3QOXA

Dot1l structure in complex with sah
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
328
structure length
326
Chain Sequence
LELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMENLIDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTTQPMKLNTRPSTGLLRHILQQVYNHSVTDPEKLNNYEPFSPEVYGETSFDLVAQMIDEIKMTDDDLFVDLGSGVGQVVLQVAAATNCKHHYGVEKADIPAKYAETMDREFRKWMKWYGKKHAEYTLERGDFLSEEWRERIANTSVIFVNNFAFGPEVDHQLKERFANMKEGGRIVSSKPFAPLNFRINSRNLSDIGTIMRVVELSPLKGSVSWTGKPVSYYLHTIDRTILENYFSSLKNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Chemogenetic analysis of human protein methyltransferases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Histone-lysine N-methyltransferase
total genus 102
structure length 326
sequence length 328
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2011-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08123 DOT1 Histone methylation protein DOT1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.60 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) 434 Repressor (Amino-terminal Domain) 3qoxA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3qoxA02
3AXSA 2O05A 3HCCA 1RI5A 4C06A 3TR6A 3NTVA 3UWPA 4RTKA 2PWPA 4Y2HA 1RI2A 5M5BA 4PYOA 1RJEA 2G8NA 4OBXA 4OA5A 2B9EA 2BM8A 5LQUA 5EG5A 4EQZA 3AWIA 1R6AA 5C9ZA 4IWNA 1NW8A 5ERGB 3FUXA 1AF7A 5DX1A 3UJ9A 3SSOA 2JJQA 4YUZA 3PS9A 5FHRA 3TRKA 1U2ZA 3HVKA 4PONA 3AXTA 4PNEA 3PB3A 3DXYA 4KDCA 1X1AA 3SM3A 1JR4A 2B3TA 2LD4A 2IIPA 2F8LA 2QY6A 3JWIA 4HC4A 3FTEA 3P2EA 5K0GA 3WSTA 3Q7EA 5K09A 1NV8A 3LKDA 3LSTA 3P2KA 2V7EA 4HGZA 3UJBA 3MHTA 2UYQA 3ELDA 3MB5A 4RTMA 3JWHA 3HCDA 4RV9A 4ER6A 4YV0A 3VYWA 1P91A 4ER0A 2IP2A 3FPHA 1X1CA 2DULA 5HILA 3E8SA 3H2BA 3GRUA 4PIPA 1NV9A 5E1DA 5GWXA 1BOOA 1I1NA 5DSTA 2N47A 3HA3A 5HIMA 3G8BA 3RIEA 3V8VA 2AOWA 4A6EA 5K0JA 4GOMD 2KW5A 1G38A 5GP1A 4PGGA 1M0EA 3M6XA 3KQYA 4OX9Y 3HA5A 4FS8A 4KDRA 4BY9E 4FSXA 5IH3A 2I6GA 2HTEA 2QM3A 4WVLA 1VL5A 3AJDA 3DMGA 3DTNA 5LQAA 1UIRA 2XBMA 4U7TB 2HNKA 5EQJB 4AZSA 2PX8A 2H11A 3EVAA 3BWYA 5JUWA 1F38A 5CVJA 4R8SA 4QVGA 2YXEA 3GGDA 1VP3A 3SR4A 3NVMB 3OFJA 5CCXA 2FYTA 3BGDA 4MWZA 4DKJA 2YVLA 3GIWA 2AS0A 2FPOA 3HNRA 3R3HA 5E8RA 5FULA 4DM3A 4ER7A 5DLYA 2CMHA 3SGLA 3LDGA 1N2XA 4LWOA 5EEHA 3LCVB 5ICEA 4RTOA 2FRXA 1DCTA 3KQTA 1KHHA 5KQSA 4KRGA 3BWMA 3REOA 1N7JA 5HEKA 4E32A 5K0EA 5EKXA 4M7RA 1SUSA 2PKWA 2PXCA 3A27A 5EMMA 3EGVA 5EZSA 3KKZA 1L9KA 2GLUA 1QAMA 4BLWA 2B2CA 2YUIA 5LSAA 2ORED 2CL5A 2P3OA 1RI4A 2ZBRA 1ZQ9A 2O06A 1HNNA 4CTKA 3FYDA 3T7RA 4KVZA 4E70A 5EHIA 2YR0A 3UA4A 1KIAA 3BUSA 3DLIA 5EVJA 4XUDA 2ZBQA 5D1HA 5FUBA 3A7DA 3DLCA 3M4XA 5KQRA 1FJXA 3CJQA 4C04A 2V74B 3R24A 3IHTA 4E2XA 4NECA 1QZZA 2Y1XA 1OR8A 1O9GA 4QDJA 3C3PA 2GAFA 4U7PB 1R00A 3SX0A 2AOUA 1RI3A 3KQMA 4HTFB 1VPTA 2B78A 3PVCA 1NT2A 5EHGA 4AZTA 3MCTA 3IV6A 4E30A 3JWGA 2ZCJA 5LQJA 4X41A 3LL7A 5EMJA 2EG5A 4A6DA 5G02A 5CCBA 1F3LA 2AN3A 1VP9A 4JXJA 5BXYA 3LCCA 1KXZA 4R6XA 1JG2A 3OZSA 5E9WA 5CVDA 3CVOA 2G70A 1I9GA 2K4MA 3FRHA 1R8XA 3KR0A 3KR1A 5HIIA 4DQ0A 1NE2A 3A25A 3GJYA 3A26A 5KYGA 1IXKA 2Z6AA 5DXJA 3ELYA 3SXJA 5FQNA 5JR3A 2GB4A 2PY6A 3TPZA 3KR9A 2OBFA 3U81A 3G8AA 2G71A 4M38A 1WS6A 2QE6A 1KR5A 3HVHA 1EG2A 2IPXA 1EQAA 2OO3A 3OU2A 2IFTA 4PINA 1QAOA 2FK7A 4BLUA 4C07A 3HEMA 3TKAA 4E31A 3P2IA 1SKMA 5DM4A 3CGGA 5GM1A 1JTFA 3RODA 1ORHA 2PT6A 1O9HA 1M6EX 2I7CA 2P40A 3HP7A 3P9IA 3TLJA 2G72A 5DM1A 1UFKA 4PYKA 3OZTA 4PWYA 4POOA 4P58A 3CKKA 2A14A 4RWZA 3TM4A 2CKDA 4XCXA 3KQQA 10MHA 4B17A 3LDUA 2C7OA 2PX5A 4FT4A 1JG4A 4PYJA 7MHTA 1VIDA 3EVDA 4RYLA 4V0QA 2GPYA 3UJCA 4E2YA 2ESRA 3SSMA 4AZWA 2PT9A 3G2OA 3GU3A 3UJ7A 3EEOA 5DTQA 1XJ5A 1DL5A 1Z3CA 2P7HA 3FUWA 1NBIA 9MHTA 2E5WA 1X1DA 5E9JA 3T7TA 1WY7A 3KHKA 3F4KA 5FTWA 4DCGA 3OU6A 2EFJA 5E9QA 1JG1A 3EEYA 5EIFA 4KIFA 4OQDA 1XTPA 1D2GA 4YV2A 1L3BA 1WZNA 3P9KA 5DM2A 1EIZA 5C0OE 3P9CA 4GBED 3EVFA 3ER8A 3PT9A 3NW9A 2P41A 1VBFA 3HA7A 3DMFA 4GF5A 4FGZA 1ZGJA 5EGSA 2AN4A 3V97A 2WA1A 1P1CA 3QV2A 2P7IA 4PYMA 4RVDA 2O07A 3HCBA 3FZGA 5MHTA 1ZG3A 5CUQA 5E8JA 4HRAA 4PYLA 2B25A 2ZSUA 3GRYA 2IH4A 4ZTBA 2ADMA 5EIWA 5HIKA 2P8JA 3OU7A 5ICCA 1BKYA 5IKMA 4YMGA 3SVZA 5C1IA 3CJTA 3OCJA 2Y1WA 4ER3A 3TFWA 1NW5A 1KPHA 1V39A 1IY9A 3DR5A 2H00A 5GINE 1UWVA 5EMKA 4FZVA 2WA2A 5K01A 3FPJA 3NVKI 1WXXA 2Z6QA 1AV6A 4BLVA 3EGEA 3FYCA 3O7WA 3OE4A 3KQPA 4F85A 3THRA 1EJ0A 1M6YA 3ELWA 3TM5A 3B7PA 3FUUA 2ONYA 4X61A 3VC2A 3HVJA 5CD1A 2XYVA 2XYQA 2AZTA 2C7PA 3M6VA 1JQDA 2Q41A 3LGAA 2BR4A 2OY0A 4R8RA 3GXOA 3NJRA 4YUYA 3KQOA 3B3FA 3FTDA 1YF3A 2AOTA 4DA4A 3GDHA 4PCAA 2OXTA 3M6UA 2IBSA 4CWAA 2PV0A 5DX8A 3NDJA 2UYHA 5LQRA 3B5IA 4R05A 3G88A 2AVNA 4IKPA 3GRRA 4LECA 5K03A 3KPYA 5K0BA 4FR0A 4Z2YA 5CVVA 3KPUA 4P7JA 3S68A 3IEIA 5K0FA 1FP1D 1X19A 1YFJA 2JH9A 3BT7A 3B3JA 4FSDA 3NWEA 2IH5A 3HCFA 3PFHA 1FPQA 1MJFA 1XDUA 3P8ZA 1WG8A 1HMYA 4RVHA 4HTFA 4GC5A 1YUBA 5B1SA 1VQ1A 2P35A 5EKUA 4AZVA 3HVIA 1XXLA 4MTLA 5FADA 3G2QA 2JHAA 1SUIA 3KPJA 3X0DA 4CKCA 2NXJA 3LECA 4M36A 4CKEA 4HG2A 2BM9A 4K6MA 4IV0A 4C4AA 1Y8CA 3BXOA 2PGXA 3ANXA 3QOXA 3OZRA 2AVDA 4QQKA 2AOTB 2QRVA 3C0KA 3P9NA 2ZZMA 3EVCA 4QDKA 3LBYA 2PXAA 4EKGA 5K0NA 4RTPA 1L3CA 