3QOXA

Dot1l structure in complex with sah
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
328
structure length
326
Chain Sequence
b'LELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMENLIDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTTQPMKLNTRPSTGLLRHILQQVYNHSVTDPEKLNNYEPFSPEVYGETSFDLVAQMIDEIKMTDDDLFVDLGSGVGQVVLQVAAATNCKHHYGVEKADIPAKYAETMDREFRKWMKWYGKKHAEYTLERGDFLSEEWRERIANTSVIFVNNFAFGPEVDHQLKERFANMKEGGRIVSSKPFAPLNFRINSRNLSDIGTIMRVVELSPLKGSVSWTGKPVSYYLHTIDRTILENYFSSLKNP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone-lysine N-methyltransferase
publication title Chemogenetic analysis of human protein methyltransferases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 102
structure length 326
sequence length 328
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2011-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08123 DOT1 Histone methylation protein DOT1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.60 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) 434 Repressor (Amino-terminal Domain) 3qoxA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3qoxA02
3ER9A 4FGZA 3G8BA 5DM2A 1JQ3A 2N47A 1FBNA 2PX5A 3IYLW 4M38A 4UOEA 5CD1A 4EQZA 3D2LA 2YTZA 3G2QA 4P7JA 4QQNA 1SQGA 4EKIA 4QQKA 5KS2A 3MQ2A 4C05A 3B89A 2AVNA 2OZVA 5MHTA 3C3YA 5K0CA 1YZHA 3MTIA 3EGIA 4C04A 1JQEA 4WVLA 3AWIA 3CVOA 2IPXA 3UA3A 2EJTA 4ER6A 3G2PA 3PVCA 5HILA 1RJEA 3FRIA 3GWZA 5K01A 4RTJA 3HCFA 2YXEA 1WS6A 5EIWA 2AOUB 3MGGA 4QDJA 2IBSA 3A7DA 4GC5A 3CC8A 2OY0A 1WY7A 5DSXA 2IDKA 3FPGA 2NXNA 3HCBA 2IH5A 4L7VA 4A6EA 1HMYA 2G70A 1D2HA 2BM9A 3REOA 1ORIA 1R18A 3G5TA 3QV2A 5BXYA 4E33A 1O9GA 5G02A 5EC8A 2NP6A 5LQRA 1FP1D 4WXHA 4OBWA 3THSA 5CVUA 5FQOA 3AXSA 4RTLA 1YUBA 2NYUA 2HTEA 2H00A 3G2MA 5T6BA 2I6GA 2HV9A 2ZZNA 2AN3A 3DMGA 3FPHA 4P7GA 3NDIA 2YXLA 3M6XA 1XJ5A 3TM5A 4FZVA 4GF5A 3DTNA 1G60A 3KQYA 1VQ1A 1NW8A 1X1DA 2OB2A 3P8ZA 3JWGA 1R6AA 1AQIA 5JUWA 3P2IA 2GH1A 2XYVA 5DWQA 2H1RA 3C6KA 4E70A 3ORHA 4P7FA 5LQUA 2ZZKA 3ELDA 2HMYB 3LL7A 4AZTA 1KIAA 5K03A 3OU7A 5FA8A 4HSGA 2JH9A 1VE3A 1U2ZA 5C0OE 4RVHA 2Z6UA 2P3OA 3PLAE 3C3PA 3HVHA 4RSRA 5ERGB 2I7CA 3SX0A 3M4XA 1AQJA 1EG2A 1NW3A 3GDHA 4PCAA 5E1DA 4RTNA 1XXLA 2IGTA 3PX2A 3R3HA 4GOND 3TM4A 5KVAA 2IFTA 10MHA 2GS9A 2DPMA 2JHAA 1XDUA 3KKZA 5EG5A 4QVGA 1NKVA 2HNKA 3QOXA 5DX1A 1PRYA 3KQOA 1PJZA 7MHTA 1ZKDA 1INLA 3G7UA 5E8RA 3HM2A 5BP7A 1BOOA 1QYRA 3KQMA 2EFJA 2GPYA 5K0NA 5CCBA 3UJBA 4RWZA 1JR4A 3LSTA 2IIPA 3BZBA 3TKYA 1TW2A 3OFKA 4MQ4A 3O7WA 3UWPA 3A7EA 1I4WA 2R3SA 2PKWA 3A25A 3HNRA 4BLUA 2QE6A 4BP1A 5KQSA 3FPJA 2AOXA 2GB4A 3P2EA 4XCXA 1P39A 1SKMA 2B78A 3BWCA 2YVLA 4JXJA 4MWZA 4OA8A 1QZZA 4PYNA 5CIYA 5EEHA 2CKDA 3B7PA 3KPJA 5GINE 3KPYA 3TR6A 4CTJA 3BWMA 4RTRA 4R05A 4ZTBA 1UFKA 2PGXA 3R24A 5E1MA 8MHTA 4CKBA 3G89A 1Q0TA 3KQPA 4DA4A 3BKWA 3OU2A 1NV8A 5EIFA 3GRVA 3T7RA 3GU3A 4DCMA 1TW3A 2ZBPA 3UJ8A 2PV0A 3MHTA 2YR0A 3DULA 3E7PA 3KPUA 5E2AA 4YUYA 4RTQA 5M5BA 2BR5A 4PYOA 1X19A 5E9QA 3RODA 2ZLBA 2GAFA 1VP3A 5F2OA 3UJCA 4Y30A 4P7KA 2IH2A 2AOWA 2EJUA 2IP2A 1JTFA 2JG3A 2AN5A 2BR4A 3BXOA 5FHQA 5B1SA 1YF3A 3VC1A 3P9NA 4KVZA 4OA5A 1Y8CA 4K6MA 2O57A 3JWHA 4HGYA 2FRXA 3OZSA 2ZSUA 4ER0A 2I62A 3HCAA 3IHTA 4A6DA 5HFJA 2PX8A 4X63A 2Q41A 2CMHA 2PX2A 2O07A 4GOOD 5HZMA 3EVGA 3LKDA 2Y1WA 4PGHA 4GEKA 1NW7A 2ZIEA 4CKEA 3EVZA 5DXAA 1YFLA 5CVJA 3RW9A 3TRKA 4C4AA 3I53A 2P8JA 1IY9A 4PYIA 3VC2A 1WG8A 3PTAA 4GQBA 1D2GA 1NBIA 4ATNA 3PT9A 2AOVA 2UYOA 3ELUA 3LCVB 4QTTB 2NXJA 3KR0A 1KYWA 3OPNA 1KPGA 3P9IA 1TPYA 1JQDA 1NW5A 4MTLA 1JG2A 2OO3A 4POOA 2EG5A 1B42A 4X41A 5LSAA 3ELYA 3NJRA 4RTMA 5EHIA 1L3BA 4HTFB 4M7RA 5T67A 2HWKA 2P7HA 1IXKA 2PWYA 2ZBQA 3E23A 4FR0A 1MHTA 1N2XA 3I64A 5T64A 1JTEA 1R8XA 3DXZA 3GRUA 5K05A 3BT7A 2QY6A 1WXXA 5LQNA 1VL5A 4P58A 4HRAA 1RI2A 2PVCA 3BGVA 3GIWA 3ME5A 4GBED 4M36A 5FULA 5GIPE 1ZGJA 1XTPA 3DXYA 3ID6C 4OX9Y 1G8SA 4PYMA 1H1DA 2O0LA 3NWBA 2CWWA 2QRVB 3DUWA 5DPMA 5EGSA 1F3LA 3TQSA 2VDVE 5EQJB 1KP9A 2XBMA 2OPBA 4OQEA 3SM3A 1RI3A 4PYKA 4YMGA 4YV2A 2AOTB 3DMFA 3I58A 2V7EA 3E05A 5EMMA 4BLVA 4CTKA 1EJ6A 2GLUA 5EHGA 3EGEA 5DM0A 2G72A 1X1BA 3FRHA 2ZZMA 4ER5A 5LQAA 2NNWB 1BC5A 2ZW9A 5DX8A 3AY0A 2P3QA 3FPFA 5EPEA 3ELWA 3GCZA 2ONYA 2FHPA 4QDKA 5DM1A 3EVEA 2Z6AA 1VIDA 3DLCA 5K8VA 1P1BA 5JR3A 3M70A 2PT9A 3HVIA 3EVAA 2AS0A 2LD4A 4YV0A 3SGLA 2PY6A 3I5UA 5LQJA 4E30A 2UYQA 1ZG3A 5FWAA 3X0DA 3H2BA 4PINA 1X1CA 1R00A 1JG3A 2P1DA 3BGDA 3FTCA 5IH3A 1Q0SA 3OZTA 4GOMD 1RJDA 3IV6A 4R6XA 3E8SA 3GXOA 3PFHA 4HC4A 3BWYA 3U81A 5ICCA 5K09A 3OE5A 4AX8A 3DP7A 3PB3A 3KR2A 4YUXA 2OKCA 3R0QA 3DH0A 4PCLA 2PX4A 2OBFA 2ZCJA 2NXCA 2C7PA 1VP9A 4E2WA 1ORHA 4PYLA 3THRA 3ERCA 5E1OA 4RTPA 3BGIA 4OBXA 3KQSA 5EEGA 3KQVA 3UJ9A 4E2ZA 2O06A 5K0GA 5CM2Z 1X1AA 4CXMA 5CVEA 1M6EX 5P8WA 1D2CA 2Y1XA 4IWNA 3HA7A 3BKXA 3JWIA 4PYQA 1L3IA 1XDSA 3SSOA 3LHDA 2B25A 5DTQA 4R8SA 2Z6QA 3PS9A 2JHCA 3SMQA 2B9EA 3TMAA 3VYWA 2ZVJA 2IH4A 1DUSA 3A27A 3DR5A 1BKYA 3R6TA 5GM2A 2BR3A 1KHHA 3KHKA 3M33A 1RJFA 3DLIA 5DM4A 4DF3A 3FPEA 5K0BA 4F86A 3EMBA 3JWJA 3HVJA 3B3FA 4QPPA 3KPWA 2OB1A 1O9HA 1RJGA 5ICFA 1ZQ9A 4KDCA 3RIEA 2YQZA 5GIOE 2WK1A 