1QZXA

Crystal structure of the complete core of archaeal srp and implications for inter-domain communication
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
432
structure length
425
Chain Sequence
b'MLENIRDAVRKFLTGSTPYEKAVDEFIKDLQKSLISSDVNVKLVFSLTAKIKERLNKEKPPSVLERKEWFISIVYDELSKLFGGDKEPNVNPTKLPFIIMLVGVQGSGKTTTAGKLAYFYKKRGYKVGLVAADVYRPAAYDQLLQLGNQIGVQVYGEPNNQNPIEIAKKGVDIFVKNKMDIIIVDTAGRHGYGEETKLLEEMKEMYDVLKPDDVILVIDASIGQKAYDLASRFHQASPIGSVIITKMDGTAKGGGALSAVVATGATIKFIGTGEKIDELETFNAKRFVSRILGMGDIESILEKVKGLEEYDKIQKKMEDLTLRDVYAQIIALRKMGPLSKVLQHIPGLGIMLPTPSEDQLKIGEEKIRRWLAALNSMTYKELENPNIIDKSRMRRIAEGSGLEVEEVRELLEWYNNMNRLLKMVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Signal recognition 54 kDa protein
publication title Crystal structure of the complete core of archaeal signal recognition particle and implications for interdomain communication
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Signaling protein
total genus 130
structure length 425
sequence length 432
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00448 SRP54 SRP54-type protein, GTPase domain
A PF02881 SRP54_N SRP54-type protein, helical bundle domain
A PF02978 SRP_SPB Signal peptide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.30 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) Signal recognition particle, SRP54 subunit, M-domain 1qzxA03
1.20.120.140 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 1qzxA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1qzxA02
3MG9A 2H1LA 3UK6A 1OH7A 3ZZ0A 1CR4A 1N5JA 1FL9A 4A2QA 2ANBA 3IBYA 3T61A 2YWEA 3W34A 3O8RA 2F9LA 2R8RA 2W6IA 1CIPA 2ZIAA 5EP3A 1JQJC 4BFTA 1SKQA 3SR0A 3QJYA 1P6XA 2GJSA 5CLQA 1C4OA 4ERNA 3C41J 4JYCA 1HEIA 2D2FA 1YR6A 4MQBA 4QGGA 2ZRKA 2KWIA 2D62A 4FD2A 2PBRA 4W7SA 3THYB 1W4CA 3OEEA 4V02A 4ASUD 2A5JA 2JJ8A 1IY2A 2O8CB 1I2MA 4V0KA 1CS4C 1G64A 1UEJA 2J0UA 2J0UB 2XZOA 4Q4AB 3VHXA 1RJ9B 3AKDA 3NHBA 3KKOA 1E2LA 3K0SA 3REFA 5BWMA 1SVLA 2BIFA 5TDHA 4ON9A 3SEAA 3WNCA 2IK8A 4D0NA 4EPWA 1OYYA 4DT1B 2V6IA 5ELXA 1KSGA 2CHGA 1FFHA 2ODEA 2J87A 3D7MA 5B2ZA 3CF2A 4Q02A 4PSAA 2VBCA 1JJ7A 5HCNA 3DZ8A 1G3RA 1I4DD 1G8YA 4K81B 4Q18A 2A30A 3LDAA 2PXVA 2R44A 1G7CA 5DI3B 3GFOA 4A6PA 1HH4A 2WPDD 4RZXA 1XTRA 4QJ4A 2ZAOA 1SVWA 2YOGA 2GDJA 1VCMA 1MR3F 5AUOB 2PXQA 1JBKA 2P5SA 2RAPA 2YWFA 3MJRA 3ZIAA 4OHWA 1VG8A 1NLZA 2ZVQX 2G88A 2GZAA 2GVDC 3OIUA 4P32A 1GRNA 1WE2A 2CL6X 3SBEA 2CMKA 1TEXA 1XJQA 4US2R 3SNHA 4CGZA 4TMKA 1P9RA 2QSYA 1COWD 3BGWA 4QNMA 2BBWA 1XBTA 2B8TA 2QQ0A 5FPYA 4RKFA 3EW9A 3FGNA 4M1SA 2FX3A 1PV4A 3AKEA 1NVVQ 4PXAA 2CLSA 2BCGY 4NYMR 1T5IA 3LNCA 4IDPA 2MSDB 4OJQA 2J41A 1U8AA 4M9QA 3B1WA 3P26A 