2ZW9A 3RW9A 5HFJA 1DUSA 5BW5A 5FHQA 2WK1A 1AQJA 3EGIA 5DTRA 5CM2Z 2ZWAA 4KIGA 5FWAA 2BZGA 3T7SA 2PLWA 4HH4A 4YUWA 5LR6A 2BH2A 3MGGA 4DCMA 4L7VA 3M70A 2EJUA 2NNWB 2ZIGA 2ZIEA 3A4TA 3GWZA 3I5UA 4R6WA 1D2HA 1N7IA 2H1RA 4ATNA 4DF3A 2ONZA 4RTJA 3QOWA 3P97A 1G60A 3E23A 3KPVA 4RSRA 4CXMA 3R9XB 3KR2A 3GRVA 3UFBA 1ZKDA 1PRYA 3CJRA 2GA9A 2JHPA 3C6KA 5DSXA 1RJGA 4MQ4A 3GCZA 4CKBA 3FUTA 1XCLA 2AR0A 2NXNA 2XYRA 3BKWA 3DH0A 3JWJA 2PJDA 4P7GA 1TW2A 3MTEA 4ER5A 4AUKA 3SMQA 4V0RA 1QANA 4MHTA 4FT2A 2QRVB 5K05A 5HIJA 3G89A 3NMUF 3O31A 2IH2A 4EKIA 4PCLA 4E33A 3OE5A 5EMLA 3NWBA 1SQFA 1EJ6A 1D2CA 2DPMA 2BR3A 2PVCA 3FPFA 4CTJA 1MHTA 5GOZA 2ZVJA 3MTIA 5F2NA 2I62A 2O57A 1SVUA 3CCFA 3EVEA 3LCUA 2R3SA 4DZRA 2EJTA 4PYNA 5BW4A 2FHPA 4F86A 5DXAA 5DX0A 2OB2A 5FQOA 1P39A 3DP7A 4E2WA 3D2LA 4MIKA 4C05A 3G5LA 5FWDA 1KP9A 4PYIA 2P3QA 1I4WA 3GO4A 5E2AA 3ERCA 2VDWA 3R6TA 3DXXA 2VP3A 3DULA 3FPGA 3P71T 2ERCA 3ELUA 3CC8A 2NP6A 2QYOA 3I53A 3R0QA 3IYLW 3KU1A 5D1NA 5DRTA 5F2OA 4GUAA 4RTNA 5F2KA 2OYRA 1SQGA 4ISCA 2GH1A 3FTCA 2G1PA 5HZMA 2NXCA 1NW6A 1QAQA 2P3LA 4H0NA 1KPGA 1YFLA 3PFGA 5BP7A 2FK8A 1B42A 3FRIA 1JSXA 3K6RA 3I58A 4QTUB 2AOXA 3M33A 3ORHA 3SSNA 4BP3A 1T43A 2AOVA 4IV8A 4C03A 5EZQA 1NW3A 3K0BA 4EVIA 1RJDA 1H1DA 2AN5A 2JHCA 2YX1A 3EPPA 3DOUA 3I9FA 2ZZNA 4RTQA 2BR5A 5DM0A 4Y30A 5E2BA 3HCEA 4RX1A 1TPYA 5H02A 1L3IA 1XDSA 1YB2A 3MQ2A 5FA8A 1NKVA 3KQWA 3DUWA 1VE3A 3Q87B 3LKZA 3LDFA 1L1EA 2AOUB 1SG9A 3UJ8A 5ICGA 2O0LA 4RTRA 3GRZA 2YTZA 3E7PA 4RTSA 3FTFA 4PYQA 2HWKA 4EMSA 3UJ6A 1G6Q1 1Q0SA 2OZVA 2XVAA 4DMGA 3FPEA 2IBTA 2I9KA 2PXXA 4P7KA 5GIOE 3HCAA 1NW7A 4LWPA 1FP2A 1RJFA 5K8VA 8MHTA 2EX4A 2ZFUA 1G8SA 3BGIA 4O29A 3T0IA 5LQKA 3C6MA 3UJDA 1KPIA 2VDVE 3GNLA 2XVMA 2ZBPA 1PJZA 2CWWA 1AQIA 5CVEA 5E1MA 5FA5A 5ICFA 3TMAA 3UJAA 3UA3A 5U4XA 5DT2A 1G55A 3G2PA 1JQ3A 3LHDA 4RTLA 1ZHFA 4PGHA 3B3GA 3EVBA 5K0CA 3EVGA 3A7EA 4LG1A 5K0LA 1XDZA 1XVAA 3MAGA 4RVFA 1R8YA 4KWCA 2YQZA 2C7QA 3DXZA 1YZ3A 4XUCA 4PIMA 4EK9A 5DPMA 4X60A 4YMHA 1ZGAA 3VSEA 1G8AA 2ZTHA 5T67A 5T6BA 3KPWA 2NXEA 4C08A 4GOOD 1FBNA 2HMYB 4GOLD 4OQEA 1JSZA 3EVZA 2R6ZA 1R74A 1KYZA 4F84A 3O4FA 3THSA 3OFKA 3NDIA 3G5TA 4GQBA 5EEGA 5KVAA 4BP1A 2IDJA 3DMHA 5GM2A 4QQNA 1JTEA 2PWYA 4P7FA 3PLAE 1INLA 5DTMA 1Q0TA 1WXWA 3AY0A 3KQVA 2OB1A 1RI1A 2ZWVA 3TOSA 5KS2A 2YXDA 4GEKA 3G7UA 3BZBA 2OPBA 2PX2A 1KYWA 3BWCA 3LPMA 4GC9A 4QPNA 1NBHA 3VC1A 1EAMA 3KQSA 2UYCA 4FP9A 4G56A 2HR1A 3E05A 3CBGA 5P8WA 3I64A 3BGVA 3BWBA 3LBFA 4E2ZA 2UYOA 3EMDA 2ZZKA 4OA8A 2PBFA 1P1BA 3UBTA 3LX6A 4QVKA 5E1OA 4XUEA 5EPEA 1XCJA 2FCAA 5GIPE 1QYRA 5HOQA 5CIYA 5EC8A 4AX8A 1TW3A 3FUVA 2PX4A 3TQSA 4QPPA 2CMGA 2NP7A 1R18A 5CVUA 2JG3A 5LQCA 3ME5A 4M37A 3PTAA 2NYUA 2GS9A 2OKCA 1VLMA 1X1BA 3ID6C 4KW7A 4WXHA 2HV9A 3G2MA 4X1OA 2YXLA 3HTXA 4YV1A 3ER9A 1IM8A 2Z6UA 3MCZA 5LQNA 4YUVA 3PX2A 3HM2A 1YZHA 3PX3A 5EOVA 2JH8A 5T64A 3MERA 2P1DA 4OBWA 1BC5A 4UOEA 5FCDA 2ZLBA 1JQEA 5E1BA 2PSSA 2ZIFA 1JG3A 2C7RA 2VDUE 3B89A 3EMBA 4QTTB 4RVGA 4YUXA 1ORIA 3BKXA 3M6WA 5DWQA 4HGYA 3OPNA 2ZULA 4GOND 4HSGA 1O54A 2IDKA 2VZ9A 3C3YA 3L8DA 3TKYA 2UZ4A 5DRYA 2IGTA 3UZUA 2VS1A 4X63A 1BHJA
chains in the Genus database with same CATH superfamily
3GCWA 3FLMA 3U4GA 2O3UA 1NVEA 1I30A 1LBIA 2RE8A 2ZI7A 3T9AA 2R1TA 4S1WA 3BSWA 3X3HA 2HZBA 3HZZA 4N5LA 2R62A 5FBKA 1J8VA 1GILA 1NYQA 2FEPA 2PGJA 3F6EX 2F55A 4NBUA 3OJLA 2E4AA 5LUBA 4CUZA 4LFBB 4OHWA 5C9ZA 5LZ2A 3JZFA 5TGZA 2JAOA 5IASA 2P90A 2B36A 4U6NA 5FIUA 3RS0A 4KQCA 3SSOA 1CR6A 2IUYA 3DEAA 7AT1A 3H5RA 3VH1A 4X4EA 1Q12A 2YVAA 5JXIA 4KFUA 4B2IA 3ACDA 2DFNA 2OOSA 2JPDA 3KAJA 4L5JA 3ROKA 4L3OA 5HXAA 1PT7A 3WSTA 4NCJA 3Q0EA 4H7DA 4EIWA 3LKDA 4MVJD 3S99A 3DEFA 2JGJA 3L5KA 5TF4A 2OCYC 3COZA 3PSHA 4K9PA 4RV9A 3SQLA 5LM3A 1GZ3A 2CJPA 4UUQA 1F8FA 2A5DA 2PGOA 4ZU6X 1I7LA 2NPFA 2K7FA 3B48A 1X1CA 5TVGA 3CB4A 1FBTA 1QDEA 2BSAA 1EZ1A 2GDZA 2CROA 3H9BA 4BDTA 2AN9A 2PDAA 2WFAA 3I9MA 5HIMA 4QJBA 4B3TB 5MF6A 1CETA 1QGUA 4FGSA 3WVNA 4B2PA 8AT1A 2WTEA 4RZXA 1GADO 3KVOA 1LCDA 2BBTA 3HKEA 2DPXA 1R0SA 3Q7TA 4OXXA 2IV3A 5BRAA 3M6XA 3DAOA 3R3UA 4TQ9A 4NZNA 1SCIA 2V7UA 5CNIA 1Z5WA 4PQFA 5KU1A 4MVJA 4J1NA 5TARA 3IBTA 5HUJA 4BO1A 2P6OA 4I1VA 4L9WA 1R6VA 4FFMA 1G5IA 2FPGA 3DOCA 4V39A 3VR1A 1PT9A 1CK4A 3RG2A 3A8TA 1V9CA 1VP3A 5CW1A 4QU0A 4B09A 2RKOA 2FMFA 3AERB 4UMEA 2GHQA 1X7ZA 1W4RA 3ZW7A 5J58A 4QRDA 2FPOA 2VLBA 3QFSA 4BFWA 1VJ5A 3UKOA 4D9CA 2VQ3A 2RAPA 4URHA 3WIOA 2OK8A 2EATA 3DQQA 4BCCA 4B0OA 1IBLB 3PXEA 3Q6NA 3BB3A 5ICEA 2OCGA 4G1EB 1KZYC 2VDJA 4HVTA 2RGCA 2GTIA 2Q50A 2HDNB 1G8KA 4R16A 4LBYA 5K0EA 2AWNA 1AY0A 3V6LA 3IQFA 2PKWA 2IF0A 4C5BA 2XYHA 3AVUA 1QVAA 2CL5A 2INGX 5DHTA 4DLVA 1ZQ9A 4F9TA 1HNNA 1XYGA 1H2EA 2O2GA 1NLZA 3O6VA 1R6BX 3QK7A 1RYHA 4IINA 4XIIA 2DHCA 3D8SA 3ROQA 1OT5A 1GEEA 1WKBA 4KSCA 4RL4A 3HSKA 2LVBA 3PITA 2CMFA 4JSTA 2KM1A 4S3MA 3RBZA 3V4SA 3WV5A 4B4DA 4LYFA 1XRJA 4OLJA 1EDZA 1ND5A 1Y3BE 2MYTA 3ANYB 1CBUA 1Q1BA 1VCHA 4MXDA 4JJ6A 1QG2A 1QQBA 1QGUB 4AD8A 1VPTA 4HWRA 4Q9HA 4M2LA 5EHGA 4BEBA 4ETIA 3BMNA 3PFBA 3R8XA 2J85A 2JIOA 1DV1A 3LX5A 1C4KA 3OBBA 4O1MA 3S70A 4A6DA 4AY4A 1V8BA 4QU9A 3NEPX 2QQFA 2GPAA 2AK3A 4RABA 5IJZA 3MD9A 3ZTTA 4N48A 3TTTA 1GNVA 