5EZQA 3LDGA 3LX6A 1KPIA 3Q87B 4EMSA 1P1CA 2AR0A 3FTDA 3GJYA 4RX1A 4H0NA 5U4XA 1FJXA 3OE4A 2VZ9A 5ICGA 5LQCA 4HTFA 3B5IA 1L9KA 5F2KA 2JJQA 2I9KA 1EAMA 1HNNA 4EK9A 2FK8A 3NVMB 3P9KA 5HIIA 4QVKA 3FUWA 2PT6A 3SVZA 2AOUA 3LKZA 5EMKA 3FUTA 2CL5A 2P3LA 4PIPA 5HEKA 1WZNA 1R8YA 3T0IA 1EQAA 1YFJA 4O29A 2UZ4A 3TPZA 1JG4A 3FTFA 3KQWA 1XDZA 2QRVA 3PFGA 3B3JA 3KR9A 3CCFA 5EMJA 5CUQA 5DXJA 1VLMA 4GOLD 2P35A 4RTSA 4F84A 2AOTA 2XVAA 4DMGA 3KQTA 2H11A 3NWEA 3OU6A 1RI1A 4IV8A 4AZVA 2PXXA 3UBTA 1VBFA 4IV0A 3SXJA 1MJFA 4V0QA 2ONZA 4C06A 4C03A 5DSTA 3FTEA 3NTVA 1JSZA 1KXZA 1NW6A 1QAQA 2CMGA 1NE2A 3GGDA 3ANXA 3MTEA 2PLWA 3CJRA 4PONA 1UWVA 3NMUF 3HCCA 3WSTA 2ESRA 1M6YA 2ERCA 2WA2A 3EVDA 4BLWA 3K0BA 4ISCA 4KIGA 3T7SA 3BWBA 4YUWA 2PXCA 5E8JA 2C7OA 4QPNA 2FCAA 3IEIA 2KW5A 5EVJA 3AXTA 3CJTA 1NV9A 1QANA 1Z3CA 4FSXA 5DLYA 4LG1A 2GA9A 5GOZA 3CKKA 3KQQA 1T43A 3GO4A 5HIKA 2VS1A 5EOVA 3FYDA 1N7IA 3QOWA 3MERA 3CGGA 2IBTA 3VSEA 4OQDA 3OFJA 3HA5A 5K0JA 3V97A 3UJ7A 2YXDA 4U7TB 3A26A 4AZWA 2PBFA 3MB5A 2P41A 2DULA 2ZULA 2R6ZA 3EVCA 3GNLA 3O4FA 4FS8A 4RTKA 3SR4A 1ZGAA 4CKCA 1XCJA 5K0EA 4EKGA 3I9FA 2ZIGA 3LGAA 2P40A 3V8VA 2OYRA 5D1NA 4RVGA 3HTXA 3MAGA 2P7IA 2VP3A 3S68A 1JG1A 5FHRA 2G8NA 5EKXA 3P71T 5HOQA 3M6VA 2C7RA 3GRRA 3SSMA 1EJ0A 3C0KA 1QAMA 1VPTA 5DRYA 5CVVA 4RTOA 3EGVA 4YUZA 1SUIA 3KR1A 5KYGA 3K6RA 5F2NA 3TFWA 1RI4A 5FQNA 3B3GA 2BM8A 3R9XB 3GRYA 2AVDA 5BW5A 2XYRA 3NW9A 1NBHA 4DCGA 3M6UA 4EVIA 2FPOA 4E31A 1ZHFA 4DM3A 3LBYA 4BY9E 1XCLA 4KWCA 2HR1A 2IDJA 3LDUA 4RVFA 3P2KA 3OZRA 3LBFA 4FT2A 1R74A 3P97A 4V0RA 5E2BA 1SVUA 2ZTHA 5FWDA 3DMHA 2ADMA 4DZRA 2O05A 1G55A 5C9ZA 4C08A 5EZSA 1AF7A 3AJDA 2NXEA 5CCXA 3G2OA 1M0EA 3TOSA 2V74B 3FUUA 3CJQA 4LWOA 4R6WA 4E2XA 3Q7EA 4XUCA 4U7PB 4Z2YA 1G38A 5GWXA 4X61A 5GM1A 1P91A 3M6WA 1F38A 3G8AA 4E2YA 1XVAA 5LQKA 3UJ6A 5E9WA 4LECA 4X1OA 4KIFA 3GRZA 4RV9A 4DQ0A 4YV1A 4MHTA 5EKUA 5K0FA 1O54A 2XVMA 2PXAA 3G88A 4ER7A 3C6MA 5FTWA 5C1IA 2ZFUA 3EVBA 5FA5A 1FPQA 2BH2A 2PSSA 1V39A 2C7QA 5E1BA 3TKAA 5GP1A 2VDUE 4KDRA 3EPPA 3A4TA 4BP3A 3PX3A 4KW7A 5FADA 3CBGA 2G71A 1IM8A 3NVKI 3BUSA 3HP7A 4XUDA 2ORED 4DKJA 2QM3A 2K4MA 3NDJA 3EEOA 1AV6A 4HH4A 1NT2A 2ZBRA 4IKPA 5CVDA 5DX0A 4YMHA 4F85A 2YUIA 2E5WA 3FZGA 4G56A 1KYZA 3G5LA 4AZSA 3FUXA 2JH8A 2PWPA 4Y2HA 3KU1A 3MCTA 5DTMA 3UZUA 3KPVA 5FCDA 2QYOA 3HEMA 2ZIFA 4C07A 4KRGA 3LDFA 3SSNA 4B17A 4PIMA 3UFBA 3DOUA 1G8AA 2ZWVA 3LECA 4ER3A 3T7TA 1RI5A 3HCEA 4M37A 3LCCA 3LCUA 5HIJA 4PYJA 2AN4A 1SG9A 5IKMA 4LWPA 1N7JA 1YB2A 2AZTA 2YX1A 4R8RA 5D1HA 5K0LA 4GUAA 1BHJA 4GC9A 4HGZA 3O31A 5FUBA 4MIKA 1I1NA 5H02A 3UJAA 5DT2A 5EMLA 1OR8A 5LR6A 2WA1A 1FP2A 5DRTA 3P9CA 5KQRA 1EIZA 4RVDA 5DTRA 3EEYA 5E9JA 2FK7A 2FYTA 4HG2A 3F4KA 2XYQA 3UA4A 3FYCA 3UJDA 4FT4A 3LPMA 9MHTA 2ZWAA 3HVKA 4X60A 2PJDA 1SUSA 5BW4A 2VDWA 4NECA 3L8DA 3EVFA 4PGGA 1G6Q1 4XUEA 2OXTA 4CWAA 2G1PA 1KPHA 1KR5A 4QTUB 3TLJA 4RYLA 4AUKA 4E32A 2NP7A 4YUVA 1L1EA 2JHPA 2A14A 3HCDA 4FSDA 1JSXA 1UIRA 1I9GA 1QAOA 3DXXA 1DCTA 1L3CA 4PWYA 2BZGA 3MCZA 1DL5A 3HA3A 5HIMA 2B3TA 2UYCA 1WXWA 3ER8A 2EX4A 4PNEA 1SQFA 4FP9A 2UYHA 1YZ3A 3EMDA 2F8LA 3OCJA 5ICEA 3FUVA 2B2CA
chains in the Genus database with same CATH superfamily
3AINA 4IF6A 1Q21A 1PR0A 4P98A 1OVMA 3RRXA 4ZTZB 2J08A 3HLKA 4IMIB 4INJA 3RU3A 3MQ2A 3FY4A 3T3PB 4GPD1 5ALPA 3WFIA 3NP7A 2W8BB 4XX0A 2WAAA 5BYBA 4YMVA 1KJZA 5HILA 2WC1A 1C14A 1LSJA 4RVSA 1LXCA 4ZQIA 4BGDA 5A1JA 1O0SA 1KOFA 4HDMB 5EE1A 4PRYA 4ENQA 4RGVA 3H8VA 4B9AA 2OSVA 3ZDZB 1RR6A 4MRSA 2UZAA 1WUJS 1N3IA 3CEJA 1TCUA 4X1IA 4CIVA 1FE8A 4CJXA 3U4QA 3RUFA 3LTNC 2XKJE 1D2HA 3TIVA 4A91A 1GFIA 4O4JA 1PNQA 4PAQA 4OAPA 4E33A 1QQAA 3RIHA 3RAFC 4PY2A 5G02A 2YZMA 3RG8A 4R9NA 4WXHA 2IHKA 4EHHA 3RZZA 3AXSA 1Y48E 1YBFA 2RHTA 4RTLA 4G5FA 4MVJG 5KNBD 5EFZA 2BJCA 3TO5A 1KKUA 3IAHA 3WL8A 3GFRA 2GNPA 3L1IA 1ANKA 1XDGA 5AD1A 3LHSA 2GXQA 2P1ZA 4BJHB 3IHKA 1BWRA 1NN5A 3P4XA 4NDNE 5IKXA 3NIDB 3IH5A 5MGNA 4K6OA 2Q8NA 3GJ4A 3R7AA 1AIPA 1N5JA 3DKRA 1WIZA 1FTQA 5FYDA 2VNIA 1CWUA 3ESYA 3W06A 4AQDA 3UXHA 4CBVA 3QYXA 2IYUA 3N7UA 2PJZA 2PJRA 3SQXA 2WHEA 4QDTA 5BSVA 4B40A 1WULS 2TYSB 1I9CA 5HCNA 2CFCA 2GQ0A 2QLNA 2VRCD 2B20A 4NQRA 2I66A 3QELA 1SQ8A 4LMBA 1P3DA 3WAJA 5IKOA 4P1ZA 1TM7E 1EG2A 2WLTA 2PX6A 3GZNA 3R7NA 3VJLA 2R7MA 1PQWA 5IXSA 1P9LA 2ODQA 4QAQA 1SULA 3ZZNA 5FKJA 3CT4A 4M0DA 2J5RA 3O2QB 3JPWA 3TM4A 4W1RA 1TJ4A 3OMTA 1Q14A 5EG5A 4WT7A 4EY7A 4LDNA 2JBHA 2P79A 3DQZA 2A1UB 4L22A 1RBQA 5JSUA 3LT2A 2B2NA 1L7NA 2Q49A 4F04A 2QMZA 1V45E 3GDGA 2BGIA 2V0NA 2BEUA 4WD3A 1XRLA 2VWHA 3PNLA 4KZPA 1ZJWA 1C9MA 3LFUA 1K1EA 5IDYA 1NBME 3AVPA 1YZVA 2CL7X 3L1KA 1YE8A 3INTA 5FL7D 3P2EA 3VO9A 1SKMA 1YJBA 1T3HA 1RM4A 3C3EA 5HE8A 1RBZA 2RGCA 3OKAA 2B78A 2GRMA 3JYNA 2PSFA 2ZBEA 1LVHA 3D8RA 5HQTA 2I8AA 3WL6A 3RYCB 3Q3CA 2ZCUA 1ESEA 3I6BA 1ZM4A 2H8GA 4XARA 4Z2AA 5H9WA 1NV8A 5K8LA 1EGMB 4S1NA 4YI3A 1QVWA 2ZUBA 2HK6A 3S4YA 2BFEB 1Z63A 1RRPA 4DR4B 3MJTA 3N2GB 3DEIA 1LBSA 4DV7B 1OH8A 1LI7A 4K8RB 2P1RA 1CUZA 2ZVDA 1Q2XA 3G0TA 4ZKDA 2GBGA 4ITUA 4MWDA 3CZRA 4U8GA 4X6XA 1MFZA 4G5YA 4ALJA 4AX4A 1W4BA 3GP3A 3M7IA 2V6FA 3IO5A 4KIWA 4L9SA 4C1NA 3QVOA 1DXYA 1Y8CA 2D1RA 4JI6B 3PWTA 4J7AA 4UM9B 4I9UA 