1QZXA

Crystal structure of the complete core of archaeal srp and implications for inter-domain communication
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
432
structure length
425
Chain Sequence
MLENIRDAVRKFLTGSTPYEKAVDEFIKDLQKSLISSDVNVKLVFSLTAKIKERLNKEKPPSVLERKEWFISIVYDELSKLFGGDKEPNVNPTKLPFIIMLVGVQGSGKTTTAGKLAYFYKKRGYKVGLVAADVYRPAAYDQLLQLGNQIGVQVYGEPNNQNPIEIAKKGVDIFVKNKMDIIIVDTAGRHGYGEETKLLEEMKEMYDVLKPDDVILVIDASIGQKAYDLASRFHQASPIGSVIITKMDGTAKGGGALSAVVATGATIKFIGTGEKIDELETFNAKRFVSRILGMGDIESILEKVKGLEEYDKIQKKMEDLTLRDVYAQIIALRKMGPLSKVLQHIPGLGIMLPTPSEDQLKIGEEKIRRWLAALNSMTYKELENPNIIDKSRMRRIAEGSGLEVEEVRELLEWYNNMNRLLKMVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Signal recognition 54 kDa protein
publication title Crystal structure of the complete core of archaeal signal recognition particle and implications for interdomain communication
pubmed doi rcsb
source organism Sulfolobus solfataricus
total genus 130
structure length 425
sequence length 432
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00448 SRP54 SRP54-type protein, GTPase domain
A PF02881 SRP54_N SRP54-type protein, helical bundle domain
A PF02978 SRP_SPB Signal peptide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.30 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) Signal recognition particle, SRP54 subunit, M-domain 1qzxA03
1.20.120.140 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 1qzxA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1qzxA02
1N6NA 1Z3IX 3QPVA 3ADCA 3AVUA 5CB6A 3PUWA 1XMVA 2W6JD 4D0GA 1ZCAA 5E7IA 5FPYA 3CF0A 1ZJ6A 4CEHB 3M6AA 2AL7A 3MG9A 3NTUA 3R7WB 3RHFA 3TMKA 2FSIA 2IYSA 3VX4A 3U3MA 4JLDA 3U4QB 4EJSC 4URWR 1EFHA 4G5OA 4BLTA 3U3JA 2GK6A 3MAAC 3A1VA 2F1HA 3OFND 1HQCA 1A1VA 5F98A 3NVAA 4MRPA 3ICQB 4RJLA 3REFA 2IYWA 1II8A 1IN5A 2VP9A 1TEVA 3P27A 3T1VA 5JJIA 5ELXA 1LS6A 3CRVA 1EXMA 2O0JA 4R2IA 4QL3A 3IIKA 2VSFA 1CR4A 3O8RA 3EPKA 1J7KA 4W5HA 5EXPA 5GVRA 3QXXA 3WMFA 1VCMA 3BERA 3ZS8A 5F2EA 4DJTA 2EWWA 2CMKA 5FBLB 3THOA 2HF9A 3VTKA 5IT5A 1GM5A 1XRJA 1OH8A 1EFRA 4JLBA 2LWIA 1KNQA 2WJYA 2F1RA 3IUYA 3K9HA 3UATA 4Z1MA 3U44A 1KO5A 1UPTA 3C41J 4QKQA 4PHHA 3MWJA 1X1SA 4MRNA 4EJSB 3L0OA 3UK6A 2JGNA 1ESMA 2WZQA 5E95A 2WIAA 2BVNA 2H5EA 5DGXA 1FX0A 1L7VC 2YZ2A 3FKQA 1E99A 1N6LA 2PXBA 2GXUA 2WPDA 3VMFA 4C0SA 2OBMA 1NSTA 5EE5B 4XIGS 4XSHA 2WMOB 3MRSA 4MKHA 3DKPA 4DBLC 3KQLA 3LX5A 4YMWA 1QHHB 3JZMA 4CYMA 1KI3A 1G17A 4LBWA 1XZPA 3F5FA 3GJXC 3K1JA 2ZI4A 5KSOA 1AJEA 3VKWA 2W00A 1AZTA 4OYHA 1RYHA 4NYMR 2GZAA 4B33A 3SYNA 4KLZA 4DT1B 3NC0C 2YOGA 3F8TA 2V3CC 4PHFA 1JI0A 2FSHA 1OIWA 4LYHA 4DIEA 4D0NA 1W36B 1CJMA 3BXZA 3LWNA 1G4UR 5IK2A 1BO6A 2RB4A 3LBHA 4HAXA 1KI7A 4TYNA 1XJ0A 1GP2A 2X8AA 4HAVA 1G8GA 1E2NA 1US8B 4JKYA 2IEZA 1XTIA 4AG5A 2PCLA 4HLDA 1JXMA 3QG1A 4IFBA 3B60A 3ADKA 5CJ2A 1T0JB 1DEKA 2BJWA 3Q5EA 1N2CE 3CPEA 4OI0A 4F38A 1P4SA 3CUEF 1KDRA 4V0ME 1E0AA 2J0QA 5J4HA 2ZS7A 2GJKA 2A30A 1ONBA 3NXSA 3FWYA 4YONB 2QSZA 1R5OA 5GADl 4B35A 2J1LA 1E4YA 4D4MA 2ZI5A 2ZS9A 5SZJA 4C2UA 3FHTA 4W5WA 3MCAA 1G18A 4WAUA 5JS8A 3UG7A 4LY6A 4AC9A 2P5TB 5FL7A 1P73A 4DLVA 1CLUA 1EESA 3CNNA 1S1CA 1N5KA 4HDQB 3VFDA 1PLKA 5SZIA 2C9OA 2V7QD 4Q1FA 3EPLA 2NO6A 2GEUA 1T5IA 2QPAA 3AP3A 3LH5A 2GRJA 1JEDA 2JLSA 2ZUBA 3VR5A 3SJZA 1NIPA 3BAFA 2D7CA 3O47A 4WOPA 3R9IA 4QOSA 1NI3A 1P2SA 1E2PA 1HT1E 1DE0A 1KMHB 1RW4A 5JECA 3LNCA 3OESA 3QEOA 3QVUA 1W4AA 5F9HA 4LYAA 2GEVA 1RZ3A 5DI9A 1MFQC 1E32A 5AUQA 4M8NE 4PQRA 4LPSA 2IYXA 4PC2A 3ICEA 1CEEA 2AK2A 2RHMA 4RVCA 3AKYA 1E1QA 1QDEA 4Y0AA 3OEHD 4BQSA 2GZHA 2J0UA 4M21A 2ZITA 4KI0A 1ELOA 4XD7D 5BXQC 1CRPA 1QVRA 4FMBB 1OPXA 2HLDD 1NN5A 5FOXA 2PT5A 2WKQA 4HLQB 4QGHA 1RRGA 4BUJA 4YMTA 2H7VA 5DH9A 3K70D 1W49A 1G5PA 1F2TB 1E9SA 3CKLA 2DB3A 2GJ9A 3HJNA 1U99A 4TL6A 4QBGB 2WJGA 1I4LD 4LJ5A 4KYIB 4PPQA 1G7CA 4GSYA 3T61A 5HKKD 2IYLD 4OQFA 3GPLA 4HZUA 2ZRDA 4LJ4A 3ZGXA 2ZI9A 1CBUA 3WBJA 1N5IA 1CIPA 3IPXA 1II8B 1R4AA 4DB4A 1TQDA 1WMSA 2BCJQ 1FNMA 2JLZA 3K09A 4EFNA 3NWJA 5E7JA 1NLFA 4WZAE 3WRXC 3UANA 4IOKA 2ZSBA 2F43A 2HF8A 4MRRA 1HUQA 3FMFA 4QBHA 3TJZA 2YV5A 2Z4RA 2HEIA 2QM8A 4XWOA 4RZXA 5K8LA 3DMDA 5FBRB 2D62A 2IS2A 2CDNA 4PAQA 2WJHA 3AVWA 1XD9A 1E0KA 3U2QA 5DNYB 1RRFA 3WXMA 3KXIA 3WYAA 1G9XA 1CJTC 1FX0B 1J99A 1KNXA 2XNDA 3U5ZB 1G3RA 4NYMQ 4XOIA 4TZ6A 2Z0MA 2H18A 4RCZA 2C9CA 4PO9A 4BRUA 2OFWA 4CIDA 4OI1A 4JJZA 4YXWA 2VP5A 1P9WA 1MO4A 4HLUA 4L8GA 2CEAA 1E2EA 3L82B 3H2YA 3QQ5A 2QTVB 4NU0A 1KDOA 1R10A 5L3VA 1FPMA 4BEJA 2DFKB 1XX6A 4G1UC 5SZHB 2WKPA 4AI6A 1E1RA 5LD2C 2OILA 3IBYA 821PA 4P32A 1AKEA 1S4QA 4MYHA 2ZANA 1RIFA 5EZ6B 4DUGD 2ZU0C 5TVKA 5L3SA 3E70C 2EFHB 2WVJA 2Q9CA 5EE0A 3B2EA 2FGJA 3FTQA 2ODBA 2VF8A 1O87A 5A4JA 1BYIA 3MMPA 2GBLA 2PX0A 2KI5A 3I8SA 2P2LA 2YVUA 2IA5A 4A1FA 5FOWA 2X2FA 3AUYA 4C0HA 2FSFA 4II7A 2QY9A 2JLRA 2ODWA 4HATA 1CP2A 2FWRA 4YMVA 2VP2A 4TT3D 3H86A 2ZR0A 3IGFA 2PXTA 3GEHA 4ASUD 1NRJB 1YZQA 1OYYA 4TN1A 3TUZC 1DG1G 1M2OB 4Z8YA 3VHXA 1DO0A 5LD2B 2YC4C 2FU5C 2AD1A 3RC8A 3EZ2A 1IXRC 3SQXA 4MITA 1DAFA 3H1TA 2YC2C 2OAP1 3SJCA 1NG9A 1W0KD 3QKRA 2MSCB 2Q3HA 3SBDA 1G8PA 3KL4A 1Z63A 4FMCF 4Q1DA 2PX3A 3QXHA 5TARA 4ZCMA 2WAYA 4ZPXA 4FN5A 