3GPLA 2EFCB 2Q3MA 1HT1E 4JLKA 1OFUX 4P33A 2CVHA 1CXZA 3QBTA 4YC7A 5JBQA 3B1YA 4L15A 1ZBDA 1XMVA 4TTQA 2QSZA 1JPJA 1ZM7A 3DL0A 1IONA 1YZUA 3BK7A 1NVWQ 1GILA 4EJSA 2C77A 1ZNXA 2Z4SA 4L5BA 1MOZA 1L4UA 4XWOA 4Q7LA 5AJVB 4C2TA 3ZQ6A 1M7HA 2XAUA 1DELA 4U02A 1NVXQ 3TRFA 3U3RA 3I92A 3I4LA 4N0DA 5M04A 3DHWC 1W0JD 4Q48A 3VNUA 4OHYA 4BE7B 1S8FA 5JHGB 2HV8A 4B75A 1VHLA 3AP2A 4R7ZA 2G9NA 1TX4B 4BLRA 2HCJB 5JJIA 5JS8A 3OFNA 1UAAA 3W8NA 1OE0A 2OG2A 2PL3A 3BWDD 1K6MA 1R4AA 2J59A 4OK5A 4XSHA 2ERYA 2NPIA 1FNMA 1NY6A 2OXCA 2OXRA 3BB4A 4MKGA 5DISB 2QA5A 4Q4JB 4BWYA 1TQ6A 1JXOA 1X8LA 4TL8A 1E1QD 2VP9A 4RVCA 2WSSA 1T3LA 2Y8EA 5CLLA 3QKSA 4D26A 1BS1A 1M8PA 3U7GA 2WIBA 1XEFA 1SXJA 1YZLA 4LJ4A 1CJMA 3LQRA 4MITA 3UATA 4TL7A 3FHTA 1GL9B 2ZS8A 3LY5A 1Z6XA 1XTQA 4A2WA 4ZKEA 4IOJA 1E2DA 1W2GA 1K5GA 1KDRA 1KK1A 2YC2C 4OJKA 3QI2A 3H4MA 5EXPA 4FMDB 4MYHA 1LF5A 2ZITA 4BZXA 3A1UA 2VRWA 2QBYA 4DDWA 2W2VA 3GQBA 1NN0A 2C9CA 3B82A 4Z54A 2W58A 3LLUA 2QU8A 4KLNA 4TL9A 5DE3A 3U44A 1UDWA 3QY0A 4PHHA 1CLUA 4LWZA 2CEAA 2XJ9A 4TWZA 1VG9B 4FCTA 5HE8A 3C4JA 2PX0A 3GJ7A 1Q1EA 3PJRA 2GCOB 4TSFD 2GK7A 2I4IA 3SJAA 2WJVA 4PZYA 4YONB 3GEIA 5FFMA 5F9HA 3CH4B 3IDQA 1RKBA 2IHYA 1WMSA 3TGPA 2FZ4A 1C1YA 4A0FA 1OIWA 4E5UA 4DUGD 1JI0A 3RWMB 3AB3A 2WOJA 3CNLA 1W48A 4DB2A 1II8A 5GAHi 2WWIA 4D0GA 4I1VA 1F2TA 3AQ4A 1TPZA 3ADDA 3THWB 3NBXX 3ADBA 1N0UA 3T15A 2YVUA 2VL7A 1FOEB 1Q1ZA 3K1JA 4G5SA 2QE7D 1TQDA 4MRVA 3WMGA 4R9UC 2X8AA 2JJ2A 3I73A 1KNQA 3CF6R 4B74A 3FFBA 3KQUA 1KI2A 3UG7A 2BJVA 1B23P 3KQKA 1Z22A 3EZ7A 2OV2A 4FCWA 4IOLA 2D74A 2ZSDA 4Q5IA 1G1MA 5TY0A 1KGDA 2EFGA 1VYTA 3G82C 4IXMA 1TQ4A 5DHFA 4ABYA 5L3QB 2HLDA 4H9GA 2OILA 3BC1A 1XMJA 3CR7A 3BH6A 4WIAA 4ZDKA 3DKVA 4QGFA 4TMXA 1F5NA 4QG7A 4Q9HA 2EYQA 3I3SR 2W6ID 1HURA 1XEXB 3FYHA 2ZI3A 4CF7A 4LYAA 4MGIR 4HYYA 4JL5A 2Q3HA 5AJWA 4TT3A 1LVGA 2CDNA 2F3TA 1KMQA 3BIFA 4LX0A 4Z8XA 4QHYA 4DKXA 1Z0KA 5KDLA 1Z5ZA 1D2MA 2IA5A 3NXSA 3SFVA 1BMFA 4D4MA 2PXBA 1TF2A 3WRXC 2GRJA 3GJ4A 1ZUIA 1N3BA 1OH6A 3QPWA 2C03A 2BEKA 3GLGB 4A0RA 5L8VA 1L8QA 2QN6A 1CULC 4PO9A 1T4GA 4C0JA 3NH9A 2FPKA 2YNMA 4ZKDA 3A6PC 4HZUB 2IYYA 4AKEA 4QKQA 3CRW1 2RGEA 3V4FA 3HYTA 4IFEA 4DSOA 1JR6A 5SZJA 5D3MA 3PENA 1EFUA 4XTRA 3QXHA 2IF0A 2RHMA 3VU9B 1KZ7B 2IS4A 3V00A 3BXZA 4Q1EA 2W2TA 5LPNA 2WWHA 4Z1MD 2AKAB 1RW4A 2BVNA 1AZTA 2ODBA 2WWGA 2OBNA 1W2HA 3KQHA 2P3SA 3B7GA 1KI8A 2QGNA 2AFIE 3LQXA 1AN0A 1MRNA 4TLAA 5FL7D 2R65A 1A5TA 5DLQC 1UM8A 1IXZA 1Q57A 3FKSA 4JKYA 5JI2E 1JALA 2QTFA 2Q3FA 2EU8A 1QDEA 3AP3A 3DZDA 1L4YA 2B7CA 4E03A 4BPBA 4ESHA 4GSYA 2VH5R 1KSFX 2QTHA 1GG2A 1LY1A 3CWQA 3QF4A 4M1MA 1UKEA 2C9OA 4YLGA 2D3WA 4HAUA 4X8MA 1UJ2A 1TTTA 4JLPA 4TMTA 1JNYA 2JJ1A 3X1WA 3AVQA 4LJ8A 4N3NA 