3QOXA

Dot1l structure in complex with sah
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
328
structure length
326
Chain Sequence
LELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMENLIDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTTQPMKLNTRPSTGLLRHILQQVYNHSVTDPEKLNNYEPFSPEVYGETSFDLVAQMIDEIKMTDDDLFVDLGSGVGQVVLQVAAATNCKHHYGVEKADIPAKYAETMDREFRKWMKWYGKKHAEYTLERGDFLSEEWRERIANTSVIFVNNFAFGPEVDHQLKERFANMKEGGRIVSSKPFAPLNFRINSRNLSDIGTIMRVVELSPLKGSVSWTGKPVSYYLHTIDRTILENYFSSLKNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Chemogenetic analysis of human protein methyltransferases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Histone-lysine N-methyltransferase
total genus 102
structure length 326
sequence length 328
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2011-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08123 DOT1 Histone methylation protein DOT1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.60 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) 434 Repressor (Amino-terminal Domain) 3qoxA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3qoxA02
1G6Q1 1FP2A 2BR3A 2VP3A 3ELDA 4PYMA 5CVJA 4P7GA 5FUBA 3OCJA 1KPIA 4Z2YA 4QQNA 2WK1A 4V0RA 2ZBQA 2OB1A 1RI2A 1N2XA 2K4MA 2ZZNA 5B1SA 5P8WA 3UJAA 1FJXA 1I1NA 3GO4A 3HCFA 4X1OA 1TW2A 2VDVE 1MJFA 5D1NA 3BUSA 3K6RA 3LKZA 3OE5A 3KR1A 2IH5A 5KQRA 4YUVA 3PS9A 5E2BA 1NV9A 2YTZA 1SUSA 3V8VA 5M5BA 1JQ3A 3MERA 4E2ZA 2O07A 2G71A 4BLUA 5GWXA 3M33A 1X1DA 1ZGJA 3MTEA 2AR0A 2ZSUA 3R6TA 1JSZA 1L1EA 3ANXA 4V0QA 2Z6AA 2ZFUA 3KPUA 2NXJA 3G7UA 3NW9A 3LDFA 4GEKA 2ZBRA 4CKCA 3LSTA 4R6XA 5CIYA 2UYHA 4WVLA 4H0NA 5DPMA 1DUSA 3UJ7A 3KQPA 4C05A 2F8LA 5CM2Z 1QAMA 3PB3A 5ERGB 4AZTA 1D2HA 2I6GA 4HH4A 3I64A 4GOMD 1JG1A 5GIPE 2QE6A 3BXOA 3JWGA 2GH1A 2NXCA 3KQSA 4M38A 4OQEA 4PYOA 5DT2A 2YQZA 3DXZA 3THRA 3CVOA 4BLVA 3CJQA 1JTEA 2CWWA 4QQKA 2EG5A 2IP2A 3EVGA 3SMQA 4OBXA 4AZVA 4PYLA 3SSOA 5F2KA 1NV8A 4P7FA 2P41A 5EC8A 3DULA 4HRAA 3M70A 3EVEA 5EZSA 5EEHA 2OZVA 3KQVA 1RI1A 3ELYA 3MHTA 5DM2A 4IWNA 3DMFA 2FK7A 2PSSA 1VL5A 3ME5A 1RJFA 3THSA 4CTKA 2UYOA 4KWCA 3TQSA 3PT9A 2OO3A 4R6WA 2PXXA 3LDGA 5CVDA 3UJCA 4POOA 2E5WA 3EVZA 5E1OA 3TPZA 1SG9A 3PTAA 1X1AA 3HVKA 3I9FA 4LECA 1V39A 5BXYA 3B5IA 3GJYA 5DX1A 2AOUB 4F84A 3GDHA 3AXTA 2H11A 5FA8A 1TPYA 4PONA 5HIKA 4KIFA 3KPYA 5K05A 1N7JA 1WXXA 2AOTB 4AZWA 4YMGA 2CMGA 1O54A 4QVKA 5FTWA 1RJEA 3ER8A 3UA3A 3KR0A 3UJ8A 3VSEA 1M6YA 2AOWA 1XJ5A 1ZGAA 2HNKA 2HWKA 3TRKA 3A25A 3A26A 3R3HA 1VE3A 3BKXA 4F86A 4PYIA 9MHTA 5EQJB 4DQ0A 1WY7A 2PX8A 3C6KA 3FPFA 2AOUA 3P9CA 4EKIA 1XCJA 3PX2A 5BW5A 3D2LA 2YXDA 3BZBA 3LECA 3SR4A 2NP6A 3MAGA 3MB5A 5E9WA 2JHCA 5E8RA 2JH9A 3LBYA 3FRHA 5GIOE 1JG2A 3FUWA 4M36A 2PY6A 3CJTA 4RVFA 3UBTA 3G88A 4HTFB 3KQOA 2VS1A 4FSDA 2HMYB 1I9GA 4BP1A 3BWBA 3QOXA 4M7RA 4DMGA 2QYOA 4EQZA 4L7VA 3IHTA 5DRTA 3P9KA 4OQDA 2OBFA 3JWJA 4DZRA 4RTOA 3HNRA 1SQGA 3PVCA 4GBED 2C7OA 4QDKA 4C03A 3TKAA 4IV8A 3VC1A 5K0NA 4EK9A 2A14A 1VLMA 3TFWA 2ZVJA 4F85A 3HEMA 1R8YA 4E31A 3FTDA 2JG3A 2CMHA 2PWYA 2CL5A 4G56A 3K0BA 5DRYA 1KHHA 5DXJA 3KR2A 4DF3A 4GOOD 2IDKA 3GRRA 1EJ6A 2P35A 3KQMA 3DOUA 2UYCA 2GLUA 3GXOA 1XVAA 4LWPA 1JR4A 3P71T 5K0CA 2AOTA 4YV0A 1AF7A 3LPMA 3A4TA 1ZG3A 3B3GA 3UJ6A 10MHA 1X1BA 2PGXA 4CXMA 3U81A 4X63A 4RTMA 2P7IA 4FS8A 1DCTA 2ZLBA 5HOQA 5ICCA 3F4KA 1AQIA 3FPEA 4PIPA 5GM2A 3AWIA 4GC5A 4P7JA 2I9KA 2Y1XA 2EJTA 1HNNA 3IYLW 5C9ZA 3GGDA 5CUQA 4YMHA 1G60A 3KKZA 2BR5A 2VDUE 2O0LA 1L3BA 4CKBA 2GPYA 4LG1A 4HGZA 2P7HA 1YFLA 1HMYA 1EQAA 5LQCA 1ZHFA 2BZGA 3HCEA 3SVZA 1XDSA 2OKCA 3M6WA 5DM1A 2NXEA 3BGIA 3SM3A 4KIGA 5LR6A 4NECA 1YUBA 1BKYA 2YVLA 3DH0A 4QVGA 3FYDA 1WS6A 2ORED 5EIFA 4YV1A 5FQOA 3GCZA 2IBTA 2ZIEA 1XXLA 2OY0A 3GRUA 3FTCA 2VZ9A 4O29A 5DM4A 5HFJA 3FPGA 1ZKDA 2FHPA 4RVHA 3I53A 5DWQA 3HCBA 3SSMA 2YR0A 3ELUA 5FQNA 5C1IA 4AX8A 2R6ZA 1JQDA 2IGTA 5CVUA 3OZRA 3SXJA 2BM9A 5K0FA 5LQRA 1I4WA 2AZTA 4DA4A 3MCZA 5CVEA 2H00A 5EHGA 5EMJA 1ORIA 5EG5A 2DPMA 2VDWA 4C06A 1FBNA 5BW4A 2IIPA 4RTRA 1B42A 1PJZA 1VP9A 2G1PA 1P1CA 2AN5A 5DM0A 3UFBA 2ZULA 3GWZA 1WG8A 3HA3A 4Y2HA 2PXAA 3LCCA 1NT2A 4E2WA 2QY6A 5E1BA 1OR8A 1UWVA 2ZZMA 2XYRA 4BLWA 4EMSA 3ORHA 5K0BA 1XDUA 3BT7A 3ID6C 4PCAA 1SVUA 5C0OE 2C7PA 3NWBA 3E8SA 3FYCA 5IH3A 1L3IA 4RTJA 1AV6A 1VP3A 2NXNA 2XVMA 5HIJA 5H02A 3QOWA 2IH2A 3G5TA 5T67A 5GOZA 1ZQ9A 3BWCA 1KP9A 3RODA 3LX6A 3C3PA 3FRIA 3L8DA 5EHIA 5GM1A 1NBHA 3LKDA 4HC4A 2IFTA 2PLWA 3O31A 4FT4A 4OA5A 4RV9A 3DMHA 2HV9A 1Q0TA 5DX8A 1EJ0A 3KPWA 4M37A 2B78A 1RI4A 1N7IA 4E70A 3B89A 4GF5A 4IV0A 4PINA 3BGDA 1NW5A 2OPBA 2R3SA 3LBFA 5EKUA 5K01A 4RVDA 2G72A 2QRVB 2WA1A 3HA5A 5EGSA 5DSTA 3TR6A 1XCLA 2PVCA 3DLCA 3O4FA 1P91A 4HTFA 4WXHA 3R24A 4R8SA 2PJDA 2ZBPA 4HSGA 4PWYA 2JH8A 2IPXA 3PFHA 3LCUA 3REOA 2FK8A 4BP3A 3Q7EA 2B3TA 4RTPA 1Z3CA 3KPVA 5F2NA 4PYQA 2DULA 5EOVA 3G8BA 3MCTA 5K0GA 3NDJA 3FTFA 5LQKA 3E05A 2FPOA 3E7PA 3V97A 3CKKA 3PFGA 2O05A 4FR0A 3R9XB 3HVHA 2ZTHA 2EX4A 1RI5A 2O06A 5FA5A 1L3CA 4A6EA 2HTEA 4ATNA 2XBMA 3EGVA 3LGAA 1SQFA 3EMDA 3VC2A 2QM3A 3UA4A 4XUEA 4QPNA 2Q41A 1H1DA 2GS9A 2KW5A 4KDCA 3LL7A 5KS2A 1D2CA 1KYWA 3NJRA 3OU6A 