1DOAA 1HH4A 4MUAA 1QHNA 2EFDB 3CWQA 3QJYA 3KUCA 3VR3A 1KK2A 4R9UC 3B9PA 2O8CA 5DISB 3I32A 4S2EA 2RGDA 4KFRA 2QGZA 1G7RA 2KE5A 1CR2A 1OXSC 5HR5A 3PITA 1AQUA 4JLJA 1PLLA 1J2JA 3K0CC 1TTTA 4PXAA 4Q48A 1GFIA 4IOJA 4KHZA 4XVUA 2ANCA 2GVDC 1XJCA 2ZPTX 4WXRA 2IF2A 2ZROA 3K0SA 3HYRA 2J0UB 5GAHi 2XJ4A 2ZJBA 5AUPB 1E9FA 1KI1A 5P21A 4CGZA 1YHNA 2WOOA 4NTZA 3EPHA 1N6PA 1DAEA 1U8AA 5GJCA 4BPBA 4OJQA 3A1TA 3EARA 1JR3A 4B74A 4Q7KA 5FFMA 3FPAA 1W36D 3T35A 5FR1A 4A8JA 3VAAA 2R6CA 3EASA 4L16A 4RZ3A 3UWOA 2RHDA 2VL7A 4HZUB 1E2DA 1NL3A 2L0XA 2CE7A 2CK3A 2P0EA 5KNBA 4LUCA 1AKYA 3S1AB 4DLYA 2H16A 4P4UA 2F43B 4HLUC 2P6NA 4DCTA 1P3JA 1W2HA 4K81B 1IQPA 1XEXA 3EC1A 1GSIA 3GJ0A 3W6OA 3FKSA 3OIUA 2OSBA 4PPFA 1U94A 1ZNZA 4V03A 5JLJA 4TLAA 3TNFA 1H8HD 4X8MA 2BOVA 1A82A 1MH1A 2LKDA 2ORIA 4YC7A 3CPJB 1SHKA 1OXXK 2PT7A 1E0SA 4JVLA 3L0PA 3A6PC 3V9PA 2JLVA 5KDOA 1FQKA 1DAIA 1KZ7B 3X1DA 2YOFA 3DVLA 5FUXA 1KMQA 2EU8A 1QHSA 3MWYW 3X2SA 1II0A 2GBLC 4RZ2A 5JEDA 2OBNA 1HT2E 1V43A 3ZZUA 3GJ5A 3H4MA 4S35A 5C46F 5JJLA 1NSFA 2REXB 5FBQB 5BYKA 4LBVA 1OHHA 2GCOA 2ZSFA 5JMTA 4PHGA 2VH5R 4KFTA 1OH5A 5AJYA 4HSEA 2O8EA 4UKDA 5CK5A 1XD8A 4FINA 4TLEA 1CS4C 3PEYA 1T6NA 3K9NA 4LK2A 2OEPA 1CJUC 4P0TA 1T0HB 1DAGA 4MDEA 5AJXA 1DAMA 1X8LA 5L3SB 1VHLA 4PC1A 1RFLA 1R7RA 3G5UA 4Q02A 1YU9A 3V4RA 3WHLA 5JJKA 2NO7A 2P6UA 4Q4JA 1C4OA 2VLIA 2ZRLA 4ESVA 1ZC3A 1VYTA 1S3SA 4N3NA 1ZU4A 3ND9A 4B3DA 2D2FA 2VHJA 4C2TA 1ZIPA 1IXSB 1EGAA 1OFIA 1DS6A 2FPLA 1XMJA 3I4LA 5FOUA 3KQKA 4B44A 4JT4A 3DM5A 4JYCA 4JBYA 1P75A 3HP1A 4L5BA 4WVFA 3WNBA 5CDFE 1E69A 1QG4A 2NPFA 2NO0A 2PXFA 4RD3A 2J45A 2BBTA 3N5CA 3OIVA 4OI4A 3NBZC 2DCUA 2JLQA 1AN0A 2WSSD 4AYTA 4UJ5A 2ZM5A 2NZJA 3RSOA 3QKRB 1N6RA 1YR7A 1V5WA 1N6OA 4LSGA 4ZIRA 5GVSA 5IDVA 4MKIA 2FFHA 3W3ZB 2I1VB 4JKIA 1EFRD 1J8MF 1WA5A 3QXJA 4Z1MD 3U4QA 4PC6A 1G3MA 1IY1A 1II9A 5C4GB 2QGNA 3E5HA 1F60A 4KXFB 4QM6A 4A8JC 3D6TB 4G0NA 5AWFC 1NJFA 2O8CB 4TMZA 2WPDD 4PZZA 5FI0B 4DLXA 3ASYA 3K53A 5F9FA 4PQYA 1VG9B 1T4GA 2G83A 4PSAA 2LKCA 4PAMA 3VX3A 2ZRCA 1T3HA 2C9YA 3IIMA 1CR0A 3I72A 3BOSA 2O0KA 1OH6A 2GVZC 2K5UA 2H57A 1NBMA 2R65A 5CM8B 3GLFA 4Q7JB 3D7MA 3CRW1 3CIOA 1AQYA 3WMEA 4DLTA 2ZRFA 1BMFD 3SC3A 1SXJE 2ZRIA 2OT3B 4RFVA 2VP6A 1JR3E 3ZD6A 2P65A 2QQEA 4BFYA 4QNRA 1WRBA 5JSZA 2DWOA 1MR3F 1S9HA 3KKNA 2OZEA 2ZSEA 4A8JB 1Y63A 1R8QA 3SI7A 4WXPA 5IK2D 4XTRA 4M1SA 4MA4A 2AR7A 2QT1A 3KB1A 3PEVA 1KK0A 4XTCS 1S3GA 4YDSA 4B3BA 2G9NA 4HB4A 3SR0A 3I61A 1OKKD 2CHVA 2PLFA 4M0LA 2G1KA 2JA1A 2V8OA 3QF4A 2MMGA 5E7MA 2V55B 4FCWA 4QBIA 4RD1A 2VQSA 2GJSA 4FXPA 3DPUA 4NCNA 1KJZA 1R6BX 4G5QA 3O8CA 4PO1A 1ZU5A 1ZM9A 2F3TA 3LLMA 1XEXB 5FTNA 1E2QA 4V0KA 4R7ZA 2C8VA 1NP6A 2ZRHA 1TU3A 4E22A 1TF7A 1Z8FA 3CZQA 3G82C 3QBTA 5EUQB 3TIFA 3A1WA 2A3RA 4JVNA 5GJVC 4DDVA 1COWA 4CW7A 5H8WA 1XFAA 5FL7D 1CF4A 1GL9B 3ZYCA 4TYWA 4NH0A 4G5RA 3VNVA 3K0AA 1MKYA 4GBMA 3TQCA 4A6PA 2AN9A 1XMIA 3CRRA 4TWZA 5JCZA 3IPYA 3ZZTA 1G21E 4HAZA 2RCNA 1KSFX 2ZRKA 1F3OA 4ACAA 3OHMA 1P60A 1Z6XA 4JVMA 3LBNA 4DSOA 4NCJA 4RD2A 2GCOB 2KWIA 4IVRA 1HQYE 1E9CA 2FSGA 3C4JA 1Z6AA 4NL4H 2O8EB 1W47A 1Z0DA 5EZ5A 2YKGA 2AFHE 1G19A 2VP4A 2V1UA 3C5HA 4NCKA 4NDZA 2P6RA 1CJKC 5B58C 3A1SA 2FJUA 3QNUA 4NYJR 1ZM3A 3W6NA 2FEOA 2XOKD 4Q9JA 3QXCA 2R8RA 1K8RA 2PZGA 2V1XA 1UKVY 2OV2A 1NMZA 3I5XA 4Q4JB 3EZ7A 4KFUA 2ZRPA 2RGGA 1VCIA 2P67A 2AWNA 2VP0A 4Q1EA 1UKZA 4HZIA 1YKSA 1VECA 3D8BA 4WA7A 2XXAA 2A5JA 3DMNA 3HPQA 1JBKA 1E4VA 4OK3A 3SS8A 1GKIA 1S9DA 2FG5A 1W0JA 3EXAA 4Q7MB 2PXQA 1HYQA 3B85A 3PR1A 4OKSA 2FMXA 3LDAA 1KI9A 2J46A 2D2EA 3PG5A 2ZRNA 4HDCA 4MKFA 1UEJA 2GCNA 2HJVA 1M7HA 2CHGA 2CE2X 1XF9A 4C7OA 2R6FA 4GI7A 4H9GA 4MRSA 4AURA 1E9RA 2CHQA 3KKQA 4BFVA 4BLQA 4WIAA 1IN7A 5IHPA 4N0DA 5TDHA 4E5UA 1DBSA 1F6BA 4LPKA 5KTYA 3DEFA 3MJHA 4ZIRB 2C5LA 1KZGB 1A5TA 2HT1A 2BBWA 2OFXA 3W8RA 2A2ZA 1P9RA 1WE2A 4IJMA 4JL8A 2QROA 1P7CA 3KFVA 1TX4B 3SBEA 4TYYA 3ZD7A 2A9KA 3F0TA 1F2TA 1XD2A 3AF2A 1AS3A 3EX7C 3PV0A 5HE9A 1U9IA 1EFCA 3X1YA 3AEZA 3BBPA 4B48A 1S96A 1LTQA 3QKUA 4M1KA 5HE8A 4CRWB 2GHIA 1Q12A 2XNDD 5KSPA 4BLSA 4YQFA 4Z51A 4IHQA 1OXUA 3KQNA 2WSMA 2AFIE 3CB4A 3T34A 4YXWD 1RPZA 1KJYA 3BB4A 4Q9LA 3QEJA 2PMKA 3VNUA 2ORVA 2VO1A 3C8UA 4HDOB 4MRVA 3A37A 3GLFB 621PA 3IQXA 2JJ1A 221PA 1AGPA 1JAHA 2EFGA 6Q21A 1RYFA 2OXCA 4URZR 5G3YA 1E1RD 3IBGA 1ZUNB 2OE2A 4OBEA 4PR0A 3HPRA 4NCHA 1KY2A 3L43A 3RNLA 2NIPA 3AF0A 2JDIA 1XCPA 4G5GA 5JI2E 4UXJA 5JSZB 4A9AA 2PXDA 1GKYA 5HTKA 4Q66C 1G4AE 4BASA 5CYOA 2ZSDA 5CLLA 3LQXA 3U7FB 2O0HA 4TQ9A 1SVMA 4EDHA 1I2DA 2UZ3A 2QEQA 4K8OA 1JQJC 2NOAA 3RS7A 1KOFA 3UPUA 4N0EA 1YZTA 3QF4B 1JPJA 5CLQA 3Q8XB 4NPHA 4IDPA 3M0EA 4AYXA 4QJ3A 3QBVA 2WWYA 3CBQA 4F4IA 1UAAA 5EE1A 2OO7A 3UKDA 1M74A 3SJAA 4DCSA 3OZXA 4R2HA 4FCVA 3TUIC 1CRQA 3RS0A 1E2MA 1SGWA 1RRCA 3PUZA 4I4LA 2MSDB 2X2EA 3CRQA 1OB5A 4A15A 2YWGA 2G6BA 2VF7A 1HV8A 1JNYA 3GLGA 4TL8A 2ZUDA 1XXHB 2Q9AA 3SJBA 3K0AB 4QGAA 2QMOA 2FEMA 4MKGA 1NY5A 1ETUA 1GNPA 5J4LA 1IJEA 1U81A 1FNNA 3A1UA 4ITRC 4JBWA 1N6IA 3WNDA 4B3CA 2ZTSA 4NYJQ 4UNQA 1SKYB 2ZAOA 4F91B 4JZKA 5CK4A 4M9SA 1M6NA 2F9LA 3A4MA 4LHWA 1WB9A 1KI8A 3SZRA 4CEIB 2RGAA 4M1TA 3P1JA 1NLYA 3HU2A 4C0LA 4A6XA 1OLOA 2B92A 2ZS8A 3LY5A 2A5GA 5L3QA 4ZCLA 4GDFA 5GJBA 