2QMEA 3QKTA 4LDJA 2KSQA 1FQJA 1QG2A 2J7KA 2IYRA 4DLSA 4MRSA 1PLLA 1OT3A 2VP0A 4QM6A 3CWZA 1VYUA 4LV6A 4HAVA 4NCHA 4B71A 2OLJA 4K46A 3LV8A 2BEJA 1E9AA 2RGNC 3W9YA 1E2KA 1M1YE 3B2EA 2V6JA 3SYKA 2OAP1 1E2HA 3AVOA 2J7PA 3PVSA 1D9XA 1FW6A 2ZPTX 5KO2A 1Z3IX 4LHXA 1KDTA 5DH9A 4QBHA 5DYGA 4QJ3A 2QP4A 2QI9C 5F9FA 2GEDA 4DCVA 3TBKA 4NKRA 3EPLA 2G3YA 4LOAA 3QKRA 2V54A 2C04A 2WKPA 3RRMA 3K70C 5JECA 2BJWA 1Q21A 2IYVA 2XGJA 2ZSFA 1XP8A 4C30A 3E70C 2BBTA 4DEXA 3QQ5A 4HB2A 1Q1QA 1QZXA 3PITA 3GLHE 2PCLA 1AQUA 1CR2A 1Z08A 2ZRJA 2HT1A 4URZR 5EE3A 3EXAA 4TMWA 4C0LA 3BBPA 4TLBA 1P2VA 4PFSA 1ZU5A 3SQWA 1U94A 3A4MA 4C9BA 3H2YA 1AM4D 1ZRHA 1NG1A 4A1FA 1IN8A 1R5OA 3PUYA 4WAUA 2ZS9A 2F3RA 2WSMA 5SZIA 1CJKC 1IN5A 2R2AA 3GJ8A 5SZKB 3RRYA 2ZR7A 3SHFA 1SXJD 1W5SA 3NVAA 4HDOB 4OK6A 1R7RA 1JAHA 1ZP6A 3CRMA 5CJ2A 4EPXA 2SHKA 2XTMA 5FTNA 3AF1A 3FDIA 4P0TA 4B2PA 4YXWD 1T9HA 2J46A 1A82A 3F8TA 3KXLA 5AJXA 1M74A 3IQXA 2W0MA 1NSFA 3KB2A 4QC2A 4ASUA 4Z51A 2ZJ5A 1KI4A 1TMKA 4KVGA 3THXA 2ZROA 4MUBA 3K8YA 5TB5A 3AKYA 4Q19A 1GOTA 2OBLA 3F3YA 3IUYA 4QJ5A 2O8FB 1NKTA 4BFSA 2NO9A 4M1YA 4XJXA 4B32A 2AWOA 3IQWA 3R8CA 1KO4A 3B1ZA 3TIFA 1X6VA 1H8ED 2VHTA 2QNRA 3IO3A 2JATA 5GVRA 1N25A 4PHTA 1KIMA 4URVR 4C3ZA 1OYWA 4ZDIA 2IYSA 1ZNYA 2XJ4A 2WPDA 4A8JB 1GDDA 3EZ6A 2QQEA 1N6RA 2IUUA 4NYMQ 1RIFA 2K5UA 5TVKA 1Q20A 4JIMA 4ZI3A 3U7EB 1E0KA 3LBIA 1UBEA 4RJLA 5KNBA 1E0JA 3MWLA 3MGCA 4GOXA 5LB4A 4C0AC 1OB2A 2NG1A 2VF8A 3NC1C 4O2LA 4JT2A 5HCIA 2WM9B 1ONBA 1ZVQA 1KSHA 1XXHB 3CW2A 3SZRA 1M6NA 2WJHA 1S96A 3ZS9A 2WOOA 1COWA 3K0EA 2YC4C 5CDFA 4HAXA 4RCYA 4AWXA 1F3OA 1I4LD 3U5ZB 2GK6A 4AKHA 4UXHA 2QENA 4N0EA 3RS5A 4NYIR 1F2UA 5EE1A 4CIDA 1LNZA 3QVUA 1DAIA 1N0WA 1Z0FA 2FH5B 1CU1A 4LHZA 4BFZA 3EX7C 2I3BA 1PVOA 5F2EA 4B73A 1CRQA 2OESA 3NDPA 4QXAA 1IY0A 2FG5A 2HYDA 2ODNA 3PUWA 4FN5A 4GOKA 3G0HA 2FFAA 1G3MA 4Q9JA 5A0FA 3KFXA 4C0KA 4JZKA 1ZD8A 3DEFA 4XIGS 1G17A 1Z0IA 2QMHA 1DS6A 1T8UA 2R9VA 2ZQ5A 3K09A 4YMSA 2OFXA 3CNNA 1KKMA 1ZINA 5CYPA 3RYTC 3LW7A 1QHNA 1AK2A 1W0JA 1V5WA 2QM8A 3OF5A 1R6BX 1R0YA 1TL7C 4P4TA 1SXJE 4XWAA 1E0SA 1K5DA 3T06B 5EE0A 2CJWB 2ZAMA 5E3HA 3I8XA 2R6GA 4TYYA 1NMXA 2P6NA 4LUCA 3CZQA 1GITA 4L9WA 1WF3A 4PZLA 4MDEA 3LXRA 3FOZA 3EPHA 4RY2A 1P75A 3RS4A 4PSVA 2ZSAA 1NG9A 4G3XA 1F48A 1OXVA 3X1YA 2VTKA 1E1QA 2YYZA 1TAGA 4JLOA 3ICQB 2BBOA 4D4JA 1RZ3A 4D4LA 4II7A 4PAMA 4DEYA 3FHOA 4GDFA 3AM1A 2XB2A 3OIYA 1ZC3A 5FPKA 4ESVA 5H1YA 3FB4A 1PUIA 4LBWA 4R2HA 2V3CC 3B5JA 4Q00A 2Q0HA 5JSZA 3Q8XB 3AVVA 3VKHA 2WAXA 3L82B 5AK0A 4DJTA 1NL3A 1T3HA 2OE2A 4IDNA 4B3CA 3RANA 2RB4A 1C9KA 3CKLA 4AD8A 5EXXA 2WAYA 3WRYC 1U9IA 5B57C 1MT0A 2PJZA 3UPUA 4UNNA 1G4AE 2VPPA 1Z6TA 4BLPA 3GLFA 3QUSA 4TLEA 4A82A 2XTZA 3CX7A 1Z6YA 