2FRXA 5A05A 2I62A 3ZV4A 4Q4HB 1W87A 2CLHB 2SICE 4BRSA 4ZJZA 4UHDA 4FFWA 4MVJM 3JQCA 2EP8A 3D6UA 2PNJA 2PMWB 3EVGA 3LKDA 3VBCA 9ATCA 1XZHA 3UFXB 3FWPA 2C54A 5AHOA 5CDUA 2OESA 2Q0QA 3DZKA 4BKQA 3R5SA 4L74A 3AF4A 3O9XA 2CNBA 3GA7A 2XGSA 4Q7JB 4XYMA 2UYOA 1PAUA 3DOFA 3KR0A 3B1YA 4HUQB 3RBZA 3FWNA 3H2GA 4Q15A 3CUEF 5FO0A 4ZU3A 3G2HA 1LLIA 2PRYA 4ID3A 3RU7A 1DKQA 5M04A 2PIDA 4M46A 3E23A 4MLDA 4ZOEA 5AR1A 1D2AA 2A30A 3DAYA 3GRUA 3ZKWB 3SFTA 1CNEA 4M9QA 1NVTA 1P77A 1NNI1 2H1LA 3PKJA 3VSEA 421PA 4Z51A 4YAFA 2JLZA 1FFCA 1CQJA 3GVCA 3H5VA 3PDJA 4P80A 1E5DA 2X2FA 4ZV4A 1ZEMA 4M4SA 3VTAA 4LBVA 1F3LA 2BEVA 1E7MA 1UJMA 3IJ5A 5JXHA 2JAXA 2ZAMA 2HKIA 3LWBA 1D1PA 3Q2OA 4TLBA 4MRVA 5EMMA 2Q4BA 3LVFO 4WGGA 4R5HA 5BW6B 1PNVA 2OC4A 3PE4A 4Z99A 3VHLB 4Q12A 3Q1LA 5ESDA 3MTBA 2FN8A 2MINA 5GONB 3GNSA 4TVBA 1G5HA 2BFAA 2M1XA 1DLIA 3H5RA 3HUFA 2P3QA 4UBMA 3BTUA 3GUCA 2FHPA 1W2GA 1B0AA 2P65A 4D5EA 3O3MB 4Z49A 1P1BA 3I3SR 3L0SA 1KVRA 2LTAA 2AS0A 4PU8A 3M83A 1ZFNA 2IZ6A 4A15A 5B3AA 2Z09A 4YEDA 4MK4A 2REOA 3YASA 4ND8B 2ZT5A 1M1UA 3DEKA 4HLUC 3WKCA 3Q3IA 8OHMA 3ZD7A 5IH3A 5EPOA 5JPCA 4R6XA 1XVVA 3AEXA 1KO8A 1DCKA 2WV7A 4ARZB 1NFFA 4IDCA 4Q34A 2G77B 1IG3A 5JEEA 2HK8A 4YWJA 3OX1A 4DA8A 5EUQB 4W1QA 2Z04A 3C4JA 4ZAFA 2PKQP 4XJVA 2C7PA 2X1HA 1V7CA 1UBCA 2QSUA 1RRCA 3NFYA 1UWLA 2YJ4A 4K6KA 4N18A 1EGQA 5FPPA 3AR8A 4RVCA 4IIJA 3UJ9A 3COZA 5F5XA 3RSQA 2WJHA 1ABEA 3ZGYA 3ZLTA 4FE7A 3ZGVA 2H52A 3GDFA 5J9FA 1VG8A 1MD9A 3BKXA 4F45A 3SSOA 4AIRA 3ZNQA 3CNHA 1DBVO 1OXUA 2ZI4A 3B1VA 3PU6A 2VJOA 3R6LA 1GJRA 4C78A 3WGZA 4HDSB 3A27A 1YIOA 1BKYA 3MOIA 4FCVA 3QY0A 5AUOB 1RJFA 2JGRA 2HF2A 3SZLA 5I8PA 4MS3B 1RAGA 1KFKB 2ZB7A 4F86A 4YRAA 1ZH0A 1D8TA 2FX3A 1XELA 3G5AA 3GC6A 4MVWA 4QXMA 2OWEA 2H4XA 2FWAA 3LX6A 4ZVSA 3AUAA 4ESOA 3PENA 4I4CA 3B13B 1CVIA 4Q21A 4G1BA 1T2UA 1ZRNA 3H1PA 3ZCRA 3AB8A 4EK9A 1ITZA 3AMVA 4C89A 1F6DA 3FUWA 1A9ZA 3LC1O 1KNQA 2YL2A 5H5JA 3P4UA 4CEJB 1CS0B 1HPLA 1U2GA 3KB2A 3S1LA 3S44A 3DPSA 3ZWVA 3MTQA 2B21A 2DGDA 3VJMA 4H3KB 4LKOA 1CC1S 1R0YA 2WKWA 4IUDS 1V8OA 3O83A 4LXXA 3WLEA 4FFDA 1N0UA 2B35A 4YT4A 1MNAA 2VCYA 4MVJF 3HJFA 1YB1A 1S2OA 2GN8A 2H92A 4TWBA 4D4HA 1RC0A 2BGTA 1RZRD 3JAWB 5EJIA 1CHNA 1JIVA 2Q2OA 4R9SA 2BBSA 2NZVG 5K3FB 1G7TA 1PLJA 1PT6A 2DM6A 4TS4A 4MUHA 3VZRA 2CL6X 3WLHA 5DLDA 3SJ7A 2KYRA 2P5TB 5DSZA 3QQ6A 1X7ZA 1RKVA 2QMUA 1JSZA 1N2CE 3BREA 2DBRA 1J90A 2VDRB 3NZLA 1T2EA 2ECOA 2X8JA 2E18A 4IM7A 1J07A 4DEXA 5IH7A 2OMEA 2I4NA 1PG5A 3VI3B 5CDYA 3PRJA 1A95A 2Z4SA 3JRNA 3RSHA 4DQUA 2PO7A 3FYAA 4DG9A 3DBRB 1CY4A 4JCOA 2VH1A 4N3GA 4QPNA 1FRNA 3K0CC 3HXLA 4DIMA 1TDJA 4F4HA 1KQGA 1CJMA 1HYEA 3WTCA 4IZHA 1NQWA 1I3KA 3K8ZA 2VF2A 5HJ5A 4RS4A 1AXRA 4QHTA 5LP6F 5D3QA 1A8SA 4F5DA 4UFPA 3QG1A 1E1MA 4FYVA 1NOIA 1QCDA 1TRKA 1WW8A 2BHTA 2F1IA 5SYAA 1SVWA 3WSVA 1PWXA 3IUEA 1NXSA 4RDCA 4LHEA 2PBFA 3GJ8A 5A71A 1N0HA 3N7TA 3U62A 1EDZA 1RIOA 2V7PA 4XYEA 2YFKA 3SR4A 3VAZA 4Z4IA 3IQIX 4DEYA 2CXUA 1JEAA 2TSYB 3NBQA 3ZGNA 1ZESA 3NHJA 3V8VA 3HTXA 4UBLA 5D1NA 4EA8A 1ZRHA 2F9FA 1GT6A 2DWQA 3AL2A 3G2KA 4I9FA 2G8NA 5B55A 1ZGCA 3PDCA 4GLJA 5I9SA 1QIIA 1XB2A 2ANCA 2J6BA 3FGOA 4EG3A 2OM6A 5ES3A 1CUGA 3QWGA 1DKMA 4PZAA 3RS7A 2EZUA 1WHTB 5I7UA 3J81A 1P1IA 1BGXT 1JI0A 5CDHA 5ED0A 1N0IA 4V3CA 1U8AA 2Z3ZA 1ILEA 1DBSA 2I7VA 3HKBA 2O23A 2VHVA 3QEMB 3WLSA 2QUBA 2B34A 4MUBA 3O8NA 3KSUA 1N8TA 1A3CA 3L6CA 1E7YA 2YWRA 3P2KA 3A1WA 3QQ5A 2OAP1 3OZRA 1ZPDA 4KPGA 2R25B 2AFRA 1S7CA 1EFHA 3COPA 1L7RA 1XN4A 3S7ZA 4N0DA 2HHCA 1JPJA 3VHXB 1NVKA 4MR8B 3UCXA 5C9ZA 4RKEA 1CYDA 2H3HA 2MIIA 1XTKA 3F78A 3RYTC 2NXEA 1M0EA 2G1JA 3CJQA 4DJFC 4LZWA 5GWXA 1P91A 3F4BA 3DCNA 3HU3A 4TXLA 4XQ0A 5CJPA 3UF0A 1OWLA 2GJSA 2PQMA 3BB3A 3PNBA 5C7YA 5JAOA 5JNUA 4X3PA 2R751 4JBWA 2IZ0A 2BEWA 3H5NA 5HM6A 1EAYA 4MYTA 1KGDA 2OR3A 3C3DA 5AVJA 4CODB 3QHQA 4JIGA 4LOLA 3ZLUA 1J0EA 1T9GR 4HAVA 3NHLA 5CBPA 3BFKA 2PSEA 4BV3A 3S2YA 1VZ2A 3IVRA 3T6KA 5LA6A 4C0SA 4BXOB 1JLLA 1V7ZA 1ZISA 4OYRA 5D01A 4IHJF 5CG2A 2PKXA 1U0NA 4HWOA 1VJ0A 2A33A 3A1CA 4KW7A 2NU6B 4Y2GA 4DL9A 3EIFA 1U1IA 3KT6A 3TFQA 4WH0A 3UJHA 2XUAA 3L4KA 1Q11A 4WZBE 3W7BA 1CT9A 1T8UA 1YRLA 1J8FA 2O8CB 4EUEA 3RVPA 4LGCA 2V4MA 3RTGA 5K0SA 3RDPA 2RDMA 3BCRA 2H1VA 3FZGA 4G56A 3KQUA 4PSVA 1N1MA 3QP9A 4HEA1 2UAGA 2EKBA 2FW0A 2EFCB 1GSHA 3E5MA 1EE2A 3VYRB 1U0BB 1JFRA 1L5FA 3CUKA 3HN6A 2XODA 3MRTA 4KYVA 4EKEA 1E0AA 2BHLA 4G2TA 1ACLA 3NHMA 3CRVA 4JUFA 2QRKA 2W4MA 2GKSA 4BNWA 1TUBA 4EEXA 4L73A 2IP1A 3UFBA 4ALMA 1C2YA 2NSHA 4DLYA 1N0WA 2C2MA 4QTXA 1T9BA 3RBXA 5BV2P 1V25A 1F0NA 2KPJA 3IKVA 4L57A 2FOLA 4JDPA 4FWTA 1OD6A 1UANA 1VL8A 4NAHA 5D1HA 2XRYA 2QAGC 4E6EA 5IJZA 3AC0A 3IT3A 5L7YA 2F62A 4RZ2A 5DT2A 4L0DA 3V2GA 2Q3MA 2BVNA 3AIMA 3IURA 4PRKA 3RV3A 2R7AA 2RK3A 3KE8A 3WRVA 5IUJC 1CUBA 2OSBA 2BUBA 3AYXB 3N07A 1TC2A 4ZT4A 5GAJA 5IAOA 1NP3A 2O2ZA 3KZMA 4NHOA 1KEEA 3HHPA 3UGKA 3KV1A 1SH7A 3TSYA 3Q7QA 4X60A 4IGKA 2PJDA 3R76A 4CMJA 3UGJA 2V7QA 2W2OA 3JD3A 3R7WB 1G7CA 4HLQB 3PXEA 1BSVA 1QQ5A 3CBQA 4OHKA 4QYXA 2WTEA 5CFLA 1NJ1A 4J4BA 2QUIA 3MM4A 1QFZA 1L3CA 4J1XA 2JEOA 1OXVA 4NE2A 4EECA 3KCNA 1T8PA 3EW7A 2XVZA 3EMDA 1LTQA 3HRKA 4LDQA 1KQPA 1ZUGA 2GJ8A 3R1FA 2WJGA 4P4SB 