1MV5A 2D3WA 3FYHA 2CXXA 1Z0AA 5BYJA 2BJVA 5CITA 2QI9C 1EG7A 2J87A 2HXYA 2P3SA 2Z6VA 4GRAA 2GETA 2JCSA 2AKAB 1OFTA 5DI3A 3FHCB 4QM7A 1YR9A 4UXHA 2YINC 3J81k 2PXEA 1CU1A 4PAOA 5KPDA 2D7DA 2IUUA 1SXJD 3SYLA 2XXAB 4LHYA 1AGRA 1KJWA 2WHXA 4AKHA 1JR3D 1SZPA 1JQLB 4I1SA 3R20A 1U9IC 4TQAA 3B82A 3X1XA 1VG8A 4MGYR 4D82A 3WRYC 5AUOB 2IXEA 3BH6A 1E2GA 2Q0HA 2QPTA 2FOLA 4I81A 3TE6A 4C7OB 4RCYA 4TZ0A 3P4YA 5K8UA 3AGQA 4BWYA 2XSZA 4JJKA 1NF3A 1GILA 1PJRA 2XZPA 4HB3A 1D9XA 1KSJA 1S2MA 2QAJA 1OH7A 4B75A 1G6OA 1TQ4A 5JWRA 4D4JA 3FKSD 1CTQA 1MOZA 2GZDA 1Q22A 2AK3A 2KJQA 4IDOA 4JBXA 1ZAKA 4Q9HA 2QP9X 3CRMA 1QG2A 1ZVQA 4NE2A 4ZI3A 1H8EA 1XD2B 4LJAA 2GF0A 1GG2A 2H17A 2OM2A 2PZEA 4P3YA 4TTPA 1YZGA 1G1MA 2EFCB 3LVRE 2JLWA 3VR4A 3K70C 1HE1C 3QPWA 3KB2A 4I1OA 3K0CA 4OHXA 3QPUA 2PXKA 2B6HA 3GJ4A 3MGCA 3OAAA 2QM7A 4US0R 3TQFA 3S1AA 3JVUA 3RRYA 3BB3A 3RWOA 1HTWA 1LF5A 2FA9A 4LYFA 3GFPA 1UDWA 2R44A 4B34A 3B7GA 4A36A 1EX6A 4K46A 4BFUA 4DLSA 4LDJA 1E2IA 4D4KA 3ND8A 3BS4A 4QC2A 4X8HA 1IN6A 3EZ9A 3B1WA 2FGKA 2FZLA 2KBFA 1Z22A 2ZVPX 2IWRA 2DYKA 4JL6A 2PJZA 1PUIA 2V9PA 4UNPA 1JXOA 5BN4A 3IKJA 2BEKA 1JR6A 5TMPA 2QUZA 4GPTA 3U7HB 1HURA 1P72A 1XTRA 4HAWA 2AD5A 2EWVA 1ZBDA 3E1SA 4BZPA 2BBOA 3W6PA 4JYBA 3AVVA 1ZIOA 2QA5A 3SOPA 2PXLA 4U7DA 1UFQA 2N42A 2YYZA 3LA6A 1GRQA 2QT0A 4F93B 5KSYA 5C1BA 4TYPA 4OQLA 1U0JA 1QBKC 2QSYA 1Z0JA 3U7EB 1IAQA 2W2XA 4GZMA 3IEVA 2G1JA 4C9BA 3OFNA 4GMDA 4V0LA 4QG7A 5FOVA 3AVOA 4LC1A 2IX3A 2IEYA 2VSOA 4F4CA 3FOZA 2A5DA 1R2QA 1W4RA 3TW4A 3UMRA 4DSTA 5EP3A 3NBXX 3QG5A 5DN6D 3GLGB 2ZJ5A 4JLVA 4BFSA 2QU8A 4RFSA 1FFHA 3H84A 4BECA 3PJRA 2FFQA 2ZR9A 1EFTA 1KI4A 2XZOA 1YRAA 2YNMA 3DM9B 5ANRB 1XPUA 3SQWA 2JQEA 4GNKA 3TBKA 2AHOA 3G0HA 4IXMA 4KAXA 3KFXA 2CL7X 2JAQA 3LLUA 3RAPR 2Y8EA 3HU1A 4WZBE 1UBGA 2HCBA 3SYKA 1QF9A 1VHTA 1XJQA 2QBYA 1T91A 5DHFA 3TW8B 3LO5A 3B1YA 4PZLA 5L3QB 2ZRMA 4HB0A 2HV8A 3SNHA 1QHGA 4NCIA 4BGDA 1EWQA 1X3SA 3BORA 3WP0A 2NPIA 2UZIR 2CNWA 5KO2A 1NBMD 2P5SA 4CT5A 4LZZA 5H1YA 4LC0A 1UJ2A 4DCVA 5DI3B 4B3FX 2YWFA 3K0FA 2OHFA 1K5GA 3AF1A 2IYYA 2PH1A 3JVVA 4L4UA 4LI0A 1IN4A 3KX2A 4GP6A 1DAKA 1F48A 5JHHB 3PEUA 2GXQA 1KI6A 1PUJA 1JJVA 2XX3A 3HYTA 1Z47A 3AVTA 3RABA 2JIZD 5FUVA 1T3LA 4BZQA 4BE7B 2ZE5A 1ZMXA 5AUNB 2DY1A 1TUIA 1TPZA 5JZVA 1T5LA 4NHOA 4R98A 2YHSA 2ZYWX 4DLWA 4G01B 2ZXUA 2A7QA 3EZFA 2VHUA 4LV6A 5FPKA 121PA 1SHZA 1ZUIA 2BMDA 3HR7A 2ZIAA 3PENA 2G88A 4HAUA 8OHMA 4CDGA 2V6IA 1ZW6A 3TVDA 5K8TA 2QNRA 4B2PA 2LCFA 2DPXA 1B23P 3DOFA 3T1OA 4Q1AA 1NVWQ 3SU8A 2GNOA 1E2KA 1GVNB 2GEDA 2ZE6A 4M9ZA 4QGGA 1AK2A 3Q7PA 1VKJA 3K9LA 2IYQA 4IXNA 1I2MA 4HI0E 3RS4A 1FMLA 3OE7A 4ZDIA 1GL7A 2WWHA 1WBBA 1JAIA 4DVGA 4RD4A 5LB4A 1Q20A 4FMDF 3A36A 3FFBA 4EPYA 2XJ9A 4TQUS 2GILA 4RD0A 1T3SA 3IHLA 1E9AA 2ERYA 1RE0A 4ILEA 2F9MA 5J40A 3LV8A 4EPWA 4P33A 1XTQA 3A8TA 4HUQB 2HYIC 2W6IA 3AB3A 3ZZ0A 4O3MA 2B8WA 3DO6A 1KSHA 1E0JA 3VQTA 1TL7C 2R9VA 3N2EA 2HCJB 3GD7A 3OEHA 4DC9A 3EIEA 4EUNA 1KO1A 4AK9A 3LQRA 3WBKA 3Q7QA 2ZE7A 3UMSA 1QB2A 1XNJA 2A78A 2ZI6A 1QVAA 4QXAA 4YLGA 3EZ6A 4OQMA 1U0LA 2XTZA 2XITA 4DCNA 3TSWA 3FMIA 3U7GA 1SVWA 2GWHA 3GQBA 4PX9A 1OJLA 5IF9A 4JIMA 1YZKA 3WHKA 1OFUX 2BKEA 4P4SA 2MMCA 2A5FA 3BE4A 4NBSA 1NN0A 1NVUQ 2IK8A 3O8BA 3QIAA 1DARA 3SHWA 2OXRA 5J4YA 2AXNA 1FUKA 2ZSAA 5DYIA 2WJVA 5DSZA 1NVVR 3PIRA 2PJRA 1TQ2A 1R0ZA 1E2LA 3BH7A 2WKRA 1XZQA 3QSYA 3BWDD 1Z0FA 2IYZA 1CJVC 1PLJA 4OQNA 5L3RA 1JECA 1U8YA 1QRAA 3T12A 2ZJOA 5G53C 3NG1A 4RFSB 3FB4A 4Y0VA 2BMFA 1GAJA 2WICA 3RLFA 5AK0A 3D31A 4KV9A 4RZUA 5EXXA 2C96A 2DHRA 2GKSA 4MH0R 1FMJA 2JASA 4X8LA 2QRZA 4DSNA 4GP7A 3KDSE 4V02A 4LBZA 1Z0KA 1Z0IA 2G0NA 4LX0A 4QNMA 1YZNA 2R6AA 1KO8A 4OJKA 3KQHA 2CCGA 1GITA 3FMPB 4URUR 1UKYA 5JHGB 1BIFA 2QBYB 4A2WA 2QZ4A 3RRNA 4Q4HA 3W34A 3NC1C 2Q9BA 5FTJA 2DWPA 1UM8A 3LD9A 4D2IA 3Q5DA 5LPNA 2IUSA 3WYFA 1L8QA 5IRCD 2QAGA 3CR7A 3RRZA 5K8IA 2C2HA 4KLNA 4WZ6A 1SKQA 2JJ2A 3K0FB 1X86B 2GJ8A 3LQQA 2X77A 4URYR 5EXSA 4I99A 4LJ9A 2O8DB 3QY0A 1LF0A 2OCBA 2GTPA 4A0RA 3QOFA 4NYIR 3RSLA 2Q6TA 2F1JA 4EFLA 4Z54A 2VIIA 4TL7A 2YWEA 1KAGA 2QE7A 1KI6B 3BFXA 2ZI3A 3PXGA 4L9SA 4IW3B 4QHTA 5D3QA 1D6JA 4KVAA 3KKPA 3DHWC 2F55A 3GJ6A 4EKDA 1CR1A 1DULA 4AY2A 1WQ1R 2RGBA 3RYTC 3I8XA 4E07A 1MABA 4JS0A 3RRMA 2PXVA 1AIPA 3DKVA 2WJJA 4KJZA 1ANKA 1SVLA 2C77A 4FMCB 3BRWD 3GFTA 1OYWA 3THYA 1BKDR 2CCKA 2Q3FA 4C0BA 1IBRA 2GK7A 4U02A 2I3BA 4ASUA 1G8YA 1C1YA 2QP3A 2UVQA 2CBZA 4A4DA 2VBCA 4TMKA 1ESNA 1C9KA 2BHRA 2ZRAA 4Q5IA 521PA 1PVOA 1F2UA 4D4LA 3AH8A 4DIDA 1G8FA 2WWIA 4P4TA 1M7GA 2EYUA 1GUAA 2XB4A 3IILA 4JT2A 4DLRA 4MGZR 5M04A 2OFOA 3QVVA 3IHWA 1W0KA 3QXSA 2VA8A 5FTKA 4H1VA 4M1MA 4FWIB 4U00A 3QI2A 1B0UA 1BH2A 2GF9A 2GDJA 4GFDA 1L4YA 1EFUA 2H8KA 2IBMA 3B9QA 1DG3A 2O8FA 1ZNYA 4KYUA 4KO8A 1G8HA 1XMSA 1XEWX 1R0WA 2FX3A 1XDBA 3FMOB 1D2MA 2FPMA 2RGNA 3GJ3A 2IS6A 2QORA 3IQWA 4N1AA 2J59A 1XTSA 4IDQA 1HEIA 3O8DA 4FW9A 5EP4A 4B3GA 3SEAA 2HYDA 4ZDKA 2QL6A 4O2RA 3AP2A 3NHBA 4TTRA 4DKXA 4FD2A 3VR1A 5HZKA 2WTUA 2FE4A 3VKHA 2GAAA 3R8CA 1G7TA 4TLBA 1VDZA 3PCRB 2FZ4A 1QHXA 1GNQA 2IL1A 1XXHA 2QPOA 4QBFA 2PXUA 1GWNA 1MO5A 3TK1A 2H1LA 4PFSA 1D2NA 1R5NA 3B8HA 4D0LB 1G5RA 1AZSC 5FPTA 3T5GA 4A0HA 4H1UA 4L15A 5KPJA 3ZVLA 4UJ3A 2BMJA 2KB0A 4LJ6A 