1YFJA 1KXZA 3H2BA 4ER0A 3GIWA 1IM8A 3EVDA 2PX4A 4X60A 2Y1WA 5DXAA 5EVJA 1QANA 2V74B 3TM5A 4MTLA 4EVIA 4C04A 5K0JA 5HEKA 4RVGA 3M6VA 5FHRA 3FUTA 4Y30A 3SGLA 5ICEA 3KQYA 5DX0A 3G2QA 2OB2A 3ER9A 4BY9E 3LHDA 4HGYA 1BOOA 2PT9A 4KW7A 3UJDA 2PKWA 3UZUA 2ADMA 5EMLA 1BC5A 5DTRA 1O9GA 4DCGA 3HVIA 5E8JA 1NBIA 4AUKA 4PIMA 4E32A 3R0QA 1PRYA 2JHPA 1R6AA 2P3LA 2QRVA 3EGEA 3G2OA 5EIWA 8MHTA 5FADA 3HCDA 4RTSA 1QAOA 1F3LA 1XDZA 3ELWA 1U2ZA 4X41A 2AOVA 3TKYA 4UOEA 4CKEA 1D2GA 1DL5A 1JTFA 2ERCA 3FZGA 3UWPA 2YX1A 4ZTBA 3B3JA 3P97A 4QTTB 3DXXA 4JXJA 3EVAA 1G38A 4PYNA 3JWHA 3G89A 5F2OA 1NW3A 1WXWA 3KQQA 4YUZA 5LQAA 3T7TA 3CJRA 2P3OA 4DM3A 4GUAA 1IY9A 1O9HA 4RSRA 4AZSA 3AY0A 4GQBA 3EEYA 4ER7A 4C07A 3DMGA 1KR5A 3LDUA 3GRZA 4FGZA 2P8JA 3RIEA 3TM4A 3OE4A 3C3YA 4YUWA 3A7EA 1X19A 3AJDA 3AXSA 1YZHA 5ICFA 5DTQA 4DCMA 3EVCA 4RTKA 3Q87B 2YXEA 3G5LA 1QAQA 4KDRA 1INLA 1EG2A 5JR3A 3OU7A 5CCBA 3B7PA 3FTEA 1YF3A 4OBWA 3S68A 3PX3A 5K09A 2C7QA 2ESRA 3UJBA 3NDIA 2YUIA 1AQJA 3P2KA 3HTXA 3DXYA 5E9QA 1FPQA 1T43A 4PCLA 5LSAA 3GRVA 2HR1A 2IH4A 3I58A 3IEIA 2CKDA 2O57A 4R05A 1G55A 2OXTA 3A7DA 4RYLA 3TMAA 3BWYA 1SKMA 4GOND 1JQEA 3ERCA 3P9NA 2GA9A 2IBSA 2GB4A 4RWZA 3GRYA 2Z6QA 2ZW9A 3TLJA 5IKMA 2NP7A 2EJUA 4P58A 5EEGA 4YUYA 2P40A 5HZMA 5LQNA 2C7RA 2AS0A 4RTNA 2P1DA 4ISCA 4QPPA 1ORHA 2XYVA 7MHTA 1G8SA 2AVNA 3NTVA 1JG4A 2PWPA 3A27A 4ER6A 3KQWA 5K0EA 2NYUA 4PYJA 1RJGA 3X0DA 4A6DA 3EVBA 3NWEA 4YUXA 3DTNA 3EGIA 1R74A 2PX2A 3OU2A 2JHAA 1BHJA 1JSXA 2AN4A 1VBFA 3G8AA 1KPHA 4KVZA 5FCDA 3G2MA 5EMMA 3EVFA 1QYRA 3HCCA 5FWDA 4OX9Y 4E30A 5JUWA 1WZNA 2PV0A 3FUXA 2ONYA 4E2XA 1SUIA 4PYKA 1R18A 3IV6A 5D1HA 4CWAA 3O7WA 3T7SA 2PBFA 3KR9A 1UFKA 2ZWAA 3SSNA 4B17A 3EEOA 3LCVB 5MHTA 1MHTA 3RW9A 1YZ3A 4RTQA 2G8NA 1G8AA 2WA2A 3GNLA 1VPTA 2XYQA 4XCXA 2IDJA 4FZVA 4XUCA 5GP1A 3M4XA 3DP7A 2GAFA 3B3FA 3CC8A 1RJDA 4KRGA 3P9IA 1KYZA 5EZQA 4FP9A 2PX5A 4XUDA 5ICGA 1NW6A 1Q0SA 5KYGA 3CBGA 3KQTA 3NVMB 4C08A 1NE2A 3VYWA 4C4AA 3WSTA 1NW7A 3HM2A 3DR5A 2P3QA 5GINE 3SX0A 2UYQA 2ZIFA 1EIZA 2BM8A 3C6MA 4FSXA 2B9EA 3KPJA 5EMKA 3QV2A 2XVAA 4DKJA 2ZCJA 3M6XA 5EPEA 2H1RA 4P7KA 3T7RA 5U4XA 3OFJA 4K6MA 4QTUB 1M6EX 5HIMA 3EPPA 5HILA 4HG2A 4EKGA 2ZWVA 2PT6A 2B25A 2BR4A 2G70A 3BWMA 1FP1D 3HP7A 1P1BA 4ER5A 3DUWA 5KQSA 1RI3A 3FUUA 1KPGA 3CGGA 5FULA 4PNEA 3NMUF 1JG3A 4LWOA 5T6BA 4RTLA 1R8XA 4MIKA 5E1DA 2Z6UA 5E2AA 5DTMA 2AOXA 5CD1A 1KIAA 3KU1A 4E33A 2FRXA 2NNWB 4GC9A 1P39A 5E9JA 5LQUA 3DLIA 4CTJA 5K03A 3JWIA 3P8ZA 1XTPA 5FHQA 4U7PB 4PGGA 3MQ2A 4ER3A 3BKWA 2AN3A 1Y8CA 3T0IA 1F38A 3E23A 2ZIGA 2JJQA 3UJ9A 4R8RA 2LD4A 4MQ4A 3P2EA 3NVKI 3GU3A 4PGHA 4QDJA 4U7TB 1L9KA 2FYTA 1IXKA 3G2PA 3P2IA 5G02A 5CVVA 2ONZA 3EMBA 5T64A 3MTIA 4OA8A 2V7EA 2EFJA 5K0LA 2OYRA 5DLYA 5KVAA 2UZ4A 2YXLA 3TOSA 1EAMA 2N47A 3KHKA 4FT2A 4MHTA 2I62A 5K8VA 1VIDA 1NKVA 3OZSA 5HIIA 1NW8A 5FWAA 1TW3A 3MGGA 1YB2A 3C0KA 3HCAA 2B2CA 4X61A 4E2YA 1VQ1A 3BGVA 1R00A 4IKPA 2FCAA 5CCXA 3I5UA 4MWZA 3FPJA 4YV2A 3OPNA 1QZZA 2AVDA 2I7CA 3CCFA 5DSXA 5BP7A 2BH2A 2ZZKA 3OFKA 3PLAE 3OZTA 5E1MA 3FPHA 1X1CA 3HA7A 4RX1A 3HVJA 5EKXA 3M6UA 4GOLD 5LQJA 1M0EA 1UIRA 3FUVA 2PXCA
chains in the Genus database with same CATH superfamily
2VSQA 3RBVA 3G2NA 5FUBA 1TCVA 4BNHA 1I94B 4BE7B 5DASA 5H70A 1EK2A 5JDIC 1YRHA 3VKFA 2K4MA 3L77A 2FWNA 3KKPA 2H9AA 4HZGA 4ENWA 3WLSA 3REGA 3STWA 3WFJA 1O94A 2VDVE 3OM1A 4ND3A 5B3AA 5HE9A 4OO3A 1P0PA 3TSCA 4CRWB 1BYIA 3NDPA 1VFNA 5I7WA 3LBNA 2JJ2D 3NT5A 1KI3A 1I9CA 3QPVA 1X7ZB 4XIJA 3D5TA 3R9IA 3L7BA 2J31A 4ZGGA 5GAHi 2SNIE 4N49A 5GWXA 1QPGA 2FP4B 4BVJA 1K7CA 2VTVA 2JPDA 1IBLB 2L1PA 2BCEA 1CUYA 3ANYB 3BJMA 4II7A 2VHTA 4G4GA 1QHHB 5J5CA 2CL0X 3U39A 5KPJA 3OLWA 3W7VA 4L4YA 2GAJA 3AQIA 2O2JA 4NZMA 4R6XA 4YJ2A 5CIYA 1PWZA 2ECQA 1I80A 1UBLS 3GNSA 1JG1A 2BEUA 1QQAA 3K31A 3FNQA 4EG3A 2L17A 2G83A 3EZFA 2PXEA 5KYKA 2DX7A 3G85A 1KRXA 3CJQA 4Z9BA 3NUZA 2GZMA 2J4CA 3EVGA 3MWFA 3ZI7A 3DZ8A 3LKVA 4RORA 5IF3A 2H2IA 2WAOA 2NIPA 4CM9D 1NV8A 3ZHRA 5JI3E 3QJ5A 4ZAYA 3NTOA 3DEIA 1VLLA 4XWGA 4E94A 1ENPA 2ZGVA 3V1KA 1GKIA 3H6GA 1D0VA 1T36A 5KPDA 3F1LA 1U63A 5EJMA 5E7QA 4WY8A 2JC3A 1RJFA 4JUAA 4YMVA 1Z6YA 2FFRA 2GMWA 4H9GA 1XRJA 3EARA 1S7EA 3CW9A 3R6WA 1JLSA 2RHDA 1NFQA 4LJAA 4NEHB 3NXKA 4OHFA 3L4BC 2R2AA 3WDKA 1DAKA 3E9DA 1NOKA 3ESRA 3EVZA 3WRXA 1T8PA 1BROA 1XAJA 4TWIA 3DE0X 1F0NA 2A6PA 4HADA 1JIVA 4A5SA 3CVXA 1F4PA 3E70C 1TKAA 5AXDA 6Q21A 5AKKA 3V6MA 2J7WA 3RRMA 4PO8A 4KIFA 5K05A 4J2HA 3EPHA 3DZBA 1N57A 1Z13A 1RYDA 2B8TA 4NJEA 4G25A 4GYJA 4WLFA 4IIFA 4J3JA 2P6OA 3NHUA 5EIEA 1GRCA 1JDUA 2FPXA 3PI7A 1R0XA 1DJNA 1IY8A 2AE1A 2C92A 4W6ZA 1TZJA 2XWPA 3UJ8A 4DPMA 1GQFA 1GGKA 4XI9A 1QFYA 5BT9A 3GJ0A 2FEPA 5F7XA 1TVEA 1CZHA 3INYA 4S0XA 3V4VB 4DMLA 3ZLTA 3BERA 4K9RA 4AXXA 4DA9A 2FZVA 2FQWA 3O1JC 1L7OA 1U3CA 2X8LA 3EH1A 3PKIA 1GUYA 1T2FA 4TXLA 4XB6B 1C3OB 1OWLA 2Q2WA 2XDYA 3LX4A 4N7MA 4ZQIA 3S2YA 1A9PA 3VKGA 4YRKA 4LRSB 4LZPA 1OZHA 3M1AA 3GEBA 2XA9A 4O4IB 3TIFA 1C7QA 1UBUS 2JFZA 3LPAA 4NDAA 3JAWA 2HMYB 1ZVKA 2WILA 2Y1CA 1OV6A 1Z2EA 1QQ5A 3QOXA 2Q4OA 4I99A 1SZDA 4INZA 4RM3A 5HE8A 2GAIA 4L7VA 2R6R1 4Q3KA 2H1HA 2XYPA 2LNDA 1AHNA 1FRZA 3AUTA 1J8MF 5JSZA 1YVUA 3FSGD 4IM7A 2HZ7A 