1XZFA 1NMYA 4JI3B 1KERA 2ATIA 1N6HA 4YAIA 2BHRA 1DFGA 5I45A 4IXMA 5HF6A 4AI6A 2ECPA 3UUGA 4HB3A 4E5NA 2F43A 2HDWA 3ZWOA 5FB3A 3UMFA 2EBWA 2WU3A 4BS9A 3MGKA 3HXQA 3UO8B 3LXMA 4MV1A 1FU8A 2HO4A 4EHFA 5J3JA 4JIGA 1K6JA 4REMA 4GGPA 4LKOA 3UY4A 1FLVA 2DUNA 4Q9NA 5G0UA 2PXFA 2QLTA 2FWNA 4K0KB 4MW1A 1BCRB 2Y2UA 3TL2A 4BGVA 1VPEA 5GM1A 5BNTA 1T0IA 5DBFA 1PGNA 4WSOA 2QSYA 3T3DA 2WM3A 3IXLA 2Q7OE 2EWWA 4YFVA 1QUEA 3UOGA 2F00A 3DL4A 3CKKA 2A14A 3UVEA 5JADA 5G1NA 5L6MB 1YWGO 1ZM9A 1DUVG 4LJ9A 4OF4A 2ZTSA 2UUOA 2Y76A 2QZPA 3EVDA 3KBBA 4TVBA 1SD5A 3Q5EA 1K0FA 4DCTA 2P0YA 4Y9UA 1E3JA 1DL5A 4K46A 4NZOA 4PLFA 4AIIA 1AK9A 4GSLA 2IOHA 4Q1FA 3L4BC 4KQGA 3FXAA 4MWOA 3DJFA 2Z2XA 4TRMA 5U1PA 5AVVA 5HJ7A 3F4KA 1KRWA 4MP3A 1FDIA 1EBBA 4HLQB 4IW3B 4KE9A 4LJRA 2EFJA 1P4GA 4I14A 3QBDA 4H35A 4PVCA 3VBEA 1D2GA 4K9OA 1JHYA 3P9KA 4UE6A 3K05A 1XJWA 4QG7A 1V3UA 2X5KO 4RZUA 1M54A 1UDAA 4GYJA 3W90A 4AS2A 4KAAA 2Z1NA 4MV5A 4DAOA 5JSUA 5KUTA 1GPNA 1Z5OA 5ILOA 3HY6A 5AK0A 5HFAA 5I9NA 4X1KA 4FBLA 4B46A 2E5LB 4NZMA 3CUEF 3FZGA 2ZQYA 2RI1A 5MHTA 2X0EA 4DR5B 1YKFA 2IUSA 3ASZA 1SKYE 2QLFA 3HYNA 3N7TA 4JYAB 4KXWA 1E5QA 1L5VA 3HJCA 4F7WA 1DO0A 4PZLA 5G4KB 5TMEA 4DDHA 2VF8A 4ZI3A 1Z6TA 1TT5B 2W6OA 3RRNA 2D2VA 1WMAA 5BYAA 3GZCA 3ZE0B 1XD2B 1O7JA 3BTVA 5C1IA 4AJKA 1Q0RA 1VL0A 5D3KA 1B8NA 4MYHA 1QIHA 4XGQA 3KWMA 1EPUA 3LW8A 4F3TA 3IIIA 1LPNA 3KTFA 1TX4B 1WXXA 3H65A 2RHHA 3N8KA 4IDDA 4RHYA 4YI3A 1FNNA 4R2XA 3AZQA 1H6CA 3D6NB 3NT5A 3RS7A 3PFKA 5AM5A 3EGEA 3FYCA 3T5BA 3URMA 2P5TB 3THRA 4YJKA 1XKQA 4M9QA 1CF2O 3IOEA 1EXWA 5FUWA 3H9GA 4EVSA 1OFIA 3EPLA 2FSPA 3GCDA 2CYAA 4FD3A 5BORA 2PUBA 5B6IA 5FA6A 3DFIA 3L0CA 3QJYA 4YLEA 3OFND 4IMRA 3BAFA 4YLGA 1N6NA 2GESA 2I3BA 3CTPA 4XVCA 2BV3A 4DA4A 4NOJA 4QDOA 4EUHA 4EL0A 3B5IA 4HDNA 3H5LA 5B58T 4LWZA 4IOJA 4QJ3A 1L5QA 3AI7A 3IURA 4HEHA 2KI5A 1K6IA 1NI4A 3QWHA 4RFSB 1NJ8A 2H1SA 3LK6A 3N2KA 1SGWA 3ZWNA 1ZRNA 1C14A 4ZZ3A 1VCMA 3H8SA 1PZEA 3ESZA 4QNMA 4RH3A 4YI5A 5A3RA 3OOEA 2FMHA 1N77A 1TRHA 4LI3X 2E4UA 4HWSA 4ENPA 1VKOA 5F3RA 1SIUA 2ZI4A 4UNNA 3DDZX 3DVQX 3NM4A 2WKQA 3F9IA 1HL7A 3D02A 5AXBA 1WDLA 4URUR 5FUYA 4B32A 4CQMD 4LYEA 5DHQA 2AV6A 3L79A 5D00A 1H2BA 1ECLA 4G1MB 1EUCB 1XOIA 4OUKX 5CH3A 3LGXA 3T0FA 3V1UA 5IJWA 3K2EA 1Z0AA 2Q2NA 3IJ5A 1H2FA 3ZU6A 2OM6A 4B2LA 4E5MA 2PGXA 2YFQA 1X1SA 2EQ5A 5H9WA 1QGAA 2R6CA 3RWBA 2GT1A 3KUUA 5IC5A 1ABEA 2OG2A 5JAUA 1XA4A 3AUFA 3WYAA 3UHOA 2I1QA 2GN6A 5BN4B 1D9XA 2PLAA 2ZYAA 1OX4B 1RJ9A 3B1FA 1IUPA 3A14A 3RIHA 2B37A 4K03A 2P9QA 2W6JD 3F49S 1PBNA 1ZMTA 1DADA 1D0VA 1XZGA 4PHCA 1S2OA 4ZV9A 3MMNA 4M8IA 5SYMA 1JA0A 1NVKA 3S7ZA 3U4DA 4KRYA 3TRIA 1KZ1A 2ZXFA 2QPAA 4IF4A 4BVGA 1KF0A 4CUKA 3THYB 2REXB 2QN8A 1N7IA 2GJAA 3ZC3A 3ORRA 1N0WA 2D7DA 3W7BA 4MV7A 1U65A 4YK7A 1ISJA 2FETA 3R5TA 1U7OA 2ICTA 1CJCA 1Q0UA 3R09A 1Y80A 3BCUA 1HSOA 1K2WA 4P7GA 3HCOA 1G1MA 1ZWLA 2YMQA 1TQDA 3IKLA 3S1SA 3WDSA 4YRAA 1DUIA 2CHVA 2AN1A 3OMTA 4PO3X 2LWIA 4H1UA 1F6DA 5TGTA 4G86A 1R4MB 4WJZA 4D57A 1YOVA 2R8BA 3IUSA 3JPYA 3WWPA 3EFOB 1LBSA 1M76A 1T2CA 1YR2A 1Z7WA 2HIAA 3AW9A 3AR8A 3NRBA 1RMYA 1M34B 1E2FA 2X40A 4RCVA 5GOZA 2BJHA 3O0DA 3VR3A 3BFXA 1AQ6A 2C9MA 2CFOA 3DVAB 5CLIA 1JQKA 2GEKA 1EYZA 3TEFA 1JALA 4YCNA 1EGVB 2EFGA 3T4EA 2NTJA 2X6RA 5FQOA 4TZ0A 1GNQA 2ZRJA 1CEEA 3BE4A 5CFMA 3G5LA 1E1NA 2ZWPA 5JD3A 4YT8A 4PRYA 2HHLA 4MAMA 3AKZA 2ATVA 3VNSA 3E8XA 3A2LA 2RIPA 3BMCB 5EAIA 4N3NA 1U8YA 2ZYGA 4QEZA 3CLUC 4D9BA 3FOFC 3AF2A 2XBUA 4BRSA 2A0YA 1ADYA 2NP6A 4N47A 1K4KA 3EH2A 4DJEC 2FR0A 4TMXA 4RHUA 1AHHA 2O7SA 3EZLA 5BYBA 3VKFA 2RHLA 3MT7A 5IS2A 2R6GA 5IYZB 1KJYA 3B13B 3KFXA 3NGMA 5FP0A 4D8XA 1NATA 3UAVA 4DNPA 1K3FA 4H0NA 1UKBA 2R8EA 1AZTA 3L6RA 3QUBA 2PUWA 1KFJB 3IHLA 3LUHA 1R0XA 3ZCSA 4URWR 1N5RA 1KKMA 3SSNA 4LY0A 2WICA 1C1XB 5I8PA 4IDHA 1X1RA 1H1DA 1OFUX 2GTHA 4MR9B 4YRKA 1DBPA 4RVOA 4CMEA 3I9FA 2UVDA 4M98A 1SH7A 2XCJA 1EFPA 4TUYA 1PHRA 4KG7A 4UNPA 4RTJA 3H5OA 2HH9A 3MJVA 4BGDA 4I1YA 1S7EA 1C9EA 2R6FA 4QYTA 3L05A 4ZVLA 4DLZA 2V96A 2Q27A 5TQ0A 1FDRA 1Y1KE 3L92A 2JFGA 3GDFA 4BX9A 5HDBB 3JALA 1U5AA 3LDFA 1EUZA 1SQ5A 3QVXA 3MT8A 1R15A 3WYFA 3LOUA 4M0UA 3Q6IA 3BDVA 1ZDMA 2BUAA 1EA5A 3JYNA 4G65A 3SZGA 1PLJA 2H1FA 3U5TA 4WNYA 3TAUA 1LD3A 5CPFA 2CJWB 3JZMA 4FMCF 5LBUA 3FPEA 1Y9EA 3FOAA 3I2FA 5J9FA 4IO0A 4Y2UA 2QLMA 2ZS8A 3GRAA 4RL6A 3ROZA 4E4TA 4PRKA 4PTYA 3NC0C 3CZAA 3X1ZA 2C4KA 1C8VB 1JQ5A 4O4IF 1CZHA 3HKBB 2CE2X 2Z5VA 1QM5A 1XHEA 4O4JB 1TT7A 1CXZA 2Z3VA 2BEWA 4CM3A 2H9AA 2NYAA 3EVBA 5K0CA 1XVAA 3K9CA 4XYBA 2OCBA 5KQLA 1J0BA 1XNQB 5JO9A 2A1TS 4JJ4A 1JS1X 1ZO8A 3KNZA 3PJGA 4WOKA 3GLIA 3B5EA 1PFVA 4PX2A 3VSEA 4DZTA 3F73A 1Z73A 4B6GA 5HX7A 4BMPB 4R9RA 2BMDA 3IE1A 3NRJA 3NTOA 3ZGZA 3U4IA 1UOPA 2XUPA 2D1YA 4W1PA 4XM2A 2RBKA 3MCUA 4QQFA 5CG1A 3URKA 4LF9B 2JFBA 3VR6D 5AVZA 1YC2A 4DLPA 5J2UF 3HJRA 4U39A 1U0GA 3RKUA 1HETA 1JJAA 3ZNOA 3GEEA 4R2MA 3B3QA 1LRJA 3OM1A 4YJGB 1Z25A 2PWYA 4OKNA 5E6SA 4NS1A 3PLAE 5ICSA 1EFKA 2ZSFA 3HK2A 1G18A 3GLQA 3GT3A 1KI6A 3KUCA 2OPBA 3PC8C 2J5RA 3IEPA 3HFGA 3FHTA 3QG1A 2YOHA 3ZWQA 4F12A 4AKGA 3KQSA 2FP4B 5FKJA 1GPH1 2YNMD 3C3KA 5M7EA 2HR1A 1DAIA 4N03A 2IV1A 4YJDA 1JLLB 4AG5A 2ATEA 1YB5A 2CK3D 2HA5A 