3W5IA 1A2BA 1QHIA 1FQJA 1E96A 3UG6A 1E2FA 1UBCA 4I1VA 1IXZA 1KY3A 4CEIA 3K8YA 2J7PA 4P4SB 3B6EA 5JBQA 1LY1A 3CNOA 2HDNB 5BW8A 1W44A 1N0VC 3SN6A 2REBA 4MYUA 5JEEA 1E1QD 2XSZD 2ZAMA 1UADA 1XEWY 3EIQA 3N70A 2QAGC 1Z6YA 3AGPA 5D3MA 1Q1QA 1CULC 1KTVA 1W1WA 1YR8A 1W4CA 1KI2A 1KKLA 4Q18A 1ZNWA 1X8JA 3BB1A 4XH9B 1BOFA 2ONJA 2RH5A 4ZO4A 1YJ5A 2BKUA 1FTNA 3U3RA 4KCGA 1E9DA 4RKFA 2EVWX 2WAXA 4C0KA 3GCGA 3AVXA 2CL6X 4M9XA 4ACBA 3VU9B 1KK3A 2FN4A 4JSTA 2BV3A 4BFXA 2ZRGA 2W2VA 3RS3A 2IS1A 1NN3A 1GNRA 4M4SA 5KNDA 2NO1A 1IHUA 3KJHA 1OIVA 3WNCA 4NYIQ 4KBGA 4Q4HB 2DFNA 1W5TA 2MSEB 1Q1BA 2WWXA 4NKRA 3OAAD 4NMMA 2D4HA 3I73A 1W7AA 2BDTA 3B78A 1T9HA 2QAGB 3W5JA 3Q3JB 2IUTA 2IYUA 2Z83A 3A4NA 2BBSA 1IOZA 2ZRBA 4DZZA 3THWA 2FF7A 3AM1A 1QHYA 4AD8A 4D81A 1F5NA 2GA8A 2AXPA 2VHTA 3X1WA 2PEYA 3DOEA 1ZC4A 2FFAA 1TADA 3BFKA 2Z43A 1R5BA 3PFIA 3RANA 3EPJA 1XCMA 2KSQA 3THXA 1XCGB 3EIHA 2WWWA 2VSXA 3ONWA 3ASZA 4PHTA 2N46A 3MLEA 1M1YE 4QHSA 1MRNA 2C78A 1YVDA 2QMHA 3TAUA 1MABB 2BCGY 3X1ZA 4C0AC 1NBME 5FOTA 3GLFE 1SULA 5FL3A 4JLPA 3QE0A 2RGNC 1UEIA 3THYB 4BLRA 3FDIA 4B32A 2OBLA 1JALA 1P9NA 1KO4A 3LX8A 1D9ZA 2E9SA 3HR8A 4W9MC 5LDDC 3V00A 4F7WA 1F2UB 4GZLA 3ZIAA 2ZUCA 4UNNA 3GFOA 4ESHA 1CXZA 1VCOA 4LHXA 4LV5B 2C03A 3EWAA 5EE3A 4XWKA 1OW3B 2J0VA 4RKEA 5TB5A 2WSSA 3KTAA 5DYGA 2WOJA 2IS4A 5TXGA 2J7KA 2YWHA 1DO2A 5CM9C 3T06B 3U3KA 2PLRA 2XEXA 1BS1A 5FH9A 2JATA 4QGFA 2O8FB 3R8FA 5JRJA 3CR8A 5TV2A 1NNEA 2XAUA 2RKOA 2J41A 3FGNA 5EJEA 4V0NA 4WBSA 1YE8A 2G3YA 1W36C 5LBIA 3R9XA 1I4TD 3GEEA 4AKIA 4V0OA 2CL0X 1HQ1A 1N6HA 1XEFA 3SE0A 5KUTA 2OG2A 2ZJAA 3U6BA 1SVOA 1XP8A 4B73A 4A82A 3SFZA 5HPYB 1S8FA 3TKLA 1H65A 5AJWA 3I5YA 2E1RA 1NMXA 3AKDA 1N5JA 2B21A 4Q21A 1KSGA 4E03A 2W83A 1XXHE 3GP8A 1NMYA 3A4LA 2CNWD 1TQ6A 2F3RA 1XPRA 4BLOA 2E87A 2VEDA 1L4UA 3VHLB 2PXPA 1Q21A 5AJVB 1SKYE 1BMFA 2W0MA 5UKDA 4POAA 2X1VA 3CPHA 4PSKA 3TAHA 3TSOA 1TNDA 4AYWA 5JCPA 1KO7A 4M2LA 3LBIA 5GAGi 4QHYA 3CWZA 5H68A 1NN1A 1E2JA 1UBEA 3U61B 2O52A 2VYFA 5GJWC 3NBYC 4UNRA 2IYVA 1XB2A 2W0SA 3GEIA 5FUWA 3REGA 1NJGA 3FE2A 2ODNA 1VG0B 1OKKA 1VPLA 3CLVA 4F4JA 4EIWA 2QTHA 4OHWA 1TAGA 4TMTA 3NDPA 4Q1BA 4G5SA 4W5JA 1E79A 4DLUA 4KVGA 1ODFA 1ZD1A 2FFBA 3RC3A 3C5CA 4UQOA 3GLHA 1E9EA 1SVSA 5D3MB 4JLOA 1GRNA 2CJWA 3EWSA 1E9BA 2ATXA 2IW3A 3U3OA 2VTKA 4O2LA 1YQTA 2XTNA 1FOEB 1NVXQ 2X19A 1Z2CA 3PUVA 5FUYA 1TEXA 1Y3AA 4IDNA 4IEIA 4NONA 4C0JA 3ZLJA 1VTKA 4OHVA 3AUXA 4Q47A 4DRZA 1G291 3P4XA 1MO6A 1ZM2A 4XJXA 3UIEA 2D74A 3FVQA 3MUFA 5J5CA 4PPNA 3IDQA 3AVYA 3WY9A 2CK3D 3TR5A 3NH6A 3CM0A 3OE7D 5JWHA 2PZFA 2NQ2C 4BFTA 1KAOA 4HYYA 5A5GA 3AKEA 4YMUA 2A5YB 3QKSA 4FI3C 4JL5A 5CIWA 5CB8A 4LOAA 5SZKB 5E3HA 3TLXA 2IF0A 4DCUA 3JZAA 5H70A 4ZKDA 1FL9A 5E4FA 5CYPA 2ZJZA 4TLCA 5FOSA 3THWB 2REOA 1MO3A 1MT0A 2RMKA 4GOKA 1E2HA 3B13B 3DZ8A 4LJ8A 3GJ7A 4CZ2A 2CLDX 4KU4A 4U5XA 3ZS9A 5F3WB 2W6ID 1I4DD 3B1ZA 1KYIA 4Q03A 4URXR 1Z07A 2XOKA 3OEEA 3BD9A 4O25A 4TSFA 2ATVA 3Q85A 3RVBA 4I1UA 3FHOA 1UKEA 2ANBA 5FPSA 2YJTD 2ZE8A 3EC2A 3THXB 5EP2A 5CJPA 4URVR 5KSZA 3C15C 1K5DA 1O3YA 2Q21A 3WMGA 4LCBA 4EAQA 3CONA 5EXTA 2NZ8A 2WBLC 4M53A 2TMKA 1OHHD 4E09A 4IEEA 3B1XA 2FV8A 3T5DA 4B2LA 4C4PA 4JLKA 1JJ7A 5KHOC 2RAPA 2RGCA 1OE0A 1GIAA 1ZM7A 2O8BA 4HUQA 1U8ZA 1X8KA 4LHZA 4TTQA 2FNAA 4DWJA 4M1YA 1VCNA 5KDDA 4TMWA 3KJGA 5EQTA 5FTMA 1TF2A 2IHYA 3AF3A 3D3QA 3K0EA 3KTAB 4D80A 4BRWA 1D5CA 1OB2A 1DTSA 1WP9A 3KUDA 2CVHA 3OIWA 4LHVA 4LBYA 3ZQ6A 1DPFA 4A92A 4B47A 2OUKA 4IRUB 2W6JA 1A7JA 3PUYA 3IO3A 3U44B 3SFVA 4HAYA 3BK7A 4B3XA 1YZLA 2AKYA 3E2IA 3M1IA 1T8UA 1MRSA 3NDBB 1RVDA 1ZM4A 1SQ5A 1YR6A 2R62A 2J0SA 3B1VA 4ZV4A 1SVIA 3AP1A 1RKBA 5A0FA 4FWTA 3I92A 2AWOA 2NMVA 4JLMA 1D2EA 1Z06A 2C95A 4M9QA 1M34E 2G0TA 2R2AA 4YDHB 3R9WA 3PEWA 3LW8A 1NIJA 3GLGE 4D6PA 1U0HC 2ZREA 1GTVA 2J3EA 4EQ6A 1T8TA 3GJ8A 1G16A 4ZDJA 3RWMB 4MYCA 1Q0UA 1XU4A 2JJ2D 4X8OA 3TSZA 3ZJYA 2FH5B 4XWAA 1WBDA 3AVPA 5C4MA 1XBTA 1NY6A 3TUJC 2I4IA 2CLCX 1R8SA 2ZJ8A 3B5JA 4LV8B 1JEEA 4US2R 3HWSA 4J0QA 2EW1A 3U60B 1IONA 2WMNB 2QE7D 1G5TA 2CVFA 2OLKA 3RDPA 2JEOA 2HUPA 2XTMA 3WP1B 3AV0B 1Z28A 3Q72A 3ADDA 2GJAA 1E94E 4LRWA 5G41A 4BLPA 2F7SA 5G40A 4BFZA 2JLUA 1SVKA 3AF4A 1GZSA 1LVGA 3P32A 4ABYA 3GLHE 1E98A 4Q4AA 4AG6A 1Q44A 1OXTA 2HT6A 3HDTA 1UDXA 2H92A 3GLHB 2XB2A 2ERXA 3CZPA 3VR2A 4LJYA 1Z83A 2CJWB 2OESA 5JS7A 1TMKA 2ZJ2A 5C18A 2O8DA 3F3YA 3LXXA 4B43A 4GOXA 3NEYA 4AWXA 5CDFA 2ZYVX 1G3QA 2BMEA 3TH5A 2ONKA 2PEZA 3L0IB 1FUUA 4ZCIA 4EPTA 5L8VA 4UNSA 1W4BA 1CKEA 3EA5A 4M22A 2R6DA 4IVQA 4PC3A 1N25A 3DZDA 2ZR7A 2FDCA 3BC1A 3EAQA 3BJIC 2ZYUX 1PZNA 2IYTA 2XGJA 4TMXA 3SDZA 4DDTA 4PTLA 1XPOA 3BIFA 4OK6A 1M7BA 1Z29A 1J8YF 3QKSB 5KDLA 2IT1A 5AR1A 721PA 1AA9A 2BM0A 2HXSA 1YRBA 3EW9A 1Q3TA 2ZJYA 3I3SR 1M8PA 4O0MA 4CEJA 5KNCA 1Z2AA 2JLXA 2OCYC 4PSVA 1G3IA 2ZRJA 3GLIA 2ZQ5A 5HCNA 1ZD9A 1Z08A 3PUXA 4IDHA 4Q4LA 4Q7LA 1OXVA 1COWD 2IHBA 2YOHA 3L0SA 3NBFA 2ASEA 3K09C 5DLQC 1IJFA 3LXRA 1P5ZB 2ORWA 1G7SA 1OT3A 1EX7A 4P31A 1FW6A 3I62A 1QZXA 1AS0A 1S0UA 1LFDB 2V7QA 2VHQA 3M4YA 3MSXA 1LB1B 3ECCA 4MYTA 1IY0A 1N0WA 1SXJA 4Q19A 3KXLA 1D8TA 4C3ZA 2ECKA 3KJEA 5EE9A 1N5LA 5DE3A 3MFYA 1FP6A 2C98A 4GT1A 3QKTA 2J7PD 4BFWA 5FPHA 4KITB 5BN5A 1A4RA 1P2VA 2PL3A 3I1FA 