4RY8A 4E6PA 3V7UA 4ZJPA 1RHQA 3EAQA 5F12A 5FA6A 2ZXUA 3G8BA 3W90A 5AI9A 1QKKA 2GJ9A 4BU1A 2RAFA 1FBNA 4BVBA 4BZQA 5BY2A 3CPEA 1ISIA 2XW6A 1FC0A 3MWYW 4RZSA 4UUPA 3VUFA 2JGEA 3ZY4A 3R09A 5IJAA 4M1SA 5IJXA 2PJUA 3L41A 3WWOA 1HYBA 2UU9B 1SIBE 4QBKA 1WY5A 1FNDA 2VRNA 3PSHA 3SHOA 3A4LA 1Y6QA 2RE8A 3JQ9C 2QA5A 2DWPA 2IZ7A 1DBPA 1I33A 1Z6QA 3L79A 1BA2A 3EC7A 2XDAA 4O4HF 4OHZA 5A4IS 4L76A 4JVNA 3MGGA 4GBGA 2GHIA 1Q7EA 3MD9A 4GC5A 4LW8A 3ZGXA 1LJ8A 5JOQA 5L3SB 1ZRSA 3L46A 3WS7A 2WF7A 4KVGA 3QFTA 2VHQA 2OOKA 4OHWA 2BFNA 5HBRA 5LMUB 1HDOA 3L0CA 1U1DA 4D9EA 3O2SB 2QENA 3CINA 2ORVA 3KUXA 4JI0B 1OLXA 4JQSA 1O9GA 1Q0QA 1DOZA 2BSQA 5AVKA 1SAYA 5H3LA 3CLSC 3A6EA 3N59A 1K6EA 4C7MA 3AVTA 2GEBA 5AYVA 4US2R 4UVGA 2J30A 1ZJZA 2O7RA 5A5VA 2BLNA 4A03A 1JZQA 4OCZA 1F17A 1G66A 4P3PA 3H1TA 3RJTA 1Q1QA 5THQA 2JBAB 4HBGA 4MQMA 4N5MA 3TX6A 4BVGA 4A26A 2PIJA 1QTRA 2YWBA 4PLVA 5C53B 1JJIA 2XYVA 4AAYA 1JECA 1H1LB 1Q57A 4AN1A 1IN6A 1PW7A 2AE2A 3BQ9A 4DE5A 1BCSB 3QU5A 4H1UA 4KBGA 4L5CA 3ZQ6A 4BNDA 4EVRA 4ESVA 1KARA 5DCLA 2X4IA 1RWMA 2SCUB 3SI7A 1ZHHA 3AHEA 4BO0A 1IQRA 2Y1OA 4W8HA 5CJJA 4CLHA 2B1RA 2OG1A 1LW7A 5FNVB 5L3RA 3ZDFA 5C7LO 4CMEA 3EOZA 1UJ4A 2B5VA 4L0CA 4NFYA 4KQ2A 3FPAA 1OSLA 2FMIA 3B2NA 3UMBA 1UBLS 2D7JA 1SHTX 2RIRA 3M0EA 1H8HA 3T7JA 4WNIA 4DNOA 2WT9A 5MFZA 1WXEA 2GNOA 1XWFA 1M73E 1X7YB 3OD5A 1R6VA 4A8JB 3FMGA 3VPXA 2YMLA 1L6IA 4B3TB 5GZ6A 5F7ZA 1W0JD 2DPMA 3DEYX 1Y1SA 1VJCA 2Q9BA 2HQRA 2YJ3A 3SHVA 2BTQA 1IY8A 1ZJ4A 4LGYA 5DGTA 3K1AB 4NSNA 2Y8EA 3DFKA 1P19A 3OEEA 1RM5A 4J75A 1EVKA 3VSAA 3P26A 1UBSB 1IEWA 1UBTS 3FVRA 4OLAA 3DAPA 4JBLA 3MGAA 3TKYA 4PF1A 2BM0A 1PS0A 1N6HA 2GPNA 1UBNA 2P6OA 1DXQA 3T95A 3DE0X 3S40A 3O47A 3RYFB 1U9YA 3FBTA 1VSVA 4GH5A 5IULC 3LVBA 3ZJUA 1I1HA 4MWSA 2AOXA 4HZGA 3PC4A 2VP6A 1IY0A 5C34B 3PJDA 3DC7A 3TOVA 3VBEA 4WBNB 1LMB3 1NM5A 4ODIA 3WQHA 4LF4B 1E92A 3KXDA 1LWNA 1PO7A 3OKPA 1U65A 3PPVA 1O6CA 5GINE 2BGMA 2R8EA 4WKPA 1H6BA 3UXYA 4TV9B 3FKQA 2ZQYA 4ZGBA 2YIJA 2Q9AA 3JQ7B 1VJ5A 3I6MA 2W8BA 1TFUA 2GEDA 1HG1A 4JP3A 1LDNA 4OFBA 1NWHA 3G7NA 2V9ZA 4ZOCA 1S9DA 1N92A 5AK3A 1T2CA 4HDMA 4GMDA 3RM3A 4R0NA 2YHAA 3AP3A 3IQFA 4EY8A 3W77A 3VSCA 2X7XA 5E9QA 3TSZA 3Q88A 5C1PA 5EJ7A 4FNAA 1NFQA 1I0LA 1AHPA 4HGPA 2WQ6A 1G4AE 2AN5A 2RK4A 2VIIA 2ZAOA 4EMTA 4OI2A 5LWHA 1HR0B 2HIGA 1MVLA 1DKNA 2A58A 3KT3A 4GZMA 3AH8A 4YECA 3ZHTA 4MDHA 2ZSUA 2CLLB 4A6DA 4U9IS 4XPZA 2GYVA 4O0MA 2R8BA 4PZ0A 1GDHA 1EFVB 2VNKA 3ZUPA 4I4TB 4DJ5X 4GOOD 1GUBA 5J2UA 2DTXA 3EH2A 2GEJA 2BNNA 5BN5B 5LQSA 3LNCA 5LL6P 2LLVA 2QT1A 5AVOA 5B7NA 2SKCA 4FE3A 3DMRA 3ZCXA 2HPAA 2QDXA 2J4CA 4EOGA 4ICIA 5BSHA 1TZJA 4C4AA 3PPYA 3HABA 3FFTA 2BGWA 4B3FX 3IVXA 4D3SA 5A6VA 3IV9A 3B3QA 1YR1A 3P9IA 4DSZA 3O8RA 2YZ7A 4IH4A 1XNGA 3BEDA 1RYMA 2MSNA 4LNAA 4NEHB 4ZQBA 2J7PA 2XI8A 3PDUA 4JD5A 1VIVA 3L07A 3NHKA 4MKFA 1AN0A 4ZP1A 3EVTA 1PK7A 4XIFA 3OTGA 3ETJA 4MB0A 1X7XA 2AR7A 3TQFA 1YDGA 3ADBA 3B7WA 1XZEA 1BX3A 1H2BA 4IWXA 3T4EA 1UBFA 1D3AA 1R8XA 2ZRAA 1NN1A 4PXAA 4CIBA 5K05A 2M1ZA 4DKXA 1WXXA 5DHUA 5CFRA 3H9EO 3OF2A 3BGVA 5IEJA 3I45A 5EQTA 1L5GB 5A7LA 3ZEIA 4ZHQF 5GIPE 1QGUB 3ID6C 4W99A 5KDLA 5SV2A 4EPWA 4P5PA 1E79A 2ZI6A 3N0XA 2D6FA 3RASA 3E3OA 3A1DA 2A1UA 4WINA 1GFSA 2CWDA 3IQWA 5F35A 4YMGA 3VDQA 2ETVA 2QTVA 4YV2A 3DHVA 3BJZA 2DPYA 3I05A 3AR2A 2H16A 1R5NA 4S2EA 4MDFA 4K9MA 2RG1A 1WCWA 3DSRA 4ZAYA 3N05A 1XI2A 5A02A 4LBYA 1R5OA 1XK7A 3F7OA 3GJ6A 3GCZA 3RRYA 5JS7A 1NVVQ 2C0PA 4XCQA 5ELMA 4DIBA 2VZLA 3RGWS 4TLLB 2VVTA 5JAIA 2XWJI 4DV2B 4UNQA 2GERA 2LD4A 3IDFA 3SGLA 4MAMA 4NYMQ 2P75A 1RKXA 4UEWA 3D3EA 3AJ9A 2OD7A 3R5FA 1JG3A 3RK1A 1F2VA 3CR7A 1KDOA 1PGPA 3DNFA 3ADCA 4K2HA 3GXOA 2K87A 4FGWA 4IZ6A 4O6VA 2WY2D 3DB2A 3DJYA 3E7XA 3U81A 4MEJA 4EFMA 4XVUA 2YCLA 5K0TA 1OYYA 2JKVA 4GOKA 3ZHYA 2ACEA 2NNLD 3FGNA 4TPKA 3N0RA 1LH0A 5AW7A 2DUUA 3OX3A 3VJKA 3R0QA 1SBZA 5TS3A 5TSDA 1Z5WA 1QH0A 1QO7A 3KB1A 1GPKA 3KKEA 2NXCA 8ATCA 1CZUA 4E2WA 5EZ5A 4IFTA 3HC7A 2VPPA 4I1VA 3THRA 1JDVA 1J4AA 5GV7A 2VTVA 3IVMA 3NT4A 5BSGA 1WDMA 1HQYE 3ICVA 1FFHA 2GCEA 2C5FA 1W0KA 4L5BA 3OFSA 4KP7A 1U11A 4DTIA 1ZO8A 1VJDA 3AEZA 3VZQA 3NBYC 3U3KA 3B1WA 3ER6A 2LXNA 2QXYA 1JR3A 3D6HA 3ZTWA 1TLFA 2AR9A 2VWQA 2HXSA 3M33A 2XCJA 1LCCA 5A7GA 3UFXA 1L2TA 3FPLA 1WMEA 1GQSA 3LW7A 3NOQA 1MAWA 1VSTA 2YWHA 1M2WA 1N5DA 4WOPA 1Q1AA 4XIYA 3IUPA 2IUSA 4GE3A 4TXNA 4DQLA 3O91A 4EW1A 4Y9DA 3ET4A 2AXZA 4NDZA 4TSFD 3BH0A 3U3XA 4HUQA 1FQOA 1XPJA 4ZV7A 3R7DA 1ZZBA 2AFIA 4H0NA 2P27A 3SEAA 3I62A 4MQFB 3KLOA 3HS3A 3QXHA 1W34A 3D64A 2H8RA 1BQ3A 4NBUA 5G0SA 2FK8A 3NVDA 1Q16A 2PEZA 3KDPA 2DY0A 3OC0A 1WBDA 3DOHA 4NBTA 3RC1A 3ZKWA 5EMKA 2ZJZA 2IXEA 4NMHA 2YVAA 3L0IB 2F3QA 3PLNA 4WL0A 3C6ZA 4GNRA 3M81A 1U28A 3G9QA 5FWNA 4I1SA 4Y2UA 2HBYA 1J8DA 2C58A 1Q84A 3AR5A 1Z74A 1QBKC 3ZIAA 1DAKA 3B3JA 3UOWA 4BO7A 1UZUA 3CUWA 5B64A 2QPAA 2J0QA 3UO8B 2NU9B 4GOLD 4RTSA 1YB4A 3HSKA 4II3A 5E6SB 5CRIA 3GN5B 2F1JA 1E3DA 1XD8A 4A2PA 1QB2A 4H3SA 4DLBA 2OBLA 1AB6A 2I2DA 5GONA 4HAXA 1U0HC 1EA5A 2GCGA 3WNZA 5FUMA 1ZSYA 2CVHA 2HA7A 2OOSA 2QD5A 4MI1A 4OQZA 2ZBFA 5ADHA 4B1FA 4OGLA 3B9QA 2ERCA 2VQ3A 4NCNA 4KIGA 3NIGB 4KMMA 4IFIA 2YZ2A 4RAQA 3D81A 1JAXA 1YZLA 1T8SA 3K09C 2JNWA 