4IIHA 5E1OA 1XCJA 4Y2RA 1P44A 3CNQS 4LZLA 4N82A 1H4QA 3BE8A 1ZH6A 3KFLA 4WFKA 1AQYA 4H08A 3QUSA 1IEWA 1KO5A 1RABA 4ZALA 1MABB 5KOJB 2WHRA 2BZ0A 1IL0A 3JVVA 3ZDEA 5K8CA 2OKCA 2EBFX 5TEWA 3G2MA 4A2QA 1ZCZA 4CR8A 1QCZA 2QUAA 5LQNA 4MP6A 3V1LA 2Z3ZA 3PUZA 1FNCA 1M5RA 1WTCA 1L7DA 2YNMA 4KQ2A 2I7VA 4N6NA 2NUTA 3V00A 4AJ4A 1P17A 2R68A 3ZNNA 1V8OA 1HT3A 4J1QA 5FCDA 4FEAA 4CF6A 1P3Y1 2HCFA 4IILA 4X4HA 4QTTB 1UH5A 4L02A 2Y92A 4F92B 1BQEA 2Q5LA 3TG2A 1QVRA 4XX1A 3FFAA 3O8OA 3C3YA 3L8DA 4JY7A 2O50A 1S3SA 4X63A 3N8GA 2NGRA 2Z9BA 3AK4A 3Q41A 4NPAA 2PSFA 3V46A 5JEDA 4UBJA 1AKRA 3GCGA 4GPEA 1RI5A 2ZE6A 1K2VN 5A6SB 2VN8A 3OT1B 1BRMA 4RLHA 1I8TA 4MPTA 3FPLA 1E1CA 2X0KA 3NGLA 1ZJ4A 3R3SA 2JGIA 3WLJA 5BN5A 2YS7A 1Y8RB 5KVQA 2WQ7A 3A37A 1TAQA 4E5VA 3K70C 1V5GA 3A4MA 2F3PA 3V8EA 1CUZA 4R7ZA 1E7RA 3H11A 1KS9A 3MIZA 5AIAA 3QWFA 1F20A 1HG0A 1CULC 1OREA 1R8SA 2W2MA 3BQ9A 3CR3C 3PT5A 2DTXA 2H57A 3R9IA 3ZIAA 3ZQUA 4F11A 2O14A 1W0KD 1AGPA 4FYMA 1U5BA 1NV8A 4MGZR 4QUBA 4RHTA 1JKFA 3UJBA 4BE4A 3TG8A 5LL6P 1EGAA 3AJ9A 1PZXA 1ZUHA 3E0QA 3VPGA 2ISSD 1YS4A 3IP6A 3U17A 2MMCA 5D51S 2Q9UA 3GNQA 4V1CA 5JSHA 3SMVA 1LFDB 4XW2A 3V7NA 1CVLA 2WJJA 4MLPA 1V16A 4IX9A 1D04A 3P94A 5K4HA 2WWTA 8OHMA 5HQ3B 4TL6A 3OZXA 1ZA2A 1MA0A 3HQ4O 4G9BA 1DXYA 5B2ZA 4AUMA 1PL6A 4TKUB 2AZ4A 3LA6A 3N0XA 3FF1A 4KDRA 5F77A 5M3BA 3VVMA 4BFZA 2I6GA 3L8GA 2OQIA 1K3UB 1Q20A 2R6JA 2FWPA 2PV7A 3IUJA 3UMVA 3L7KA 4UU0A 3RYCA 4EW3A 4CU2A 4G4GA 4TV8F 3L1UA 5BWCA 3BWYA 2PCJA 1FRVA 2A0XA 2CXPA 3DE4X 3KSDO 3L7NA 2W43A 1RPAA 3PNQA 2R7AA 5JS7A 2X9GA 3DFKA 4WZBA 2V5AA 3ESRA 1H8HA 3Q3JB 1XROA 5AI0A 5ALWA 1NUUA 1WSBA 2PBLA 4PLYA 4XLLA 1LPMA 2ODEA 2OSVA 4KI0A 2XNCA 1XYYA 4B3FX 5B7PA 5C7IO 1Y6FA 3R77A 2C42A 2QR5A 3JALB 1KC1A 2Q3BA 3OJEA 3ZPXA 1TGVA 3I04M 1NFFA 4L16A 1RTKA 5J5CA 1E58A 2ZP1A 3GFGA 5K8JB 2A4MA 3GP3A 4OFBA 5DDIP 2O8BA 1DQYA 3NBQA 2G0NA 2AE2A 2YWGA 3O3MB 1EHIA 2FPSA 4E32A 4EW2A 2PM8A 5CAEA 5HM6A 4MIOA 4X3CA 4XWGA 2FEWB 3UF0A 1QAMA 3VKUA 1GG5A 1QHSA 2WJWA 4PFKA 1C30B 3H16A 3FYAA 5AT1A 1KY5A 2G9RA 5A9SB 3FYDA 5GV7A 3OZDA 1G8FA 4X3PA 5F21A 1E1RA 1ENZA 3BUSA 4K9RA 2JZCA 2HEGA 3ASUA 4OREX 1U3FA 2V6IA 3PHBE 4QFDA 4BWFB 1H66A 2X7XA 1P0PA 4PNZA 4N54A 4TLBA 2Q46A 1TECE 4HB0A 5AW1A 5JJKA 2YOGA 4EDFA 2D2EA 4D5GA 2YN0A 1A2OA 2GAFA 4E13A 4CEJB 4NOKA 4BMYA 4WBNB 2H1VA 3QEJA 4TX1A 1QNFA 1GRQA 2VAPA 3HYRA 2IEYA 3QPCA 4ND2A 3WWZA 4QAQA 2PO7A 5KDOA 1B26A 1ZD9A 4MI3A 5B2FA 4K9KA 3Q8LA 1ZN9A 3PV0A 1F3LA 4MR7B 1SU4A 3LCCA 5AKIA 4OLFA 4R6XA 1JG2A 5DF1A 1NVDA 3HZOA 1QHFA 2G70A 4DDTA 2SKDA 2HBQA 1U3VA 4JBNA 3L0ZA 4M1OA 3NYQA 3L3BA 3AF5A 3KWFA 5FLYA 4E94A 1OY1A 3G9TA 4FW8A 1Z18A 4IG9A 5JQGB 1W9HA 4MV4A 1LVUA 5FQNA 3U3DA 5FLXA 1HDZA 1F0PA 1AJEA 5T8KA 3SF8A 3ZXIA 1L7PA 1CRZA 3GFFA 2X7JA 3V1NA 4GQAA 3STXA 4TRNA 1FMFA 2OO3A 2QD3A 4BNNA 5I47A 2HY7A 3EG5A 1Q0QA 3I09A 4ZVVA 2A1UB 2CB9A 3QF4B 3HEMA 4L28A 4N7JA 1KEKA 1IM5A 4GS5A 3RV3A 3EAGA 3A6FA 1UFKA 2VDWB 1K7XB 4WLNA 3OPXA 4TSRA 4ND6A 5ITZB 4QOGA 4HS4A 2O0MA 3ZS9A 2PX5A 4KLZA 1JG4A 1VMAA 3A4VA 2FEAA 1C3OB 2QRKA 1C7RA 3HCWA 2QTZA 5DNWA 3T5DA 3ZUGA 3ZQJA 2PR2A 3AP1A 2PMKA 4BHTA 3CW2A 4CTNA 3UJ7A 2OFYA 2HU5A 3R7SA 3QBEA 2RAFA 1I14A 4GRAA 3PDWA 1RXVA 3TD6A 3KZ1E 2HAEA 2A7XA 3LKVA 3JQAD 4BV3A 4OK5A 3V4ZA 2YY7A 5I5GA 1IEQA 4K8RB 4ZO4A 1WBBA 1RWVA 3FPBA 4B80A 2WJ3A 4IEIA 3NV9A 5GZ6A 1F14A 1I10A 3UKDA 2XUIA 3FDZA 4J2HA 1LBQA 1U7DA 4D44A 2VJLA 5AUPB 2OEPA 4CLDA 1XVIA 3PF8A 5J2TF 4ZP1A 2AJCA 1KQ3A 6GPBA 2Q1YA 2R4QA 1HH4A 3BS3A 1I1QB 2OQ2A 4YCDA 5E8JA 3V6MA 9GPBA 5TR9A 1C9NA 4ARZA 3VU1A 4TKVA 2WYIA 2J3KA 5LYJA 2C4WA 5IVIA 4ZRNA 3IDAA 2VUHB 1CB7A 1J8DA 1H2AS 1QSGA 4KMMA 3GNSA 1G291 4COOA 3CLSD 2VK2A 2FDRA 2BFCB 2LV8A 2ZB2A 5M2QA 2PL5A 3FPJA 1NXPA 1OFUA 1CS0B 1UM9A 4KKVA 4GMDA 1RKVA 4WKOA 3UT5A 3HUEA 2R25B 3FHCB 2XDQA 4B6RA 3R0VA 1CJSA 3O7WA 4G0NA 4I50A 1A97A 1T5LA 3IX7A 4RLSA 2D5VA 3QLVA 3H2JA 2XBLA 4NBWA 4KLRA 4WPGA 3B1VA 4ZCPA 3UK6A 4DADA 4GSKA 1H85A 4EKYA 1E98A 1X7XB 3OWOA 1UJ6A 5LQSA 4HDOB 4NYMQ 2BFDA 2H65A 1SZPA 3KJXA 1OZHA 3GXOA 4TVOA 5KYKA 1GRRA 1YF3A 4F8JA 4ARIA 3ZDRA 1EFLA 2YBDA 1PYDA 4JBLA 3RJZA 3FJYA 5FNVB 5CP8A 4LXQA 2JANA 2NNLD 4NPCA 4PNHA 2QT9A 2VSNA 5EUBA 1FX0B 1NXQA 4LECA 4L6AA 2HQ1A 2IU4A 1WEKA 3P0FA 3RG8A 1RRCA 1ISGA 1XP5A 3ES9A 3B38A 3FYSA 3RBXA 2KLBA 2WKSA 3IEIA 4J1TC 2X8BA 5FJJA 1OH8A 1DPGA 3Q3EA 5B58C 1ZQ1A 4AZ3A 4CL0A 4I4TF 2UVPA 4UZFA 2XSZD 5AI9A 3O8DA 4FYJA 4IIJA 3R3VA 3RGGA 5H59A 2P2SA 4URZR 4A2PA 1ZGHA 1IQUA 1XRLA 1KAQA 1ZUWA 2JRLA 1S2IA 2I8CA 5BV0A 2NXJA 2Y1LA 1BEUB 2C5GA 3TW4A 5CDFE 4K6MA 5A2GA 1EFVA 3SJBA 1Y8CA 3AEKA 2EX0A 1KAMA 5EY5B 4N3GA 3GUCA 4B75A 1L4NA 3C0KA 1Q7GA 2C5FA 3KDPA 4QUHA 1AKYA 1A4RA 2PXAA 2FW0A 2RBEA 3WK9A 3ICEA 3EUEA 5A9SA 3SFTA 4RTPA 4MPRA 1YJXA 2HJ9A 3FVWA 2IDZA 4V0SA 3ILHA 1USWA 1VSTA 4NESA 5ERXA 4KIUA 2BZGA 2JW5A 3W5DA 4CLXA 1I0ZA 1NLUA 2BMJA 5K8UA 2D7CA 3QU7A 3FCSB 1MMFB 2ZB4A 4P35A 4NK5A 2JJ2D 2X8JA 4JB2A 3M70A 4W63A 5MGNA 5EWMB 1KA9H 2QMEA 4RWEA 3COSA 3J80A 3DEYX 4R6WA 1MP0A 3VUFA 1CT9A 1LW7A 3OI7A 4RIIA 4DSZA 1KI6B 2Y77A 4O4LF 1PRUA 1R4NA 2I99A 1B1CA 4J91A 3MTBA 4GICA 4OYHA 3E4CA 5EE9A 1H0KA 1ACJA 1DWPA 3E58A 