3DKPA 3R7WB 1E2IA 2R6CA 1E9RA 1R0WA 2GETA 1KHTA 3NBYC 3C16C 4IDOA 4KFUA 4B3FX 2IS6A 4MKFA 1N6HA 1MO4A 2NO6A 1JAIA 1P73A 3ZJYA 4JVSB 1NLFA 3TVTA 1HV8A 1Q1BA 4TSFA 4R2IA 5FH9A 1AZSC 4DDTA 3NKVA 2BM0A 3D3QA 2RGDA 1V43A 4LSGA 4W5JA 2VP6A 4HLUA 1DAMA 2IWHA 3LBHA 1X8KA 4JYBA 4DUGA 4RFVA 2GF9A 1AJEA 2F1RA 2FV8A 1G8GA 2OFOA 1QHYA 4LY6A 4E07A 3NIBA 2ZRGA 4RZUA 4Q4LA 3LX8A 3PV0A 1N6IA 4RKEA 4I81A 1DE0A 2QE7A 4HDQB 4KBFA 4B76A 1T8TA 2WKQA 1JQLB 4AG5A 1G8FA 3KL4A 4IEEA 621PA 4RD1A 3H84A 4BEJA 2PEYA 4JLBA 4X8LA 3SC3A 1AQYA 3EPKA 3N2EA 1DULA 4PHGA 4B2LA 2JLQA 1E2EA 2QM7A 1EFCA 2OCYC 5FUYA 1NNEA 1OPXA 1XF9A 4B6EA 1IBRA 2VA8A 2KBEA 3N2IA 3HR7A 1AKEA 1WCV1 2GNOA 4QBGB 2H92A 3TKLA 4BASA 3K0FA 5B64A 2JDIA 4C7OB 1DVRA 4C7OA 2I1VB 2AWNA 2PT7A 1JPNA 3BH0A 4F91B 3U61B 3U7HB 2V1XA 1IXSB 1Q44A 2ZR0A 2VHJA 2DFTA 3CPJB 1OH5A 2ZJZA 2PXDA 1H65A 1N6KA 3N5CA 721PA 3PQCA 4KFTA 2QAJA 1F6BA 3WNDA 3A58B 2ZUDA 2H17A 3GLHB 2QTVB 3GLHA 4LRWA 4PHFA 1VYVA 4I1OA 4LHVA 4MKIA 4RD6A 1S9DA 3VR5A 2QZ4A 2VIIA 1VECA 5DNYB 4G01B 3W5IA 3PUXA 5FOVA 3REGA 2IL1A 3U60B 4ZV4A 5KOYA 3VKWA 4I1SA 2PXEA 2FGKA 5EZ5A 3PEYA 2IF2A 1RRFA 1U90A 2H5EA 4HUQA 2GCNA 3T12A 2HDNB 2Z5FA 2P2LA 2HJVA 2GBLC 5CITA 2BHRA 2ZRFA 2ANCA 2MMGA 4UJ3A 1TF5A 4D82A 1X1SA 2FDCA 1OXUA 1GSIA 2G1KA 1OXTA 4Z1MA 3FKQA 1IN7A 1RC8A 1ZC4A 1EFHA 1XTSA 2P6UA 4AG6A 5FL7A 3TR0A 5KU1A 1EWQA 4D25A 5BXQC 1G20E 4PC7A 2ONJA 2G6BA 4AKGA 4V0ME 3EC1A 4BUJA 1QB2A 3B9QA 4BZQA 3R9WA 4HSEA 4Q1BA 4XWKA 1XCPA 2BMDA 1M7BA 5J40A 1NKSA 4Q03A 3L0PA 2V4ZA 2V55B 1G7SA 3UXMA 2WMNB 1Y63A 3T5DA 3KTAA 3QVVA 4TYQA 1G9XA 3H1TA 1Q22A 3MAAC 1HYQA 3GD7A 5BN5A 2CHVA 5GJWC 1OFIA 4GFDA 3OHMA 5CIQA 5FPSA 4CDGA 1NN3A 1S1MA 1W44A 2C9YA 3PR1A 5P21A 1T6NA 4GT1A 2OHFA 5G3YA 4A0HA 3BE4A 2AK3A 4FW9A 1W47A 2Z0MA 3JZMA 1G291 1GRQA 4EJSB 4PQFA 3EIHA 3QENA 4OQNA 5IK2D 2O5VA 1PZNA 4PC3A 2ONKA 2PLFA 4R71A 3CM0A 4TZ6A 4MRPA 821PA 3OE7D 4HZIA 1CRPA 3GJXC 4BLOA 1J2JA 3FTQA 2ERXA 2GJKA 2XTNA 5KNCA 1WB9A 2A5YB 3SDZA 1S4QA 3ZVLA 1BYIA 5JI3E 2NQ2C 2MMCA 1GNQA 1HQ1A 1J7KA 5JFGA 3B1XA 4DLZA 3SJZA 2N1BA 3W5JA 2EFDB 2UZIR 3OEHA 2AXPA 1XCGB 3NEYA 4OQLA 1UBGA 1CTQA 3L0IB 1DAHA 4JJZA 1KSJA 1OFHA 2IS2A 1MO3A 2NZJA 4FMCB 2GXUA 3QKSB 4IOKA 5DO9A 5J4KA 2ZE6A 2ODWA 3GMTA 4KODA 2PJRA 2Z43A 1E1RD 1SXJB 4FMCF 1S0UA 4QHTA 5UKDA 3RLFA 1VKJA 4LGMA 1G41A 3D8BA 1RYHA 2C8VA 1BH2A 4LJAA 2D2EA 3AUYA 4M1OA 3E1SA 3QIAA 4YXWA 5FOSA 1KI6A 3I32A 5GJVC 3HR8A 1ZIPA 2ORWA 1WA5A 1E9CA 2O0JA 3LVQE 4UXJA 1WDTA 1WQ1R 2IYWA 2HUPA 1ZIOA 2QBYB 2C96A 4YDSA 2P6RA 1D5CA 2UZ3A 2KE5A 1XJCA 4YMTA 4FMDF 3K70D 1VCNA 3TK1A 4WA7A 1BYUA 1ETUA 5G41A 3U44B 5JMTA 1E6CA 1E0AA 3U3OA 4KLZA 1CKEA 2ZR9A 1H8EA 2QMOA 4NONA 1GZSA 1PJRA 