 1ZIYA 4PLWA 3FVRA 3I09A 1C81A 1F0PA 1ZI8A 3D6FA 1GAQA 3NHWA 2I99A 5GQSA 1FDTA 2OCLA 3N6XA 2VDWA 1U0JA 1V6CA 4K2HA 2RHJA 4DYDA 5B7QA 5F3WB 3QWGA 1MD9A 1SHTX 1I2BA 2BGLA 2J85A 2VAVA 3H2YA 3KYDA 3R7AA 5CFMA 2PL5A 1SC1A 3CSDA 2JFHA 4NZNA 2CY0A 4JQSA 5CXXA 3TINA 3BYZA 4MEAA 2GZRA 1BEEA 2ZKLA 3D3KA 3MLBA 5IJ9A 1GL3A 3FBTA 3K6SA 1KOLA 3JXCL 4LSWA 2BGUA 4R7ZA 4YS6A 1MZPA 3NWEA 2AYXA 4FFBB 1MX1A 1BFDA 2GN2A 3ILXA 5GMOA 4ZAFA 3WGQA 3I2GA 4B3XA 4YPOA 1JGTA 2OLKA 2Q4RA 4OQZA 2WV9A 4Q4HA 3DONA 1UQUA 1HORA 3O92A 4Q7MB 3L7NA 1E1LA 1XMJA 4N1AA 3F1LA 2OC4A 3VHLB 3FPSA 2WC1A 3LFUA 5A3JA 1YA6A 1NXWA 2AIRA 4MV4A 2EWVA 4XTCS 1LSJA 3BSWA 3H1TA 4TQGA 1GSAA 1XEXA 1KEPA 3T41A 4GKKB 2JGDA 4HXYA 4A2QA 2NZWA 4AICA 3PC7A 2D2VA 1GL6A 1U6JA 2C2HA 3TQIA 2CWDA 3IUSA 3NVAA 3CUTA 5LKAA 2ICAA 4OUDB 3UNXA 1QLHA 4FX2A 1IK6A 2OY0A 4H31A 3T0GA 2QD2A 4B73A 3GLIA 1GG2A 2VPQA 3AONB 2ZTMA 3U5ZB 1WZIA 4XWAA 1ORVA 4ZTUB 3EIUA 3PGMA 1Z0KA 2FWRA 1C3OA 2QSYA 4QL3A 3VPSA 4DR1B 3O2SB 2CNNA 4QNMA 1HF3A 1JDTA 2CMHA 2BL4A 4TSRA 2I4OA 5C7IO 5FLXA 2R4TA 4WQMA 1ZSVA 1N25A 4LY9A 4MW6A 4EA8A 3I12A 1EPUA 3OSZA 2FMKA 3FWKA 3PEEA 3BN3A 5HGXA 1MNQA 4BUZA 2QOEA 3HBLA 2VWPA 4E3WA 3KBOA 3WK8A 4BKQA 3K16A 2I62A 3THXB 2VBFA 2CDRA 2QTWB 5JVDF 2DSNA 1I01A 3N8IA 3NFRA 3RK0A 3PJGA 4F60A 1ZM3A 1P1BA 3E7WA 1KTVA 3JATA 1IOVA 1VHJA 3QU7A 5FI5A 1PUJA 2NZXA 4TS4A 1MAAA 2B2XA 4GZLA 4YI3A 4ZCLA 4RLFA 3RYHA 2MEZA 1MFZA 5I4IA 3MLFA 4EG3A 2QRMA 1PZNA 4DW8A 4ZVSA 1Q11A 2B9EA 1I80A 4I6EA 4PNPA 4CMAA 4ZYVA 3TEMA 4JKYA 3OY2A 1TPZA 2EZTA 3FTQA 1JN0A 3SNKA 4IKEA 4B74A 3ANTA 1XTUA 1I6WA 2I7VA 3COSA 4K6KA 3J81k 1ONPA 2C3YA 4TYYA 3O8OB 1ISGA 1VIYA 2Q6LA 3GLHE 3UK7A 4J94A 5GZ1A 4R54A 2OOSA 