4MS1A 5CJPA 5UKDA 3RV4A 3SBXA 1HG1A 1O6BA 3RVMA 3ZBQA 2I4LA 1G8JA 1TW2A 1DKLA 2X77A 4KQFA 5C81A 4F6RB 4JLMA 2R9VA 1TC1A 1QANA 1CHNA 2ADOA 2J9ZB 3U3ZA 3ZJUA 4D8WA 5KDLA 5KU7A 2HNAA 1GCGA 1QORA 1MW9X 1M7GA 1QLWA 5F12A 4A91A 3R8FA 1D2CA 2AC4A 1O96A 2YHIB 4D9GA 3FMGA 2OV1A 5HQ3A 1SVUA 1CZLA 3CCFA 4BQOA 4JI8B 3AVXA 4DZRA 2WTAA 1GHTA 1PEDA 3COYA 1C2YA 1GGEA 4QUGA 1GPKA 3TMYA 4EGJA 1I2ZA 2YWCA 1XTIA 1GZ7A 2A1UA 2YXPX 3KRTA 1RPNA 4NKRA 2CNNA 1CD5A 2QAGC 2X6TA 3ODPA 2ZCUA 1ZI8A 4EVRA 3VR0A 1C2TA 4ID3A 3NUGA 1TK9A 4M3NA 4OQZA 4XOUA 5ESRA 1PJ2A 1I4WA 2DPLA 4J07A 3EIUA 1PX2A 1JWAB 3HWSA 4QPDA 2G9NA 1YI0A 2P0EA 4U5XA 1QQTA 4PPFA 5JYBA 3IYLW 1YUMA 1NRIA 3C6QA 4MLZA 1MNAA 2A5GA 2Y1FA 2UDPA 3F6YA 3MVEA 4N49A 4NCKA 3MGCA 1JHDA 4LOAA 2V0GA 4NJMA 4OOFA 4XXHA 1G8GA 1ZAKA 2QLLA 4NR0A 4ROTA 1Q7EA 1L7XA 3FAZA 4FHGA 1NW6A 1G1AA 2V03A 4X44A 4Y7CA 3IO3A 1NJ1A 3PNKA 3NKFA 3CUTA 4NV1A 3HSSA 4OXIA 4G4SP 4QBTA 3R74A 4Z1OA 5IULC 1AKEA 5K7SA 4OQLA 5IDVA 1X38A 4U8HA 5KINB 3NWPA 4JEMA 4RZ3A 4PV7A 4KQHA 4PIVA 2PXVA 3HJNA 2CBZA 1KY4A 1DKRA 1TVKA 2AC7A 2IP1A 3AIOA 1ZVJA 3W3ZB 4F5DA 3P0JA 5IWAB 3K9HA 4RXMA 4WXRA 4C7BA 2QVCA 5FUQA 1RLJA 4W9MC 3UICA 3DQPA 3OHMA 1XZBA 4NU6A 1LDBA 1M2FA 2J4FA 2Z0MA 5INTA 2QMYA 2QM7A 5ADVA 3WXMA 4F1JA 5DHRA 3RRJA 2GI4A 2Q99A 4W9NC 4EUSA 3S2IA 2GAOA 2GJSA 2G83A 3LRPA 4ND4A 3UMCA 2WF7A 4KK3A 2A9JA 3R4VA 1T5TA 2QTHA 2EC5A 4C7JA 4NX2A 4WHMA 4MQ6A 1XELA 4YH1A 1MW8X 5B7QA 3FTFA 3K0FB 4G84A 4NAHA 4PYQA 3RFTA 4QNRA 1JU3A 2GRJA 4Q4DA 4R98A 4Z9BA 1J33A 4JI5B 3PZBA 2IEAA 1Q74A 4TKUA 3T7DA 5B1EA 2V55B 4CDMA 1DZIA 1ZU4A 2WUEA 3HB0A 1NULA 1GUDA 2WIKA 4OM8A 1KPIA 3LO8A 1E60A 2XVMA 3OT4A 3M5CA 4QSMA 1AGYA 2C8VA 3NG1A 3V1MA 1FTGA 5JQGA 4Q1BA 5U4XA 2X14A 3NYWA 4C0SA 3S81A 4PGHA 3IBYA 4QTXA 1N8SA 4W8HA 1DULA 2QF7A 3PWSA 1I2BA 1U6JA 2AG6A 2PAAA 5B1IA 7YASA 5F76A 1ZNWA 5JVDB 1VECA 3A0RB 1EB8A 4R41A 5JS2A 3NT4A 3ZE7A 1EXVA 4PU3C 1QDLB 2QJRA 1FYEA 2O7VA 4HAIA 5YASA 1USIA 3PF9A 4BE7B 3QU5A 4WESB 3C39A 1BYIA 1I24A 2PN1A 1R74A 2ICPA 3VJLA 5KNCD 5L3QA 4AMYA 2V1UA 3AGPA 4KFSA 1ODFA 2ZVPX 4BQIA 5IC4A 3D4PA 5DYTA 1P1HA 2C04A 4BO0A 3OKFA 2I3DA 4W8GA 4WUVA 3V2HA 3Q98A 4K6CA 4AJEA 3PXGA 1XMIA 3ZEAA 4A26A 4KN8A 1CDDA 2FB9A 3G7UA 1QV6A 1XFAA 1WLYA 2P2NA 3BWXA 3LPMA 3RJ9A 3DTTA 2QM0A 3GLSA 3KXLA 4D41A 1QGYA 3CBGA 2LLWA 2Q4DA 3D3JA 1AD2A 2IHJA 1M8PA 4BP8A 3CO0S 2HRRA 1PSDA 3LX6A 3AEKB 4XUEA 1EFVB 4N0DA 5B7NA 3AWDA 1JQBA 1M8JA 3G8DA 5JLAA 4LDPA 2JJ2A 4P5PA 1K0UA 3KHSA 3QYAA 4QPPA 4Q9AA 2R87A 3ZY4A 2RKWA 2QPLA 3DV0B 4OXYA 1MAAA 3ZI0A 3BERA 2A35A 3BILA 2QAGB 4BB9A 1EFCA 1SOVA 4R2JA 4Y1FA 2YXLA 1V37A 4UTOA 3VO2A 1HURA 2Z6VA 3WL5A 2MCFA 1VMIA 3ECCA 1A27A 4ZREA 3EXEB 4EEXA 4YRSA 2EL9A 4G0UA 2QSJA 1IWBB 1UP7A 3AHDA 4U7WA 4P22A 3RIXA 3D7SA 2EXXA 2XZDA 3ADDA 4L73A 4EGQA 2A8YA 3B6EA 1G20B 4OVKA 4BO9A 1LW6E 1GG8A 3U49A 1QQ7A 1SIOA 4EMBA 5C8YF 1LSOA 3DMTA 1AS3A 3QOFA 3IOBA 4LHWA 1KEEB 3LBHA 5L6LB 2HRQA 2VNHA 2D54A 2IS6A 3BICA 2CV2A 1NONA 2ZE8A 3AIKA 3FR7A 1Y6RA 1ZM4A 4QYXA 5LLSA 5C7YA 1CU1A 1C0PA 1XTSA 1KYXA 4MDYA 4XPIA 3G0TA 3MT0A 4LGYA 5JNWA 2XGOA 3QXGA 1HPLA 1JL3A 4Q15A 4N76A 3TINA 1KFBB 2O9JA 3K6SB 1TKRA 2C4TA 4A8HA 4CMAA 1YAHA 2FUKA 3A1TA 3QIVA 1W4CA 5TVKA 3QEAZ 4GX0A 4Q3KA 4WFQA 4E1AA 5CDHA 4F2WA 3QOYA 3K1JA 2ODBA 1CJBA 1JFLA 1MDBA 2HK7A 3FUXA 1NBMA 1NUPA 4LPSA 3I30X 1UK8A 2JJQA 4XX0A 1YAJA 3UJ9A 4PN3A 3ENQA 5HS6A 1P18A 4PONA 2FQYA 3AXTA 4EENA 2FWAA 1OA1A 2B8EA 2IIPA 2YWRA 2FZCA 3PUXA 3F7TA 4Y1GA 2OZLA 2OBMA 4ALMA 2VJAA 2CFRA 4DQVA 1ZJ5A 3ZGXA 1DX4A 1XP8A 1JEQB 1WNFA 3T9DA 3MB5A 4OB6A 3UKJA 2B3DA 1F06A 4TWBA 5IYZF 2BONA 1SC9A 2GEUA 2BGJA 3RQSA 3PQ8A 5E1DA 1U8ZA 5HZHA 2C5LA 4A6EA 3BVPA 4QT0A 4PBSA 1K66A 1IPFA 5DBEX 3IQIX 1K63A 3GDWA 2H1LA 5AKZA 2GJ9A 5DHAA 2BEUB 4PGGA 2FPRA 1GPUA 2W00A 4MO9A 4RGVA 2HWYA 1IPHA 5F52A 4WVLA 2JGLA 5DHPA 4F5EA 1ZI9A 2IYRA 2EOAA 1BJTA 1ST3A 2IPOA 4G67A 3G6WA 2UXCB 3Q8MA 1LQ2A 1P7CA 3SHVA 2AG1A 4S1VA 2EBYA 3EE6A 1Z2AA 1K8XB 1QG6A 4FJ2A 1MFZA 3TKLA 2WIFA 1P4RA 2YVKA 6REQA 1Y1RA 2YZ2A 4EHHA 2EBUA 1PERL 4IIJB 4HWKA 5CB8A 3GQVA 1C4XA 1EQ2A 1ITZA 2COEA 1TJ4A 2LYRA 5A3QA 3DUFB 1GV0A 1SUPA 2IYYA 4CL2A 5IAOA 1PU2A 3TGLA 3FMIA 1NXTA 1B8UA 1OT3A 3G59A 2BBOA 4FTWA 2AF4C 5EEHA 5JMWA 5LLTA 4RTOA 1VG0B 1V5IA 3KLBA 4YASA 5F9HA 1G42A 2DXIA 3FE2A 1E3SA 1FXWF 4PAQA 4EX7A 4YAGA 1W4AA 3CZRA 3DAPA 1V26A 4FW9A 3NIWA 4H60A 4M9UA 2PXCA 2BKEA 1PRVA 2RC6A 3CEHA 2HM7A 4IMIB 1WU8A 4MVJG 3QWIA 3R41A 5JMPA 4M0LA 1O6ZA 3VPAA 3OOSA 4KLAA 4TT8A 2G9UA 2PD4A 3KX2A 1BGXT 3M9XA 4WNIA 3U9TA 1P1JA 3NATA 1U0SY 4Z5XA 3FMOB 4AQ7A 1BW9B 1FJXA 3E3OA 2AI2A 1NFQA 2P6PA 2VZLA 1U8TA 2C9ZA 3U7QB 8LDHA 1FTSA 1XMOB 1MO3A 4X6LA 4ENWA 4GP9A 2OVBA 5IVHA 1M2JA 1HO3A 1H2RS 4HDRA 5CX1A 4ZOEA 5DYWA 4DPKA 4UHJA 1X2EA 1UDBA 5DH9A 1PT8A 1E6KA 1RAHA 3EOZA 4KZPA 1NC1A 1NBME 2YMLA 2BGGA 5IF3A 4UKDA 5DXFA 3I4CA 1Q14A 2RHWA 2PTHA 3JV7A 4K6KA 3TSZA 2P11A 1K9SA 4FZ3A 1PK7A 5CLLA 3T3NA 2PLFA 4BJ5A 4NK4A 2VF7A 3UXEA 3DKVA 1HT2E 1EJ2A 4GI5A 4GGOA 4Q4JA 4C4RA 3FROA 5B55A 1OBCA 2CW5A 3ZVRA 3A26A 5C2JB 1OXSC 1IXKA 2FF7A 2SCUA 3CNNA 3PHCA 4GQMA 1N2EA 2ZDQA 5H3LA 4B0PA 4EAAA 2PY6A 1A9ZA 1YZGA 