4MWGA 4O0LA 2PO5A 4ND8A 1EZ4A 4MQ5A 4NBLA 2ZRNA 5IKPA 4AK9A 4FPXA 2M6LA 3B1JA 4Q9JA 2GM5A 3GZJA 3VJRA 3U61B 2P4SA 4H7JA 4ARZA 1TJPB 4BFUA 4PLYA 2ASEA 2CXSA 4UASA 3GGOA 3OO0A 1P7VA 1ORWA 3MPUA 3A26A 5C35A 3AFIA 4TX1A 3MS4A 1IOWA 5DISB 3TDNA 5JU6A 3H9GA 5JHHB 4LZPA 1OFGA 3NTQA 1JWLA 2QN2A 4HFNA 3WHPA 4EHIA 1FLVA 1ZN8A 1M72A 2QZ9A 3BL6A 3WLQA 4UCXA 3MOSA 1QBGA 4MVJI 1YC2A 1FTYA 5ER6A 3CPHA 2YWJA 5TGTA 3T5TA 3ZWWA 1NKSA 3VH3A 3GRRA 2I80A 1E5QA 4HDKA 4ERNA 3DT8A 1X9HA 4ZVNA 4YG7B 1K5PA 3V9AA 3Q11A 4PHHA 4BVFA 2P6NA 3SKVA 4HDSA 3DCJA 4EY5A 2XOEA 1AQLA 3ROKA 2DFDA 1XLTC 5IANA 2IIQA 2SHKA 4QASA 1JJBA 1KFCB 4MS3A 2CW5A 4BY9E 4NX2A 3C3MA 5D3KA 2WJ6A 1X7HA 1ISSA 2H2WA 3P5BA 2Q6OA 4AT1A 3I5XA 5CCEA 1TM4E 1OE0A 2IF0A 1DJNA 1P9OA 1Q17A 2F3PA 1G20A 3EOAI 3NEYA 4Y2RA 2VPQA 1XD2B 2FWRA 2HLDA 4JYAB 4B3BA 1GTG1 2V7XA 1H65A 1S1CA 2A84A 5JXGA 2D00A 2WPNA 2QG9A 4CF6A 2ZTHA 1XRPA 3IR6A 1JFTA 4B3RB 1Y9JA 4M86A 2WABA 2V74B 2GAIA 4UFNA 3QKRA 5JDIC 5ETJA 4OG2A 1GL3A 1SU7A 4UE6A 3BRQA 4V0SA 1G38A 5B12A 1Z22A 2W0MA 1OREA 1C7EA 1XVAA 4DWWA 2FPUA 3QVGB 2CF5A 4WJLA 4YUAA 1J56A 1M5TA 4J4HA 3MJSA 4KIFA 5LMNB 1DWPA 1GVHA 4B6QA 5TQJA 4MHTA 1M6HA 2P5UA 2J5XA 3LDAA 1SOAA 4GMFA 1WVMA 2FFQA 3JAWA 4JH0A 3C6MA 3TW4A 5K3FA 3S0JA 1E1QD 5I7HA 1VM6A 4FD2A 4EGJA 3IIEA 4M1WA 3O8LA 4ZPXA 3E3LA 5F23A 1AGXA 1WZEA 3WLAA 3B9PA 3TF5A 3PX3A 1PJBA 1OUMA 3IBSA 5ESXA 3UMRA 4DQXA 3EXG2 5L3ZA 1X7WB 1FRQA 2PVSA 3CISA 2R96A 3GLIE 4XQEA 1CW2B 2E87A 2PZEA 1BRMA 4UHHA 4DKJA 4WXYB 1WXFA 3UMMA 3DBRA 3IQXA 1P0CA 1FP6A 5CVDA 4KFUA 1R3DA 2IEAA 3LT5A 4FDLA 4N03A 5CFMA 1P9RA 4GQMA 1L7QA 1KJNA 1NMEA 2YUIA 4L4ZA 4EX7A 4KQJA 2GEFA 3H83A 4PLGA 4PNHA 2JH8A 1ZX1A 4OOFA 4MINA 1J09A 1RKQA 3KU1A 4CFZA 1CD5A 4CDNA 4OBBA 4EUKA 1F9EA 3JZIA 4ENWA 2PZ8A 1SXIA 4MO9A 4KRGA 1TM2A 2ZTUA 4JOBA 2MR5A 4D46A 5JC8A 5JQGA 2H63A 4YTEA 1BD4A 1GGHA 1KVUA 1NKTA 1PQ4A 4UDOA 5BO5A 3PL5A 4D99A 3ULKA 1L4EA 2PN1A 4RPCA 4KPYA 3HCPA 3KSDO 4LNUB 2XD9A 4F9FA 1KMNA 1M2JA 1F0PA 4PQGA 5EUBA 4BP9A 5JLJA 2D0PB 2YJGA 2ZSIA 3V4VB 1RJWA 4DANA 4JVLA 1XU9A 1KH3A 5AK5A 4IY1A 2FCRA 2Y27A 5EMLA 6ADHA 1EB9A 1SUWA 1WHTA 3ZE7A 3FHJA 1R27A 5IAKA 1FP2A 1QOQB 3QUCA 1E9SA 4U2CA 4BB0A 4YJ2A 2AIRA 3INNA 2F9LA 3QEMA 2FVYA 1V8PA 4IQGA 3TTYA 6CHYA 1PV1A 1W85B 2ENUA 3M49A 4JI3B 1G9XA 4IVNA 3SEFA 1IBKB 1GQQA 2BHNA 4C0HA 2AXVA 2VAPA 3L0YA 4FFOA 3MYYA 1M5UA 5AM5A 1W4CA 3N3BC 2C4VA 4GX1A 1KPHA 1EZ1A 4DN6A 3E5NA 1VI5A 2QL9A 5AOCA 3W2IA 4FN3A 3VHXA 2FUG1 1CG6A 1DC6A 3CNLA 5D5QA 4MR8A 1LW6E 1GGMA 2YNMC 2VQFB 5CH3A 4ILEA 3RRMA 4CHTA 4KE8A 1F60A 3GD5A 3PRHA 4HXYA 2Y4NA 1QFYA 3H13A 1HDIA 2HFKA 3EDMA 1BXGB 2OVBA 2PX5A 2ZDHA 5T8KA 1QGZA 4MVJE 2L82A 3QEBZ 1MV8A 2YNMA 2IX9A 1ZZ9A 1X7GA 5EI5A 1T5HX 2FVXA 1XMJA 2I9PA 2GHTA 2DBVO 3IVGA 4QQKA 3FN4A 4R4JA 4XVRA 2FA9A 5CGQB 3RI3A 4C05A 4FHZA 5FPKA 2EDCA 2UVDA 3GFBA 2J5QA 1Z5OA 4YQEA 4ZIRB 1H94A 1LX6A 4QYMA 2CXNA 2J67A 5HPYB 4G0UA 1MJNA 3HPRA 1Q7CA 1PR2A 1WPXA 1FZTA 2OY0A 2NU6A 4CM3A 4NH0A 1QHYA 4JXXA 5TPZA 4PPNA 3GARA 4ZYTA 5CJ2A 4KJXA 1U6IA 5DYNA 4KXXA 2YUTA 3OCYA 3G59A 3DLPX 1ORIA 1XU4A 2Z56A 3GGPA 3QV2A 2O8CA 3P45A 4C4ZA 1U1EA 3BXZA 3OOJA 2DHCA 3NIFB 1Q95A 2ZYHA 2C8VA 2VTKA 4KAAA 1BU5A 1VRCA 2Y1CA 2Q5CA 3EQ2A 1XXHA 4W9RA 2EZ4A 4QRHA 2SKEA 2NYUA 2RJ3A 4OUDB 2PXUA 1KAQA 1TYBE 2P0EA 2VT3A 4GMHA 4DCTA 3EZNA 4DIOA 1A7AA 3Q3HA 2KLBA 2OK7A 2H1FA 1DINA 3EMVA 2VP9A 3FCYA 1K3FA 4FZVA 4NDWA 3LUBA 1JZTA 1G3UA 1XKXA 1KY3A 3P8ZA 3PVZA 4DGSA 3G02A 3TKLA 3BWXA 3HADA 1V35A 2PXDA 2QL6A 1QB8A 5I4KA 2FX2A 1ZXLA 4HCJA 1QHHA 3RH0A 2PUAA 6REQB 3P2YA 3GH3A 1Z8DA 4GLFA 1WMSA 3SY8A 5IP5A 1YZTA 1W6UA 2A92A 1JVBA 2OHXA 3HJUA 4A9AA 2JIMA 3HU1A 6NULA 4N5HX 2CFRA 2GX6A 2VDPB 5C0OE 4YR7A 3FYHA 1JDZA 2K5UA 1TZCA 3HVHA 4NYJQ 4DGQA 1CQPA 1CS4C 3FYTA 3KYJB 4G9GA 2YQ4A 3A70A 3CURA 1DQPA 5DIZA 1NW3A 3HB1A 4PCAA 3DO6A 5FJIA 5JNLA 1P4AA 4E7PA 3KUKA 4E07A 4QYSA 3KKNA 3PX2A 5H7XA 4U9HS 1UXJA 3H11B 3PC6A 1EK2A 1AHHA 1OI2A 2GS9A 4PLTA 2H0RA 4F46A 3FCUB 1J42A 3L1UA 3WBFA 3R8XA 3R7WA 1B6SA 4KN5A 4KO4S 4OJMX 5E9AA 3FHLA 5KJEA 1OX4A 3UHFA 1INLA 3KIPA 4NHEA 1TTQB 3A9TA 4DPKA 4MUKA 3CLCA 1QNFA 621PA 2I87A 3LHFA 1JDNA 3DZJA 1I7PA 2ECPA 4QWWA 5K0NA 3LH5A 2FAXA 2Z8XA 1OMOA 1UMCB 4ZVPA 3SHQA 4NCBA 2L17A 2AH5A 2QJRA 2A4KA 2AUTA 1FMFA 3FTQA 4CQLB 1IU9A 2FRVA 3QHPA 4P4SA 3ZDDA 4QRDA 5H1YA 4FFBB 4O4JF 1EWTA 3V1YA 4YRBA 2X15A 3I3OA 1F2TB 1JKXA 5L9AA 4OA8A 3VC3A 5BNIA 4CDGA 5IVPA 3GOHA 4EA7A 4J3NA 1XQ6A 2VUHB 3C70A 4OMDA 3TPCA 4XXHA 4CTJA 5HDQA 1VI6A 2C2YA 4A3SA 1Y9QA 3E82A 2JCSA 3KOOA 1GVNB 2R7KA 3BSFA 4KXMA 3EB9A 4EATA 1KAOA 3JXBC 5JVDB 1MQSA 3TSWA 3DL4A 3GAAA 4UREA 3ER8A 4Z4EA 2DWCA 3L9WA 2RH5A 1IOVA 1U5BB 2ODBA 2M98A 3WX0A 4V0MA 1F20A 1N7GA 4ARAA 4C87A 3Q72A 3I9OA 3I04A 4E4TA 4WNYA 5L3SA 1FFAA 1EXDA 1Z88A 2BBTA 5M5BA 2ETXA 2CXHA 5AM2A 4D45A 1X19A 2G08A 4OK6A 1M1NB 5F73A 3AOGA 2P68A 2H7VA 2IYTA 1T5OA 4IGFA 4TMTA 2HIAA 2W71A 2ZUVA 3M5WA 3RUDA 3SYNA 1NLUA 4PYRA 1VYVA 3P9NA 4NMWA 3T8YA 2BD0A 2O57A 2YWGA 3OCZA 5FP0A 2REBA 4FNOA 5DBFA 3FM9A 1YBHA 1GILA 5ALTA 2EHJA 2H4WA 1PNTA 2O07A 4PQFA 3ICQB 3HO8A 2NPFA 2JBAA 5CP8A 4DCJA 2BFFB 1VKJA 2EZ8A 4ETNA 1A2KC 1NW7A 