3OQHA 1RT9A 1T4MA 3I32A 4B7XA 4CG1A 2ZJBA 4BYGA 1H8HA 3WWYA 2PAAA 4WKOA 3ICPA 1NL3A 3OQJA 2I71A 3Q0EA 1TD1A 4O4IF 2D59A 3E2MA 1ZZ7A 3WISA 5BV2P 1U9YA 2G1KA 3UMBA 1NY6A 3PV0A 4QT0A 4M1ZA 1WPQA 3B3GA 5JXIA 4PZLA 2ACKA 4C1NA 3E15A 4PZ0A 4QLBA 2ET6A 5E6UA 2WF9A 2G9UA 4Y6QA 2IUOA 1F60A 4O4JA 3GJXC 3HPRA 3SIPA 2QVBA 4A92A 3AWIA 3N74A 4KIWA 3B2EA 3DB1A 4D45A 1HNNA 5TMPA 1KOGA 1O1YA 2ORWA 3R6LA 4RF4A 2HA0A 1JTVA 4G0NA 4O59O 3MWYW 1Q3HA 3IP6A 4KVGA 2V7BA 3JQAB 4X62B 2X1HA 1E79D 2EGUA 4BZXA 3CZ9A 5ANRB 4R2XA 4LHWA 1EQAA 4FZ3A 3AOGA 1ZH2A 3EF3A 2YBDA 4KIGA 2C9CA 3SCGA 2DLDA 5ES3A 4DZZA 1G66A 1GTG1 1HYBA 1R27A 1CHDA 3EWNA 5IAJA 3DW3X 4FYVA 3L0SA 1Z88A 2PEZA 1P5ZB 2E4YA 4GPD1 3KCNA 3GVHA 2L19A 4HS4A 4Q1AA 4XX0B 1W93A 2BL4A 5DISB 2FG7C 4K88A 4RC9A 5REQA 3VHXA 3FY4A 2Q5QA 3RIHA 4LDJA 4I9FA 3IBGA 2GN2A 3QVUA 4DLPA 4KQCA 6AT1A 4YCAA 3COWA 4NU5A 1G7SA 1NOJA 1T8SA 2A78A 1DLIA 2IX9A 3GA0A 3L05A 3OE7D 4NX2A 4YACA 5FQNA 2JKYA 5F4ZA 3VZQA 3RVPA 5CLHA 3VC2A 4AK9A 3FDJA 2DETA 2BM9A 4UCFA 1GKYA 1KJZA 3EDOA 4X66B 1EE2A 1KMHA 1M8FA 2WW8A 2QN1A 1WABA 3CVJA 3GPCA 3C7KA 3KX2A 1CUIA 2O2IA 3CNQS 4JVOA 3FIJA 1K68A 3M2TA 1EJBA 2H63A 1AUVA 1K0FA 4KDEA 1V3UA 4XFDA 3BOSA 3GG2A 1TPZA 4S24A 4GPBA 3D6UA 4ZA2A 1AZSC 2XUQA 1I30A 3FCUB 3LCCA 4ML3A 4POAA 4EY3A 1JJAA 3PC6A 3A06A 4PCAA 1SVUA 1U3VA 1MEEA 2EKBA 1J99A 2IY9A 2JLBA 2NXNA 2XVMA 4NIMA 5AI6A 1MIHA 2X8JB 3P9RA 2FSGA 5T67A 1PNQA 1YMVA 2CHVA 3TLGB 3ANSA 1JR2A 3CUTA 3HKCA 4DLKA 4J43A 5AFSA 5GM1A 2ZITA 5KWIA 3JARA 4EJ2A 1Q0TA 1UMBA 3O31A 3OM0A 4C4PA 3DE3X 1YJCA 3PEUA 3Q8WA 4GE3A 1TFRA 4UXJA 3E9NA 3G9ZA 5DX8A 1QP8A 3KPWA 1U2EA 1M6VA 2RGUA 4MS4B 2Y0CA 2F8MA 3IHWA 2R3SA 4LNUB 2EIXA 5E6SA 4MKXA 2A4KA 3FUCA 4QFMA 3RTDA 1DIRA 1GAJA 2CYAA 3HA5A 3QSGA 2F17A 1JIIA 3TCKA 1Q92A 4K8RB 2JJ2A 4IHQA 4UAJA 4CKBB 4EO7A 3IMCA 1ISRA 3N76A 2IEYA 4JC0A 1SVNA 1OASA 3H0CA 4PWYA 2V7GA 1VLVA 4MI6A 1KQFA 3ZJ4A 4E14A 4GI7A 4DSZA 5CTAA 3H3FA 4E7PA 1QP7A 1AZLA 4REQA 1ULAA 3G8BA 3MCTA 2X19A 3AF0A 1EZZA 2Z9BA 3DHYA 2QD5A 3R9XB 3PFGA 3AESB 4N0MA 3IEKA 3RO7A 2WZCA 5FEUA 3LUHA 2CN1A 1RI5A 1VPEA 1YE5A 2UZIR 3AF1A 4YP0A 1N2BA 5JCPA 3NGLA 2EBYA 2HUPA 5JTTA 2VJDA 2VQSA 3TL2A 3IDOA 4KNYA 3ZI0A 1NMXA 1JT2A 5DSZA 3GJ6A 3NASA 2Q0SA 1D2CA 2N1MA 3G6WA 4F9EA 5CFMA 2HINA 2JGAA 3R44A 3EZGA 1OLXB 2BFCA 2V74B 1JQBA 3QPCA 4DXHA 4JQOA 3H8VA 1U1GA 2C7GA 3KBOA 5ALOA 5SV2A 3V4SA 3V7WA 1XMQB 2GF0A 4ARSA 4EEZA 1VHWA 4BY9E 3N2LA 1N6KA 3GC6A 3UUWA 4R7GA 1XMXA 2JI9A 3FX2A 3GGOA 3L84A 3TZCA 4IH4A 3ZDBA 4B6PA 1IY2A 2RC6A 4C0XA 4EX7A 2QRVA 3EGEA 1DINA 3ZHYA 1XO1A 1XYYA 2M6LA 4N8DA 1E8NA 1MQSA 3A3YA 4EFKA 1TRHA 5ESRA 1S3GA 3LS2A 1RRMA 2D2IA 1DC5A 3G7DA 3HBFA 3GFBA 4RSGA 3VAZA 1N2IA 3PITA 1T1JA 5I3CA 2CROA 3DV2A 4WFJA 3I52A 2OP1A 4YDRA 3FZGA 4TXJA 1CUUA 2EYUA 3TFLA 4GZLA 4LCEA 1CJKC 4QTTB 1TVMA 2DT8A 5J4KA 1YKGA 1NJFA 5EZ5A 1CZUA 3EEQA 3M5WA 5NULA 3W2HA 2I2WA 3RG8A 1ODFA 1T9KA 2J30A 4DM3A 3SJ7A 2IBMA 4F38A 4LDRA 4HWPA 1RRKA 1L4YA 4ESOA 1SC4A 2JIOA 3TM4A 2HCNA 2CXXA 1J2RA 5DULA 1DV2A 5BUZA 4TXMA 3E2IA 1YBHA 2ZAOA 3B53X 4MUHA 5JR3A 4HRXA 5IK2D 5KU7A 1QHHA 1Z39A 4PVCA 1Q0RA 3QPDA 2HCSA 1J2YA 1HFKA 3QBDA 5P21A 4CM4A 1N1GA 4BTVA 3JVVA 1ZJWA 1EGMB 2CCGA 3AZOA 4EYKA 1UK7A 3EW7A 5TMBA 3MUFA 4F3KA 2H8GA 1L5YA 2A9RA 3BDVA 4HDMA 2G82A 2A86A 4RHTA 4TXHA 4UBKA 4D9NA 3LY5A 1S5PA 4NTZA 1DDIA 4H3KB 1U3FA 1VXRA 3MBOA 1OT5A 5CHYA 4EVSA 5I7FA 3LHFA 4DC1A 3QUBA 1IBMB 2FN9A 2KLHA 2PRZA 5BSRA 4A03A 2MEZA 5LU9A 2C2OA 1M73E 2YY5A 2R8XA 3HB7A 3K0FA 4K8OA 3ZH2A 2IIBA 1HG1A 1O95D 5EEGA 3TD2A 4YUYA 4GZMA 5A9RA 2QAJA 4NU8X 5BUCA 3C3EA 4LHYA 1O6BA 1WMBA 3CUSA 2PV7A 1Z7EA 1YBAA 2JLRA 2PWPA 2QTVB 3CURA 2IIQA 1Q7TA 3EWAA 4IBOA 4IX1A 4XM0A 1ACMA 4EUSA 3SWWA 5JJLA 2IOHA 4MS4A 1G98A 1GSAA 1T4CB 3ENZA 1A4RA 3WGHA 4D5GA 3LUDA 4C78A 3OIVA 2PS3A 4NCKA 3MEJA 2HA5A 4JHXA 4PU7A 3EVFA 3HCCA 2XKBA 5CIWA 2JGFA 4OX9Y 3KNZA 1R9NA 4MW0A 1QFSA 4RYDA 4ZFNA 5C8YF 4IEEA 4J0GA 3TX6A 3AEYA 3EXFB 3OIUA 4A0QA 3CA8A 3FM9A 3IV6A 3HFRA 1P3DA 1MC1A 2FMXA 3ZDZB 2W43A 3MMNA 1YJXA 1E1LA 3AUJB 3RW9A 2QRQA 4HNAA 4M88A 4DLVA 4Z6KA 2RI1A 5CR9A 3UJ3X 4CMBA 4GP7A 2XYQA 1YQQA 3GA5A 2ZBUA 3PGXA 3V8PA 1QVRA 5IJ9A 3E4DA 3HN6A 3VH1A 4ZHSA 3TSYA 5ICSA 3L04A 3OQNA 2NSDA 2YJ3A 4E5VA 2R4TA 1MVOA 2HJRA 3SU8A 2PX5A 4BNJA 1GTZA 4OKIA 1Q0SA 1M5UA 1Q84A 1HFEL 3KZVA 1MFPA 4MCIA 3LPCA 5KCMA 2O19A 2IZ7A 3HXTA 2IPMA 2XNCA 3Q1LA 4C4AA 2X4DA 1X0VA 4G5FA 4IGEA 3WSTA 2P3QA 1VJDA 1Y82A 3HKBA 4HQNA 1PX2A 3A31A 4ZV7A 4BO4A 5EPEA 2WTXA 4D9JA 3IPLA 2PZGA 1P2TA 3N2NA 3LX5A 2QSJA 3WVNA 2QN2A 4FNGA 5AW3A 1MRNA 4M8NE 4L1KA 3T34A 2RGRA 4C6HA 3QIVA 1GZ6A 1U7XA 4L15A 1IHUA 1L9XA 1UWLA 1DDOA 1V6AA 2B1IA 2GDJA 2PX0A 2VF4X 2YYSA 4ND8A 1N2SA 2R6AA 4K9NA 2FF5A 1R6BX 2RGCA 2OZEA 3AT1A 2V65A 1SUBA 4C2AA 5DFAA 4YCCA 1B00A 1KIAA 4OQNA 1U7PA 1AQNA 1JIJA 3AF3A 1DLJA 2HCRA 4MI1A 3JYHA 4OXNA 2WPDA 4CMAA 5HFAA 2K2QB 3AUUA 1S2GA 1A77A 1PQUA 4K26A 2I7VA 2L0XA 2P2GA 4LJ7A 5FBVB 1GGVA 3IJEB 4UTZA 2PKQP 1P0IA 3DAOA 5BQ3A 4DV2B 4UXIA 2H54A 3ZEIA 1R66A 4L5JA 5HZHA 1TCUA 2QT9A 3K4HA 4Y1EA 4ENQA 5KYWA 4DUPA 4DQLA 4L50A 2FPLA 4CKXA 3CX6A 4AL4A 2VNJA 5B2EA 4DOMA 5D84A 4ZJUA 