3MWLA 4Q9KA 2O8BB 4C30A 3DL0A 4GMXA 1WCV1 2DFLA 2ZVQX 3HU3A 3KZ1E 2QENA 1N0UA 4JLNA 2C04A 4XVQA 4TMVA 4WW0A 5BQ5A 4AIIA 4LYJA 4HB2A 2GAOA 1WDTA 5EUMA 1P62B 3CX6A 5FBWB 5KU1A 4PC7A 4XD7A 3QF7A 1E6CA 1G3UA 1WXQA 1G6HA 4TYQA 4OL0A 1OFHA 3EA0A 2CCJA 2HLDA 2BIFA 3SHFA 1VYVA 1Z5ZA 4JVSB 1KK1A 1J70A 1U2RA 1W2GA 2NO9A 4CVNA 5FBVB 5FTLA 5J4KA 1W0JD 1TF5A 3C14C 5DO9A 3W9YA 5B30A 2IWHA 3NH9A 4OI2A 3TRFA 5HKKA 4DB2A 1ZNXA 3CX7A 1UBFA 1ZINA 2GESA 1OV4A 4IFEA 1U90A 2IXFA 4M1WA 3W90A 2VPPA 4OHZA 1KHTA 5B64A 3N2IA 1VG1A 2QMUA 5HCIA 4HUTA 3ZQJA 2QMEA 2QP4A 2Z5FA 3IO5A 3LAWA 1UF9A 4DDWA 2SHKA 4B2IA 4EQ6B 2BEJA 4Q9IA 3NIBA 3AVQA 2NG1A 2V6JA 1KGDA 3T1TA 3AKCA 4EPXA 1GRRA 1VIYA 2D06A 4W7SA 2WIBA 2RGXA 5LB2A 4B6EA 2EQBA 2DFTA 4PANA 4MQBA 3KQUA 4IOMA 2OCPA 2J9RA 2VHCA 4IOLA 2GCPA 1DELA 3WYGA 1KIMA 3VU9A 1KDPA 1G20E 2NGRA 2AX4A 3ZDQA 4Q1CA 1IN8A 2BM1A 1DVRA 3LFUA 4YMSA 5B57C 2ZETA 3BGWA 5KYKA 3C16C 3CNLA 3ZH9B 3ADBA 2GXAA 3NEJA 3QUSA 2IC5A 4OK5A 3W8NA 1AM4D 2F1IA 4Q4AB 5BWMA 1P6XA 4RSGA 2CLSA 2JJ1D 3UXMA 1FP7A 4UXIA 4MDFA 1RJ9A 1IY2A 1WF3A 2ZEJA 4ON9A 4QFMA 3RS2A 1AS2A 1S1MA 2B8TA 2PMDA 5EP1A 3V4FA 1Q1EA 4OQXA 1E3MA 2JDID 3ZIAD 1LNZA 4ERNA 4QRHA 3U6KA 4DUGA 2NTYC 1W46A 3GMTA 4LJ7A 4TL9A 4LWZA 1FTSA 4QJ5A 4RD6A 2IXGA 1WGWA 5DN6A 4DHEA 2WWFA 2PBRA 4US1R 4KSBA 3DDCA 3L8YA 4ARZA 5C2JB 3ZVRA 1XWIA 2BWJA 1NLZA 2RGEA 2C99A 2W2TA 4DXAA 3NKVA 4FIDA 3TR0A 2I1QA 4CEHA 1SXJC 5KOYA 2Z4SA 4M1OA 3R7WA 4GOJA 3C7KA 4D26A 2G77B 2DWQA 3KXKA 3LW7A 4TT3A 2F6RA 3FFAA 2EYQA 5FR2A 1RC8A 1EK0A 3OIYA 4CEJB 3GLIE 4B6FA 4PPGA 4BZXA 4DLZA 1HA3A 1TU4A 3GLIB 2FPKA 1ZD8A 5JFGA 1Z6TA 5JRZA 2B7BA 4AKEA 1YZUA 4KFSA 3VKGA 4CT4B 3KKOA 1P2UA 2XZLA 3QENA 4OHYA 1GL6A 1N3BA 2ODEA 4IVPA 4Z8XA 3CO5A 3EG5A 2ZYTX 3MWKA 2QG6A 3MJRA 1XTJA 1W48A 4DDUA 4ZI2A 4AKGA 4MGKR 4Q00A 4G3XA 3L2OB 4FCTA 4JMPA 1G64A 1SXJB 1NKSA 3LVQE 1OF1A 2W58A 3BFVA 3CF2A 5AJZA 4EJSA 2GXSA 1VMAA 4NP6A 2EFEB 3P20A 3Q9LA 3ZVMA 3BH0A 4QJ4A 3L8ZA 1TUEA 4L9WA 2JIZA 2XNSA 5DIFA 1ZUHA 1ZYUA 1BYUA 3IIJA 3TVTA 4F92B 3AQ4A 3UMFA 3TGPA 1K6MA 1P2TA 1EWRA 2WV9A 5HZHA 1QHHA 1A2KC 1E79D 1VIAA 1JPNA 2V54A 3VR6A 3LRPA 4A2PA 3CH5A 2WM9B 2R6GA 5TY0A 4RY2A 4FMDB 1L2TA 1R0YA 1NVVQ 1LS1A 2PCJA 1X6VA 4MGIR 5CIQA 5B2ZA 1W5SA 2B7CA 1LV7A 4DT1A 1KDTA 3K70B 1GKUB 1Z6GA 4PZYA 1Q57A 4XVRA 4D25A 2JLYA 2Q3MA 1ZCBA 3A58B 2BC9A 1FZQA 4JLAA 4PQFA 4C0QC 2ZU6A 1P61B 3IEUA 1HY3A 1US8A 4NZYA 2KBEA 2DR3A 2QRNA 1LW7A 4B71A 3KJIA 1KKMA 1X1RA 4ZKEA 1JB1A 4KODA 4A2QA 4B76A 2JJ8A 2ZI7A 2QN6A 4HLCA 1N6KA 4V0MA 4IKEA 3CH4B 4TLDA 1H8HA 5J4VA 1H8ED 5FI1B 4ZDWA 4DEYA 2OAQ1 3W3AA 3T15A 4A0GA 2WJIA 4LGMA 2IYRA 3K9GA 1OSNA 3OEED 4JSYA 1J90A 4TSFD 1ZP6A 1G41A 4DSUA 4GL2A 4PO8A 1RRPA 1VYUA 4CF7A 3UWKA 2V4ZA 1R0XA 3P26A 4Q01A 3KKMA 1IM2A 2VRWA 1GOTA 3NHAA 4XSGA 421PA 4EPVA 3ETLA 2J5XA 3MD0A 1DAHA 1NKTA 4A0FA 4DEXA 3CF6R 5DHAA 2OCAA 2WWGA 3CW2A 4KBFA 3OF5A 1ZRHA 3PVSA 1KMHA 1OIXA 1RJ9B 2N1BA 1Q3HA 4EFMA 3CX8A 1U98A 2UKDA 1GDDA 4HEJA 4EPRA 3ZVNA 2O5VA 5JI3E 1HE8B 5G3ZA 3H0KA 4MUBA 5JWOA 2DBYA 3RS5A 3PQCA 4R71A 4KSCA 1DADA 2QQ0A 5J47A 1XTKA 3T1QA 2HJGA 2OLJA 1PV4A 2QTFA 1NG1A 4BEBA 5BN3A 1Q1ZA 4ARZB
chains in the Genus database with same CATH superfamily
5LP6B 1HSZA 3MINA 1BXGB 5CB6A 2VPZA 5FCLA 5KYNA 3L8DA 4CEHB 5CPBA 3RTDA 2ZAIA 5DLYA 3U3MA 1LQUA 1ZY2A 2GK6A 3WWDA 4PGMA 2PP4A 3ZSUA 3RQGA 1A3CA 1A50B 3GRZA 5C81A 4DREA 1W35A 2C5SA 4X92A 3V7WA 2FUG6 4RK4A 5IT5A 2ZIXA 2ZM6B 4O2AB 2JCGA 1V26A 3U44A 2JA2A 1LM3B 1NUTA 1FX0A 3GANA 5HZMA 3C2QA 3M4BA 1W76A 1KRXA 4CYMA 1KQFA 3DFMA 1KI3A 4UTRA 2ZXOA 4E5VA 1WIZA 3B6JA 3VKWA 3H9UA 3LTEA 3BXZA 2Q5IA 4WXEA 3V7UA 1NPYA 2X8AA 4JKYA 1GNSA 1E2NA 2HHLA 1WVGA 3SSAA 4MW4A 2R7AA 1Q0PA 1SBHA 2ZUUA 4YWHA 1MNEA 3VPCA 2PGIA 3MCAA 2JNWA 2IOQA 3UG7A 3OCWA 4X6UA 1LE2A 1N5KA 1V71A 1T6BY 4B31A 2QPAA 1GNLA 1NIPA 4P86A 3ICVA 2ECOA 2X5JO 3FYUA 4CMHA 4M0FA 1USIA 4CN9A 1K7EB 1AKMA 5AVQA 4MR8B 2O1XA 5LNK6 1Z0ZA 4RGQA 4KI0A 1D2AA 1L4LA 3PVCA 1XAHA 5FOXA 3TNDA 1F2TB 4IO0A 1P5HA 1I4LD 1ZZCA 1VTMP 5F2NA 5LSAA 2OAGA 3GPLA 1X42A 2W45A 3M1AA 1SK9A 1SK8A 4H31A 1ZOPA 3LQYA 2YRFA 4PIVA 2HF8A 2XLWA 3TFQA 3GVPA 2FHPA 5E38A 5JP7A 2WJWA 4DJAA 4Z5HA 2O54A 3VO9A 1MF7A 2C9CA 3OBIA 3E7WA 4D3SA 3CO0S 3VSDA 3N2KA 1WY5A 2AUNA 3NOQA 2O8VA 2DFKB 1J0CA 1OA0A 4L5AA 3R5HA 1F9AA 1KY5A 4WT7A 4DUGD 2ZU0C 3BA6A 3OI7A 3PNMA 1DNPA 2VYQA 2KI5A 3AUYA 2QY9A 2PUWA 3H87A 4JI0B 3P97A 2J8ZA 4C6HA 4MITA 4Y2GA 2J3KA 3FVTA 2OAP1 3IAFA 1Y1SA 4WJLA 3SM3A 4INZA 1UANA 3FDZA 5AH0A 4HQ0A 4UPDA 4EENA 1HH4A 3MTQA 4R9UC 4AS3A 4HQ6A 2BM9A 5JMOA 1V3QE 2WFLB 5BQHA 1Y98A 2EGGA 1GAEO 1P3Y1 5IXYA 2CXTA 1U8AA 4N18A 3ZHXA 4BBJA 1P45A 3KPVA 4OG2A 1BG6A 4HZUB 3GJZA 2B2CA 2OBYA 1CPQA 3GPIA 4UATA 2NZVG 3FA2A 1ORHA 1X80A 4PS0A 1TECE 4PPFA 2AOUB 1NRIA 1U94A 1J21A 1YDEA 4KBYA 4G1FA 5DS4A 2GSDA 3NMJA 2ROQA 3X1DA 3KYJA 1DU4A 4FYXA 4D7AA 5FUXA 1S2DA 1P1RA 5AI9A 1COZA 3ZZUA 5JMTA 1UBOS 1KS9A 2B1JA 3O75A 4HSEA 1QU3A 3ED1A 4E7SA 4TLEA 3PEYA 1QG6A 2HK6A 5AJXA 4U63A 3EMDA 3KD2A 1R7RA 1L4EA 1D8AA 4KO2S 1CZHA 1BX3A 1ZC3A 2GLTA 4N3NA 1OCEA 3SXPA 3AI1A 1DS6A 5KSWB 1BD3A 3DXXA 1X7GA 4PV7A 1AG9A 3QOWA 2BBTA 2PL5A 2DCUA 2OHJA 5GVSA 1H93A 1GZVA 2J8WA 