1W5TA 2REOA 3KJIA 3HPRA 2H18A 4ARZA 1XD2A 3TMKA 3EIQA 4QGAA 1JJVA 5CDFE 4JLMA 1TQ2A 3K9NA 4LI0A 5HZHA 1OV4A 2XOKD 2G0NA 4S35A 2ZI6A 2NZ8A 3QG5A 4DCNA 4M21A 3GLIB 3AVYA 2WJIA 2XZPA 2BV3A 3F0TA 3H86A 4EQ6B 2YJTD 1G6OA 4EQ6A 5BW8A 5EP4A 1KO8A 4IJMA 4A36A 2WBLC 4GZMA 4Q21A 4TN1A 3B1VA 4PTLA 4NYIQ 4CEIA 4K8OA 2FGJA 1II8B 5FL3A 2J0VA 3ND9A 4JJKA 1F2TB 3PEUA 4KV9A 4PC1A 4A2PA 1VPLA 2XB4A 4I1UA 4OI2A 4URXR 2A5FA 3CH5A 4CW7A 2NMVA 4DCSA 4U00A 4AI6A 4PPQA 4B3BA 4PAOA 3LH5A 4F4CA 3GCGA 2ZANA 1GM5A 2BMFA 3LA6A 1ZNZA 5B30A 4IEIA 5KPDA 3FVQA 5TMPA 4MYCA 1E2FA 3EASA 2FMXA 1W46A 1Q12A 1TADA 1A1VA 1OSNA 3RRZA 2GBLA 1D9ZA 2R6FA 2PEZA 5FI1B 2JDID 1S9HA 3I61A 4PSKA 3QE0A 2C98A 2QPAA 4WVFA 3P4XA 4W5WA 1JB1A 2JA1A 1E94E 1MRSA 5KSZA 4QNRA 5JWHA 5E4FA 1O3YA 4OK3A 4LBVA 1GKUB 2JLXA 2OCBA 4L9SA 2ZU0C 4GPTA 4YQFA 4P3YA 1Z8FA 1F60A 3MCAA 2FWRA 3C5HA 5EJEA 2A9KA 2MSCB 5KSYA 3U4QA 2FSIA 2J3EA 1ZUNB 3IHLA 3VMFA 1UKYA 3C5CA 1G8PA 3O8BA 1HUQA 3TVDA 4ZCIA 2IXEA 2JLUA 1RPZA 1Z6GA 2GAOA 2P65A 4A8JC 1N6LA 1VIAA 3EZ9A 3W3AA 1FX0A 3K9LA 1G19A 3WP0A 3GLFE 3UMFA 2ZETA 1Z6AA 2NTYC 3CF0A 5LD2C 3RAPR 221PA 5D3MB 2FFQA 1XTJA 4RD2A 2DB3A 4P4UA 4A4DA 1OIVA 3Q3JB 4YDHB 5HZKA 4M1KA 3M1IA 3CRRA 3K53A 5FUWA 1EFTA 1EGAA 3VTKA 1P72A 3SBDA 2CNWD 3GJ3A 2YWHA 1ZUHA 1YE8A 4V0OA 2QL6A 5FOWA 4AKIA 4G1UC 2QAGC 4C0QC 1KO7A 5FBQB 1W36B 4DLYA 5HTKA 2QPTA 1OW3B 1J99A 4QL3A 3U3KA 4KXFB 5CK5A 1NJFA 2H57A 1SVOA 3Q85A 3T1OA 2ZJYA 1CBUA 2J45A 2F55A 5JLJA 5CM8B 4ZO4A 1EWRA 1LW7A 4Q1CA 3TAHA 4LC1A 3QF4B 5GAGi 3PEVA 2CE2X 3LW8A 1IJFA 3GEEA 4LJ7A 3PEWA 2CXXA 1Z2CA 1G3UA 1YU9A 1WBDA 4UXIA 1UPTA 3EWAA 2AR7A 3FMFA 2G83A 4W5HA 5DN6D 3B13B 4FIDA 1MO5A 4ILEA 3PUZA 4V0MA 3S1AA 3T34A 2WJGA 1E9BA 1FUUA 2OBMA 2WHXA 3EIEA 3KKMA 1OH8A 4G5RA 2FEMA 2HJGA 3V9PA 1HA3A 2B6HA 4Y0VA 4BLTA 4UQOA 2ECKA 1E98A 1JEEA 2GILA 1DO0A 3EG5A 3X2SA 1CJVC 2PMKA 1N5KA 3NH6A 1E2GA 4C0HA 1B0UA 1XEWY 3L0SA 3QBVA 4JVMA 5J5CA 2HT6A 2TMKA 2F7SA 3IGFA 2Z83A 4FINA 3ASZA 4BRWA 2CE7A 2FSFA 3AVPA 3IILA 3QKRB 2IWRA 1XX6A 2ZRDA 5FR1A 1NN1A 2ZRIA 4C2UA 2ZRMA 1H8HD 3KJEA 4Q7MB 1G8HA 3MWYW 2CVFA 1DAGA 5FR2A 1XMSA 4UNPA 3KQLA 2H7VA 1OB5A 1E32A 3OEHD 4OQXA 3DPUA 3SN6A 3I8SA 2P0EA 2PLRA 2GEVA 5E95A 3TAUA 4RD3A 1DG1G 2W0SA 1JEDA 5DYIA 2WVJA 4NCIA 4RCZA 3FHCB 2WICA 3TNFA 5FUVA 3W3ZB 1RFLA 2BMEA 1U81A 2LKCA 5E7MA 4C0BA 4BRUA 4KFSA 2GJ8A 5AR1A 4GL2A 5FUXA 5BN3A 3ECCA 3TW8B 3QXJA 2FOLA 4M2LA 2QUZA 5HPYB 4PO8A 1US8B 2QG6A 1US8A 2OLKA 5EP1A 2BC9A 4NCNA 5D3QA 5SZHB 3A4LA 4GI7A 5JWOA 2JLZA 1YHNA 1W49A 5JEDA 2FE4A 3UG6A 3I5YA 4EKDA 3L8YA 3RC8A 4TL6A 2RGCA 3R8FA 1AIPA 5EE5B 4BEBA 4A0GA 1DG3A 1KAGA 5EUMA 4OHXA 3ZZTA 1U0JA 3K0CC 3MSXA 4IRUB 4UJ5A 1ZM2A 2QRZA 3THXB 2WV9A 