3AEQB 5KSZA 3D81A 1DBPA 1NRIA 4G63A 3TNYA 3OPMA 4UCFA 1U7PA 2PUJA 4PE5B 5ALLA 2GK7A 2IPLA 2Q8NA 2NUPB 1WVIA 3OO1A 1QH1A 2HLPA 3UG6A 2Q3EA 1E9DA 1JVBA 2HPAA 3EUEA 3KEOA 3MXTA 3NNDA 2ZB8A 1PI3A 3HVKA 1MU0A 1QHXA 3BXFA 3VSEA 3JQFC 4Q03A 3OCVA 2AWNA 1T4MA 3C48A 3KKMA 2XGJA 3K6KA 3KEMA 1M2HA 3MMPA 2EF0A 5BSKA 3U0BA 3CUVA 3LXUX 1A2OA 2AFHB 2ZS9A 2LCVA 2XXAA 1PGNA 5LBTA 3R8FA 2PRYA 4MR8A 1EK1A 1YRBA 4YH1A 2IHBA 4BFZA 3JVIA 3L7DA 4UHJA 5KJFA 4RA6B 3H9QA 1KYIA 3LX4A 3BILA 1AT1A 1YR2A 1R4MB 3RBXA 1P7CA 4V0QA 4H3HB 2I55A 4JOCA 1X8JA 1U9IA 2QSUA 1Y5NA 5F9HA 4BNXA 1DVRA 3VKUA 1NLMA 2JFPA 1B8NA 5IW8A 1YFLA 4PHHA 1TKBA 1NAHA 1UJNA 5E4TA 1WXGA 5DW0A 5SZIA 4AJ2A 4TZ6A 1I7PA 1WW2A 3VMFA 4U39A 1L5YA 3O0DA 2VAWA 3W7AA 4RPJA 2VZLA 4KW7A 2Z3VA 3SK0A 3TSCA 3UYLA 1TUEA 1L8AA 1P0CA 3GH1A 1LD3A 1Q50A 3BMXA 3KT6A 3RHFA 1GG9A 2BEUA 3M81A 2B5VA 4FIZA 2QR3A 1ZH0A 4GPEA 4ZVPA 3UATA 3RSGA 3SVTA 2FMXA 5KTMA 2D54A 3JAWB 2GLTA 2RONA 4XVQA 1Z6XA 4KWTA 5JYEA 3EDCA 3FBGA 2GXQA 1V16B 2CCJA 2FE1A 2H4YA 4NBVA 1AKYA 3RSOA 3S7ZA 1FW6A 1EWTA 4IHQA 4WK0B 3HXTA 3PRJA 1MAHA 5MN4A 5KQGA 4IHAA 5DV9A 1ZWKA 2FPGB 2BHLA 1NDQA 4QDXA 4DCCA 3RAEC 4AT1A 3CQ9A 3RO7A 1XJWA 1GLNA 4AF6A 3QFIA 4JELA 3URMA 3WRVA 3HO8A 3NBKA 2RHLA 2FH5B 3DT6A 2BBSA 2G36A 3EG9A 3A4NA 1MN6A 4O2AB 5F33A 4OP1A 2HK8A 3T1VA 5K0CA 4NCHA 4KQHA 3CH7A 1JR3E 1UK6A 1X1CA 2V0CA 3EHDA 3QGMA 4WXMA 4CDNA 1OD6A 3PZBA 4KLRA 4RXTA 3V2UA 2AZMA 4BGIA 5AUOB 4PTZA 3AQIA 3PKZA 4NU6A 4G65A 1KJJA 1VKOA 2O4UX 1Z22A 1QAQA 2HC9A 5EA2A 2FGKA 2W90A 5JLAA 3PFGA 4RPGA 5EI5A 1PZFA 1JKXA 3PYXA 4MI3A 3SIPA 2PRKA 5G0WA 3F51A 5CM2Z 1DO0A 5ERYA 3HUUA 3KE9A 1UDBA 2UYHA 4C3UA 3D2BA 2OB1A 1XQ6A 2OXRA 2ZI9A 3EZYA 4Z7QB 