2YV4A 4FNGA 4M1QA 5KO2A 1CUUA 1DMSA 3KP1A 1QLHA 2C5BA 4KQKA 4P9NA 2JI4A 2B0CA 3GHHA 1NVTA 4HY3A 1D7AA 2P9YA 3EOBI 2KEKA 3AY3A 2IFTA 4HAVA 1RM3A 2FPMA 1RRFA 3TOXA 1YRWA 5GPBA 4HVCA 3IC5A 1TEZA 3QBJA 1R0LA 4JFRA 3ZWCA 3AF1A 4XFJA 5ALPA 4BVEA 2POCA 1YR6A 3QLVC 5AR1A 3K1AB 1N4DA 1JMVA 2Y1EA 4PWYA 4QGAA 4FFLA 5TQ0B 1AK1A 4POOA 1Y7HA 3O1LA 4Z49A 10MHA 5CIQA 3LD9A 2C7OA 1TCAA 4MRMA 5JPCA 4FOSA 2EX1A 4OAPA 2LXNA 1VIDA 1R4MA 4R2KA 4V0QA 1OXKB 3QMVA 5TPZD 1NNEA 2JEOA 2WPDA 4BPRA 1VB5A 2Q1UA 5I8WA 2VUSA 2FG5A 1SU6A 4RIEA 3F4LA 5DI3A 2CHGA 3PXUA 2CHEA 5LZ5A 4YFYA 1QONA 1IK4A 2ZJ7A 3SICE 2E4XA 4OL9A 3ZI7A 5FI5A 5LZ4A 1T6YA 1RIIA 4K9MA 1E3WA 4MNTA 2ANBA 1PI3A 1WO8A 3GFBA 2AQKA 4DYDA 2V3CC 4YV2A 4DWWA 2UZAA 1EIZA 3L43A 2AJ8A 4M6WB 1AXGA 4YDHB 2LCQA 3HL4A 3T5AA 3FH0A 3A2NA 4GBGA 2O4AA 4N7BA 4G4JA 3A9YA 3NHMA 4XOIA 4YO7A 4CLHA 1CUGA 5ICMA 2GN0A 2O07A 4EPTA 3WLSA 3TCKA 5CUQA 4HRAA 4Z5CA 4YP7A 2G3YA 1YS7A 1QJCA 5JDCC 5F7XA 1MO5A 1CZUA 4CE6A 4R2WA 3TS1A 3SZ3A 2ADMA 1YZYA 1F2DA 3AEUB 1Y8ZA 1VJTA 2GZDA 3OU7A 5ICCA 2Q5OA 3UUWA 4KPFC 1P2SA 1EGHA 1KJQA 3AHJA 1LX7A 3QEBZ 4J1XA 3DYVA 4FZVA 1J00A 3HJFA 4UU8A 2JAUA 1ZW1A 2E89A 3LUCA 4EM6A 3B78A 3K0SA 4BLVA 1WZCA 3BDNA 3AR9A 3I72A 3IQXA 1LK5A 1VHLA 2NO7A 1M6YA 3TM5A 5HGJA 2Q8PA 3DPUA 3ONFA 5AOCA 4A9AA 4YYZA 1PWZA 4G5GA 4P4LA 1VIAA 4CG2A 1NVGA 2AHRA 4J16C 5I4IA 1HUQA 1N9ZA 3ZQ6A 2FN7A 1XALA 3EZNA 1X7WA 4R8RA 4XEUA 5I5EA 1EE1A 4EJSB 1YDMA 4BMCA 2GNPA 2HCTA 4II3A 3PGVA 2J32A 3PUYA 9ABPA 1Z5GA 3QVSA 1NF8A 1HE3A 3ICVA 4U7FA 3FLBA 1T1JA 4IKPA 3T15A 4OI0A 1KOJA 2JLRA 3D8UA 4ZVNA 2GSDA 3Q1LA 4GNKA 4LHSA 5LOVA 1MC1A 2RB4A 3ET4A 2HQBA 1TIBA 5K03A 5EJFA 3WFJA 2V3WA 5C34B 3AGQA 4QUJA 5AW0A 5JMOA 4KP7A 3W8NA 4CW7A 2JH9A 1X13A 1UXOA 2O2DA 3OFSA 4G5YA 1T5HX 3ZWPA 2OECA 1R1DA 1AB6A 3EW9A 5AKYA 1M2WA 1RE0A 1Z2PX 3RFCA 3LQRA 2J9RA 2X41A 4C4YA 3W3AH 5CG2A 3Q2IA 3BRQA 3IESA 2HT1A 4REQB 4AZVA 2BCGY 2C20A 4X4FA 1JIVA 1AZWA 2DR0A 3G2QA 2Y93A 4RD4A 1MBZA 1G20E 2AFIB 4M36A 4P33A 5AI5A 4BWYA 3ROGA 3BH7A 1WU7A 3I4LA 2XR1A 1GL6A 3P96A 5SY6A 5BNWA 3QOXA 3FCCA 3BM5A 3SIRA 2AOTB 3D8RA 5JY6A 2VNJA 2VA8A 5KYUA 1IY8A 4IX1A 5ALKA 1MC5A 1KMHB 3LBYA 4M9SA 2DTEA 4H1TA 1ML4A 3BXEA 4U6SA 1BX3A 3D8HA 1MPXA 2WVJA 4JH0A 2ZATA 4WESA 3TLAA 2GN2A 3ZE8A 2VHZA 3EGIA 4N0EA 4PPNA 3O26A 3RPEA 1W581 4FE7A 2PLWA 4PU4C 3WMXA 4DPMA 1Z56C 1XRRA 4PSAA 2D4HA 4Q93A 3W6NA 2BDEA 1MPTA 4E5UA 3LQFA 5DJ5A 5KJEA 3A6DA 4FIZA 3CVVA 5JYCA 5B53A 5DLQC 4ZCSA 1Q84A 1XKTA 5SYAA 3K5HA 4I9HA 5IFLA 1QE3A 3SBDA 2H8RA 1IXRC 3WLTA 1JFSA 1PRYA 4MDEA 3C6KA 2VJPA 3CIOA 2IYEA 3LY5A 3RSSA 4ASUA 1GFZA 4BU0A 4OYLA 1YDHA 3JWJA 1DDOA 3BKWA 2JGDA 3GQBB 1CY6A 1SKBA 3WDKA 4H59A 3R6WA 5HS4A 1FFHA 3X1KA 3A1WA 1DOAA 2CXTA 4F6RA 4KFTA 1KK3A 1HM5A 4B71A 3OFVA 1WUYA 4PAMA 4Z4IA 2CUKA 4BXOA 2RGNC 4OKIA 5K9ZA 3LE8A 2DPMA 2BR3A 3B3AA 1AHPA 1VDZA 4UNIA 3FSGA 4FS3A 5FPHA 1MB3A 4NMXB 5AYVA 2OBNA 4ZPXA 2IWHA 1QK5A 5IARA 2ZT7A 4DT1B 1G16A 1PR9A 4DILA 3FWNA 4FCVA 1AHNA 4RELA 4R1MA 3WICA 3AIIA 4ARSA 3ZCUA 4F86A 1GTG1 1V9LA 2KSQA 1RWNA 1YU6A 3BIXA 3D2AA 2HA2A 3TN7A 1QPBA 3E9MA 3NHRA 1NIPA 3DFZA 4LQLA 4YC7A 1DXHA 1M7HA 3B85A 3NKLA 3GEIA 5DK6A 4JCOA 3OE7D 2NVUA 1KP9A 3IMGA 3AYXB 3NAQA 4FMCB 1US8A 4IRUB 4JAVC 4LDRA 3WOVA 3GLFA 4GKKB 2WFLA 1Z4IA 3REGA 1G8PA 1C7ZA 1QE5A 2R60A 3CF6R 1JR2A 4NBNA 4Q4AA 1RLTA 5AICA 5A4AA 4JYBA 2QYOA 2GCNA 2CNWA 5K6TA 2F8MA 3KALA 1W5TA 2JBAB 4O2BF 1UKAA 5BQ3A 4ZYYA 2J3EA 1Z33A 4G8JA 2AXZA 2AK2A 2AMLA 3FTCA 5F1OA 5H80A 2JZOA 5IM5A 4BMZA 3O8QB 5AJHA 3TBKA 2G1PA 4JV5B 1QAQA 1RHRA 4N3CA 5K3CA 1B0AA 1GGVA 2F62A 3LP5A 1B6TA 1JDTA 3VNVA 3S0JA 3SP1A 3AUJB 1YB7A 3SZLA 4DG5A 4ZQCB 2H4JA 4I08A 4J3JA 3GGGA 4FZJA 5EXTA 1QP4A 2R6HA 4BVLA 4CNQA 4RX1A 3Q40A 3NVAA 3V48A 1XDSA 3M4ZA 4B43A 3L7IA 1RMQA 4PN7A 1OB5A 4P2BA 1SFRA 5DNDA 4YMSA 2D2XA 1W0JA 1E7MA 3VNUA 3NHUA 1E62A 3RO7A 2FUNB 3Q7QA 4TWAA 4Y7DA 1CYEA 3OLVA 2YTZA 2JLUA 2GASA 2IOFA 2XTNA 2FMIA 1E0KA 5G53C 2LYJA 1C8LA 1W5FA 2J0SA 2WWWA 1N8KA 2Q4EA 3K8QA 3L1VA 1AGRA 3ZGVA 1UR5A 1CF9A 1KI8A 3A9RA 3WSVA 3SY8A 5IUJC 3ABZA 4WT7A 2OA0A 1LSJA 2NACA 2VDVE 2VLIA 3CT4A 4A10A 2CLSA 4EF6A 4RH0A 2CWWA 3UA3A 2ZIVB 5C35A 1F6WA 1ZY2A 4GOJA 3CGWA 1ESMA 2H7CA 1WMSA 2C2HA 1PEYA 1X7YB 4U7HA 1YR7A 3LLSA 4JOBA 5B57C 4JGIA 4DBZA 1SURA 4IIBA 1WCV1 4RVFA 1G21A 3ZGYA 1AUOA 3V8BA 2Y1CA 4KWCA 5JNUA 2O59A 5JDIC 4PZEA 4C4XA 2VL7A 4XVHA 2H3EA 3W7AA 3C8UA 3NC4A 1A3CA 4Y6OA 4RQUA 3G8YA 3GGOA 1JKJA 5CH8A 1PUIA 1FBNA 2ZTMA 3FNHA 2BBSA 3QNUA 2HIGA 3H4TA 4GKAA 4FFOA 5B64A 2C3PA 5C37A 3NDIA 3RS8A 4TMWA 4ZHQF 1NDHA 4RDCA 2YWEA 5IZCC 1HK7A 4JSRA 4IQFA 5CK4A 1Z26A 5DP2A 1Q0TA 3VM6A 1JLRA 2D4AA 2WZCA 1IEXA 2OB1A 3TEMA 5MN4A 1N2ZA 4LHYA 3SCZA 3CW8X 3L0YA 3JW8A 1A4XA 3WGTA 4U8GA 4A23A 3I64A 3O2JA 3T06B 4YP6A 3NXKA 3K72B 3UBTA 4MI9A 2H2FA 3ILYA 1E0AA 1T13A 2NO6A 5AUOB 2GBLC 2XEDA 1MB2A 1BXKA 1I6WA 2QEQA 4P5DA 4WDQA 3FUVA 5DP1A 1GZSA 3HSYA 5LQCA 3ZWKA 4YP0A 1C0KA 3I3OA 2QV0A 1IXSB 3HFSA 3IS3A 2GETA 3IB3A 1KZ6A 4WCFB 3U0BA 4KXFB 2QJWA 4YUAA 4Q3BA 1LRKA 1YOVB 1ZS9A 2QRPA 1JH8A 3H9JA 1ZZ7A 3MJFA 1GFSA 4IIJF 3RHSA 3T3EA 3M49A 2FZLA 2DY0A 1ZXLA 3DZHA 2WV7A 1VKNA 4QOJA 1ZH0A 