3H16A 3MJRA 3ET5A 2DFTA 3EVZA 5KTKA 3D4NA 3EHDA 3A14A 2ZUSA 1Z8FA 1DJOA 2VL7A 1Q15A 1QG6A 2N0SA 4X66B 3CEPB 4MGHA 2EKZA 5K8TA 1CFZA 2AOVA 4F2WA 3DR3A 3JWEA 2MWMA 2Z6VA 4ESEA 1UXOA 2SCUA 5JHGB 5L6LB 1NVWQ 3CWZA 4Y98A 4A8JC 5F1PA 5LSAA 2XQKA 1GZ4A 5FNVA 5BQFA 3TZ6A 4AKGA 1JBKA 2ID8A 2AWOA 4H16A 5TF0A 3FCXA 2NO9A 2XUOA 3GDWA 4D81A 3UANA 2X1MA 3VWSA 3D59A 5EIBD 3BIOA 1TJNA 1P17A 1B1AA 2K7ZA 3ITEA 4PFSA 4EHAA 1VL5A 1X7YA 4BUCA 1CQXA 1RI2A 3GCXA 4GVPA 1H2ZA 5ALWA 1JEYB 1R0BA 3D31A 2XNDD 1SC9A 2HU8A 5GJWC 4ZO9A 4YRKA 1NJSA 1H1DA 2O0LA 1X42A 2C9CA 2QTLA 3NWBA 5A5EA 3K1AA 1EWVA 2VDVE 2Y4OA 1KP9A 3A2KA 4UD2A 1J9ZA 4YLGA 2YMMA 1YJCA 3OCUA 4A7PA 3LL4A 4CTMA 3UOGA 3B36A 4CT4B 3A1NA 2WAXA 3EE6A 4HEJA 2BCJQ 9ABPA 4RA9B 1N6PA 3TCNA 2D1QA 1QMPA 2FP3A 2G72A 5AP9A 4CF5A 4AZSA 3ZDCA 3FPFA 5IS2A 3I5YA 1T9CA 2VJDA 1U5CA 4AO8A 4TQUS 1YB5A 2ZUDA 5JI2E 1G4UR 1K75A 4E11A 4WBNA 1RXEA 1OFUX 4WOCA 1X39A 3ADOA 1TVMA 3E9EA 3EGOA 4U7GA 3S2SA 4OD0A 3SF8B 1LNSA 1NVBA 1GOTA 1W5TA 1YJQA 2Q4EA 1JUDA 4R1PA 4TV9A 4XGQA 4B3MB 2CJWB 3K05A 1PDOA 2LIPA 3TSAA 4DMHA 1M8JA 2VK8A 4GOMD 3K2IA 2I0FA 4XWYA 3ZXYA 4B33A 3MAJA 4DTCA 4U2FA 4B73A 1CY0A 3FVQA 1MFQC 2C9BA 3PB3A 1P7CA 1TMYA 2QZJA 3QVXA 4TWIA 1PVDA 2BMEA 2VYNA 4PCLA 4BRWA 3OOSA 4TMZA 2VJAA 2NU7B 1DTSA 1HDZA 2B83A 2R62A 3HFSA 3PHLA 1WSWA 4JB3A 5DTJA 2F43B 4MZXA 5FL3A 2UXCB 1L8QA 3PNPA 4O2AB 1VPDA 3KV3O 2PS1A 3KQVA 2W6CX 5AW8A 3OT1B 5T4HA 1N2SA 5FFMA 4RO0A 1AA9A 1EFLA 1P4GA 3HA7A 3PXCX 4JFAA 3JWIA 4FYYA 5FTKA 5KNCH 3C4VA 3K0AB 3G2NA 1EFVA 1S89A 2Q2NA 3PS9A 4I4TA 4WY5A 1YJ5A 1C1XB 4NCXA 1JKFA 1XEXB 3LXXA 5BN5A 5CYOA 4HAWA 3OZAA 5B4TA 2BLLA 3W5CA 4OQYA 2C4NA 2V98A 3OMWA 5ADUS 1DG3A 1M8PA 2PA0A 2WNSA 5E2IA 3OCCA 3QSGA 2BGGA 1QB7A 1FS5A 2FGJA 3RC3A 2JANA 5G1PA 4KQFA 1NVFA 5TT1A 4BO5A 3JRXA 2Q4TA 1A72A 2VRWA 1XE3A 3BCUA 1T8TA 3RAGA 1C0PA 3SF0A 3E2IA 5KYXB 1CSEE 4O2LA 1U2QA 1AKEA 2J07A 3I52A 4LHXA 2F67A 1GAJA 4M1YA 4RQAA 3GN1A 1YZQA 4WZZA 3ZXUB 1M1XB 4ITRC 1E2BA 4BN0A 2XTMA 3T3GA 1US8B 2HU5A 5K8JB 1BD3A 1UKEA 5GTDA 3E48A 4N3CA 1CEQA 2HQ1A 3LZ6A 4PGAA 3OY7A 4K1LA 2AOUA 3WICA 4G6ZA 5MN6A 3CMCO 4O25A 3QFFA 1G1AA 4UVIA 1WZNA 3NHBA 4ZOBA 4DARA 3T1HB 4O4IB 4LJYA 3W8RA 2I3ZA 2GZAA 1QGUA 1JG4A 2ZSFA 3T3HA 4EHNA 3AONB 3LF1A 3ESDA 2IX3A 2Z1NA 3GHHA 5HFNA 3AIIA 3G23A 3GLHE 2O49A 3V48A 2XVAA 4J3JA 1BCRB 3D0QA 5AVYA 1P1JA 1WH6A 1P31A 4H2DA 4Y67A 4LY3A 2GBFA 3ED1A 4N8SA 4C29A 4YLYA 3COWA 5IHPA 5JSFA 1Z5VA 2FFBA 3L06A 4YRFA 4RPLA 5HOEA 3K1JA 3MTEA 1NNEA 3E9RA 3E7FA 4EI8A 1B3BA 5A3VA 3PK0A 4IIJF 3IKTA 5AJVB 1ISFA 1UBEA 1H3EA 5E8JA 4BV2A 3V4ZA 3FCSB 1AUOA 2C7OA 1DTWB 4Q2JA 2ZT7A 3GCDA 1NV9A 3T35A 1TU4A 1MAAA 1ORDA 3B20A 4IX1A 2CXXA 2LCFA 5DF1A 5KOIA 3SC2B 5A3QA 1Z5NA 3IILA 4COKA 4H35A 3VR5H 2XB8A 3MERA 1PK9A 2CE2X 1UK8A 1MZPA 3WDMA 4PLHA 2BDTA 3SICE 3DE5X 2XNJA 1GT91 1U7TA 1W48A 1UOEA 5AI6A 4JI8B 4WW0A 4BECA 4EO4A 3B8HA 1KO7A 3LBAA 1XKLA 2A9PA 4KMSA 4YDRA 3TRIA 1W36D 4K88A 3COVA 3ANSA 4YAUA 3UUWA 3D3NA 3ETEA 1RXVA 4QIHA 3AU9A 1GGNA 3UICA 1JWAB 1QYVA 4M60A 2XCLA 4MLCA 3S68A 3VNBA 2IVZA 4EJMA 2KS6A 1J2TA 2CVPA 2QP3A 5D3ZA 1U9ZA 4F1WA 3OIWA 2JIPA 1CV2A 2O50A 2FMUA 2HSJA 2BDUA 4OK3A 3RSZA 2FE4A 2XYRA 4TXHA 1D03A 2AMFA 1CEYA 3B6EA 3FPBA 3ZNPA 5KREA 4E31A 1KE1A 1XCLA 1U3WA 1JAIA 3BILA 1NR1A 3FRJA 5CTJA 1C0KA 1RQ2A 3C87A 3DTYA 2AQIA 2J7KA 1Z75A 2XRZA 2Z9BA 1ZLYA 4B3HA 1XQWA 2WRZA 5FI1B 4C4RA 4DUGA 2VYVD 1J06A 4HQ6A 4BNKA 1SVUA 2OECA 4I08A 4MQFA 2R6GA 1VA5A 5EESA 1T0IA 1TZ2A 2Z8YA 1W29A 2WE7A 5F1KA 5CCXA 2M6SA 1SZPA 3IXLA 3I39X 1TF2A 3Q7EA 4YI5A 4IZOA 3KDSE 4G85A 4G8JA 3DL2A 4QBTA 3GEPA 5DBGA 4F93B 3M9XA 1F38A 3IFSA 2RI1A 4LYAA 1ZR4A 5E9WA 3ABOB 3AVWA 2AEEA 1DX4A 1T9HA 1GUAA 1QOZA 2VP5A 3GCGA 3OSUA 1MC8A 2YS6A 3KOUA 1RAEA 5IDXA 2QUZA 1EVLA 3ITDA 5TXGA 5C4MA 2NU9A 2IA5A 4BAZA 5DT9A 3ZHQA 2OGSA 2DKOA 5FTWA 5E6SA 3GN5A 1QDLB 5KAMA 3EULA 4CGYA 5BMVB 3EPRA 1WVIA 3FMPB 3OZIA 2J33A 3A4TA 3Q3EA 4IIVA 5CFQA 5JPDA 3DLAA 3HBAA 1NDUA 3HWX1 1N6RA 4BX3A 2KEIA 3JQFA 5KTTA 3RARA 1ULUA 3VPBA 3KALA 1V3TA 2RHCA 4N6OA 1A76A 1PL6A 2PUJA 2SNIE 4KXFB 1N3BA 3T5MA 4C2UA 1V43A 3ZBPA 4DIKA 4RY9A 2HIMA 4BZWA 1K0UA 4H0CA 1XRQA 1XZCA 2ZOSA 4HH4A 3B7GA 1BDHA 1TM3E 3NYIA 5BSUA 3R5HA 2VK1A 1PRVA 4JQDA 1VE7A 4WFJA 5IMBA 3ZZUA 1GEGA 3VPHA 2CJPA 2P5YA 5DKFA 4Z1OA 3FUXA 4QTZA 3TQHA 1IN5A 3MCUA 3HJTA 3W6OA 1IBSA 1O6ZA 3WE7A 4F7WA 1AHNA 1FTGA 5KNDA 2CVFA 2FMHA 4HV4A 4Y42A 1CJUC 3HDVA 2P0AA 1W47A 3T4UA 1A7JA 1Q74A 1Z0IA 4IAOA 4P92A 5DCWA 3WNCA 5JXWA 1RYYA 2B9VA 5JROA 1ZK2A 2ZJ2A 3C3XA 3ENZA 3UQYS 1U7DA 1O94A 4FK8A 1LQUA 4D4GA 3BICA 1EBFA 4KXWA 1E18A 5I9NA 2CSUA 2PZFA 4BJ1A 4CMBA 4CM4B 2FW7A 4ETMA 1G291 1V0JA 2QMEA 5K3CA 4OI1A 2QTZA 3C45A 1THMA 3CEMA 2YX1A 4R8RA 1RCUA 3A0UA 4X4CA 3PGA1 1W9HA 4MIKA 3VXKA 3IT2A 3GJQA 5E3HA 2V7WA 3U19A 2ZAGA 4QBHA 1M66A 1POWA 3UGTA 1OR8A 1YGYA 1MO3A 3EEOA 1POXA 4B3GA 1LRJA 2QQ0A 1VIYA 1KZ9A 1RM0A 2ZTLA 3PDIB 4BAUA 3BF7A 3F6SA 1ZXXA 2FG7C 2FYTA 3MGCA 4WX2B 3MIIA 2FW6A 2DMRA 4M76B 3WMRA 1AKTA 5AVUA 3LPMA 1GTMA 1U0FA 1L1MA 2D3TA 2Y99A 2L2QA 4H31A 2OXTA 3C7CB 4ZT7A 1QO0D 3TLJA 1Q3KA 1QONA 1M2EA 3C8UA 4KL8S 1E60A 1Y9EA 1X57A 3PLRA 