4J43A 4R9NA 3KKZA 3KOUA 3FKSD 4TV9A 1U1EA 2GHRA 3COWA 2YTZA 2KBFA 4G84A 4HZGA 5KHLB 3D8SA 1ULUA 2E49A 3KU1A 4OHUA 2FRDA 4WK6A 5TGTA 4RDXA 1HQDA 1OF1A 1MT0A 4WZ6A 3T1NA 4RIFA 2CVFA 4YMUA 2IW3A 4D42A 1CVLA 4OMFG 3MJSA 3LC2O 4K28A 3IVPA 2VNIA 4DRXA 1UT5A 2BYTA 3DKKA 3HGTA 3LYAA 2H2WA 3ZV3A 4D0SA 1ZQ1A 5FADA 4G25A 5L95A 1I7LA 1W85B 2CZCA 1VL6A 4BMPB 3C1TA 1RC8A 4TYPA 3EVNA 4IDAA 3HP4A 3ASVA 2UV8A 1UEXC 2X0KA 2CXXA 2VF8A 5GM2A 1P62B 4EZIA 2A9VA 3NXHA 4Y2RA 3TZCA 4J1SA 4NZOA 1Y6GA 1MG5A 3C98A 2QRPA 3C3EA 3EUAA 4HKTA 1AKTA 1KC3A 2WLTA 3QBEA 3C6ZA 3QU4A 3GLFE 3ROGA 1YJBA 4XR9A 4DGSA 4ARZB 1H69A 2VATA 5B30A 4V0RA 3D5QA 4OYHA 3PFHA 3NDJA 3FDFA 5IN4A 3ITDA 4ZO9A 3LW8A 1X2EA 4Z7JA 4G9GA 2DYKA 2OGSA 3GWZA 4TRNA 3G0OA 1GZSA 3K9QO 4BP9A 1G5IA 3HVJA 4OB7A 4RHEA 3SPXA 4AP6A 2VF5X 2KX7A 2QX7A 1ONSA 2YS6A 3MUOA 3OCYA 4GYYA 1T8TA 3HDYA 3KQSA 1RP7A 3UXHA 4BU1A 4IFTA 2IHUA 4JS0A 2OZKA 1DFHA 2CDNA 4UXIA 2JL1A 2OGTA 4MYHA 3A4YA 4J91A 4YLYA 1NVFA 4EW2A 2ZYVX 1DBQA 2JIMA 3DBLA 1JHRA 3JQDA 4KN8A 5U9CA 5FCDA 4P3OA 4YONB 3A31A 4V1CB 5DO9A 3L0DA 4N76A 4JCYA 4I08A 3VHXA 3JW8A 3LBIA 4F84A 3STXA 3T3PB 3U3DA 3WHIA 2FZVA 2BKVA 4BNLA 1N5JA 2GWHA 3PD0A 3AK4A 3EGIA 1U1CA 2CXUA 4O08A 4F46A 1QHFA 1CLEA 1M7HA 2NVBA 4P0TA 2HRQA 2YQZA 3KAKA 4NMMA 3RHSA 3DDWA 4YIKA 3N39C 3MFYA 3ODPA 2GMWA 5A1TA 1E98A 1K4MA 1IC8A 1BVRA 1YJAA 3KQPA 4WSOA 3ZHUA 1GAXA 1VL2A 4RNCA 5C1BA 1TVEA 4F5YA 1W2WB 4KQJA 1HTBA 3GQBA 3LFPA 1NBMD 1XRMA 3P9XA 3ZHVA 1LPNA 3A6DA 4G5RA 3NHUA 3RVPA 1PQPA 3JWJA 1F7UA 1WDTA 2PMDA 2PUWA 4FMCB 4H16A 3GLIE 4XTRA 4OHZA 3HXOA 1EFLA 2WWHA 4OBXA 2LP4Y 2WTAA 1OQAA 3KT3A 3T5DA 5CLJA 1J06A 1U9JA 3JQBC 2WDPA 1KS2A 3I72A 3LWDA 2VJQA 4MWCA 4L9AA 1OFHA 