2PNFA 4BB6A 3WL4A 4K28A 2PSSA 3SZRA 5FBQB 4GM1A 2H1WA 2CLHB 1Y3IA 1OYYA 1R9JA 4MUMA 4NFSA 3ABOB 4TTIA 4IYRA 3KS9A 2QL9A 3NBXX 2ZGVA 5T6BA 4CKBB 3DBLA 3I52A 3HB9A 4NPHA 2IDKA 2JCGA 4NYJR 1XLWA 3BB4A 5DRYA 3H2SA 2W83A 3R2JA 5GV8A 2G77B 5EJ2A 2PYDA 4WKGA 3TGWA 1HXHA 2KBEA 3L0OA 3QXJA 4D9FA 1E9CA 4ZFNA 1FFXB 2ALJA 2C1ZA 3PCTA 4DLTA 2F9FA 1PAUA 2W6ZA 2Q5QA 5E6UB 1ISHA 1WEHA 2NX2A 2B9EA 3VWSA 3AETB 4HTAA 1W73A 3TZHA 3TNYA 3WS7A 3P9PA 4DT1A 1YHNA 1L2TA 2FPXA 2YWXA 1XDGA 3U40A 5ERGB 3MD0A 3RSCA 1RM0A 2ETXA 1NBAA 2O2JA 2ZXEA 2H54A 4MGIR 1R5JA 4PXAA 1T36A 2ZJFA 1M8FA 3DXYA 1D0IA 1U0OC 4RXUA 3DD1A 2GBIA 1JR4A 1UBSB 1T5OA 2BGMA 1KVUA 3NKVA 1V8DA 5T41A 3RVQA 3CZQA 3ITNA 2NVUB 4JI4B 4AF7A 3P2KA 3BHIA 4RLFA 4UULA 1QXSA 4ER6A 2C83A 4GG1A 3JXBC 2JRCA 2VP5A 3B6JA 4O33A 2XMGA 1Z5ZA 3TLXA 6Q21A 2HINA 2I6XA 4ZAWA 1GPAA 5HILA 2BP7A 2ZRLA 3H2BA 4ZAXA 1W76A 1IC8A 1GLGA 2ZKIA 1KK1A 5DGDA 1V45E 2W4QA 2AOWA 1GZVA 1I7DA 1SG6A 3PPYA 4CR7A 2DHRA 3IVPA 1JFRA 1W4LA 1YGYA 2B94A 2MSEB 2NU7A 2O2YA 2QTFA 5H82A 2R65A 3HXKA 3EXHC 1QOPB 1PJAA 1SCAA 3HA5A 1JIQA 4LI0A 4TV9B 2ILVA 3FCEA 1C1YA 1VLHA 2RHGB 3H1BA 2REQA 5EQJB 3RYFA 1BCSA 3W4KA 1VXRA 4R8SA 1CR2A 4FI3F 4MVJH 3BMOA 4DCSA 1CSEE 1BCSB 3FCOA 2W2NA 3GLGE 5EZYB 2WWIA 1A2KC 3BAZA 4O2RA 4EEZA 5E4JA 2ECKA 1PFGA 2IYZA 4HDCA 3ZHQA 3MJSA 2DR3A 3VR4A 3V8RA 3WKAA 2CNOA 2ZUEA 1RQGA 1YRBA 1G4AE 2GPWA 5KX5F 1A7UA 2NUBA 2IXAA 5GONB 3GH3A 1P0CA 1CJKC 1N7JA 4XB2A 1WDMA 3JATA 3OVMA 4HF7A 4B6FA 1L7NA 1R27A 1XPUA 1EP3B 5ISMA 2XJ3A 1I6LA 2DECA 2H2AA 1OV6A 1RT9A 2J9YB 1L9KA 3Q9SA 2VZEA 2XRFA 2OHGA 4I9FA 4LQ4A 4DCOA 4KNVA 2ORED 4HSEA 3TO5A 1CRQA 1VJCA 1E5DA 4IF6A 3EFHA 3B52X 4ZI7A 5KVSA 4U7JA 2MYUA 1DSSG 3D1VA 4R3NA 3IAAA 1NG1A 2VH5R 3H5NA 1R6TA 3I9V6 1X70A 3I83A 4KBFA 4A0SA 4G0VA 4ZI5A 3R8CA 5MN6A 2EZ8A 3LPCA 5FBWB 4Z4FA 1E89A 1ZRMA 4YRRA 3SX0A 2CXUA 3RSQA 4QO7A 1YU9A 3SC3A 4E07A 3AVVA 4LX0A 1ZONA 2Q6TA 4LHXA 3A4NA 4YQZA 5T4FA 2NLOA 1UJNA 4EX6A 3INTA 3KWLA 3C8DA 1H2YA 3OCYA 1BO6A 1L8LA 3RHZA 2H52A 1TT5A 1US8B 5BXYA 4PLHA 3OURA 5DCLA 3RREA 5AVRA 2PJRA 4K88A 1L5RA 1KYIA 4RK4A 1K8RA 2GXSA 4HQOA 4MA4A 4N5NA 5C1BA 1YVPA 2O8CB 3U3WA 2YIMA 4Y9TA 2R1TB 2Z2YA 3D0KA 4P4SA 3JAMA 2GCGA 4G5HA 4BZXA 4MCHA 3VSAA 3VOBA 1YBMA 4KO3S 4X7PA 3EGXB 1K4MA 2NSYA 3VZCA 3ASVA 2A9RA 2NUTB 4M83A 4LVNA 2NTNA 1G5QA 4BNJA 3GOHA 2DSNA 2VKQA 1TXGA 3F5QA 3HL0A 5C1OA 4I19A 5EXPA 2P75A 1JZTA 1M2EA 2CNKA 3Q10A 5EHZA 1GRCA 2C61A 5A71A 3C7CB 1Z6YA 2ZRBA 4XH9B 2RGGA 3FNQA 4G0PA 1OXTA 2HOQA 3UV7A 1BX1A 3OZTA 1OXMA 2ZRIA 5JI3E 2HUPA 4EHNA 3MIIA 2WAMA 4Q1AA 5KSPA 1NI4B 3K6SA 4XCVA 1OLOA 1KRXA 3WP0A 4TZKA 5DEIA 2X5JO 3H9UA 1ADGA 1DAKA 4C7OB 7MHTA 3NAGA 2V6BA 4WVFA 1R9MA 1BWPA 4GIBA 2OQVA 1T24A 3DVSX 4NCXA 2NQTA 4L8YA 5ALFA 4W5WA 2E5WA 2C58A 1AGNA 2ZR8A 3IULA 4TM8A 5A03A 1DOZA 2HWUA 2PUFA 2A6PA 1NNLA 4N0QA 3VDXA 3OIDA 5F5XA 1XTVA 3GIDA 3K3PA 2I2XB 1CW2B 1HE5A 1N3YA 4TV8A 4BFCA 4E3ZA 3HO1A 2QUZA 1SBQA 1T1IA 5BSHA 1PVVA 2Q4BA 2IQIA 4NJEB 2DLNA 3ZHBA 1YRLA 3DMFA 1PQPA 3EXHA 2B1QA 3H1TA 5H4HA 3N8NA 4YR9A 5JROA 1KIMA 3D4BA 3E3NA 3TVTA 5J4YA 3J81k 1U6KA 1PV4A 1GAWA 2COUA 1JLMA 4M8LA 2DQSA 3HB5X 2WM9B 3BTSA 3SR3A 2IYTA 2ZITA 4QBFA 2B7BA 3QJGA 4BO2A 1ZNZA 4NICA 4DY6A 4BNDB 3E8MA 3EDYA 3OY2A 1EEXB 1NW5A 1IG0A 4ZXPA 3ROMA 3TCXB 2RGRA 1UXKA 2M6SA 2JI6A 3A1SA 1E2DA 1MHPA 1Y89A 1XZCA 1MV8A 1SPXA 1UWVA 2WM8A 2XE7A 3KOUA 4TUYB 5CYOA 4L5CA 4EARA 1BWRA 3W5BA 4LZWA 4OHKA 1D2RA 5JNRA 1BE6A 1OTXA 5JOQA 5FPYA 3B7PA 3UB2A 5FWXB 1JJ7A 3OLXA 4I2NA 3HVJA 4EHAA 1T26A 3L1KA 3FGZA 4UCXA 1EK6A 3UGQA 1ZH2A 2ZYSA 2TMGA 3EN0A 3RRZA 2GZSA 3B3FA 3FTDA 3HDVA 3X1MA 5JAPA 2L49A 1UFRA 1K8ZB 1L7EA 2GRLA 1MORA 2IBSA 3OZCA 1YR9A 2PIAA 3WNCA 2C2YA 3ER6A 1QZUA 4L4UA 3GRRA 4C6TB 3AQ4A 5HYVA 4Z9AA 3AY6A 4JSYA 1V3TA 4JLSA 4UEJA 5AJZA 2AQHA 4FR0A 1KOLA 1Z39A 3VQTA 3SI7A 4TKZA 1PL7A 8ABPA 4FI3C 2PUVA 1VSUA 2QVLA 2I66A 3KOOA 1D6SA 5AOBA 3WLRA 5F9MA 2HSEA 3UANA 3TECE 1DI0A 1ZU5A 2NSDA 3WISA 4BQRA 1DQRA 1VIMA 5DYNA 1CG6A 4ZEMA 1WG8A 2EFCB 2MDTA 3WA7A 1O5IA 4NYIQ 1YUBA 2IL1A 1T0BA 1RVV1 4GR4A 5J40A 4DTCA 1V4BA 3GROA 4JUIA 5KAMA 3MK31 1ZBDA 4R1TA 5LB4A 4HNGA 1O1YA 1T2DA 5BVGA 5JBNA 1SM4A 4R1NA 3EF1A 1WIZA 4X4IA 1Z75A 2GCPA 1A96A 3O4HA 3K0FA 2WIJA 1NC3A 3DPSA 1GZUA 2C3MA 4FNMA 1XZJA 2VNSA 3T7CA 3DLTA 3UYLA 2ZZMA 2JI7A 2ZR9A 5EJ4A 2FPLA 2B82A 3HB7A 1XD9A 2JLQA 2ZRAA 3L7OA 1LX6A 2YZKA 4R8KA 2OHFA 3GEBA 1BROA 3QE4A 5BW5A 2WK1A 1PDOA 4FGUA 5TQ2B 1MVOA 1MEOA 4GMKA 2F8TA 1P6XA 4AJPA 2Q49A 2GX6A 1Z2NX 2MYPA 4JFAA 5AVXA 5KQMA 1ZVKA 2D1SA 3OFKA 3IP1A 1AO0A 2VSOA 4D6YA 5I7SA 3ROXA 4YRZA 1GQQA 4L2IA 1Y9ZA 4ABTA 2AFVA 2H5EA 3E23A 2X0JA 4RSRA 5D7NA 1OOEA 4KR3A 3A9UA 3ZD9A 2OAQ1 5T3UA 1J9ZA 3DM9B 2XA1A 3BYZA 2BKAA 3ZZ1A 1LDGA 1KQGA 2PD3A 4AKSA 2ZVDA 5E6RB 1CLUA 2Y27A 1XU4A 4O4LA 3TI7A 1Y4UA 5A4MS 3WO1A 1FUEA 2ZCVA 4BQEA 2IRWA 3G89A 3AF6A 1JHPA 1Z0ZA 2D5BA 1C1DA 2VDOB 3AKDA 1TPZA 1YRQA 3IERA 2DPGA 2DWUA 2EERA 1JP7A 2AMYA 2N42A 1E8NA 1F5NA 3E70C 3R7NA 4EJ0A 2EGUA 2F9MA 1ZIXA 2XE4A 2PVCA 1I7PA 3AO0B 3H7IA 3JSAA 3STYA 3GRKA 5CJJA 1OX6A 3LCUA 4RQTA 4J0FA 4X7RA 4DR7B 2MYNA 2J5XA 5LA6B 1RFLA 3BIJA 2JLBA 3H83A 2C0QA 