3FE2A 2ZI4A 3NBZC 3DOFA 3Q5EA 1KDPA 4KSCA 1XRJA 3Q72A 3EZFA 5KDOA 1YKSA 3R20A 2F1JA 1M7GA 1YZTA 1LFDB 5JS7A 2O52A 3AVUA 1R5NA 3TQCA 1TF7A 2CCGA 4DCUA 1E9DA 2BKUA 2ZRAA 1E79D 4GBMA 3IEUA 3D31A 1IAQA 2OZEA 2Q9CA 2WJJA 4LJ5A 1VG1A 3UWOA 1DTSA 1DAEA 1UFQA 2ZVPX 4TYNA 4URWR 1NIPA 4YMVA 4B34A 4E22A 5EXSA 3WYAA 1OKKA 2A5DA 5DI9A 2WWFA 4A15A 4TLDA 1IOZA 4HEJA 3OZXA 1E96A 4U7DA 5DHAA 1TU3A 4FXPA 5JRJA 5KTYA 1E2JA 3WMFA 2JQEA 4PZZA 5CM9C 2NO7A 5G3ZA 3SQXA 5HKKD 1XZPA 2QT1A 4D0LB 5FTKA 4POAA 1UKVY 2JLRA 4A92A 1XDBA 3KFVA 4V0LA 4CEJA 2A7QA 2IUSA 1W1WA 2OCAA 3IBGA 4LC0A 1OHHD 1F2UB 4CEHA 1TNDA 3VQTA 1D2NA 1YR8A 2Q6TA 2F6RA 2ZYTX 2CBZA 5EE9A 2VQSA 2ZI9A 1ZMXA 3A1WA 2XXAA 3OAAA 1NMZA 2O8EA 4QBFA 4JL8A 4BECA 3ADCA 3BRWD 5IK2A 4DSUA 4MDFA 1YZNA 5CYOA 2CK3D 2QAGA 1ZYUA 3MUFA 3CLVA 1MFQC 2QMUA 1QHXA 2HF9A 2HEIA 3JVUA 1BO6A 2A78A 3OE7A 5AWFC 3WP1B 4BZPA 2W00A 3AF2A 3DMDA 4DWJA 2GJAA 1FZQA 4PPNA 1CR1A 3Q7QA 1XWIA 3A8TA 6Q21A 2O8DA 2B8WA 1DADA 4I99A 1SVIA 4PQYA 2JLWA 4CVNA 4BLQA 1E9SA 2RGGA 2R62A 5HR5A 5JCZA 2ZYWX 2DFNA 3NC0C 3MMPA 3TE6A 1XPUA 2OFWA 4OHVA 2QRNA 3UKDA 4Q4HA 2X19A 2FU5C 3AF3A 2BWJA 4PX9A 4G0NA 3EA5A 1ZM3A 4JLNA 4FWIB 4D81A 4KU4A 3TW4A 1XNJA 1N6PA 5JJKA 2IUTA 3LWNA 2PZEA 3C14C 2FPMA 2IS1A 2GHIA 1N0VC 1Z07A 4WOPA 4GOJA 4WXPA 1OXXK 1QHIA 1E1RA 3TLXA 1KMHA 4HAZA 5JSZB 4IVRA 1XFAA 1ZJ6A 3IKJA 3M0EA 3AVWA 1I4TD 3CX6A 4EFNA 2VHCA 3ZVNA 2RGNA 4DIEA 3QXCA 3ADKA 1EK0A 3QXXA 5C4MA 1A2KC 2EWWA 2J9RA 3GLFB 1IN4A 1G3IA 2QP9X 1YR9A 3P20A 2C2HA 1A4RA 4QFMA 3M4YA 1KI9A 3K70B 4IHQA 3WHLA 1R8QA 2ORIA 4EJSC 2RHDA 3EZ2A 3Q9LA 4BQSA 3KJGA 4OQFA 4TQAA 1GRRA 4ZDWA 2W83A 1QHHA 2DFLA 1NBMD 1S3GA 1NY5A 2ZJ2A 1ZU4A 2PXFA 1U2RA 2OCPA 3CRQA 3B8HA 3ETLA 3KKPA 4Q9LA 1Z29A 2HYIC 4QGHA 1CR0A 2OEPA 4ACBA 3PXGA 4DDVA 2YWGA 1GUAA 2VYFA 4ZCLA 1SGWA 4KBGA 4HB4A 4LHWA 3CRVA 2XOKA 3FMIA 2PT5A 2WIAA 3MWKA 2FA9A 5JEEA 2RCNA 5G40A 4IFBA 1AA9A 3Q5DA 5KNDA 2ZRBA 4MGYR 3U6KA 4XVQA 4P4SA 4HAWA 3DOEA 1P4SA 2IYZA 4JBXA 2ZTSA 1G21E 1G7RA 1MABA 2KJQA 2IT1A 1Z63A 5K8LA 2PXPA 2QEQA 5KSOA 1DO2A 2XEXA 1P9WA 3CB4A 1E3MA 1EFRD 1JR3D 1U8YA 2C78A 2REXB 1KTVA 4IOMA 4OBEA 2AXNA 1XD8A 3SJBA 1IM2A 3KKQA 3BH7A 1HE1C 1GWNA 3IPYA 1E4VA 2QORA 2GTPA 1P2UA 1IHUA 2FN4A 3BS4A 5G53C 5JHHB 1LB1B 1RVDA 4NU0A 5FI0B 4XTCS 5FOUA 1P61B 1P3JA 2DFKB 3K0AA 2XZLA 2W6JD 3VX4A 2NPFA 1DEKA 5J4LA 1KI1A 3SYNA 3U3MA 3DM5A 1PLJA 3RRNA 1YRBA 2NGRA 1Z2AA 1HY3A 5KPJA 4HI0E 4HUTA 2V7QA 3ZYCA 2DYKA 4L4UA 3KKNA 3K0FB 3WXMA 4ZIRA 4DBLC 3P1JA 4TTPA 2PH1A 5IF9A 2CLDX 3OIVA 4CT4B 2GXQA 4ACAA 5BN4A 2ZI7A 2VSXA 4QRHA 3CZPA 4W9MC 2IC5A 1HTWA 3LVRE 4F38A 1J90A 4PAQA 4LBYA 3AEZA 4XSGA 521PA 1JXMA 3G5UA 4LJYA 1NLYA 3GLGE 1E4YA 3X1DA 1GL6A 3L0OA 