5C46F 2ZQZA 1AXEA 1RZVA 3HP7A 3AHFA 3QLVC 4YQZA 3RODA 1W4AA 1VI2A 2XSDC 2ZRNA 1DV2A 1U9YA 1UODA 1T6YA 1J8DA 3KTOA 1NI4B 4CVNA 4KX3A 2HDOA 2B98A 2SHKA 1TZKA 3EISA 4PCUA 2AZ4A 5TQ0A 1QBKC 1A97A 3BULA 3GVIA 2AFIB 4M9CA 3CHYA 3HN6A 4DSOA 3GL9A 2DKFA 2FQ1A 1RQ7A 3T4UA 4B3IA 5I3ZA 1V37A 1XX6A 1SXJB 1BVYF 4J29A 5DLYA 1FSGA 4DG5A 4EG5A 4HSGA 4PZAA 4Q66C 4C0HA 4M88A 3ZY2A 4IMIB 3LKZA 2C5EA 2GRMA 4R6XA 3TNDA 2G9UA 5K0ZA 3FMVA 4CT4B 5MFPA 2VT2A 1BCSA 1I4DD 3RFVA 5BR8B 1CIVA 4AS1A 1ZVMA 1VA5A 2PZLA 1G19A 3CRRA 3G59A 4CLOB 1A0OA 3IYLW 3IJPA 2TS1A 2HMSA 2BR5A 3PDCA 4JX8A 4X90A 1XAJA 5DMHA 4LZOA 4DEYA 3HEBA 3CVYA 1VPDA 2NSYA 2XEXA 4C03A 2NVUA 4ZI3A 3EXHA 3ILVA 1B15A 3U19A 2XUKA 1NVAA 3RRJA 2R1UA 3MS2A 3PNSA 4RMHA 2ZAYA 3VFDA 3ZBUA 1M8FA 3HCBA 1PF7E 1LUAA 4ZP1A 4C7OA 5EVCA 4L4SA 4KMOA 4ZYLA 4OA5A 1Z5GA 4B87A 5HWSA 2IUSA 3B9PA 4O2LA 2GRLA 4K88A 3ZWAA 1ZO8A 3M89A 1X7DA 1M5RA 3SGLA 1E69A 3RRNA 4XLTA 2CUKA 3IBYA 1DIHA 1FXWA 5CHEA 2JANA 4TKLA 3R3VA 4LC9A 4BLTA 4D9EA 1C8VB 3NO4A 4F3RA 2O2JA 3QWBA 4D6PA 5CJPA 4L5CA 5IF9A 2BMFA 1BKDR 2XNHA 3ZGNA 3K0SA 4R5MA 1UOPA 2Y1EA 2R1ZA 4Q9IA 4FGLA 2EQBA 3R5HA 1T9ZA 1J8YF 4GBED 1T2CA 2C97A 2FWAA 3FWYA 3GJTA 3OTQA 5ICCA 3TB6A 4AM8A 5EIAA 3LRXA 3GRPA 5F73A 4X0EA 3QI2A 1NONA 1P2SA 2J3EA 3FFTA 4HAVA 2R8BA 2COUA 4BB9A 4F9TA 4B35A 5DNYB 1AXGA 4R2HA 5K8TA 4QHSA 4QBTA 5K8LA 4TYMA 2QDKA 1KXJA 2OZLB 3NTXA 5L40A 1KVUA 3OD5A 4HH4A 2AWIA 1HYEA 1WY5A 3CLUD 4AFNA 3DAFA 3ESBA 3ABOB 2IY8A 4G0NA 4MGHA 3B12A 2DTDA 4ND1A 4RZUA 3ND5A 3FNBA 1EP9A 1KKMA 5CM8B 2XI4A 5FL3A 2QTNA 1RBYA 2I4TA 4BJ1A 2IU4A 2YVLA 3C8HA 3UKDA 3UT6A 3IIIA 3ZWQA 2WK1A 3QV1A 2WTXA 1W44A 1D0IA 1REQA 3F78A 3IOMA 2B5OA 4U2BA 3SDZA 4F11A 