2BR4A 2YJZA 5DBFA 2X23A 1RZRD 1II9A 5C4GB 5U9CA 1WZUA 1Q50A 5FI0B 3E35A 5PNTA 1P5RA 3VX3A 3I72A 2O0KA 4KRGA 3TN7A 4FP9A 2BGMA 1DTWB 3JQ9C 1BMFD 3WGLA 3OJCA 2HNKA 4QNRA 3BSSA 5JSZA 2AR7A 5KTKA 1OLUB 2CHVA 3DVQX 4KOEC 3VSBA 3QF4A 1RQ7A 4IUBS 3TOZA 1R6BX 3O8CA 5HBRA 2AI3A 4YV2A 4RS3A 3LLMA 3LBYA 1M75A 4UM7A 2JPUA 2C3YA 1TF7A 2AOTB 1S2IA 3G82C 5AVWA 5EUQB 3GWNA 2JFZA 2JEZA 1L5ZA 3JYYA 3DJUB 4MQ9F 2MINA 1ENPA 3BGVA 3R9KA 4RHUA 3C4QA 1WLSA 2ZIWB 4BLWA 2LV8A 4RJ2A 1LPEA 2XCSB 3PWTA 1W47A 1XWRA 3ISTA 2XLVA 4NDZA 2H11A 1E92A 3QNUA 3UM9A 2FEOA 1UKVY 1TB4A 4Z4GA 3S29A 2AF4C 1Y6QA 1YKSA 4DA9A 1W0JA 4CIXA 3RUIA 4ALLA 1HYQA 3PR1A 1KVUA 5AVKA 3EXEB 3EPVA 2C4KA 1DQYA 1GDHA 2XUDA 5AJTA 1XVAA 1VIMA 1PDWA 1FMTA 5B4UA 1GARA 1ECLA 3STWA 1P29A 2M1XA 3JQRA 2BFFA 3QWGA 1T6IA 2E6UX 3PNPA 2L1PA 1QQTA 3KM0A 4FM9A 3QEJA 2VO1A 2YIDA 4R0MA 2OM6A 2EFGA 2OXCA 2B35A 1KY2A 3RARA 3PDMP 2WMYA 3MMXA 3LQXA 1I2DA 4DRYA 2C07A 2RARA 2HQ1A 3D5QA 3M0EA 3ZWIA 4F4IA 1JYSA 4TM8A 2OO7A 1M74A 1YK0A 3ZW8A 1JMYA 3OZXA 3WIOA 5AVJA 2YWGA 3MSCA 2X8JB 4F97A 1XXHB 3COYA 4L0CA 2FEMA 4OF4A 1FNNA 3ZLUA 3GWLA 4NYJQ 1SKYB 1APBA 2R85A 4LHWA 3OP1A 3JPYA 2A5GA 3S84A 3H7AA 3I6QA 5AK3A 4E94A 2Z6VA 1R9MA 3BICA 3CRZA 3EULA 4RJKA 3HDHA 4AAYA 2GNPA 3R20A 4NWIA 2OFYA 4MGYR 5A1TA 3FI9A 4PSUA 1M2NA 3O8OB 4CR6A 2BONA 1FYFA 2WABA 2VDWB 1SJ9A 4WCVA 3BWMA 4HDMB 3INRA 1ZUGA 1JW9B 1KJQA 1J20A 1ZAKA 5EIOA 3SVTA 1HTBA 4NE2A 3KK0A 2GM5A 4MOWA 4P3YA 1U8EA 2CB9A 4X4DA 3RIHA 3DYIA 4LRXA 3IAS1 4JRZA 4HDNB 1L8AA 2FETA 5BRJA 1XROA 4B34A 1UDWA 4A36A 4BFUA 2D2IA 2AMYA 2QD2A 4HRXA 3MTBA 3IDAA 2ZFUA 3ZU2A 2IQIA 1DBVO 4ERXA 2YVAA 2YL0A 1TGVA 3U7QA 2J5RA 1JXOA 2PRKA 3ZDCA 2WTNA 5DCUA 1C0IA 2DP4E 4HAWA 4NZPA 1GTRA 3E1SA 1RKQA 4TRNA 3LA6A 4P93A 2PKXA 2OZLB 4FNOA 1OYVA 3IMFA 4F93B 1U0JA 2VNHA 4GMKA 3IEVA 1V25A 1QGZA 3OFNA 1A8SA 2CBXA 3RBXA 3D2LA 4F4CA 4YAUA 4DSTA 4P7BA 1NLMA 3AG1C 3GLGB 1H69A 2IELA 4I4NA 3CKMA 2ZR9A 2OP0A 3ORHA 1DRJA 3UMJA 4EA6A 4UTNA 1B1AA 2W48A 4A26A 4GNKA 1L3PA 2J07A 3O21A 5JT4A 1XQVA 2PUHA 4GRIA 3GOHA 5HJ2A 1X3SA 2MTBA 3BORA 2XHEA 3VR4H 3JQDA 1YULA 4GE3A 1QGDA 5AVOA 3RNOA 2VJLA 3TMAA 1NP3A 3LHSA 1IN4A 3KX2A 1I3KA 1RKCA 4RDCA 5EMJA 3LUPA 1JJVA 4RQAA 1FEZA 3KQOA 1MU0A 4O4LB 1MLDA 5CVDA 2DY1A 4H2DA 3L1MA 4MVJM 4MPPA 3EZFA 3F96A 3ZU6A 3PENA 2HS5A 1KERA 4YRIA 2F48A 3DOFA 2OMKA 3Q8LA 1UBJS 2PRZA 4QQFA 2I7CA 1UBLS 3FLAA 4EPYA 4LJLA 3GA7A 3ANYB 2HWUA 5BV0A 3UJHA 3P9RA 1PT6A 3QUQA 4K6MA 2LGJA 1P0FA 4MVOA 5F12A 3HY4A 1WDWB 1Z2PX 2XTZA 4IQFA 2AJTA 1XCLA 4YV7A 3JQAD 3C7JA 1OJLA 4DMMA 3OFJA 1VHQA 4C3OB 2FZEA 4X41A 3RKUA 2AE1A 1JFTA 2SBTA 4CM8A 1JECA 3WQRA 2R97A 2IPMA 4RFSB 2PKCA 4Y0VA 3HJRA 5FNVB 2C96A 3PE5A 4PW0A 1IVSA 2G0NA 1LPMA 2A59A 3FAKA 5LPNA 4W8GA 3AT1A 4G1VA 5LP6F 3R6TA 3KC2A 3KELA 3OOSA 4Y6LA 2OCBA 4A0RA 4NYIR 4EFLA 4RADA 4AY5A 1ZQ1A 3D8TA 3L1KA 1FDRA 1MEOA 4RENA 1WQ1R 2QUAA 2PXVA 5EEHA 3UWPA 4O2AF 3THYA 1BKDR 1BGWA 1NBHA 3CU5A 3DJNB 1C1YA 3L9XA 3UAGA 3CUUA 1HXHA 3NBUA 4PZDA 4Y7DA 5B53A 2OFOA 4HNVA 3HYSA 2IGTA 4DR1B 2GDJA 4HDKA 3EPRA 1XDBA 3IQWA 1RPEL 2DAPA 3FOOA 3ZCUA 3BREA 1OU0A 4ZVRA 4TTRA 5EK0A 2P9JA 4ENWA 2ATIA 1U5AA 4E32A 2LDBA 4R31A 3R7FA 1CY0A 3BXGA 4H1UA 4L15A 3AUFA 5AW3A 1QHIA 3I5QA 4FJ1A 2RBEA 1JLSA 2IXTA 1JVBA 4ODIA 3NETA 5JEEA 4ZTBA 3I30X 3P2EA 2H1IA 1KI2A 3BB1A 4QZVA 4IICA 2O14A 2RH5A 1QR6A 3GCGA 3TI9A 1T2DA 1LS4A 2ZRGA 5AHOA 4M4SA 1OWMA 1S6YA 2FMHA 2LD4A 2XBUA 3HZRA 2RI0A 1QBGA 4C6SA 4YR9A 3R75A 5TQ0A 1LH0A 3AILA 4R2KA 4O4JB 4RLSA 1V55C 1C4WA 4NZNA 5JCOA 3SYTA 1XTZA 5CDYA 3WLKX 4OXIA 1BCRA 4MWCA 4Y2RA 2Y3DA 1U6KA 3QE0A 1P1HA 4PZCA 3PQ5A 2E9SA 5LDDC 3JVIA 1F2UB 2ZUCA 3N2NA 3EWAA 3C45A 5TB5A 2WOJA 5TXGA 3ZR4B 1E77A 1SUWA 5HRUA 3SD7A 4CF6A 2WWRA 1IUPA 3FOCA 3PF9A 4UVGA 4V0NA 4ZCQA 1PK9A 2G3YA 3GEEA 2C92A 1KQNA 1UBSB 1ZI8A 3KPWA 5KTMA 1NMYA 2OVFA 5AI6A 3TPFA 4ED9A 3Q2KA 1XTTA 1SCUA 1VB3A 1FYDA 3N8HA 2X1VA 5EUBA 3TSOA 4MVJE 2BMVA 4X44A 1F1BA 1IMJA 1H2HA 3ETHA 2HSEA 3QVMA 3KU1A 4ZRDA 1AA6A 2WSYB 3A3PA 3NDPA 2FFBA 2QX6A 1IVNA 2DFPA 3HHPA 1EQ1A 3G1WA 1XG5A 3E81A 3GJSA 4FGJA 3L1IA 1D2HA 2C8LA 3C3EA 3P4XA 3KSAC 2CUZA 3NHFA 4PPNA 4MUNA 2NQ2C 1X57A 1GRCA 5FULA 4LOAA 3BWYA 4EB6A 1O9HA 4DCUA 4WESB 2BFWA 1EXWA 1X1CA 1Y1RA 2D5AA 3NV9A 1GG8A 2IE8A 5KWJA 2CLDX 4F2PA 2VC2B 4JQCA 3K66A 1DRWA 1Q5PA 4AJHA 1DG9A 1ND5A 4LF4B 4U6SA 3AMVA 5EWJB 5FPSA 2FZ5A 5B1YA 4DAOA 2Q21A 4CIVA 1JYFA 3OTQA 1POXA 3L41A 1JHQA 5GMOA 2O3TA 2RGCA 2P35A 2O8BA 4HUQA 4X7MA 4LMPA 1QTQA 5AKKA 2A9RA 4XARA 5ICSA 2GM9A 3R5TA 2XLBA 1EP9A 3RZZA 1D6MA 4YBZA 3W8DA 3R7AA 3U44B 4KOAA 1KH3A 1YR6A 4M9RA 3IA7A 3B1VA 3AP1A 1YQ9A 5CVUA 3PEWA 1NIJA 3U09A 4Y6SA 1YI1A 3JTMA 4ZDJA 4X8OA 3TSZA 5IEJA 3F3SA 4LV8B 4US2R 2WNIA 1G5TA 2CVFA 3RDPA 1X38A 1E94E 3VI4B 3N28A 3MK31 1EUCB 2Q0QA 1Q44A 4P4LA 3IAEA 1Z83A 1JQKA 1Q17A 2IM8A 1A4IA 5LMUB 4UNSA 4M22A 1XAJA 3S44A 4A5OA 1Y4CA 4EG0A 1V7CA 2CFIA 2BNMA 5CURA 3G0IA 3GRKA 3JSAA 721PA 4X1IA 2JLXA 2ZRJA 1RTTA 3DF7A 3QJGA 1THZA 2JGLA 5EJ5A 1SKBA 3RIXA 1FW6A 3U56A 3S2ZA 1T6ZA 4KO4S 4KI7A 5FD8A 3ZWOA 1KEEB 4XDYA 3S8YA 2VAXA 4IDFA 5F78A 5FP0A 5BN5A 5I47A 2F62A 1DW9A 4AY4A 4X85A 1Z4MA 4RMHA 3B5IA 4NDNE 3O1IC 3QF7A 2H2WA 3R23A 5TS2A 