4Y0NA 5LA6F 3DXXA 4P5EA 1GCUA 2LCQA 2BZGA 3MCZA 3GFFA 4NCHA 2JFHA 2A5FA 4MKGA 4ZDKA 4TYPA 1OH5A 4ND7A 3VYVA 1IXRC 2CDCA 3COYA 3TLZA 4AO7A 4OXKA 1NQAO 2YY7A 4OB6A 4DY6A 2B2CA 2C95A 1M8FA 4WXMA 5KAPA 1EXVA 3QVGA 4WRRA 4C43A 4CM5A 1Z4OA 3PFFA 4AB1A 4DSAA 3JXEA 1XWRA 1XO1A 1FBTA 1FDIA 2JJ1A 2IPNA 3FGZA 3I1YA 1A8IA 5DN6D 1HOXA 2QRNA 1YZHA 4PANA 2P9TA 3LUCA 3QJYA 1VMIA 3ZVMA 4DR2B 3ETNA 3RWOA 1ONBA 4HX5A 5BN4B 2I1WA 2EJBA 4XRGA 2P2SA 3A3NA 5C1DA 2XMZA 2Q6TA 3EDRA 2KPOA 3A7DA 3V4SA 1YQTA 4FJ1A 3D6NB 2PUFA 1T25A 5LLSA 1X7WA 1MLDA 4WACA 2XV1A 1BOFA 4NVRA 2WZCA 5IUKC 4HS9A 4UHFA 5BRAA 3G9TA 1EXMA 4CETA 4I1OA 1EWKA 2A0UA 1DWOA 3K2QA 3IMGA 2XMDA 3D02A 4RIIA 2GYUA 1JEOA 4V0KA 1KWKA 1C3VA 1GFZA 4LZNA 4J1NA 3QK7A 1K5DA 1RVDA 5K3EA 4J07A 4EI2A 1W52X 3K30A 1ZA2A 3E9ZA 3F49S 1TKBA 3EBOA 3OLXA 4JV5B 3F5QA 1HETA 5ERXA 2JQEA 1TGYA 5T6BA 4BTLA 1QH1B 4NJOA 1KRXA 3NHYA 3BMNB 3ZCTA 5JAMA 2IK8A 3GT3A 1O57A 2OWDA 2WJYA 4GF5A 5CDFA 3S1SA 2VPYA 2OB2A 4TLAA 1NLYA 4I7EA 3T12A 2GH1A 3KFXA 3S6JA 3VHRA 4E70A 2P6UA 3W04A 1JWBB 1EDOA 4YREA 3X1XA 4MEAA 3ELDA 3A58B 2ODTX 1SHJA 4LNUA 2REQB 5EJMA 3INGA 3OU7A 4CCYB 2AXEA 3C1AA 4K86A 2JL1A 4FINA 4U2KA 1VE3A 4CFSA 5JSZB 1U9IA 5F51A 1I4LD 1QGAA 1XSEA 2I91A 4YDQA 3LCRA 1LF0A 1QV7A 3SX0A 2WYVA 4C7XA 4Y9TA 3ZR4B 4CHGA 1RZUA 3B53X 5CT5A 1E9AA 2DCMA 4EBBA 4ZODA 4FMDB 5J23A 3ZV6A 2UYGA 2RFLA 4IMRA 2FPMA 1D1TA 5AKJA 2GETA 1W85A 2OCXA 5D00A 1KR2A 3IODA 2D7CA 2ZWPA 5FBLB 4CM8A 3MTDA 3QTLA 3IEXA 4GMXA 4UC0A 3JYHA 3OZGA 3MHPA 3G7UA 4ONEA 3ENWA 3A32A 4YPFA 1DJPA 1QYRA 5CW2A 4JLMA 1NA5A 3ORYA 1ZITA 4RWZA 5KB3A 4IL5A 2XUIA 3JX9A 3V1KA 3FIJA 1UP4A 4K9LA 3CLRC 3B1KA 3Q8LA 1IBCA 3TQRA 2R3SA 4QELA 3N8HA 1BVRA 5IC6A 2HOQA 2H1SA 1KZ4A 4QSHA 3TMKA 4IPTA 1P5JA 4XASA 2HMVA 1BXGA 1Z4JA 3GCWA 5L45A 3OLVA 4MV4A 1F5NA 1XRJA 1RQNA 1QZZA 5CIYA 3QLVC 1HNZB 1D07A 3HJBA 3QHAA 1DSSG 4RVNA 4WXEA 1V1MB 1YONA 4QUBA 5BMOA 5DW0A 3H5IA 2QAIA 4DBZA 4ZIRA 2IYAA 1GNRA 4QNNA 1T5DX 1CLUA 4OKNA 4FC7A 3GEHA 4P53A 1MOPA 4DCMA 4DHWA 1EEXB 1TW3A 5B7PA 5D2CA 3E7PA 3P7MA 2ZIVB 5BPFA 1RWBA 2WU3A 3DMNA 4MA5A 4BKUA 1BVHA 1EK0A 1R6XA 1ZGHA 3EWNA 1YR8A 4QFCA 2ZLBA 3T15A 3E22B 2XGOA 1LSSA 4KFTA 1JJFA 4FX2A 1E64A 3WKEA 2FWPA 2JI7A 4WFKA 2GYYA 2P3SA 2X42A 4Z7QB 4TMXA 1SVLA 3FSJX 1EH5A 1MO5A 3OZSA 2ZYRA 1NRJB 2HMAA 2RMKA 4OUDA 4QUIA 4RFSB 3G0GA 4AS2A 4EL5A 1XIVA 4D25A 1V7QA 2QW1A 3T1OA 1A2BA 1MOSA 1ZAYA 1GG5A 1PEDA 5KJCA 2VJNA 2RBEA 4OB4A 3HR8A 2CT8A 4YV7A 4CEJA 4PHCA 1Z47A 2I8CA 1CYEA 4XR4A 1UDCA 1USUA 3TRKA 4X9XA 4Z4GA 1GXSB 1OTHA 3CUTA 4DQVA 5L4SA 3KSBC 2XUFA 5C1OA 4Q1EA 4DFDA 1KZHA 1BRTA 1D2GA 1KYIA 5D86A 1W44A 5G0UA 6REQA 3ELUA 3DC2A 1T9DA 5HJ7A 4G1MB 2GKGA 4MTLA 1EB8A 3PQEA 5JY1A 2QM7A 4JUDX 3ZY3A 1C9DB 1II9A 3WMGA 3ELYA 4ZZ3A 1PR4A 2D2IA 5FH9A 4OKSA 2TRSB 4RJIA 2P7HA 4JODA 2EXXA 3CLTD 1XMSA 1N2XA 1XK6A 2G6TA 3BA6A 3GEMA 3H75A 4G1EB 4R7ZA 4XB6B 1QF9A 2ZBGA 1XTUA 4GZ3A 4V2UA 1UH5A 1RTKA 2YHSA 1E2NA 3IALA 3GIWA 1YZFA 3H11A 2YBEA 1YSCA 4B7CA 2G63A 4LK2A 4P83A 2C88A 3RIXA 3TQOA 5D3MB 3U39A 5BNZA 2AEMA 4PYMA 1IFXA 3EJ6A 3S3TA 2HCSA 4JI4B 3H5TA 4FUTA 3SM3A 1A9SA 4UXJA 4FOOA 5TGDA 1VMKA 2FSPA 3L6BA 3RRNA 4RJTA 2O20A 3SFZA 5CBKA 1N34B 1I7DA 3R0JA 2O7NA 1NQUA 1PP4A 3ZDYB 5AVVA 4NPAA 4FR5A 3O1IC 1A5SB 1UDAA 4L3OA 3L4EA 3FRHA 3DL7A 1HNWB 1R1DA 3KXLA 5JWOA 3I9V1 2NYAA 3LPLA 4G4GA 1MT0A 4DR3B 3S5UA 2W6NA 2H9AA 4FFBA 5CH5A 4XOIA 5HXAA 1C5KA 1F8GA 3OUZA 3AHIA 4J0IA 1ZI8A 4CM7A 4CNBA 2LV8A 4XQ9A 3LX5A 4WADA 1E5TA 4YBAA 3RT7A 1P7YA 1L5KA 1R5BA 3TNYA 1CF9A 4XYLA 1OWOA 1MX9A 4R1UA 4RK7A 5AVRA 3E1GA 1AXGA 2PDAA 4Z0HO 1FF9A 3OUTA 4LC9A 3RANA 4D3FA 4TYQA 2A6CA 4G4SO 4FW9A 5JVDA 4KN9S 5I45A 3KJXA 2GCIA 2JAHA 1U5BA 3L1JA 1MKYA 1CZLA 3P9SA 4UXIA 4EO7A 3IR5A 1H3FA 2ZETA 3ADKA 3SIWA 5D51S 2CVQA 3ZBTA 4ZJYA 5JBNA 2WJJA 1AKUA 2JAQA 5DWVA 1KEPA 2EX1A 2W93A 3RNOA 4HAIA 1R8JA 4J6EA 1L5RA 1M1NA 2ODWA 3FAZA 3MJDA 2BUAA 1RJ9B 4L51A 3GJ3A 2WFMA 3JD0A 1FUIA 2QW8A 5CM2Z 1CLEA 4E13A 3J7AC 1K8XB 3WYCA 3O0DA 1L5MA 2D1SA 3LUHA 4I81A 4CEIB 3NBAA 3AHCA 4LI0A 4R8SA 4IG9A 1SCJA 4ZO6A 2ET6A 3ZJ4A 5KC9A 2O19A 5CHEA 1DUSA 5LJIA 4TMVA 2BFFA 3FLBA 3IOEA 3QKTA 5CLHA 2PSDA 3MIZA 5DM4A 5HF5A 1Z4MA 5FXMA 4EGFA 4B75A 1G1MA 2YJ5A 4QPPA 3TNLA 1JDBB 4U7DA 1P4JA 3D1NI 3AF0A 1ZQ9A 2IDMA 2ZS9A 5IBPA 4G37A 3TD2A 3LDGA 5KVQA 1FTSA 4Y6GB 5E38A 4KOEC 5U4XA 4EPXA 3DDUA 4QNMA 2EP5A 3NKVA 3P0IA 2JLQA 2JJQA 1F14A 1LBTA 2HGSA 3NVMB 1H4QA 3L1HA 5F9HA 1EEHA 2JGIA 3BG5A 4WE3A 5F4ZA 4CF4A 5ECYA 3RUCA 4FHFA 3DBIA 4YMIA 3VYTB 4G4IA 4QUGA 3QSYA 5TR9A 3RKSA 4DM7A 3D8HA 4M53A 1A50B 2YZGA 4H6PA 4J1SA 4ANFA 2VSFA 2GARA 2V7TA 1L7VC 2BAGA 4ZYLA 1ZVMA 1FRFS 3NTRA 1GRQA 4R68A 5DXJA 2YMQA 1TM5E 3HE3A 2V97A 3KAQA 4KKVA 3O82A 5C5CA 5F5NA 4KO8A 1HGXA 5H82A 1RYEA 1Y1KE 1FS6A 2YINC 4RA9A 4JSTA 2IXAA 2VHUA 5AKEA 3GZTB 1S2IA 1FFDA 1UJNA 2AHOA 2MTBA 3NTVA 1Z35A 2IZZA 1HDCA 2PZLA 1ECPA 3C7AA 3RFFA 2AJBA 4WCFC 5EUMA 2JCYA 1PSDA 4JBNA 2PMFA 4XI9A 4XE5A 1ULAA 4RADA 5I7RA 7GPBA 3IJRA 3AFNA 4AZ3B 2PXCA 3F6PA 4QZVA 5JYEA 4MDEA 1CJKC 3L7LA 3MK31 2SKDA 2E48A 3AXTA 5ALSA 3SF8A 4LV6A 3NH9A 3A6HA 3N3AC 1I5EA 1YOBA 2IEBA 3F7TA 2CJWA 5EWLB 5GOZA 1F06A 