2V4ZA 3IDAA 4N03A 1RKQA 2GD1O 3G2PA 2XR1A 3KWMA 3PBKA 2NZJA 3E7XA 4FDVA 1QZUA 5THQA 4CM4B 3EPJA 3K5IA 2Q3CA 1ZITA 4OXRA 2NVWA 1ZCZA 2OLJA 3ND7A 4RZ2A 1XQYA 1GSIA 2YFQA 4YFYA 3KHKA 1LWNA 1L8AA 5EPUA 3DEJA 1YDGA 1PBTA 4HF7A 1DC8A 2PNJA 2ZSJA 3I9KA 4DREA 2HHHB 3JSXA 2RGYA 2O4UX 2ZR0A 2B5AA 1GEEA 1I0ZA 1QFJA 3AF2A 2NZYA 3GQBB 4L9AA 4ROSA 3TNYA 4LKRA 4UNSA 4U8HA 1KJ8A 1Y3IA 1UBJS 2HHJA 1SCAA 2HSEA 1XZKA 2ZB8A 3NR2A 4TV8F 1B1CA 1M0WA 2MSLA 4HAYA 4TMFA 4YMTA 5B6JA 3H2SA 1VJ0A 3OQMA 2VJKA 1ZA1A 1Y5MA 4H6PA 1C81A 1NBWB 4KU4A 3VH3A 3W2GA 1M8GA 1CY4A 2O0KA 5EHZA 1NASA 2PXCA 3JX9A 3TRDA 2PRSA 4A6EA 1K66A 4M54A 5LA6F 2PSFA 1V8ZA 2HB6A 1N4AA 1G19A 2CLKB 1GZ4A 2ZBQA 2ZUCA 2DR2A 2BWJA 1CS0B 3AJ9A 4MYDA 5EWMB 2J7UA 2WT8A 4B6JA 2OOSA 2REXB 1T26A 1XD9A 2COEA 3GO4A 2HK7A 1HDGO 4FHDA 5TDHA 3L8YA 1X8LA 3D8UA 3MMXA 4KOEC 4RCYA 4S1NA 3PS9A 4EWLA 1YBFA 4MGIR 5JH7A 3KEMA 3N59A 2NYRA 4KL8S 4W1RA 2J9GA 4Y9TA 2H57A 3VDQA 4NENB 4JBXA 1GKUB 3U2QA 1M7HA 5JJIA 5GZ3A 2QQ0A 2RHCA 3C5WP 4CIXA 2NXJA 2R7NA 3TDNA 1UPAA 3K1YA 3OEYA 4ZI3A 1HTWA 1LSJA 2BEKA 2PTHA 3EGCA 1FFSA 4HDSA 5AYVA 2UYHA 4WUTA 2JLXA 3NIFB 5DTEA 1YO6A 1XNHA 1PFYA 5D01A 3EQ8A 3H9CA 1EUZA 1ZP6A 1TL7C 4CE6A 3KQSA 1X9GA 4R51A 4AW9A 1FS4A 4NKRA 1DQZA 3IO3A 3EZYA 5K3DA 2EX1A 3HGTA 5SZHB 4OBXA 5D6NA 4GQMA 2P90A 1VRCA 2CXQA 5EQTA 3SSOA 1O57A 2YHIB 9LDTA 1F4LA 1JP7A 1S7CA 2HXGA 2DB3A 5ECWA 3U9SA 3LPDA 1N6NA 3HCPA 4YAOA 3HI4A 3SC3A 3TW6A 4F5ZA 2LKCA 4FOOA 2HA6A 2Y0PA 3M70A 4K81B 3W04A 1RRGA 4D3DA 1Z36A 3KQVA 2GKGA 2JKVA 4UHBA 1NXXA 3D7KA 4OM7A 3ENWA 3IURA 2PPVA 2PSSA 2LUOA 1QHFA 2ZB4A 3FNIA 4ROTA 1J8YF 4OIFA 4BO2A 4CN8A 3ZGLA 2ILTA 3DZHA 4I5FA 1KQOA 5AQEA 1ODKA 4EGSA 1EHCA 3GVIA 2OFYA 4JLBA 5CEEA 4D6PA 2RCYA 1VECA 2H3HA 3LDGA 3TRJA 1GNPA 3F3YA 5D3ZA 5MN6A 1AB6A 2CFSA 3DDNA 1C3LA 4LECA 3LGSA 5JYBA 4KZPA 3FJOA 1Z3IX 2BNOA 4EITA 3F5MA 1NMYA 2W6OA 1TMOA 2BVNA 4LHSA 4CW7A 2PGIA 4W8GA 3A6LA 2WF8A 3MTBA 3BHNA 3HUDA 4IAOA 4RPHA 5KAPA 4CCWA 1ADRA 3V7UA 4ERNA 4GS5A 1HRDA 2COUA 2G40A 2PTGA 4ZVKA 1CD5A 4NU0A 4CU5A 3FPSA 5CEFA 1H4TA 2D3WA 1JAZA 2JLQA 2UVQA 3JASA 2I6FA 4HR7A 2VAXA 1DQSA 4LY3A 3KOXA 1S4MA 3ZVRA 5JOQA 3OX2A 2GA8A 4AP9A 4B9EA 3KSAC 1VE5A 1PU2A 3NP7A 3A25A 3KAQA 4Q4JA 3WLQA 4DM4A 5EQJB 3PDUA 5JS8A 3D7MA 3DV0B 4OHBA 4TYYA 4Y6SA 3GLRA 3TFOA 1GU0A 4LMRA 4XM1A 3ZHSA 5KZMB 1AKWA 1YI1A 2Q1YA 2YC4C 2AHRA 1RACA 3NEAA 3GROA 4IHAA 1GTL1 4KTTE 5E4JA 1VBMA 3CUWA 4O5OA 5E8RA 4ZDIA 5LYJF 4U3JA 5K3FA 1R0YA 1KY3A 5A4FS 3LV8A 2J0VA 3PNYA 2Z3WA 1QIGA 1T6ZA 2CF5A 2ZR9A 4U0JA 4DZRA 4KQ6A 1CP2A 3ROFA 5I8ZA 1FY2A 1G1AA 2Q3BA 1IATA 3CZCA 3ADOA 1KJ9A 3AM4A 4IV8A 4TN5A 4E0BA 1QZXA 3WV4A 3PUVA 1ZM9A 3Q8XB 1KEZA 1CF4A 3FTDA 1DAFA 1SUWA 4TWJA 1EGVB 2V4MA 3RM3A 5DRYA 3Q88A 2BEWB 1KHHA 4FJ0A 4D80A 3O7MA 1ZISA 2A5DA 1ZJZA 3DQQA 2QI9F 1T35A 4DTIA 3UH0A 1RIFA 2WFLA 2E2WA 4QNNA 2OOKA 2LE0A 4O4JB 4DA7A 1X1BA 4CV1A 3ZCQA 5K9ZA 2VAPA 1E4YA 1LLFA 4FS8A 4UQOA 3UKJA 4B6GA 1MOQA 2FMTA 1II9A 1BTOA 1AQIA 3SJCA 4YMUA 5B12A 3DJFA 2XT9A 3GGDA 3O8OA 3QKRB 3ZW8A 1I3NA 1L4GA 2NUPA 3Q0IA 4F5DA 1VKNA 1TLLA 2Q4EA 2PBLA 2BP7A 2F6RA 3PLRA 3S1LA 4XIGS 4C7XA 4LG1A 1E0DA 3LK7A 5IBPA 2NO7A 2R8RA 2ZIZA 2WM9B 1MX9A 3I5MA 1JGTA 1R37A 4R4JA 5LB4A 4LJ5A 3NWPA 2Q3EA 2NLOA 5EIFA 2ORED 5JSFA 3L8GA 3SYTA 4F92B 3LBAA 3GAAA 5KTSA 3J81k 4DV1B 1QIIA 4Y9RA 4E07A 1DAGA 5DM4A 1E9FA 2G1AA 2YRFA 5DBEX 3RROA 3V55A 5BRJA 4K6HA 3Q9NA 3EB9A 3ELUA 4UEOA 1SWVA 1T9BA 4INJA 1X2BA 3RUAA 2WJ3A 3BRCA 3OURA 2O8DA 2WABA 2W00A 1QOZA 4Q05A 1BIFA 1NI5A 5AW5A 5SY4A 1P29A 1B0PA 2F43B 1USVA 4KXFB 1S02A 4ETIA 1W0JA 4P98A 2JCVA 1FFXA 1ORIA 4ZO6A 1WHTB 4EZIA 2V5UA 3DL7A 1ZW6A 5JRZA 3ZHMA 5A3VA 4EENA 3OZEA 2IIVA 1MKYA 2FZCA 4FHCA 1P9NA 4R41A 4LQDA 3GWZA 1R4MB 4D44A 4E2WA 2XA2A 4IFIA 2O0MA 3AZPA 3CZRA 4CFYA 5DMHA 4E15A 2GZHA 2RIPA 3JVUA 5JS1A 1B0NA 3IP8A 3TQTA 1OPXA 1FMJA 3IERA 3UXHA 2NUAA 3QOWA 5LBUA 1I6LA 1KA9H 1OGYA 3TCNA 2RAPA 4C5BA 3REFA 4D9FA 4GM4A 2YW2A 3LX6A 2J6HA 2CVOA 1CZNA 1OREA 1WZEA 1WVGA 2POCA 2WKPA 4EHNA 5LNK1 4ZMRA 4R3WA 2WTNA 3L18A 3RIMA 4ZI7A 2JGNA 5IJXA 3TRIA 1Q14A 2H8KA 4YRDA 3ZNPA 2QL5A 2PGAA 5ALLA 1ZK3A 1PUJA 4JD5A 4BRWA 4H7KA 1NW5A 3GJTA 1IONA 4BGEA 5HRCA 4HWKA 4LJ9A 3H2ZA 5EGSA 1UBMS 1L8OA 3HJNA 4G4IA 4CI0B 1EVIA 4GHJA 1P91A 4LXIA 4DLXA 3GV0A 4NCAA 4KDFA 4M1OA 1YHNA 2NVOA 2XRYA 3MD9A 1GUFA 3I2FA 1KI1A 1ST3A 1KWGA 1G4UR 4BP3A 2JH8A 4RTPA 1D4FA 3SVLA 5D85A 2B3TA 3SC2B 1HYQA 4XQCA 5JC8A 4HMQA 1CZKA 1SCIA 1RWXA 4BFZA 1M34A 3ZVKA 4LPKA 1N3IA 1GGMA 3T3OA 3HVHA 4NHEA 5DYNA 4AB1A 4YY3B 5CK5A 3SYMA 3Q8KA 4H0CA 1CS4C 1JBKA 4G5YA 1PFKA 2ZJOA 4QJ3A 1E2GA 2DTDA 3QV1A 1Y9QA 1KJQA 1SG0A 4MI3A 4XUEA 3N0RA 4CLXA 4CM3A 2GBLA 1WQ3A 2R68A 3GJZA 1N92A 3NJRA 4KXUA 4RQTA 5DF1A 1U5AA 1T6NA 4I6JA 3BFXA 4MA0A 4MW2A 4FC7A 2BM0A 3ISJA 5AM5A 4X4FA 3WLIA 4HDCA 3KQLA 2XYGA 4MUBA 1QOPB 3K0HA 3HCRA 1R2QA 4WZBB 1ZCFA 5EMLA 1W19A 1L1QA 2FUG1 1VL0A 3OOSA 2QENA 5SZIA 5CBPA 4MS3A 5FPHA 1GDTA 2L49A 2PSEA 1U9JA 3HVIA 1NMQA 3H5IA 3K3PA 1K0UA 5GJCA 1KJYA 2B36A 1J7JA 3FPLA 3LD9A 4KG7A 4EMUA 5LCXA 8OHMA 1JFFA 4GNRA 4X44A 1DTWB 1GQ2A 4TZKA 3OKZA 5BQFA 3A6PC 1YTLA 1FQOA 2O8CA 1U1IA 4CR8A 1QAOA 5TVGA 