4NJEB 1SBIA 4JVSB 4IAOA 2CV1A 4KNYA 3FSGA 2GAIA 3ZWXA 3FM9A 2GSWA 3TRFA 5HKKA 3V1NA 2IXFA 3MLFA 4BVHA 3OZ7A 1Y8CA 3WDKA 1WOYA 4L0DA 4B7CA 3KSDO 2BE5F 1LMB3 3ME5A 1M6YA 3X2FA 3WMRA 4IOLA 3SP1A 4OHPA 4MUKA 3VZPA 4QXPA 2OWEA 2W42A 3RSQA 3LFUA 3IELA 3BGWA 1D1TA 3NKDA 2IC5A 4OK5A 4HQRA 2F1IA 4CODB 3F7MA 4MO9A 1T6UA 1AS2A 5FUQA 1N2GA 4HNSA 1PJSA 4FGKA 4L57A 4K6HA 1UQRA 1E20A 2RGEA 1BXGA 2P9BA 6CHYA 2QXYA 1ZESA 3CLTC 4CEHA 4HGOA 4MCJA 1ZMBA 1W87A 3V34A 1F4LA 2HRZA 4Y6PA 5JARA 1JNXX 3R3XA 1NV9A 1Q0QA 1Z6TA 4AKEA 5JALA 3KKOA 3TIGA 1EI7A 2ZYTX 5EHQA 1H85A 5HXAA 1W0CA 4O2AA 4O6YA 4ZVNA 4OPMA 3QHPA 5IVHA 4ZEOA 4OIPF 2P0YA 3UGKA 3IEEA 4BGVA 1B0AA 3PVZA 1NX9A 5K8CA 4MGIR 1XLVA 4KB5A 2L2QA 1BR1A 4KMMA 3KYJB 4NZYA 1N7JA 1P1FA 5B37A 3B48A 1OZAA 3V2IA 4B79A 1RPAA 1YCFA 1REQB 3PICA 2V0NA 1JHVA 3P0HA 1F7VA 3ND7A 5KQPA 1VYUA 4TV9F 1MFPA 2AWCA 1FTQA 1XWWA 5FBKA 3OOWA 2I5PO 2TECE 3CLSC 3SIXA 2IEAA 1JEAA 1GDDA 3ZVNA 4ZANA 5C3MA 4MR8A 3J81A 1DADA 4OMCA 2IH2A 3PFFA 1JDTA 1A27A 2ABWA 1GCIA 3CSDA 2P9QA 3NTUA 3VR6H 2FSIA 3L4JA 1ULUA 4URWR 3DCYA 4RMNA 5JS5A 5F28E 5EQFA 4H7KA 2IYWA 3HLYA 3IIKA 2EWWA 4PICA 1OAAA 5F5NA 2HF9A 3OPXA 5E33A 3QV1A 3DVRX 3U49A 2EHJA 4P08A 4EAAA 4TMYA 5E95A 2WZQA 4OYYA 3BWEA 1N7IA 4NNOA 1AUVA 2R1ZA 5H4GA 3C5EA 5LL6P 5JS6A 5L0FA 3FLEA 2DOKA 4JX8A 3WGNA 1EHCA 1BDIA 1RYEA 2YBEA 4CDRA 3V7FA 2W00A 1TR2A 1VMEA 2GZ1A 3PK0A 4X61A 5DP2A 5JXIA 3O9XA 2B4RO 2CSFA 4PHFA 2C8JA 3HYLA 2XCTB 5E0KB 1RC1A 2YJ5A 3LBHA 3JYPA 4FUTA 2Y2UA 1JXMA 3HKEB 4MTCA 4MVJP 4F4HA 4R1TA 3CUEF 3WIEA 2HPAA 1KPIA 1LPAB 2GD1O 2VHXA 1NW7A 2NV6A 2UYCA 4TZTA 4AC9A 4O4LF 4KPFC 3SSOA 1NYRA 4DLVA 4QRDA 3TTXA 3WKBA 5ALGA 4O02B 3G9QA 2FFRA 3RSCA 1GVHA 4L2IB 5FFNA 3ZE8A 2I0FA 3QEOA 2HJMA 1RYMA 3ICEA 2AK2A 3O8LA 2WFLA 5DBEX 3D0OA 4ALJA 5L0HA 3CCBA 2PD3A 1CRPA 4MPRA 1D0SA 4G89A 4MVUA 4CMEA 3CUSA 3NOXA 2MSWA 5CVTA 4HFFB 1YUNA 4HZUA 1UUFA 2CUNA 4UFPA 1D7OA 1TRHA 5K3OA 2O7RA 1TM7E 2VXBA 2IE0A 1AXGA 3NWJA 4WZAE 2FW8A 4PSCA 3EQLF 4O6MA 1P17A 2YV5A 2HEIA 5LMNB 1YBVA 2AOUA 3G2KA 5KIAA 4PAQA 3DE0X 3ZH2A 1O77A 1Y5LA 3CF4A 1ISRA 2JK1A 4F8EA 5FNVF 1W52X 5CYFA 2RHLA 1FPMA 5GTDA 3NTVA 1JPUA 2CUKA 4HH0A 3ZGLA 4Y9UA 1E1YA 2NT3A 3EQ7A 2I54A 4XYBA 2Q9CA 2JFGA 2BKLA 2ZUTA 4X60A 2WYHA 3HV2A 3HSSA 1KF0A 3CZ9A 1LGYA 4ZVKA 1LD3A 4TT3D 1GZ3A 4IF4A 5HDBB 4L3VA 3SC2B 2GA9A 4ZP1A 1G8PA 1Y6GA 5TE9A 1QC5B 4DLAA 3EZNA 3W7AA 4R6XA 3PKZA 4LA4A 5I7SA 5DISB 1XE3A 2C20A 4LRYA 2KE5A 2Z8YA 3MBKA 1EA8A 2ZPTX 3L0DA 4PG5A 1DTWA 5P21A 1ZQ9A 3BZBA 1LK0A 2N9UA 4Q7KA 2BH2A 4X9XA 3PQFA 3MGGA 2XVAA 5FO0A 3ITEA 4S24A 1OLUA 1MAVA 3CZ4A 2FX2A 2GO1A 5KNBA 1D0IA 4BLUA 4AZSA 1GV0A 4OLFA 5A4FS 2XQJA 1H8HD 2AOTA 1N2HA 4JEHA 4N5LA 1SM4A 4F1JA 3LXMA 1WXWA 1DAIA 1FDSA 3WLPA 2IUOA 1V11B 2AZ4A 4MV5A 2SNIE 2B2XA 2NU8A 4Z4IA 1ITZA 2REXB 1RLOA 3I5AA 4LBVA 1F5SA 3EY9A 4ZQFA 3B2NA 3COPA 2FOIA 4B8WA 3NT5A 2X9GA 1T2EA 4L8LA 3OTOB 4JYCA 3EXEA 2H4FA 4O4JF 4RD3A 3N5CA 1J42A 2NO5A 2R8YA 3KO8A 1QP4A 1O89A 3HXOA 2CXUA 3MCWA 5C0OE 1O1YA 4GGMX 1R66A 2XVYA 5HOEA 4HR7A 1G3MA 3S7ZA 3SCHA 2O8CB 5B3SC 3CVXA 3QXGA 5F9FA 3E8SA 5K03A 4FQ8A 3OE1A 2PGLA 5CM8B 3S2IA 3JD1A 3HJUA 4BL5A 1U65A 1N2ZA 4MAAA 1WRBA 4EG3A 4A8JB 2KW3C 4M1SA 5AXCA 4B3BA 5AI0A 2PLFA 3KSUA 5E7MA 3ZHBA 4QT0A 4QBIA 1UBKS 5CMLA 2XB9A 1KJZA 3H9BA 1HF0A 3DD5A 3QX9A 5AW2A 1TYDE 1P1IA 2ZRHA 4BNJA 5B7NA 4K6CA 4WY2A 3U4CA 4Y2UA 3M5CA 1R9GA 4JVNA 1COWA 1GT91 1CF4A 2X8JA 1XRQA 4BMNA 4GBMA 1ZIXA 3TQCA 4A6PA 2MSNA 4TWZA 2FR8A 5BW6B 3VR5D 4ACAA 1I24A 3BDAA 3OC6A 4QYWA 4TKLA 1L7NA 2C7VA 5K0BA 4GICA 2AFHE 3T4EA 2GVNA 1T0PA 1MQ9A 4JYMA 4NQZA 1O97C 4Z9IA 4Q4JB 5ALIA 3AHJA 2C2MA 3B5EA 4UFNA 4MSUA 1RHQA 4F9FA 4XB1A 3I6IA 5CIVA 1NDHA 1BW9B 3LDAA 3O8OA 4MKFA 3HN2A 2HAEA 4TKVB 5E9AA 5ARDA 2VDWA 1A2QA 1GNVA 1TZKA 3PFNA 1F6BA 1U8TA 4TV9A 1ENOA 1OCTC 4FKMA 1B2LA 4B3SB 4BKPA 1IY8A 1L4NA 3DUWA 2W2KB 2PO5A 4ROSA 4CRWB 4QJIA 1ZJ4A 4J75A 1NHWA 4HDNA 1Q0HA 4BMDA 3NUGA 1O58A 2R0QC 2SKCA 4BVBA 4YXWD 4G85A 4H15A 2WF6A 2PMKA 4CMCA 1WUIS 4HDOB 5EKDA 2WIUB 3S7TA 4F3YA 1EX1A 4QFBA 4OBEA 1YC2A 2RH4A 1QCCA 3PXUA 1GQAA 1EVLA 5HTKA 2ZSDA 4M0CA 5KWVA 1SVMA 4LZWA 4D79A 1KOFA 3A70A 1MC5A 4IVNA 3EXG1 5THXA 3B3JA 5CEEA 2QRJA 4D45A 2JFVA 1SUSA 4D92A 1UMKA 3GIDA 1CUFA 1XLWA 3GLGA 2GHQA 1AO3A 1P4GA 3O2SB 4N5MA 3LT1A 1SQFA 4MTFA 5F1PA 1N3LA 3ZY2A 4EUKB 2ZAOA 4XDGA 3IJEB 5ECWA 3OKZA 3ZHCA 2J4DA 3UMVA 4NCQA 3BA1A 2D3WA 1O4WA 1J8QA 1SOAA 4OQYA 4GWKA 3FHCB 1EJBA 1SXJD 1F3LA 2XXAB 1A77A 1OI2A 2V65A 4YRNA 2JKYA 3BH6A 3SKXA 1E2GA 3V7YA 3BIXA 3NVDA 4O4LA 3DEIA 3AGQA 1I0IA 2GYYA 4D4JA 1EP1B 1MOZA 1R6TA 3V2UA 4IDOA 4PTYA 2D1SA 3LKDA 1LWNA 2CY0A 4HNHA 2UXBB 1D1PA 1TZMA 5EN4A 1WVMA 3AM4A 5IKMA 5FJJA 2C83A 4GNRA 4DLSA 4W8OA 3K31A 1ZICA 1ZHXA 3OQBA 1VKHA 3BS4A 4X8HA 3H5AA 3E4CA 3LDHA 4BS9A 2PJZA 3DMPA 3OD1A 1CB0A 4CNQA 3MJFA 5THKA 1XTRA 4EI8A 4ENUA 4J1XA 1ORRA 4B9AA 4BRZA 4U7DA 2L7AA 1TZJA 4TYPA 5G4LA 2VF2A 3LLCA 4GMDA 3GGDA 4ZO6A 5FOVA 2IX3A 3KEQA 1BE1A 1FMFA 2IEYA 2ZULA 3EGCA 3DI5A 4RFSA 1YB4A 5FNVA 1CQTA 2P27A 2JGFA 1H2XA 3IXQA 1UXHA 3HU1A 3SYKA 1VHTA 3IOCA 1FS5A 4M0EA 1RHMA 4IZIA 1EE9A 2OKCA 4LZZA 5DI3B 4B3FX 2YWFA 4EF4A 4ZI7F 1F48A 1AB6A 3H2ZA 4Z2YA 2GLXA 