3HJHA 1S2GA 2VSFA 5DTIA 4C7VA 3VPBA 4TRJA 3BHMA 2MSNA 1TD1A 4ZOCA 1JA9A 5CGZA 4WLEA 1FYXA 1USGA 4I55A 4PYIA 2FV8A 4NENB 3TJZA 4IIYA 4NS4A 2HQSA 4DJAA 1RAAA 3PNPA 4IZHA 4E1VA 2VP3A 4D0GA 2GEVA 3CPHA 3HWWA 3ELUA 3RUHA 5BV1A 3DEIA 2V3VA 1E63A 3BF7A 3LDAA 3OSZA 1PUJA 4D43A 1A7AA 1U2GC 2GILA 3GLGB 1XNJA 4EL5A 2HIMA 4RD6A 3CCCA 3P19A 5EIHA 2GH1A 3RC1A 1ZW6A 3AJEA 3PEEA 4M1KA 2VQFB 5K51A 4R7GA 2Q4RA 1GQSA 2HF2A 2HU2A 3ST7A 4NZYA 5ANRB 1ORVA 3WIEA 4P34A 1BQ3A 2JA1A 4JQYA 1O57A 4N7MA 5EWJA 5I9MA 4ZZIA 1YOBA 3QUTA 1EESA 1YR3A 4EO9A 5K3BA 1EFDN 4UUAA 4ZWNA 1GOTA 1SZJG 1QYXA 3GUHA 2NVWA 1YJQA 4QREA 3RAFC 5CPBA 2GHRA 1NNSA 1ENOA 1Y4ZA 4KGXA 5H83A 4LW8A 2DFLA 2QQ5A 2H2DA 4MKZA 1HYHA 1SC1A 1ISRA 2AMJA 1TA9A 2ZROA 1EDDA 1Q1EA 1UC5B 1N2JA 1P33A 1GP2A 1T1RA 2R6DA 3PI6A 1J42A 4GXTA 4R2HA 1C1DB 1Y7YA 1HC7A 3K70D 3VDQA 1NZFA 3LKZA 3N3AC 4D45A 2I6QA 1LVGA 2FW7A 3JQ7A 1PD1A 5JARA 4B3BA 2AJDA 3EEQA 4N18A 1W5AA 1ZD5A 1WXDA 1QO0D 4GYYA 3WL8A 3AIMA 3K2IA 1YR8A 1Y6QA 2QTBA 3O9MA 5CITA 3DNVB 1ULBA 1T3ZA 2G80A 5LUAA 3S2UA 2GD0A 2Z08A 4WBSA 3T12A 5CAEB 1Q0SA 1ND6A 2OXIA 2YN2A 3QPWA 4C14A 3ANNA 3ONWA 3I2GA 3RTEA 5BSGA 1D5CA 2RH8A 4LWPA 3LLVA 1X57A 4MQEB 4UHBA 4F9FA 4PU7A 2WMOB 3FFTA 3EA0A 3ZKWB 3QYXA 4LRTB 2YBEA 2PZBA 1P0IA 4JUFA 1R0ZA 2QW0X 4R1QA 4RJTA 1NUSA 3HM9A 2OSBA 1Q95A 1N3IA 4RTLA 4LBWA 1QX4A 1HF3A 2HHJA 4D4IA 1IHDA 1OBFO 1H22A 4XTCS 4UHHA 3QKIA 3ZVLA 4BZWA 1OIWA 4JNKA 3L9XA 3LT2A 4KI7A 1S6YA 3IJPA 3F6RA 3LSYA 2C7QA 1ADRA 5JZSA 1OB2A 3OA2A 3GRCA 3I0ZA 4IOKA 2CCGA 1PJBA 5T67A 1R0BA 5LP6B 3G0OA 1AKUA 4X84A 3EYAA 4Y98A 1FU7A 3WKDA 4LBZA 4HAXA 4PC2A 4LBVA 4RFSA 3U7IA 1ZVMA 5CVCA 3THSA 4IJKA 2C8JA 5FOUA 5TS2A 3K6KA 4NBVA 3ILVA 3SEFA 4K6HA 4IIEA 3VU9A 4M0PA 4TS9A 1G3QA 5JCPA 4N8DA 5IH7A 5DTMA 3HFRA 5KYWB 3PDIA 2IE8A 2FPPA 3MW8A 2YYYA 4J0DA 5I7EA 2ZPAA 1H6BA 3PRJA 1E4OA 1YQUA 4RSMA 1MJGM 3OSUA 4K81B 4F93B 4DIDA 1NTRA 2BM0A 2WZBA 1W4ZA 3R3XA 1P6QA 1F1JA 5EIOA 2PBFA 3KDSE 2JGKA 4M99A 3TLZA 4QVKA 3P9YA 4RE6A 4W7HA 5T4HA 2P9JA 4ZOQI 4G8CA 5AXCA 2ES4A 1KS2A 2XHZA 4JUAA 2XT9A 2CCJA 4KXXA 2D0IA 2ZRPA 4FFBA 2IHTA 1PL0A 5ARBA 4GL2A 1CY4A 3SYMA 4MS4A 4ZYUA 4D8UA 4R0MA 2DWPA 4ZK2A 3I34X 2PRJA 3N2LA 5JS6A 1SR8A 3R0JA 3M6IA 1CNMA 5FWYB 2QE7D 5LZ7A 4ZCTA 4OEHA 1WH6A 1P8AA 5IF9A 3NX4A 4WXMA 4EDHA 4K2AA 3JAWA 4Q7LA 3T7AA 1Z8FA 1L5WA 1KJ9A 3G85A 4HOYA 5HUQA 2P3SA 2R86A 2DKNA 4UOEA 2H0AA 2O0KA 3IPCA 2OLJA 2QKYA 2BHTA 5AW6A 1XZNA 1Z4LA 3MRTA 3H0KA 2NTVA 5JZOA 1PS0A 3EIFA 2OGWA 4L76A 3C15C 4U02A 1X7GA 1MJHA 2Y0BA 3LVFO 3LTNC 2UZ4A 4DR3B 4S04A 3PFIA 5CM8B 3MOSA 4JJ7A 1DWUA 2GN4A 3R75A 1FDVA 3HCCA 3K92A 3QF7A 4U2DA 4CMIB 4P3YA 5F4BA 1VLQA 1SULA 1YZTA 4TYYA 5ES3A 5M5BA 1XZEA 5ENVA 3B5JA 4B9AA 2XVYA 1IHPA 3E6AA 2G8NA 3JQ6A 3L7JA 3QHPA 4FILA 4LZJA 3OJOA 2WF8A 4EQZA 4FFPA 3LF1A 1GQRA 5AVOA 1HLGA 4IWNA 5MFZA 1FFYA 3TD9A 3Q7PA 4D25A 2IEGA 2J3MA 3D0RA 1LWNA 2GHIA 5A3SA 1U2ZA 2CXQA 3LBNA 1WHSB 4M60A 3B8EA 2X0RA 3KLMX 4H1HA 4JC4A 3JWIA 3JWEA 4UPVA 2C5EA 2I5PO 1EQUA 1YQTA 4D0RA 3QV1A 2B83A 3AU8A 4A4DA 7GPBA 3MHTA 1NUHA 1FW8A 3ITEA 3N8IA 5FOTA 2VIIA 2ZJ2A 1C0IA 5HOQA 3TGPA 2MTBA 3DT6A 2WWGA 2V7VA 2WU0A 3THWB 1A0OA 1VB3A 4F71A 3ZK9A 1PWHA 3CEJA 1BS1A 3CE9A 3X2SA 3FDXA 2YHIA 3OJWA 3H9QA 2W8ZA 4GBJA 3WGIA 4LXIA 4FLEA 4L8VA 1B6RA 1QRDA 4RD1A 4TMKA 4D0SA 4UTPA 3U4QB 1CQZA 3PD7A 1YCGA 2QM3A 1YULA 2HTEA 4Q5IA 5IH3A 1B73A 5LQAA 1GQYA 5IT4A 1A5SB 5K0ZA 4PO9A 3Q1KA 1UPBA 5AJVB 3QVVA 2H11A 1SHZA 1R12A 2AXPA 2DRIA 3AJRA 2P1ZA 3AR5A 3GELA 5C80A 1EVEA 2EP8A 1YDWA 3K9FC 3RADC 3K16A 3AV0B 1ENYA 1JPUA 3SR4A 1XZKA 2CD7A 4JX8A 4X71A 3GLKA 3ZZTA 5BUCA 1IZZA 1JE1A 1PK8A 3A9CA 4MWZA 1K5HA 4DM3A 3UMRA 3AI3A 4WCDA 4LF8B 3F51A 2JGEA 3CMCO 4JEIA 1THMA 2GBGA 4UJ3A 2ZSBA 3J7AC 4Q4CA 4U0KA 2O8FA 5EXDA 2ZIXA 2WLSA 5KYYB 4DB4A 4MVXA 3E9QA 5KQSA 3F71A 3H05A 4P08A 4R1SA 3OCXA 2BKXA 2CJWA 4G09A 4NDNE 4YVFA 5ULLA 2O8BB 2GZ3A 1VKJA 4MWSA 4D46A 3TSYA 1KNQA 2GLUA 2QT0A 2ZQ5A 3FYMA 2YUIA 1DKNA 2II6A 2PU5A 1PP4A 4IDQA 4QNNA 5IJ9A 1L4GA 1P4AA 2BFBB 2KS6A 4KVGA 3UA4A 4IIGA 2C54A 3GLUA 1U2DC 5A05A 5EVJA 5EIBC 5FUBA 3IKTA 5GAGi 4BBJA 4OKSA 4C04A 1U4SA 3MPUA 3IHTA 1SHJA 1MNQA 1TZMA 2QP9X 1OR8A 2BLNA 2GAJA 4K2HA 2ZJZA 4P0PB 2X0DA 5HQJA 3SQXA 3CUYA 1HE2A 3PHHA 3LT4A 2J1LA 4C43A 2RGBA 5TIIA 3SSAA 3DWEX 1OLXA 2QGZA 2B5VA 5BSTA 2Z4SA 1NWHA 3JWGA 3DHNA 1N57A 3VSCA 5GONF 3X2EA 1KFEB 1AU7A 1UFOA 3I9JA 1MJGA 2YNMC 3IVCA 3ZKAA 1QHGA 4D9KA 2PQ2A 3CIFA 1ZP6A 2FU5C 3A9VA 2HFZA 1Y37A 1DAPA 3CVOA 3JYPA 3QKSA 3WRYC 1R8XA 1TVCA 1EBUA 3R3ZA 5HIIA 4UTVA 5HHTA 1NE2A 3A25A 4MW6A 5CURA 1RZSA 4RHCA 2PKXA 5E6SB 1TTTA 3OH8A 1BFUA 4EKDA 4UOZA 3BC1A 4DM4A 2GB4A 1TTQB 1V4VA 1G6KA 3KR9A 2HFKA 2OLKA 3ETJA 3OEWA 3DWGA 1Z5VA 1XCBA 1L4FA 1KIFA 1RCTE 4I99A 5G0SA 5JRJA 4XFKA 1A8UA 1Y1PA 3GJZA 1JG6A 1QIFA 1DOHA 1XDBA 4TYWA 4DMLA 3UWSA 5A0TA 3N0WA 5TF0A 5JTTA 1HF0A 3GUUA 3E7DA 2C8LA 3MWYW 2DKOA 1JTFA 3UT5B 3A6GA 1M6EX 2HT6A 121PA 3FM9A 3RVBA 2F67A 2D1RA 1FNDA 2DVMA 1GGMA 1P19A 1PGOA 1V95A 3TW8B 1P1IA 4LYYA 4LVOA 1Z7YA 3KQQA 2YWJA 4BGUA 3DKPA 3PQ5A 1PNTA 3MJEA 1UKZA 2C2OA 3PSAA 1R50A 3S2EA 5C18A 4O1HA 4Z4GA 3E5RA 1MIHA 2FZVA 1GEGA 4WXPA 5L8VA