2QZZA 2BEJA 1OFIA 4TT3A 9ABPA 2NU8A 2EKLA 4CKEA 3BDNA 1V1MA 4WLEA 2EHJA 2IYTA 1UC5B 2CF6A 2XPCA 3CUYA 1JAXA 4JMLA 1AS0A 3ADCA 1E1KA 4JSYA 4QM7A 4P4NA 4LC9A 1O58A 1FUEA 5EE3A 2P2DA 1LQUA 5DN6D 1H3NA 2ZB3A 1C3OA 4AD8A 2AE2A 2O2HA 3CSDA 3QG1A 3DDSA 5A3QA 2V1XA 2QN9A 4M0LA 2DSTA 1I7SB 4GQBA 4PZZA 4JEUA 1OW3B 4YRQA 3DMGA 3H5OA 5I7OA 3RRBA 2IZ5A 3CBQA 4ALIA 1QGUA 2DT5A 2EU8A 4WADA 1XC7A 2XVXA 4MUYA 3K73O 3RIEA 2ZTLA 3SDSA 5JS6A 3M3DA 2C78A 4EA9A 5L53A 5DM70 2YXEA 1Y1TA 1M7GA 3QELA 4EKNB 1INLA 1OIVA 2JAWA 1UANA 4J9VA 2XOXA 3B7PA 3IOEA 3QLJA 4PPQA 5DHTA 1CC1S 3A58B 4W5OA 1CJMA 1E6MA 2FUCA 3KLPX 3LOQA 2AYYA 2ESRA 2G8LA 2IYAA 3DAFA 3MQFA 4FUTA 4JHLA 1U4SA 1Q77A 2OTCA 3AERA 2B9VA 1X87A 1P4GA 3LVFO 2H1OA 2CVFA 4Q6WA 3ZD7A 1JXAA 1G5PA 1QG6A 1DKOA 1MF7A 1KAMA 2LP4Y 3DAGA 1G55A 3QPWA 4TQUS 5C34B 4BV8A 1DKLA 1W25A 1VB3A 3KJZA 4EHDA 4MVJI 4OHOA 5JCZA 1FFGA 4RKWA 2CFOA 2JJ1A 4HVTA 3X2SA 3ZHBA 5IVKA 2ZRLA 3KTAB 4I1SA 1TJ3A 4QUBA 2MYUA 4F56A 2D74A 2IHKA 4CDMA 4URYR 1OH5A 2Z6VA 3W0LB 4C3VA 1XB2A 2JCGA 2ONKA 3N6RA 4E5MA 4CTMA 2OBYA 2CMDA 4ZT3A 3LX8A 3UT0A 1NURA 1GOTA 4J6FA 5AVYA 4TUYB 2ENUA 1XXHE 1CFZA 2KB0A 1BWSA 2Z1MA 3PJEA 4MICA 1CBUA 3LT1A 1PT8A 5ELXA 2BOVA 1U04A 4I4TA 4GMKA 3VPXA 3NM6B 2XA1A 4MKGA 1G6HA 1IWOA 2BI4A 1WSWA 4YCJA 5LB2A 3JQQA 5AT1A 5FWDA 1F2TA 3OUTA 4YR9A 3A9CA 4BQRA 5JFGA 5EE5B 1YOVB 1BX0A 1RWNA 4QG3A 1KERA 1T2CA 4A82A 4B3MB 5HF6A 2FJUA 2ZR7A 4IIUA 1PQPA 1YNSA 2GZ1A 2RGEA 4OSOA 4C6TB 3ISTA 4GMGA 3I42A 3SS8A 1E2BA 3GGJA 5HG0A 1C4KA 3GJSA 4LMPA 5JZSA 2GN6A 3RIGA 2XGMA 1X7XA 5IHPA 1Z73A 2WUDA 1K5GA 2UUCB 4DIEA 5LVAA 2R65A 2ZRFA 3IB3A 1ZS9A 1P4AA 4PZCA 4FMPA 2GAFA 4O1HA 2IXFA 3FWPA 3QH4A 2CLLB 4DUYB 1YI0A 4MWBA 3FCEA 1HNWB 2B7LA 1O87A 3ZBUA 3U4MA 1EIWA 3IS3A 2ZI7A 2DKOA 2NZVG 3HVUA 3OE7A 1QC5B 1KO4A 4L2IA 4Q4AB 5EMKA 5AJYA 2X86A 2Z95A 4RPIA 2QP3A 3VO8A 3EAGA 4HGRA 4D8VA 2R8PA 2H07A 3TQFA 3GJ7A 5GY7A 5FFMA 5JALA 2Y93A 3BWMA 4HG2A 1J8FA 5GPBA 1HSOA 2WSBA 2X5JO 4BMOB 4DR7B 1T8UA 1KPGA 2PU7A 2I65A 5DLDA 1ZH8A 1ELOA 1XEWX 3LUKA 3AUFA 2CDBA 3K16A 4MIKA 3OEEA 2B21A 3RE1A 2PT7A 2OAP1 1PR4A 2D5VA 1G3QA 1QGOA 1BJTA 3L2OB 3P0JA 5HR5A 4YO8A 3W6NA 1YB6A 1K9SA 1EBBA 4OHWA 3URMA 1CETA 3UMJA 4JBNA 1J1UA 1ODTC 3B1ZA 4EO4A 3UHFA 1ND5A 1H0RA 2CDNA 5D3MA 1IHXA 2B0JA 2I6QA 5FPSA 4EKDA 2X77A 3F8TA 1XNJA 4EB0A 4UZFA 1WCXA 4XEHA 1T5SA 3UPDA 3O74A 4Y3UA 1QYVA 1LVUA 3RYIB 2EBHX 3VR6D 2PYZA 4WJLA 3QLVC 1JHXA 6LDHA 3L7LA 4M8KA 3OJWA 3INTA 3KZOA 3FDZB 3TOCA 2QROA 3EH2A 1EWVA 3CLVA 2PAFA 4TYQA 2EP8A 3NG1A 2FPUA 5BN3A 2Y1FA 3CNNA 1BMQA 3UTCA 1CP3A 1Q1GA 1XMSA 2QV0A 4UUQA 1JDJA 1N7HA 1VPWA 1NC1A 4PC1A 4PZAA 5G4KA 4OI0A 4U02A 4L7QA 1OH8A 4M53A 1Z4QA 2F8SA 2UV8A 2N47A 3IT2A 2E0IA 2WMYA 4OYLA 4AJKA 2CXHA 4DR2B 2MSEB 4M87A 1T0PA 3D6JA 3GPDG 1NUUA 5LP6F 2RK4A 1ZJ5A 3A9UA 3Q11A 2DERA 2W6MA 3CPSA 2FCRA 3O2SB 4TSRA 2DFTA 4KUEA 4CYMA 3W2EA 1KK2A 4DNPA 4QU9A 2I7CA 4L5BA 1FQKA 4YIKA 1CWUA 2JFVA 4Z4QA 2XCLA 3GH3A 3R5XA 5CXXA 3EG9A 5JD3A 2LYJA 4G81A 2AR7A 4IJUA 4QO8A 4R54A 7YASA 1NVAA 3W9YA 3BH7A 5KVQA 1EDEA 2OCPA 1GU7A 1XLTC 2QJOA 3GJQA 3P9PA 3RUPA 4F6CA 4TKUB 4S1OA 4F2PA 1NLFA 2YJ6A 3PEFA 2GN0A 4OI1A 2FPRA 2XWQA 4GI3A 1GN8A 1DVRA 1PFQA 2FR0A 2BONA 2IGBA 5KAMA 4FE3A 2BFBB 2AV6A 4EG4A 8ABPA 1HWYA 3IIJA 1FNDA 1YI8A 1KYYA 1R0RE 5C1DA 3EXIA 3FMOB 3DL2A 4PZUA 1FE8A 3KS9A 4X1IA 1VFPA 2OHIA 5D1NA 4QARA 4WNCA 3ZWQA 3GAMA 4KP7A 4F3TA 3VO1A 3JAKB 4IG4A 4E5SA 1PJCA 4P82A 2C5AA 4OPMA 4E88A 1OXMA 1U9CA 2J33A 1YHYA 1E66A 2G71A 1IN4A 2F8TA 3TGPA 1H6DA 5AVKA 1QFXA 1XMJA 2EBFX 4A8TA 1Z2PX 1YRLA 2HF2A 3MTDA 4PLHA 4TWBA 5H68A 5JARA 4INAA 4V1CA 4JV5B 3B3QA 3CRW1 4P3NA 3CCBA 4HNUA 1FQJA 1XQWA 3WIVA 3B7HA 5A6VA 1EXWA 2JIMA 3EIWA 4FNOA 4XQ9A 3LTNC 1VGRA 2WFZA 4NNOA 3C98A 1XA0A 4OHMA 4P5DA 3VR6A 3WL4A 1YQWA 2XAUA 1D9ZA 3K0SA 4WN9A 3MUNA 4Y1RB 5BVHB 3PXBA 3WRVA 4EMBA 5FLEX 4F4DA 1TK3A 3KZNA 3WJAA 1T6YA 2AKYA 2R1VA 4IGAA 3CZ5A 1SJ9A 2TYSB 3OF2A 4OQXA 1VJTA 1Z08A 3SZUA 1GVNB 2B5VA 4WEQA 5HBRA 1DOHA 3MBIA 4RVOA 2BSXA 3L9WA 4YJGA 5EJAA 5IC6A 1NLUA 2ECKA 2OESA 2W6IA 3MC1A 1BKDR 3R74A 5IDQA 2PSJA 5T4BA 1P75A 2X41A 3H84A 4IVRA 4MUNA 4JYAB 1CE8B 4DMHA 3KYCA 4W8HA 1CRQA 2GJ9A 5BSFA 1IG0A 2VLBA 3DTVA 3WMXA 3ZV6A 4X24A 1OBHA 1PHPA 3FROA 4RVSA 5E6UB 5DYIA 1D4ZA 1PV4A 4MQEA 1GD1O 3S28A 2PD6A 2QR3A 1LBTA 1JR6A 4R1QA 4C0WA 1N0HA 3GZDC 4K5QA 1J0AA 3EYWA 1XA3A 5CVDA 3TEPA 5GAGi 1KMIY 3UJCA 3V6LA 3DSRA 1I5OA 3MVEA 2PZMA 4JNCA 4BGVA 3IAHA 1SA0A 4ZKEA 3FHCB 2PE5A 3B5IA 5K2MA 3B38A 4MRVA 3S5JA 4HH3C 2WYVA 3BM5A 4EFMA 1PVDA 3WL3A 3LK6A 4OYYA 4GZ5A 3T61A 2OGWA 3ZBPA 3MYRA 5LFAA 1M2OA 4WNIA 3H4IA 2AXNA 3NUQA 4V02A 1O54A 1DTEA 4FGUA 3OAAD 5JLAA 1QHYA 5AXCA 3CZMA 1UBEA 4KBYA 4XASA 1R12A 3TRKA 3ABRB 3GN5A 4PYIA 4S1WA 2RK6A 5JY6A 4TSFA 1FFWA 1PGPA 2XTJA 3JWPA 3JYNA 4IXNA 1BDMA 2BY4A 1T34A 1T6XA 3W90A 5J4YA 1H6AA 1MQAA 4AO8A 1JG2A 1OTYA 2CNLA 3O0DA 4DJDC 2HKIA 4IYRA 3JTEA 1D09A 4NFHA 3CX3A 4EY7A 2J08A 1APBA 3P27A 3ZD6A 2A5GA 3L6RA 2VTBA 4BMZA 3ZGYA 2KS6A 2RGWA 3A6GA 3AEKB 1IOVA 3PNSA 3RFUA 2IRWA 2ZDGA 5BSVA 5JV5A 4YRBA 4WZ6A 3EQ2A 1SBIA 2OFOA 3A04A 1NONA 1W47A 1XCMA 2WAXA 2PL9A 2YNMD 5BWCA 1ZW1A 