2FSGA 4WW0A 4XD7D 3ZH9B 2P5TB 2OAQ1 3U6BA 2E9SA 5EUQB 1Q3HA 1TUIA 4JVLA 4MKHA 4B2IA 2Q21A 4HB3A 4TYPA 2QROA 2D4HA 4ZDJA 2A3RA 2X77A 1ZD1A 3VR3A 4CT5A 4P31A 1S1CA 1HQCA 1E99A 4HUQB 3WYGA 4A6XA 2E87A 1ODFA 3A4NA 4PPFA 2ZI5A 4ZCMA 2MSEB 2ATXA 4PANA 1HE8B 4HB0A 3THYA 1NBME 3SS8A 3I62A 2CNWA 4BGDA 2F1HA 1XB2A 4AYWA 2O8CA 4NPHA 2ZUBA 5E7JA 3LLMA 3GJ6A 4Q4AA 1RJ9A 1YR7A 3KXIA 1RRGA 1OKKD 4IXNA 1EG7A 3A1VA 4QHSA 4QM7A 4EFMA 4ZI2A 3MLEA 4JMPA 1G4UR 1KK2A 1W0KD 3EC2A 4IDQA 3SHWA 1MH1A 1P2TA 2BKEA 2YOFA 3FFAA 3RDPA 4DT1A 4F4IA 5C1BA 1YZQA 1I2DA 4B48A 5J47A 3HU3A 4EPYA 3QF7A 1LV7A 4US1R 2N46A 2O8BB 2O8BA 4URYR 1XCMA 3KTAB 3DVLA 1JR3E 2IYTA 3IIMA 5DI3A 3U7FB 2R6AA 4D4KA 2PX3A 1WRBA 2CCJA 3T1QA 4JKIA 3B6EA 3KJHA 2GJ9A 3OESA 2GAAA 2VHUA 2YHSA 1P62B 2ZSBA 5DN6A 5C4GB 1X3SA 4Q1AA 4Q7KA 8OHMA 5JZVA 3EARA 2RMKA 2LKDA 3MRSA 2YKGA 3B85A 3OAAD 1FTNA 2O0KA 2R6DA 3ZZUA 4TMVA 1M34E 1N6OA 3P4YA 5IHPA 1R0ZA 4DLUA 4B44A 4WZAE 1P7CA 4AYXA 3KQNA 4TQUS 1SKYE 3VKGA 2JASA 3CIOA 1G5PA 1WXQA 1KKLA 3QNUA 2GVZC 3RS0A 1E2QA 1ZCAA 4G5QA 4LV5B 4QBIA 4EIWA 1RRPA 1OXSC 2FPLA 4LYJA 3VR4A 1P60A 2YV5A 2EFHB 4JT4A 4XVUA 4GNKA 1H8HA 1XZQA 1VTKA 1NF3A 2ZE5A 2ZYUX 4GRAA 1QVAA 5J4YA 5FTMA 4EAQA 4L16A 1CJUC 2AHOA 3H0KA 3SE0A 3TSZA 4UNRA 4NYJR 3AP1A 2WWYA 1GIAA 3DM9B 2G77B 2L0XA 2ZUCA 3C8UA 4M9SA 1W36C 4F4JA 3DMNA 2CHQA 2PMDA 3B78A 2D7DA 4DDUA 3E5HA 1MV5A 2NIPA 2IXGA 1E2NA 3LRPA 1U99A 3IIJA 3UWKA 3D6TB 2DHRA 5KSPA 5GJCA 2F43B 1DPFA 2F43A 4HATA 1XEWX 3T1TA 2HXYA 2JIZD 1ZM9A 1EESA 4DZZA 1E9FA 1K8RA 2PCJA 3V4RA 2PXUA 1KI6B 2CL0X 2IXFA 4Q4JA 4DVGA 1UBCA 2UKDA 3O8CA 1O87A 2DBYA 1IQPA 2Q9AA 1KYIA 3HPQA 1HQYE 2J0QA 2VF7A 1PUJA 3IO5A 3CONA 3CUEF 4Q47A 2WTUA 2OM2A 4F92B 1NVUQ 2EQBA 1KJZA 1T0HB 4M22A 1Q0UA 3EWSA 5AUQA 3WMEA 4C4PA 2X1VA 2FFHA 4NP6A 2IYXA 1FUKA 1RYFA 1NP6A 1Z83A 1W7AA 5IDVA 3TJZA 4RZ3A 2ZXUA 2VSFA 1L7VC 4H1UA 2BMJA 4F93B 2XX3A 3TR5A 1KK3A 4ARZB 2HXSA 5ANRB 3NBFA 3WY9A 1E79A 3PFIA 1QBKC 1XD2B 3QKUA 3O8DA 4MGZR 2PXTA 1YVDA 2H8KA 3GP8A 4PC2A 3W6PA 1T3SA 3I5XA 4NCJA 4MH0R 4DC9A 4RZ2A 1YZGA 1DAKA 1VCIA 3ZD7A 2A2ZA 2RKOA 1SVSA 3O47A 1NRJB 3RHFA 4CEIB 3RSOA 4M4SA 1G5RA 4KYUA 2IX3A 2PZGA 3BFXA 4TYWA 3NG1A 2B92A 3M6AA 1XXHE 2ORVA 1XPRA 5K8TA 1L2TA 2GXAA 3ASYA 4M53A 1CF4A 3B60A 2GCOA 1OLOA 2PZFA 5HKKA 2RGAA 4R98A 4LV8B 1WP9A 2RGBA 3MFYA 1VDZA 2CL7X 3LQQA 4NZYA 4NH0A 1GFIA 4MRRA 1XD9A 3QPUA 2G0TA 5FBRB 2KBFA 3IEVA 1II9A 3AGPA 1S2MA 3Q7PA 1G3QA 4JVNA 5GVSA 1KNXA 2JLYA 2XNDD 1N5LA 1OHHA 2CLCX 2XITA 2IEYA 1XTIA 2ZEJA 1TUEA 3GLIE 1FQKA 1P9NA 1Q3TA 1XU4A 3MJHA 4HLQB 2AKYA 4EPVA 3HU2A 3QSYA 2H16A 1Z06A 3UANA 3THWA 2V7QD 3GFTA 1FNNA 4KJZA 2EW1A 4OHZA 3QEOA 3DO6A 1CJTC 1G7TA 2WZQA 1W4AA 1E2PA 