4CM3A 2ZLBA 4CMKA 3PJEA 3STVA 4R1QA 2ZIEA 2ZXUA 2QM0A 1LU9A 2PZJA 3O6XA 4BUZA 4QGGA 4X6YA 3K9LA 2X4IA 3HO1A 5KCMA 4KPGA 4IDAA 3TRIA 4LXXA 1OUMA 3RG2A 4RXUA 5IM4F 1QVVA 4NHEA 1R0LA 4GPAA 3H2IA 4HUQB 3KB6A 4B83A 3ZHTA 2YHAA 3V7OA 3RK0A 2HCJB 1PGPA 1NU8A 2A6EF 1KO1A 1LDGA 4BIIA 2ZE7A 3N9IA 1W8DA 1JHXA 2ID9A 2Y9MB 1JAYA 3FMIA 3B6ZA 5FI5A 4NATA 4J07A 1YVUA 1Y5RA 4A6DA 3SHQA 1CJVC 5P8WA 5HP4A 5JVEA 4EJ0A 3HZOA 5ALRA 1OXMA 4OJMX 3PUKA 5AK0A 3IMKA 3BMCB 3K6JA 4MH0R 2JASA 3R3UA 1QM5A 4MW6A 4QNMA 1JKIA 1RBYA 2CCGA 2C54A 4FONA 2RIRA 4DOZA 1W5BA 3MT9A 5LLDA 2MR6A 2P6MA 4EMTA 1SWVA 1XHEA 1R74A 1ORWA 1TZBA 3QOFA 2NWQA 3H1PA 2O07A 2CNLA 4O4JA 3O4VA 3TLAA 1G6KA 2W4QA 1JG7A 1IUKA 1XUOA 1ZFNA 1V3TA 2X4DA 3UF0A 1ANKA 5KJCA 2XTAA 3A2MA 2OB1A 2ZRAA 1F2UA 1GCUA 1U3TA 3V2HA 2EYUA 3DAPA 3IILA 1YWGO 3OIFA 5TPZA 1UT8A 3EAFA 4LDZA 3DEKA 1BH2A 1RXVA 2YS6A 3NRBA 5DGIA 4J8PA 2EP8A 4N01A 2AG8A 3TZHA 4C7XA 1XEWX 1NQTA 4ZT7A 3O8DA 3E53A 5BN5B 3EIWA 5TJHA 3MYYA 1B3BA 4EGSA 1PQWA 5E3CA 3TK1A 3AM3A 4PFSA 5LLSA 2H54A 4A0HA 1P5FA 1A2BA 2OUIA 3WLJA 2B5OA 2B94A 2WP8J 2J7PA 1JKXA 4Y2YA 2H7BA 1LY1A 5HF5A 1RKXA 4EX7A 3E84A 4ZYZA 3SF0A 3UICA 3EBOA 5CTAA 4KDEA 1BOFA 3OFKA 2JJMA 2P0NA 3VJKA 1DMRA 4M9XA 1FVOA 2A69F 2NO1A 3ZQUA 3ZTWA 4Q4HB 1UAGA 2ET6A 4NKRA 4WESA 2YRWA 2MSKA 3KHUA 1Y4UA 2JHCA 1AKQA 2ZRBA 3UV7A 1YL6A 1Z8HA 5K9ZA 3BMOB 4DC1A 2G82A 2KS6A 1TLLA 2X86A 2HIAA 5EWJA 4K9KA 2N46A 5GZ1A 3GLFE 4CLOB 2PBEA 3FDIA 4XFJA 4ZLDA 1EB8A 4NG4A 4W9MC 5A03A 1Q7GA 4HXFB 1BA2A 4PTZA 3GNQA 2IS4A 2R3SA 5K05A 1CDOA 5DM70 1NONA 3FPEA 3VZDA 2JJYA 1AKRA 3HCFA 2IZ7A 1P1JA 2F9FA 4V0OA 3D3WB 5AHXA 1RACA 4FN3A 3RKOF 5FADA 1IWOA 1VLLA 1IIRA 4I36A 1KSGA 2Q5JA 1XDDA 1FS4A 4O6VA 1IOLA 1KO7A 3RJZA 1YBAA 3NP7A 4HQFA 4QHYA 3HV0A 5CBPB 3INNA 1ZGGA 2LCHA 2PD6A 1EGQA 3CN9A 5JZMA 3M2TA 2PL1A 1OTYA 1EUCA 4DQKA 1U80A 1HL3A 1E79A 5EA2A 4GSLA 4OXRA 3U3OA 2W8ZA 1YQTA 4J91A 1NVXQ 3H9EO 1LPBB 1IC8A 5ESXA 4WN9B 2J0XA 4UMDA 4F7DA 2YLGA 1NMQA 1MO6A 1K04A 4GYYA 2XGGA 2C31A 3OE7D 1N2IA 3V4LA 3CR3C 4L6AA 4FI3C 1WKVA 2Y3GA 3E0QA 5LQUA 3I09A 4FHZA 1I6WA 2Q5HA 3B13B 1VKRA 5H3HA 4N7RA 2Z57A 3LDFA 3DZKA 3KT8A 1UZLA 2ATVA 4WFIA 5CH3A 3JSXA 3SCFA 4OFWA 1GAQA 3EIXA 3KHTA 2AJ8A 4IEEA 1KEEA 2X7JA 1V4NA 3WYEA 3IUEA 1RM3A 2LP4Y 1ZM7A 4LYDA 4TTQA 5DCWA 4GHWA 2ZBRA 3LESA 4OJYA 1OZFA 4AO6A 4EABA 4RIFA 4NJEA 4LBYA 5D1NA 4JVSA 1QVWA 3UUGA 2AYZA 2ZG6A 3M1IA 1MRSA 4TWBA 3E5NA 1Q16A 1D2EA 5F7JA 2FRDC 3X2QC 3OZRA 2KLBA 3LMKA 2JJ2D 5C4MA 2I4IA 3RRFA 3HWSA 2C88A 9LDBA 2XE4A 1IONA 3LRXA 5IMSA 4KLRA 3DZHA 3FCUB 3P2YA 2B0HA 5G40A 4ABYA 4AG6A 4IGGA 3ANNA 1WTYA 3OQ6A 3PXDA 3SVLA 2Z5LA 5EMLA 3G0CA 5MFZA 5JD4A 2FDCA 1PZNA 2YV4A 4OK6A 3C70A 2FQWA 3PC4A 4PLZA 2GKOA 4ZI7A 4O0MA 1V5EA 1ZD9A 4MV1A 5DYWA 3PUXA 4WGFA 4ITVA 4Q4ZF 1P5ZB 5KJEA 3W4KA 2V7QA 1SU8A 1E1LA 4NLLA 4WKNA 2XUZA 2YQZA 2NP6A 4OQPA 4DG5A 2JZOA 5JQGB 2CYAA 1GFWA 1XLTA 3OKCA 2A1DD 1N0UA 4CTKA 4NF2A 3ZY4A 4D9EA 2HIGA 2G72A 5IM4A 1J70A 4B6RA 3AETB 4CNBA 3ZCTA 4IV5A 2VPPA 4PYNA 3Q6MA 2BSQA 1VG1A 1I3CA 3LAWA 1UF9A 1QANA 1CW2B 4M49A 5B3IA 2AR0A 2RGXA 3KQUA 4K87A 2XUOA 1J0DA 1REQA 3TSYA 4O2BB 5A3JA 4JC0A 2DCMA 4ETNA 4DLBA 3ACBA 3UBTA 1A8UA 3ZH9B 4KAAA 3PI7A 2O20A 2ODTX 1N32B 5AVXA 2B8TA 1JQ5A 3JYNA 3STUA 3PMRA 1WMBA 3L92A 1VA4A 1IEVA 3L40A 3G5MA 1KFBB 3Q5GA 5L0DA 4KSBA 4XPXA 2HX1A 1WB4A 5JPIA 3B0UX 4CEJB 4S1PA 2GZRA 1X7HA 1TU4A 4KGZA 4RAQA 4KFSA 2CT8A 4Z8XA 3EG5A 5DPMA 1VL5A 4HG2A 1E3LA 2Y6UA 2Q3JA 3RFFA 1BU8A 3WTCA 1IK6A 2B8EA 5AJZA 5FHQA 4NP6A 4N49A 4PCAA 3CLRC 3RODA 2PZKA 4E88A 5LQDA 4M7OA 3JW8A 1YQEA 5AK4A 2YS7A 2V54A 2P75A 2W93A 4BCDA 5CB4B 1D4OA 4KN8A 2IYEA 3FLBA 4KG7A 4JWTA 5ALSA 1OWPA 3IKLA 3EVEA 2BI4A 4PJNA 4UAVA 4RF5A 5C52B 4H7EA 3VO8A 3Q7TA 5K8JB 3HKEA 2GCEA 1X1RA 1M76A 2CYDA 1C8LA 1JB1A 4KODA 2NU8B 1VIVA 4L9AA 5B7QA 2PYIA 3GX1A 3FXAA 3T15A 2WZGA 1QCDA 4HJRA 1L8LA 4JEUA 2QRVB 2ACWA 2CJXA 3CV3A 3ZJ5A 1YQGA 4WBNB 2HBYA 1R0XA 2RHTA 2J3IA 3DDZX 4LY0A 2VZ8A 2WWGA 4L2IA 2V3WA 1OIXA 3RUPA 3PC7A 2X1HA 5JZBA 3HKCB 3PQCA 3N2YA 4MMYB 1MP0A 4AM8A 1QYCA 3ADCA 3D9QX 1ZCAA 2AC4A 4L6CA 3IRUA 1JB9A 3NVAA 2IUYA 3S9OA 4JEIA 1EXMA 2O0JA 3MJTA 3WMFA 4HX5A 5ISMA 3VTKA 4PU0A 5JSHA 1EFRA 1Z5VA 2VPTA 3L0OA 3UK6A 1M9NA 4BQPA 3FWHA 2FZGA 4RTJA 4F2HA 4OIRF 1R1DA 5WRFA 2WSIA 1OWLA 2GH1A 4BQIA 4CE6A 3LX5A 3QMWA 2VRCD 2PJDA 1XZPA 1ONNA 3DEHA 4NQFA 2GZAA 1GGMA 3KUUA 3S8QA 2J30A 4KLZA 1GG5A 3QWIA 2WVQA 3ATPA 4HAXA 2UDPA 2UUAB 1NOKA 2WU0A 3AZPA 1N7GA 3H0CA 5A1JA 4DRXB 5CJ2A 5EERA 1DKMA 3SC2A 1P8AA 2ATCA 2ZS9A 4DJ5X 3AIKA 3EZXA 1J33A 1QC5A 2GEUA 3KL2A 2Q49A 1K0FA 2IVFA 5KYVA 2ZTVA 3D6HA 1QSGA 4W6ZA 2OK8A 1E2PA 2FE1A 4LYAA 3RROA 1MXHA 2VEOA 4D5EA 1ZWLA 1FYVA 3S0XA 4TV9B 5C34B 4CKCB 4EW6A 3GRAA 4LFBB 1A5SB 3VPDA 3K8ZA 2HK7A 4K7JA 5DH9A 1E62A 3H13A 2DB3A 1JDNA 1ECBA 3I28A 3S27A 4QE3A 4KYIB 1HBJA 1N5IA 1WMSA 1M1XB 3K09A 1I51A 2RC5A 1JHPA 2DR2A 3TJZA 3QBJA 3CE9A 1Q0RA 1K4YA 1F0NA 4IH1A 3AVWA 2OQIA 5EIFA 1SEVA 1DDGA 3SZ3A 1J99A 2G7MC 5JT1A 1V11A 4JEMA 4EX6A 2XRZA 3N2ZB 1TZ2A 3B0VC 2HQSA 1KDOA 4JI6B 3F6CA 5F35A 3OMWA 4P32A 1AKEA 3RS9A 1RMYA 2D0DA 4R8RA 3AU9A 3E70C 5GIOE 3RFUA 1C81A 1DRUA 3SSMA 1ZJ5A 1LZLA 1A5ZA 1CP2A 2Q4OA 1NRJB