2WWFA 2A14A 3LYLA 4UFNA 2PLNA 3BRWD 1FDIA 4E31A 5IBQA 3H5NA 5JNSA 4C9BA 1GGFA 1JQAA 4Q0MA 4PO1A 1VGQA 5DXJA 3KR2A 2N42A 1WIZA 4JVMA 4RY0A 3ESDA 2Y1GA 3W8RA 1I4TD 4X91A 3JVEA 4ZZ2A 3AEUB 1J8VA 3WHPA 5JJKA 3ONDA 1E1RD 1E4EB 1QZ3A 2PGXA 1JKIA 3WNVA 1UOPA 3ED1A 1FFBA 4TTSA 1O6CA 1MJGA 1AS3A 2QZ9A 1MQ9A 3F6SA 5HA5A 3VTKA 1G16A 1YVRA 5B30A 4IIGA 4N5HX 4O8CA 4Z1MD 5LKAA 2O1XA 3N05A 3LU1A 4QOSA 1OT3A 2OYCA 4RFVA 4C7OB 1XTIA 4CKBA 4A8JC 1JWLA 2BKAA 3OLCX 4LYFA 1MB4A 4XXHA 5A5VA 3HCEA 4N47A 4N40A 1VOTA 1GT6A 5E6SB 2I54A 4OGWA 4TYNA 5LR6A 5D3QA 2HQ1A 2CBXA 1C50A 1RLUA 3DH0A 4UBMA 3EEBA 2JLSA 3DO8A 4AIRA 1FX0A 3HDQA 2WPNA 3QXJA 4KSYA 1FLNA 3OHPA 3RFXA 2VZ9A 1QO9A 1YSCA 4WLUA 1QIMA 2PMKA 1N3BA 1VPDA 2W58A 4H18A 5I8PA 2VP5A 3U19A 3OPMA 3H83A 2Y1OA 4QU5A 2RH4A 3H7AA 3UHJA 4EFDA 5IWCA 1BEEA 1Z45A 4K40A 1E0SA 4UD2A 1KEVA 2DP4E 4JH0A 4F4FA 3V4RA 4PR3A 4CQNA 3AEQA 2WY2D 2IV2X 3MSXA 1T0BA 3WSVA 2VYND 1DEXA 3VNAA 2YW9A 1IJKA 5JO9A 1EFTA 1MO3A 1IIBA 3EC1A 4Z1OA 3EW9A 4HUQA 5I48A 1XYVA 1CR2A 3ENVA 3S29A 3SLRA 2UUBB 1E1MA 3FNFA 3OOEA 4N5IX 1J2JA 2HMWA 4IMJB 4TWZA 2TMDA 3ZIAD 4CKYA 4O1MA 1R6UA 2EFEB 3LT5A 1I10A 3MJHA 2OKGA 5EGNA 5C7IO 3A37A 4HDRA 1ML3A 2XMRA 2R6CA 2GEKA 2KQUA 5AVXA 1G4HA 2J3EA 5C37A 3WWOA 4ADSG 3QTTA 2C9YA 4BNGA 2XE7A 4WCFA 2IVQA 5AKLA 5L4SA 4Z4FA 1L3IA 3PZRA 4WXEA 1ONSA 2AEMA 3WP0A 4CMGA 4P4UA 1GQOA 2H2DA 3EISA 3DD5A 2XRZA 2LRHA 2QVCA 1DKPA 3T7JA 3O8RA 2X8BA 1YA6A 3FR7A 3ITEA 3FRIA 1T9GR 3NXHA 2FW8A 4RL6A 4L6CA 1TA0A 3ZY6A 2FGKA 4AM8A 2B8NA 4OLHA 1JDTA 1QGED 3M89A 3SBEA 4B4OA 4DE5A 2A9VA 4YB8A 2WYHA 1H2BA 5FFFA 3ROPA 1L5NA 2GUWA 1L5OA 4GF5A 2QRPA 2MJLA 2OPBA 3M9XA 2HLDD 5TSDA 4NYJQ 2R87A 2EARA 3O4FA 1K08A 1OIWA 3GUVA 3RS4A 3NRJA 1K3FA 4FFMA 4J7CA 4MB2A 1MX1A 3M9WA 4LVNA 4OUKX 4XPIA 1XP5A 3FKSA 3PFHA 2OXIA 4ZOBA 2WSYB 2QN3A 3INRA 3KPVA 3E8MA 1EWKA 1N2OA 2TS1A 3KOOA 4KKXB 4AP5A 2ODWA 1KZYC 4AWAA 5LL6P 3MCUA 3AMVA 2VPPA 3ABQB 2J9XB 3Q6MA 3NKLA 4UUMA 4YMSA 3QVTA 1WD5A 4YP5A 2VT6A 2DWOA 1RYYA 2YMMA 3ND9A 3DWGA 1RVDA 4Q9LA 1UP4A 1U0RA 3JQ7A 4UJ3A 3LGAA 5J4LA 3IT0A 4QOFA 4G36A 4Z99A 1SRRA 2MT9A 4B3BA 5KSPA 2MWMA 4J76A 4P4SA 3X2EA 2YMQA 1FLDA 3BJIC 3T7EA 4HQ6A 1L1MA 1DRJA 5DWDA 2FFHA 1PT9A 3E3LA 1AZWA 4LTMA 5AOBA 3U37A 1Z25A 2D0DA 1WDMA 1SXQA 3PUKA 4FZ5A 5HEKA 4B43A 3M6VA 5HK9A 3PHHA 2DUJA 4GDMA 5KWEA 4JI5B 4YWHA 2ZIXA 1T13A 1N1EA 2PH7A 3LHDA 1ITZA 2GRJA 1BOOA 1HT3A 2O20A 1NJGA 1KF0A 1U80A 2HIGA 2OMKA 2X2FA 3DKPA 3UJDA 3C5EA 1BC5A 3U3RA 3ZS9A 1BFKA 1CQTA 1O9GA 4I66A 3TZEA 3CT4A 4XGNA 4YPOA 1NBIA 4HX2A 1TJNA 4AUKA 1XJCA 4U63A 5JO0A 3DDUA 3OTWA 5LQSA 1UOOA 3CLUC 1ZL2A 4HJRA 4Q1CA 3HO6A 3F67A 1Q1ZA 2VJMB 4MCAA 3F0TA 3WLAA 1XK6A 2J3KA 3F7NA 3Q7IA 4G5GA 2VQ6A 3W05A 4NYJR 2QMYA 3CVUA 5IKOA 2I80A 2E4UA 2BFNA 3E6AA 4MINA 2K5UA 4PLYA 1JVNA 4U00A 3CH6A 3QELB 3AVVA 1URPA 3FYTA 4FGZA 4O1IA 3NMUF 3A7EA 3EXEA 1EP3B 3PYXA 1C5KA 1UDAA 1GFZA 2BSQA 3FTEA 1CUEA 3H9UA 5A9SB 2YJTD 4QJBA 3IOCA 2C7QA 1EM6A 3FSRA 1TF2A 2PRYA 4B2LA 4AIIA 3BE8A 4FXPA 1T43A 3ZOZA 3OBBA 5IAOA 4I9NA 5EP4A 1NGSA 1B23P 3QI2A 3CLTD 4RH0A 1BS2A 1HKHA 3K5WA 2IKQA 2WTBA 2ECOA 4HDOB 3H1PA 4N3GA 5KWJA 3P9NA 4DDVA 1F2VA 4LYHA 4F6RB 3Q1KA 2E4AA 2NP7A 4NENA 3I9V1 4KC0A 4D3XA 5BYKA 2VQDA 3HHPA 4BGDA 1QNLA 5AW4A 1MRSA 5F1YA 3FA2A 3RYCB 2C7RA 3OHSX 1H2AS 1KIFA 4QWWA 1CQWA 2GEUA 4L57A 4EHLA 1C1XA 1IZZA 1ESNA 2QTTA 2O59A 4WN3A 1ADGA 1D8AA 5GVSA 3FAKA 1XZGA 2GM5A 4FGJA 1Q1QA 5ARCA 3GN5B 4J49A 1FP6A 3JR3A 5CNMA 1VBFA 5DB4A 5FP0A 5L4NA 1LNZA 2YWEA 3I6ZA 1ZS4A 1IY1A 1ZM3A 3AVOA 3F78A 3O4GA 1E3JA 2X2OA 4G5HA 4QOHA 3VPBA 2GXAA 2WWXA 5G3ZA 3T5GA 3BE5A 3H86A 2CHEA 5D51S 3D3WA 4PCVA 2RHWA 2JAHA 2VHCA 2ZATA 3AHDA 3VYSB 2HRQA 2LLVA 1U7DA 3A1NA 3RFTA 1YZ3A 1N5DA 4KVFA 1B8PA 2V6JA 5TGTA 3KP1A 3V5NA 4UXHA 1IXYA 4CQMD 3NHMA 4QPCA 4G1CA 3SPXA 4RBNA 1UFQA 4Q1BA 2O7SA 3KT0A 5LLSA 1VJ1A 4ZK2A 2GJKA 2YDXA 4WMLA 2VHVA 5AI5A 3EGDA 3LWBA 5A4MS 1W5AA 1JMYA 4UPVA 5LZ2A 1ULUA 3AONB 1KI6B 1RWWA 3KALA 1O0CA 1SGWA 4DWOA 2IYFA 3C1OA 5C31A 4FN4A 1GTMA 2IQIA 3L0IB 3PJFA 4EF4A 1H66A 3E1GA 3L7OA 1PHRA 3C3JA 4R9UC 1SIBE 1Z4OA 1ZH0A 3LWNA 3I8OA 3W5JA 4ENSA 5CXUA 4YJ2F 5BRAA 3AIIA 1OTXA 1WXFA 2CEKA 4UU8A 5JVDA 4QXAA 5C1OA 1BJRE 3OKCA 1S2NA 1ZI8A 4O5AA 4JXZA 3GVPA 3L1IA 1ZN7A 1W0JD 4MQEB 1OHHD 2QX8A 2YJ4A 4YIHA 1I2AA 2X1MA 1I5EA 2ATEA 1N3LA 4GBGA 4UU1A 3R5FA 3VC3A 1UKZA 1Y4AE 1XAIA 2PKXA 2YJNA 3CGGA 3QXGA 4RTLA 2Q3JA 3PWZA 4TLEA 1CU1A 2NO9A 2W2XA 2GFQA 5DTMA 1ZX1A 4IJMA 4O6VA 3RK4A 1I7QB 1H2HA 2VT3A 3KU1A 3IMEA 4FB4A 1M83A 1HO3A 1X1EA 4YEDA 5TT0A 2IWRA 3Q12A 2H4YA 1CYDA 5JAQA 3LYHA 4GLOA 1DCMA 1TQ8A 2IYPA 4NARA 2QVZX 3OEHA 3KJGA 4CG2A 3E9YA 3S5UA 2BLLA 5BYAA 5TE9A 2C2KA 4HK4A 2JJQA 1K8ZB 1TEHA 2YS7A 1YJBA 1FB5A 2B92A 3IR6A 1LA2A 1FXWF 4H3HB 3C70A 4MARA 3RSSA 4LXHA 1N2EA 1TJYA 3SZGA 1T2EA 3K70D 3CE6A 1XLUA 2WFAA 4NS1A 3F4BA 4MROA 5HKLA 4Z0TA 5DU2A 2OCDA 2YVQA 1Z5VA 1L4EA 4R1MA 3P94A 2GSWA 5T64A 3ODGA 3CEJA 2A33A 3PQ6A 2O5RA 4OA8A 4QC2A 2OYRA 3UGQA 5AW7A 5M2QA 3K0AB 2PPLA 2IU0A 1EAMA 3CG0A 1ZIPA 4PS1A 1U3GA 2QVXX 4H17A 5GZ1A 3V1NA 3LWDA 4B9AA 1M2WA 2EXXA 1WPXA 2PRIA 4QOJA 1WEHA 5GONF 2EEPA 5BV1A 2IT1A 4PU4C 3AL2A 