1QHIA 1PD1A 3QE2A 4HY3A 5HIKA 2VXYA 5FOUA 5JPIA 2XPCA 4QPJC 2YWDA 3PE6A 4FBMA 5EMNA 3BS3A 3ZI7A 4W5RA 5EVCA 2E55A 4Z3DA 1A96A 2BF4A 3G5UA 4IUCS 2NU7A 4BO9A 4F3YA 1PZHA 1IZZA 3GZDC 1L4LA 2F43A 2YVKA 2RJNA 3L8EA 4KI7A 3L7KA 5KTSA 2FX5A 1FYFA 3GT7A 3IP3A 4HD8A 1HG0A 2V54A 4RVGA 3MUEA 4X7RA 1K06A 4EYQA 3DWFA 4BCCA 2JD1A 5EP3A 3QUSA 3VZDA 3CRZA 2OD9A 5HOQA 1SCBA 5KINB 3LT0A 5D5PA 3NB0A 4OM7A 2OCKA 3OQ6A 3Q5DA 4IRMA 1E9BA 1OASA 2H07A 3FSGA 2X0NA 2JK0A 3DDSA 5DE3A 2EL7A 2IYVA 3VR0A 2H48A 1VLVA 3ESRA 1GTSA 1C1XA 1ZICA 1XEXA 3R9XB 2JARA 3ZU3A 5BW5A 3CX3A 2R8YA 4IQ0A 2A86A 1KK0A 2JAOA 4N7RA 4I9HA 2Q3EA 2UZ0A 4LF6B 2B61A 2C8KA 3IQGX 4C88A 3KJZA 5TNXA 1R50A 1NJGA 2XUPA 5KYXA 2OFFA 2CLMB 3H5LA 3O4RA 3K15A 3WV5A 1FLAA 1RDFA 2NXWA 3IB6A 4GDMA 1NATA 3O03A 5GONF 2ADMA 1US8A 2O05A 4IJWA 4ZT6A 4OUKX 5YASA 3BL5A 4IBOA 4D0GA 4MKHA 4HQ0A 1GYPA 1NVGA 1QHGA 3KKQA 4PZDA 4XUCA 3T99A 2JCVA 3KJIA 1E5XA 4Y9UA 4EL0A 1O8CA 1H9BA 4B3JA 4HAZA 2ADFA 1NYLA 2LZ0A 3C14C 3GUUA 3OJFA 4Q9AA 4TM8A 3VA7A 2CE7A 4O4IA 3DE6X 3HMKA 4B3IA 4S1WA 1P33A 1Q0PA 1GCGA 1XVIA 1XZNA 2NUTB 3H1GA 4DAEA 2W42A 1ZAKA 4UHKA 1SVNA 2IY7A 3LRTA 2WWRA 2XVMA 3K4PA 4RLHA 4KLAA 4L07A 2WUVA 3UGQA 1H9CA 1BCRA 1SCKA 2GBLC 2XITA 1E1YA 5SY9A 3T54A 3VR6D 2WM8A 1DAMA 2GLTA 1R0KA 1M2GA 1KXJA 1TYEB 4GMGA 1EGAA 4MMZB 1MO6A 3MTJA 4RUKA 4RKQA 1R0XA 4REQA 4JA2A 5TT0A 1ZZ8A 3SDSA 4B34A 4CQMB 5CG1A 2HA0A 2NSDA 2QMYA 1E0JA 1CQWA 2GGSA 3C6BA 1QX4A 2QHXA 2WPDD 4G8BA 4CKXA 1JW9B 1E77A 1FXSA 2CLCX 3FIUA 2UZ1B 2ZI5A 4KO2S 4X6LA 1ECGA 5HA5A 5I7VA 1TCCA 1DOAA 2IEYA 3CKYA 2HDNB 1DEHA 2QM3A 3H2IA 5SZIA 1DC7A 2AC4A 2K4MA 1DTWA 1HLPA 3A4VA 3QM1A 4ALNA 5A2GA 1UFQA 2VDNB 3DVQX 1IBRA 3LQRA 1T3TA 2VK2A 4C4YA 1SFRA 2DUJA 2IKQA 4KK3A 5H80A 2WG2A 3SC2A 2D2VA 4B3CA 4HAYA 5TQ2B 5GVSA 2Q3LA 3KQKA 5JY6A 5I9TA 4P0QB 3VGPA 3TFOA 2GXUA 3DG9A 1E5LA 4LJ6A 4U0JA 1O96B 1X0VA 2BBOA 1ODIA 3E5RA 4AI6A 4RK4A 1NAHA 1UBOS 3LUAA 4G5GA 3LCUA 2X8BA 2PTHA 4QU0A 2YYZA 1YKFA 1W46A 1E2QA 2V7GA 3PEUA 1FVOA 4AJOA 4G1VA 3WRYA 1GRCA 1W49A 3AESB 4HQKA 4II7A 1U7HA 1N9ZA 1OY1A 3I76A 4DNQA 4LJLA 2WMYA 1EWRA 2WYOA 4YV0A 1UMDA 4LVNA 3AI3A 3AR9A 4BHTA 3QVSA 3OX2A 5JS2A 3PGLA 2J09A 1KZYC 3C1UA 4C3UA 2CNKA 3FYCA 3MOGA 4C7BA 4G2NA 1KY4A 1DV2A 1YGPA 3SYRA 2BL4A 4UMEA 3V8NA 3TJRA 2LNMA 1WW2A 3L8DA 3QBJA 1W4ZA 2RCNA 3F46A 3GLVA 1PT9A 4UBNA 4UMVA 2VQDA 5JYBA 4YUVA 1L1EA 2EJCA 4XPIB 1UIRA 3C8ZA 1UK9A 1QAOA 4YXWD 3ZQJA 1VA4A 2JBWA 1DL5A 2P9HA 3HGTA 3HA3A 3MRXA 1WXWA 3FKSA 4NOMA 4N3AA 1GNSA 3E9CA 3RSLA 4KE9A 1RHJA 1UJ5A 3WNVA 1R88A 5KIAA 4NAVA 3WZ2A 5LU9A 3ER9A 4PR0A 2OCLA 5KYUB 2DC1A 3HDTA 1JPNA 2OV6A 3TCXB 5C7IO 3CEAA 3NJ8A 3NWOA 4H18A 2CHFA 1SG0A 2R00C 4D9GA 1V6AA 1RAAA 3ND5A 3EARA 4I50B 3D0KA 3PNYA 2R66A 2CFSA 1X6VA 1XP8A 2ZJ0A 3KEOA 3PGJA 4L6AA 5HZGA 5LKRA 3QA3E 4Y6QA 4C04A 2NT3A 4KNYA 1GUZA 1T1JA 4P84A 5BMVA 1CPYA 3CIOA 4FX5A 4N0PA 3U3MA 2R60A 3WIEA 4W6QA 2L42A 3VFDA 3D6JA 2D2FA 2P90A 5DSXA 4DIDA 2E1RA 2OO5C 2WYHA 4BVJA 4UBOA 1FDUA 1AMUA 4G0VA 4IUYA 1R18A 5K2MA 5HP4A 4JP2A 4P38A 1GY8A 5C46F 2CLEB 2VAXA 4LFAB 4NOLA 3IUQA 4DM4A 3AR3A 2AXUA 1V4VA 3QXJA 1D0IA 2AKYA 2MMCA 4LE0A 4BFTA 2P9FA 5HKKA 3REQB 1USGA 1USKA 4QT4A 4UAUA 2GXSA 2VTDA 3AVOA 3G2MA 4Q4JB 1UPCA 3MWJA 4YJ2F 4B35A 4BUZA 2ZZNA 1M6VB 2AN3A 2NWQA 2RONA 3DMGA 3F2VA 3NDIA 3OLYA 1TA4A 4P7GA 3I6QA 3M6XA 4LHVA 2OZEA 3WZLA 2PBRA 3BB4A 4DCOA 4LYFA 3LQYA 3JQEA 2C4KA 5JUWA 1JSLA 4YAEA 5FUQA 5LOVB 1P5FA 1CQZA 1BS9A 3MA0A 4XWOA 1XAIA 3I04M 4FGKA 4CM4A 2BKUA 2P4HX 1L4HA 4I8TA 4E15A 2PL9A 3EQ7A 1RWPA 5TDHA 4AZTA 2QRQA 3ESXA 1OBCA 1U4SA 2QD4A 5DLPA 5DXFA 1CR1A 4EPYA 3RD5A 3OOHA 2JH9A 2VLIA 3D4PA 3TR0A 1VCHA 3OLZA 5I4IA 2CHGA 4IDHA 3B78A 4J0CA 4U9UA 5K4AA 3P32A 1EDEA 1QUEA 2J4DA 4CF3A 4W9MC 4HHEA 4Y2SA 3GRKA 4OHBA 3UAGA 2WD7B 1OXXK 2WJPA 5A03A 3PDIA 4ED9A 1GAEO 3ROMA 3WKDA 2NZUG 2QVZX 1NNLA 2WHYA 3LLUA 3I8OA 4BGEA 3R3HA 2OVFA 5FV4A 4TZKA 1K4KA 3ZV7A 1VFNA 3O95A 5EQFA 4YDSA 4D1YA 3IA7A 3QOXA 3OE7A 3ST7A 3QV1A 1FLDA 3AR4A 1IY1A 1TFRA 3GP8A 3M3HA 1C8LA 1OXKB 3ICEA 2GPYA 5CLIA 1A88A 3QKWA 5IW8A 3SZMA 4AO6A 1S02A 4Q4CA 2DFNA 1VB3A 4FDTA 3PHGA 2PZMA 1G8HA 4F6LA 3KQLA 4JLVA 3A7EA 2P9GA 4K5QA 4QEKA 1OH6A 4JLPA 4LZZA 3TEJA 4AKSA 2GN9A 3CRMA 2R1UA 1S0UA 2NVWA 3NAZA 3SS7X 3TTXA 1WXGA 3BWCA 1XCBA 1WV1A 3IQHX 3LPAA 1QYCA 3M8KA 4C6TA 4RYDA 2XMGA 5HMLA 3BWMA 3V8EA 5BQ3A 3IOBA 3GPBA 4PFKA 3D7MA 3X2SA 4HGOA 1LB1B 1UAYA 2BW0A 1KQ3A 3A1TA 3L0OA 1CE8A 2WWXA 2RKWA 2C3OA 2XZDA 5BN4A 2ZJ4A 3PZRA 4IJ5A 4KFRA 3VR4H 1W25A 4LOKA 4NDAA 3WSWA 5JZ9A 4EG5A 2OGWA 2OM2A 3FZYA 4MIEA 3UCFA 2KWIA 5JG7A 2ZB4A 4CR6A 4NZMA 3L7JA 4BFZA 2XX3A 4G1CA 1LK5A 4R9VA 4ID9A 1SHLA 1PTKA 3L6DA 4LZOA 2ORYA 3LE8A 3NBUA 3QBVA 5IM4A 5CB4A 2UXBB 2AXNA 3BULA 4ZCTA 3BXOA 2WUSR 4NU5A 3PQCA 2RGAA 3WYAA 1CJVC 5FFNA 2KB0A 2UV8A 5I3CA 1VHJA 3VPSA 4ZMBA 3FHTA 3OPXA 1O9BA 4QUJA 4LIPD 4R84A 3UHOA 4D2IA 1E8NA 4Y7CA 1GPAA 1RNLA 2Q7XA 1QH1A 4RVOA 4EQ6B 5FOWA 4YAKA 5ITWA 4CM9A 1JQJC 1OFVA 1YKSA 1DELA 2QR3A 4NCIA 2I55A 3K6JA 3U56A 2F00A 2V5AA 2Y1GA 2O2YA 4HN4B 3TQIA 1YFLA 3M3PA 3MEQA 3DS8A 4QGAA 1J0CA 2GKOA 4MUGA 1P9NA 2AE1A 2XT6A 1XYYA 1JQLB 1ORTA 1T0UA 1V96A 2KBEA