1E0JA 1XQWA 2LW7A 2HJHA 3GEMA 4WN3A 3C14C 3HM9A 2GZHA 1H5UA 4IDGA 3MILA 1SD5A 2WI8A 4ZANA 4KR6A 4MJ7A 3RLIA 1UJBA 2I67A 3EGXB 2FQXA 3KQTA 4LK2A 4MPPA 5KYWA 5AQEA 4QXPA 1B0UA 2WJPA 5AWFC 2WE7A 2O9JA 1KIAA 3U80A 3W6NA 2E5LB 3UKJA 3NNSA 4C14A 1G9XA 2P0AA 3HEAA 3ZS8A 5EIXA 3NDPA 4OSOA 5LP1A 5TQ2B 4LRSB 4FBLA 1NY6A 1KQ3A 2VXYA 4MVJE 1WUKS 2LTAA 1QRRA 4GC5A 3KVNA 4E09A 1T0JB 1E5TA 1WDLA 1MEEA 3H11A 4K2AA 4OKSA 4O25A 4YC7A 3P9SA 3T9FA 3I04A 3NS7A 1LS6A 4P2BA 5ELMA 5U1PA 1E3TA 1OR8A 2PY6A 1L1RA 5KS2A 4QRDA 3W5VA 2GZAA 2F17A 2FSUA 4F5EA 4F6LA 2XTZA 3TUIC 2AXVA 1TLFA 2ZUWA 4DDVA 4D26A 2IYXA 4F7DA 1DKLA 4QDZA 2FR1A 3VO8A 4Z49A 3CX7A 4FFMA 3ACDA 1O8BA 1G64A 2VP9A 4ZREA 5KTYA 1FC0A 2QZJA 4G1CA 4Y1EA 3DE0X 1ZGJA 3MWDA 4O1IA 1Z83A 2FPLA 3KZ1E 5KTRA 2UVQA 2BMVA 2GLUA 1AKWA 2RCNA 3FSJX 2VTBA 4BAUA 3AVVA 1N6LA 1ADJA 1GZUA 1E3QA 5EHNA 3ZY3A 1UFQA 1UEIA 2A86A 2RI1A 2V6GA 3HCAA 1QIFA 3C2QA 1EDEA 3PQDA 5FFMA 4ENWA 2OAEA 5JQWA 3OZWA 3SC2B 4ZMSA 5B2FA 5CT9A 2H2GA 5DBGA 1ZMXA 1R27A 1TLTA 2VCYA 2ZR7A 5B1DA 1SY7A 5DNUA 3OLZA 3C8MA 3KQHA 4LE0A 4KNYA 2PX4A 4KO3S 4UTZA 4RA9A 2GEDA 1AF4A 1TCAA 2WM2A 4RV5A 4AMUA 3G13A 4ZYYA 3UUEA 3O9XA 2R25B 1CQJB 1G1MA 2JGMA 4NATA 5F5XA 3S29A 5L3QA 4EQ6B 2PU7A 3ZQUA 1YVUA 4MS4A 2GR9A 2QXYA 4RU1A 2XE6A 2Q3BA 2XWJI 3HN2A 1M5TA 2ZSEA 1IJFA 1ZN2A 4J0QA 5HILA 3F49S 4AQDA 2YYAA 4BE7B 3BAZA 3TE6A 3OP9A 4RPCA 2RMKA 4A73A 3ZWVA 4AZWA 4F86A 1CK4A 3R7WB 2E21A 3RBAA 4NPHA 1Z0FA 4K6MA 1QFZA 4ALJA 4PCVA 1OZHA 2D8AA 3VR4D 1DDGA 2YWBA 3OZAA 1A5BB 1VPVA 2TECE 3PUXA 2R65A 3UAVA 2QG6A 1DJQA 4H6PA 3QNUA 2VRWA 2A84A 2FJRA 1TPYA 1YR1A 2ORWA 3TF5A 3URKA 3VSDA 4UMVA 4XUGB 3PEYA 2Z6AA 4D02A 2VKQA 4HMPA 4IIEA 4KWEA 4FZJA 