3CH7A 3EAFA 3FKSD 2DFNA 2HK8A 4J7UA 2FCAA 3GQVA 3I5UA 4E51A 5IXJA 1WBBA 3N2GB 3OA0A 1T6BY 2F48A 2QVYX 3TL6A 2ACWA 4LV5B 4PHCA 1QP4A 1WIWA 4IMRA 1IQ0A 4TKUA 1UDXA 4R2HA 1HQ1A 1KMMA 3G0CA 3ZHUA 4OHKA 1XAHA 4KXWA 2CJPA 1WMEA 4QQNA 5AHOA 3FNHA 2NG1A 4BNXA 1N2XA 5P8WA 4PPGA 5AHRA 3FTQA 3QBVA 1NVVQ 5J5AA 8LDHA 2RE8A 2XGJA 4ZJYA 4EKYA 4U9HS 1TYCA 3O2NA 3V1TC 3ZGZA 4P35A 4EJSB 4W9MC 4TMTA 3NTXA 4BQQA 1DRUA 1X7WB 1S8AA 3KRTA 1T0UA 2VDPB 3EFHA 5INTA 2AN1A 2NT4A 2QF7A 2FLVA 3QYFA 2IXTA 1QU2A 4URZR 1UAYA 4E2ZA 2R4QA 4CF3A 4ZAFA 4DCPA 3DLHA 4L4UA 3R6TA 3W7AA 2R00C 3FIUA 2WU4A 3WICA 3NV7A 3KE9A 1FTWA 3CNEA 3PYLA 3JYQA 3GUHA 1Z8DA 4MH0R 4LXTA 2GHTA 1SHJA 1VCMA 5DPMA 2FPWA 1UAAA 1ZH6A 3OICA 1DELA 2NN3C 2BNMA 4Z0PA 3R5HA 1A97A 4W82A 2HQBA 3ZWBA 3HYLA 3UXYA 1XFDA 2EKQA 2P1RA 6PFKA 3CONA 3TI7A 4FTWA 2V6GA 5I7AA 2LYRA 1W5FA 2LIPA 1GNQA 3RYHB 3N75A 3H2JA 3ZXUB 4JP3A 4B4KA 1SKBA 1NSYA 3BMQA 1MJ5A 5T8KA 5A4KA 5ALTA 4Z4IA 2O3UA 5GJVC 2ERXA 3V7NA 1BVRA 2HLPA 4N6OA 4OJQA 1RKXA 1ZI6A 1QRAA 1TQ2A 1VI6A 1Z5ZA 3RV3A 1E2EA 4HRAA 3OSZA 3EVEA 4Q3CA 3U1TA 4AX4A 5K3EA 1G20A 1BAPA 2W6NA 2FSPA 3F6CA 2FP4A 3ME5A 1B16A 4DQUA 2DSNA 1C8BA 1A0OA 1GTVA 2WJVA 5COAA 1TC2A 4N41A 1W4CA 1QZTA 3DE4X 5FOTA 3TN7A 4V03A 2QM0A 4W63A 2PZAA 1DOAA 1Z0AA 2PXXA 5CDSA 4POOA 3I37X 4MITA 4PFQA 4WNYA 4YX9A 4L22A 2XEXA 2K2WA 4MWEA 2BGMA 1XGKA 1KE1A 3A9WA 5GJBA 4X54A 3ZIUA 5KMGA 3DJYA 1NQUA 4C4TA 4TXNA 3KL4A 3NC1C 4BMPB 3NHPA 1XHFA 2EERA 1O0SA 5EUMA 3T9BA 4DRZA 1SCDA 3LZCA 2HZBA 4MHOA 1N7JA 3BXGA 1O2DA 1U8UA 3KT6A 4OI4A 1ZM4A 4M4SA 4PG6A 2ZTVA 4EGAA 1K6IA 1ZPQA 4DC9A 4G1UC 5TX7A 4J1QA 3BE6A 4U2EA 1O94D 3K32A 1KQ3A 1S2MA 3KR0A 4UJ5A 3PUZA 5GV8A 4CF5A 3SHTA 4BZQA 3QLUA 2D1YA 5IVDA 1Z4PX 4M0CA 4G9GA 4CCYA 4D79A 5CLFA 3NI2A 3BKXA 2XDQB 4NDNE 5JASA 1C30B 1UXOA 2P5TB 1GUAA 1E3DA 1MIOB 4UMDA 4YNBA 3UMRA 4DYDA 5BW5A 5A9SA 4LYDA 2HT1A 3QFCA 3KYDA 3R9KA 1EX7A 3CZAA 2JHCA 2ODTX 1TTPB 2I6UA 4QL3A 3LBYA 4QGFA 5GIOE 1YT5A 2CNBA 4HDKB 3NLLA 1SC1A 1B74A 3CRRA 4HXEB 3PEEA 4F2WA 5B55A 2RDMA 4AICA 4BVAA 2FUNB 1U9IA 3K9BA 4H7PA 4DMGA 4O4IA 4A8PA 2H0RA 3HJUA 2XD4A 2P5UA 3EQ9A 2OBFA 2JLYA 2XRFA 3LCRA 4ENRA 4Y1FA 1E2KA 2Y6UA 3TKAA 3GD5A 1F0PA 2Q50A 1U3DA 3CO5A 3SYNA 4FCCA 2ZM6B 3CW8X 5EZYF 2WHXA 5HJEA 1V7PC 4UBLA 3UK1A 1B3BA 4JJEA 1Q7GA 4DYVA 1GN9A 3I05A 1GNSA 1QG4A 2X3FA 3I1JA 3OETA 4M7OA 4DMUB 3KQNA 1FTYA 1OF1A 3F5SA 4DLNA 1YQGA 3PGA1 1MNAA 3ZPXA 1Q0PA 3KK0A 1HYHA 3MWLA 4LWPA 4QEKA 5E0OA 4AG3A 3SHOA 3LPMA 3H6KA 1GA1A 1J6UA 1CUCA 3QXCA 1ZK2A 3VQTA 2HF9A 1D6MA 3FSEA 2W8BB 4ANFA 4AJ9A 3NH9A 1I13A 1CRZA 2COKA 3R1IA 1FZTA 1LD3A 2WUEA 3NDBB 2EJTA 1KFBB 1USIA 4BKUA 4E4RA 5ITSA 2NQ2C 1UK8A 4E1AA 5A9TA 2CLEB 2XIUA 1RBZA 2ZYSA 4LI0A 2O0LA 3NOOA 2A4MA 2ZOSA 1B7GO 4R01A 3QVGA 3FHTA 3DCJA 4MEBA 3LFPA 4HEQA 4EI8A 1D2EA 1FTNA 4WK2B 1KOFA 3MQ4A 4DCNA 3KZ3A 1H5NA 5G2OA 2HBZA 4JA2A 4R5HA 5AXAA 1IQPA 2BUAA 3ORFA 4QVGA 3VR5D 5JAPA 1WF3A 1VSTA 1KAEA 2D00A 2IBTA 4XYBA 4FHGA 4D6XA 2A94A 1EP1B 1YJ5A 2GAAA 2HWYA 2O2ZA 3EVNA 3OO0A 3PFFA 2QTAA 4FGSA 2FUEA 4WZBA 3DFUA 5H81A 3WLRA 4NE2A 2GZSA 5CPBA 2YV3A 3BL5A 2F4VB 3QE3A 4JB0A 4P80A 5CB4F 5JWOA 3BJZA 3NHRA 4WOCA 1QMGA 2CZGA 2Q2QA 2FFAA 3DONA 4KACA 1JFFB 4YBRA 5CX4A 1ULBA 4DHWA 3U13A 5BURA 4KRXA 2OXEA 4XH9B 1GXSB 2C31A 4L4XA 4N18A 4NCXA 1E9SA 4UARA 5A5DA 4WZBE 4FWTA 2L69A 5EG5A 3ILSA 3B6JA 3D5EA 1US8B 4IDBA 5AICA 4IVZA 2GOYA 1ZN8A 4IKEA 1EU1A 2DQYA 4DCCA 3BSYA 3CLSC 1PK8A 4RY2A 2ZS9A 1COWD 3IKJA 2VDWB 4FIZA 1OFUA 2CYCA 3A1WA 3PHBE 3T5BA 3ZJ5A 5KDOA 4KV7A 3U7IA 1CULC 1I2CA 4OSPA 2ZZMA 4ZAWA 2WWRA 1QK3A 3OIDA 3ORHA 4MVJF 3KL2A 4OATA 3T3MB 4BO6A 4F7WA 2GM3A 4MR9A 1L7XA 2JGMA 2X42A 4K9MA 3E8SA 4MV9A 4ZDJA 1Q21A 3LBHA 3G3EA 4IDGA 4F46A 2DQ4A 1NM5A 2DUNA 2RBKA 4Q37A 5I7SA 4L75A 1GAWA 8ADHA 1SWWA 5GOTA 1L5WA 1X86B 1OCTC 5TQ2B 5SYNA 3D3EA 3LKDA 4HC4A 1R9MA 2YRXA 4RV9A 4C4ZA 3Q4GA 4XUGB 2OCBA 1OYWA 4DIOA 2AI1A 2AWNA 4YI5A 2IHZA 3GW8A 3KVYA 4RXUA 4WQMA 4Y2QA 2VTEA 5THKA 3T94A 4I6RA 2WE7A 5I7EA 2NAPA 2Z3VA 3FHLA 3QHPA 2G72A 4RD0A 2A5FA 1PERL 1XCLA 2HJSA 3L6DA 5EJ2A 2GRUA 1KR2A 2O8BA 4QXPA 3EIQA 3RSQA 2OFXA 3QA3E 2IYLD 3BQ9A 1A96A 1O6GA 2IYWA 1QCDA 2H16A 4I4LA 4H35A 4L3OA 1NWCA 3F6YA 4PYQA 5EOVA 1JEDA 2HU8A 4CBVA 2ZCUA 5HF8A 5K0GA 4L9WA 2IKSA 3FTFA 2O2DA 4HEA1 1Z5WA 2BAGA 1TIKA 2J3JA 3V97A 2BMEA 5CITA 4YDSA 2V3WA 4FYXA 4MGHA 1N2HA 1PR3A 3RLIA 3U49A 1SC3A 4B3DA 4ENVA 3SE0A 1CZRA 2QM3A 4JWTA 2AMYA 2QL9A 4YCMA 4L76A 5JZMA 2E48A 4HNQA 4E3ZA 2D1QA 1JU4A 2NX2A 3BDIA 3FNRA 4QRHA 1OXVA 3U3WA 3CRNA 3I2YX 4R9NA 4WKCA 3LBIA 1RC1A 3DF7A 2IOYA 4KUGA 3QPAA 4RQAA 2Q21A 5DXAA 4ARBA 1GADO 1N2GA 3ZI4A 2J5KA 4BKOA 1H2YA 3OPYA 3UMFA 1DFIA 3JXEA 4LOHA 4YBAA 1Z74A 1MNQA 4Y7CA 5IJ0B 3OZIA 4YPFA 1TMGE 4HGYA 3THWB 4YP7A 2PT9A 3OCYA 1RYFA 3EZXA 1VM6A 2BHTA 5DBFA 3EFBA 1DKNA 3V3KA 3AEXA 3RBZA 1FLAA 2C97A 4TMYA 3QWGA 1NI4A 3MK31 4MDYA 5KTOA 2FSVA 2PU5A 4IIXA 4JASB 1K5HA 1ZXLA 2IVFA 2AEFA 2RIRA 3JSAA 3ORYA 4J8PA 2ZRDA 1BXGA 3GCDA 3KSDO 3P2YA 1FSPA 4MO9A 3ZEAA 1T9ZA 3TKYA 4CI9A 3PDIB 4UTPA 4MR8B 3PFNA 4WJZA 4HYYA 3I6MA 3EF1A 1IWPB 3R2JA 5CNJA 4I6TA 4PG4A 4O0LA 2PDAA 5LYJB 2HHAA 3LWZA 4KPEC 1IAVA 