1TRHA 3HSSA 4LQ4A 4E30A 2DHCA 2WSBA 4OP3A 4UASA 4CM9D 1W46A 5IEBA 3FTEA 3MJHA 2Q1UA 3GIDA 4WOKA 3RNLA 2ZPAA 1LPPA 4IVZA 3BD7A 2HA4A 5JQGB 2YVAA 3KUXA 2BZ1A 2FCAA 2RHDA 2NV6A 5DGIA 3ZV5A 2F4VB 5JZ9A 1LK7A 2CNDA 4NBSA 1H9CA 1NU6A 4QDUA 5HE8A 2P11A 1U0RA 2PNJA 5C8DA 3RD5A 1DXQA 4BQFA 3RYCA 4N49A 1VLMA 2XJ4A 3FM9A 3MWEA 2I87A 2YINC 2ONYA 2FPMA 4EG0A 1J00A 1UPAA 3K72B 1K6MA 2H48A 8MHTA 1GV1A 1G60A 2FPRA 3OJEA 5K98B 5H80A 3NBZC 1NF9A 2BMEA 1ABFA 3GDGA 3WRXC 3ADCA 3KAJA 5GWXA 3MAJA 4OB6A 2VBIA 3D3EA 1NF2A 3DB1A 2ECOA 3DOEA 3KHUA 3MTDA 5FPSA 1DQZA 5J2UB 5AOVA 4MCIA 1Q21A 4F4CA 5KQMA 1IDOA 4C0QC 3OKCA 4PEVA 1UAAA 4YAKA 2VP6A 3W1EA 2R8PA 3UB3A 4QWWA 5JRDS 2FVXA 1J5EB 1KMHA 2VH5R 3QITA 3V7FA 4ZYXA 4B6SA 1P0FA 3BVPA 5A5DA 1ORTA 7AT1A 5JASA 1DUVG 2QN6A 2OENG 2I4LA 2Q99A 1P74A 2FWPA 3BB1A 3WIUA 4BFTA 2HLNA 3VZCA 3QKSA 3IDAA 1P8JA 3GWGA 1F38A 2CUZA 3JQGA 2NYUA 1DT5A 1GM5A 4BNHA 1L4BA 3KG2A 4KAXA 1ZUWA 4PPFA 3R5TA 3TRKA 2PKQP 5KCMA 3NKFA 1X14A 3FDZB 3LLMA 4QHTA 3A6PC 1UDWA 1SH7A 3PNPA 5HBRA 5CUQA 2UXCB 1NUTA 1JJVA 1NBWB 3KDSE 3O2JA 1EK6A 2A7XA 2RJOA 3EN0A 3IKVA 2VYNA 1A71A 2PXUA 1KAGA 4RLHA 1LK5A 2G9NA 2P65A 1HSOA 4HUTA 2QL6A 1LBSA 5IAKA 1K27A 3PWKA 4L8VA 3WB2A 5FKJA 1F9AA 1M0TA 3LKDA 3OQ6A 1J0CA 1UZAA 2JCGA 4D96A 1PR0A 3MCZA 4D3YA 3NHAA 3NLLA 4I6JA 1WMDA 3ZDAA 1QLWA 2K4MA 4NEQA 4JP8A 1BNCA 4UPVA 4XJSA 4I1VA 2GJKA 3IIJA 2ZSKA 4NQRA 4DIUA 1T25A 3UHFA 5HQTA 2YXLA 4OJYA 4CM5A 4OB4A 2R8RA 1GLGA 2REOA 3BH7A 4OCZA 2PXTA 5E4JA 4MDHA 4EEXA 3S81A 4YRAA 1QCZA 4FFWA 5TS2A 3PUZA 1XKQA 3L6DA 4X3PA 4XSVA 1NW7A 5CJ2A 3W9UA 4OM8A 4DIBA 1IQUA 2Z4SA 3PUHA 2BEKA 3NROA 3KJZA 4KQWA 2EL9A 2C7QA 2OMKA 3ZCPA 1PV2A 1XRSB 2ZJFA 3ZYCA 2GHQA 1RWQA