2WTUA 4AF7A 4X4IA 2HFZA 5LQAA 3W4JA 4XRRA 1BYUA 3CJRA 2D5AA 1DTWA 1V9SA 4DLAA 3B51X 4D8WA 5A05A 5D3MB 1B6GA 1A9SA 3Q2KA 2P8JA 2YVUA 3CKLA 2BE7A 2FG6C 1DP4A 2YWRA 3OE4A 4LJKA 3AXSA 4NESA 5ICFA 4D92A 4DCMA 3AC0A 2AW6A 1X13A 1U1CA 1EG2A 1MAUA 1JPJA 2GT1A 3H11B 3RC7A 4YAGA 2EYQA 2Q4BA 1ORWA 4K1LA 3D2AA 4FCVA 4M46A 3T9AA 3IP1A 3L1UA 1XYGA 4R1TA 5AJHA 3COJA 3SI7A 1L4UA 1XU4A 4IVNA 5CLLA 1P19A 1RRPA 1ECPA 4Z58A 4X92A 2R79A 1IZ7A 4JUDX 4QASA 2VZLA 3GEPA 3A2MA 2WUGA 3JZFA 4Y0NA 2Y1DA 2ZIWB 1AKRA 3JQFC 3ZR4B 3AV0B 1AKVA 2CXRA 3NHZA 3AG6A 5H0IA 4EYEA 2YBEA 1JQEA 3G7SA 4L51A 3C3MA 3WI7A 4OH7A 2VHZA 1RE1A 2FMFA 2VAVA 1TGVA 2Z2YA 3LF2A 4Q4DA 4RVCA 5FTJA 1G63A 2I2DA 4B4VA 5HZMA 5ALJA 3VYUB 4AMUA 1XROA 1GPYA 1QB7A 2FLWA 1ONPA 1V4BA 1JG4A 1RPZA 5MF6A 1KQGA 1SQ6A 1AMOA 4Z7NB 4H4EA 4NG4A 4JJIA 2QAIA 3U61B 4KR7A 1MFZA 2A88A 4BNMA 2PUWA 4Q66C 4S2UA 5DP2A 4YXWD 2IF0A 2PL3A 2XVZA 2AN4A 2ZSKA 3H2IA 1LI7A 2CDAA 2Z5VA 2C54A 1XUOA 3CX8A 4HO1X 5AJTA 2NUTA 4D7AA 5KHAA 3FZNA 2F1IA 1WOMA 1U8ZA 4LYGA 4Y18A 5JH7F 4NOLA 3CQ9A 4M49A 2W42A 2PV0A 1JAIA 4WCVA 1WOYA 2H65A 4LZNA 2IOFK 3QFFA 1M0SA 4EL0A 1OXSC 1UFKA 2YMPA 4O4LF 4TV9A 4XE5A 3LCVB 3R23A 3SSNA 5DWVA 4B17A 1SHKA 3FYUA 4I4TB 3TZQA 2UYGA 1DWPA 3E3MA 5AHKA 5BYJA 3ETJA 1UXJA 3IVMA 4G23A 4CLEA 2HT6A 2HD4A 3PLNA 1BS1A 1O08A 2E3JA 3IXQA 3OPYI 4PO9A 5L3ZA 2JASA 3EPKA 1K88A 1GEGA 3ACCA 3WGUA 1VCHA 2Y0BA 1K5DA 1KP2A 3WB2A 4DVJA 5C4MA 5G3YA 4I1OA 4TV8A 3MILA 1C4WA 5JHGB 1V48A 1IOZA 1VMIA 3OZFA 1GSHA 1IHDA 3C6MA 1PJ2A 1XQVA 2G5TA 2XBUA 5FOWA 3K8ZA 2H1RA 4BO8A 1ODCA 1OXKB 1RHKA 3EUFA 5HIMA 4TLLB 1N8NA 4QU0A 4Y1RA 4KTVE 4AJOA 3EOAI 4KFRA 3HP7A 1OLXA 2FMIA 4DA0A 1QDUA 1P1BA 1RZ3A 2FN3A 5TT1A 1K98A 4DWWA 4OHVA 3U7HB 1K75A 1ZRHA 2A0XA 3W6ZA 4WZZA 1SOVA 4JT8A 3R1FA 4GIBA 4OP3A 2BMDA 1Y5RA 3OZAA 4M8IA 5FRDA 1HDZA 5JZBA 1PZHA 4PSDA 1GDDA 2GN8A 1X7HA 2OSBA 2IDMA 4WL0A 3AR3A 4MR8A 3K7EA 1G6KA 4X8OA 3PENA 1WXGA 1YZFA 2C4KA 2P9JA 3JQ6A 1E3TA 2VHEA 5LA6A 2IE8A 2FZKA 3T7IA 1B8UA 4LXQA 2QPLA 3QU4A 3V8NA 3L07A 4I8IA 5JANA 1A8PA 3K20A 2R85A 2XBLA 3NVKI 3TOXA 1TJ5A 1CQZA 3GU3A 4BX2A 1H2FA 1PNTA 1H1TA 1YJQA 3KVRA 4E22A 9LDBA 3U4IA 4HV4A 4ALJA 3Q2IA 4AG6A 5HQ3B 721PA 5AKYA 4MMZB 2BYTA 1WU8A 2HSGA 1FJHA 2HLDA 4I55F 4FDTA 4IWXA 3GUUA 2EFJA 3VK0A 1ENZA 4C4SA 2HRRA 1V16A 1LFDB 2PMDA 4YJHB 3QTLA 3BXEA 2JBHA 1Y3CE 3PUYA 4RVNA 3I2KA 2UZ1B 5HIIA 5D7BA 3P9YA 1M1YA 1P0QA 4TZ0A 4GYYA 2CLDX 3M4NA 5ADUS 4L74A 3C0KA 4U6NA 1J2UA 1TD9A 1ZONA 3QFHA 4AXBA 4B8YA 4FOPA 3I0NA 3WMFA 5F1OA 1T5DX 2FXIA 4YGXB 3K35A 3IXLA 1EI9A 3DKVA 3F6EX 4BAZA 2Q5EA 4EYGA 1VRWA 2IXEA 4AMBA 2EBWA 3PLAE 3AP3A 2QX7A 4CR6A 4Q7EA 2ZIXB 3M81A 4GOLD 3VX3A 1YR7A 5KOHB 3IT1A 1BE0A 1UIRA 2WE8A 5EMHA 1NF3A 2I2BA 4GMDA 3UKOA 2FR8C 4NBRA 1YS1X 3C7TA 1A8UA 1LKZA 1W2GA 2C99A 4RZSA 3OQIA 4RXTA 4BVFA 4Q03A 3GFTA 3WGOA 3RVNA 3NATA 1DEAA 2D0OB 4R2MA 1FVFA 1KXJA 3WGGA 4ME6A 4C0HA 4HMOA 1Y9AA 3IT3A 3L0CA 1ORVA 2BEUB 2VTBB 3PUHA 2PO7A 1IDOA 4LY6A 5E2BA 3BZWA 2GBIA 1QLWA 3UHPA 2A3RA 4DV7B 5FL3A 1E2DA 1ZLYA 4HXYA 4MV7A 4WXYB 5CJPA 2BRUA 3ABZA 3NTLA 1GLGA 1ZNZA 1LFAA 2HL6A 3DVLA 3JTMA 2BFDA 4PFSA 3P96A 1LK7A 5D6OA 5EXDA 3TTTA 3V8EA 3NRCA 3U9TA 2YIDA 1BCSA 1BH2A 3H1TA 1H1LA 3AILA 5ICGA 1GFSA 5D3KA 2OCKA 5FPPA 1DUSA 3UJ7A 4AVYA 1C0PA 2F8LA 3GLSA 5AJZA 2X4IA 4G5OA 2W2NA 4HH4A 2QD3A 1G291 3QM1A 4RSMA 3J81A 1Y6FA 4BTEA 3DS8A 1CKEA 1J39A 1TAGA 1YUMA 2GX6A 1CDEA 1USWA 2QUBA 1ECGA 4G65A 4MW7A 4PYOA 3V1UA 1R0CA 3NQ41 1J0XO 4WK6A 1XVLA 5AI9A 1SCQA 2GPSA 4NBLA 4WA7A 3RIXA 4D9KA 1UKVY 2V7VA 3LOPA 4H4CA 3OO1A 2AFHB 1LV7A 2Y8EA 2VVTA 4CCAA 1Z0UA 5AR1A 4KR3A 5DBGA 2VBFA 3BWVA 2WU8A 3PIIA 5EZSA 3THWA 1ZAKA 3EDYA 4NP6A 5ALMA 1CJUC 4BP8A 3H9JA 3AIMA 1BQEA 4BNNA 1KE2A 1N1DA 3IOYA 3DMFA 5CB4B 3F3MA 3GEIA 1WNTA 1J06A 3EDRA 1NBMA 4WBSA 5B4UA 1ZM7A 3O03A 2RGGA 2Y71A 1MB0A 4NRDA 3KDPA 4XA8A 1RW4A 5E9AA 2HJ9A 2XJ9A 3PT9A 3U4QB 1SXPA 5C18A 1W4ZA 4QPZA 4Y2TA 4IPTA 2NWQA 4TS3A 4MDEA 3H4TA 2PLRA 4ES6A 3VV2A 3TLXA 4IXWA 2GD6A 4EGJA 4JI4B 3MWJA 3NBFA 1OWOA 2FPPB 1QPZA 4H3SA 1UOQA 1K9VF 4KK4A 4P54A 1TUBB 4OMCA 3NAQA 4XJTA 4XFKA 4D57A 2WP0A 5DX1A 1P17A 3AXTA 2H11A 1M6HA 1EUCA 2KYRA 3LQ2A 2C88A 4HGQA 2OP0A 1E77A 4FK8A 1WCWA 1NX6A 3SOZA 1CQJA 1DCFA 5DDIP 2HJVA 1XKTA 3TOVA 1D4OA 4OJYA 3FE2A 5HFNA 3WKEA 1RAIA 4DXDA 3HXOA 3NTUA 2J1LA 3BMNB 1GAEO 2YY6A 3ISVA 4BDTA 4PAOA 3TH5A 4KMSA 3WL5A 1E0KA 2ODNA 4K3VA 4MQLA 1UXHA 4NMLA 4W8OA 4YRIA 1NQAO 2AOUA 6ADHA 3AVTA 3H13A 4P4SB 3LECA 3AVXA 4DDWA 2CLSA 1DARA 4X6XA 4FZJA 3T7DA 1LWOA 1TM7E 1DRVA 2VR1A 4YR7A 5AM0A 2PMCA 3IFSA 3KQOA 4F60A 3D59A 1I2MA 1I9GA 4Q4HB 1O5OA 2IC5A 4Q16A 4FFSA 3PEWA 1QNFA 1RHJA 1MG5A 1YIOA 2R4UA 2YJ5A 3C3WA 4J0HA 3QVXA 5DK4A 1ZWLA 1P6UA 2J9RA 3FJ1A 4RKYA 4AYXA 5KX5B 1V26A 5EHNA 3ZHTA 4QUJA 2B1GA 2PFSA 2GR9A 3W3AA 4MUMA 3CXUA 3HJAA 1BXKA 3C87A 3H9BA 1X6VA 1YR3A 4N01A 2ODPA 1KYQA 2P2ZA 1X7ZA 3K6JA 1U1DA 1L4MA 4G56A 4ND1A 1OPRA 2ZYTX 5CH5A 4ZPXA 5A0TA 3C45A 2IDKA 1WMFA 3LY9A 4TVSA 3CPEA 3DZDA 1F6DA 4N12A 2WM3A 1J2EA 1XVAA 2C4TA 2Z0MA 4EG1A 5AVQA 2V0NA 4IOMA 1ZG3A 1OHHA 3EAQA 3FH0A 3UJ6A 3ZE7A 1H69A 3HFSA 5CLGA 2ZUUA 5TS2A 3U81A 2X0NA 4BO3A 4CXMA 1XTVA