4O3MA 4Q9KA 1GNPA 3RVBA 1CP2A 2CK3A 2JLVA 3BB3A 3BB1A 4O25A 2XSZD 1SQ5A 2VO1A 3HP1A 3L2OB 3ZD6A 3OIWA 3F5FA 5H68A 3WYFA 1QHGA 3FWYA 4O0MA 5KDDA 2DY1A 5AJZA 2GCPA 2ZM5A 5L3QA 5L3VA 4E09A 3U4QB 1WGWA 1CEEA 3GFPA 3KZ1E 5KYKA 2AK2A 3CX8A 4DB4A 4NHOA 3BD9A 2JLSA 2VP2A 1FX0B 1A2BA 2G1JA 4DSNA 4JSYA 1XEXA 3E2IA 5GJBA 1BOFA 2X2EA 3WBJA 3CBQA 4H1VA 5FOXA 4NL4H 2OSBA 2J0SA 2GEUA 4EUNA 3LBNA 2E1RA 1SULA 4M9XA 5LDDC 4KCGA 4OI0A 2Z4RA 4GP7A 2BCJQ 3ZQJA 3NHAA 3KXKA 4KO8A 2VP4A 5AJYA 3OEED 1VHTA 3WBKA 4YMUA 2KB0A 3KB1A 1A7JA 3GLGA 1R8SA 1UDXA 1KZGB 4HZUA 4DLVA 3T35A 4B6FA 3W6NA 4CZ2A 2RH5A 3NDBB 4D6PA 4DLWA 3AV0B 2J5XA 1IN6A 1G16A 3TUIC 4GMDA 1DBSA 3SJCA 2AL7A 3J81k 1LF0A 5EQTA 1TEVA 1EX7A 1FMJA 4X8OA 5L3RA 1P5ZB 1X1RA 3VU9A 4F7WA 4RSGA 4KHZA 1AKYA 4NBSA 4EDHA 1N2CE 1QVRA 3TH5A 4G5OA 4OI1A 2IEZA 1J8MF 2OT3B 3K09C 1SZPA 1NBMA 1LTQA 4L8GA 1KI7A 4U5XA 1NMYA 3NWJA 2ASEA 3W6OA 3T5GA 3FPAA 2N42A 4B3XA 121PA 3L8ZA 2JCSA 1AS3A 4URUR 3ZIAD 4KITB 3KDSE 3S1AB 2O0HA 1NJGA 2AFHE 5DGXA 4M8NE 4KFRA 4M1WA 4MYTA 2AN9A 4O2RA 4WBSA 5CB8A 1R10A 5K8UA 1FP7A 3KX2A 4Q7JB 2WMOB 1BIFA 3ICEA 2FFBA 2J1LA 1EXMA 4PC6A 4UKDA 4WZBE 3RSLA 4B43A 3VAAA 2CCKA 5CJPA 3SYLA 1SHKA 5CB6A 4DHEA 3SU8A 1GAJA 1EFRA 1JR3A 1LS1A 2DPXA 2OUKA 3UMSA 1KDOA 4M0LA 4NMMA 2BBSA 3TSWA 4MA4A 4YMWA 1R0XA 1HT2E 4PPGA 4HLDA 2ZU6A 1J70A 4JSTA 4TQ9A 2AX4A 3HYRA 4LHYA 3CNOA 1MO6A 5J4VA 3PCRB 3SFZA 3UMRA 2YOHA 2W6JA 1XTKA 5EZ6B 2ZRHA 4XH9B 5FBVB 3W90A 2NOAA 4FMBB 2WJYA 1U9IC 4HAYA 1NVVR 1UADA 4S2EA 2EVWX 3X1ZA 1FPMA 1U8ZA 4JS0A 5LBIA 3ZS8A 1GKYA 1UF9A 5DSZA 4BFWA 1QHSA 1ZAKA 3AH8A 4DLRA 1SKYB 1SHZA 4BFYA 5FOTA 4IKEA 3QPVA 4A9AA 2C99A 1IJEA 4KAXA 5TV2A 5J4HA 3A1TA 3ZLJA 3BORA 5DIFA 5K8IA 1KAOA 1G6HA 3SI7A 4QOSA 5BYJA 2FZLA 4EFLA 3OFND 3RS2A 3A37A 2GWHA 2VEDA 4B3GA 5KUTA 3BERA 4UNQA 3QG1A 2I1QA 3QXSA 3EPJA 4KVAA 4G5GA 3I1FA 4LZZA 1UBFA 3CPEA 1ZM4A 4JLAA 2WSSD 2QGZA 4KI0A 4XD7A 4BFUA 3KUCA 2XNSA 5JWRA 4DCTA 3TUJC 3RC3A 4V0NA 2AD1A 5FBLB 4HLUC 2IYLD 1GL7A 1QRAA 3PG5A 4LJ6A 4ITRC 4D80A 1OF1A 2Q9BA 1MKYA 4JLVA 4FWTA 4TZ0A 4LK2A 3PUVA 1VIYA 2HCBA 1XJ0A 2ATVA 3FMOB 421PA 4NCKA 2FJUA 4J0QA 2ZJOA 1KJYA 3P27A 1VMAA 3LFUA 5JCPA 4XOIA 3MWJA 3EA0A 4OL0A 2P67A 1D6JA 1Z0DA 3TUZC 2RGXA 3TSOA 2BDTA 2GESA 2LWIA 4IDHA 1YJ5A 5FPTA 3U2QA 2GF0A 1W4BA 1IY1A 4LYHA 4C0SA 4FCVA 1II0A 3BOSA 4JBWA 4KYIB 3K9HA 2JEOA 2VSOA 3MD0A 1D8TA 1KK0A 3A36A 3I72A 4IVPA 5TXGA 4AYTA 4NTZA 5GADl 3RS3A 2DWQA 4RD0A 3ZGXA 2O8FA 1Z0JA 4B33A 1NN5A 5C2JB 3VX3A 3VFDA 4RD4A 4XVRA 4ZPXA 3AUXA 2V8OA 2QT0A 1FMLA 1PLKA 5EP2A 5JRZA 1OFTA 1W0KA 4RFSB 4RFSA 4OQMA 2NO1A 3JVVA 4WXRA 5LB2A 1U98A 3CO5A 3ZVMA 3AKCA 1E9EA 3X1XA 1EX6A 5TARA 4DLXA 2ZRLA 3P32A 4Q1FA 3VR1A 1RRCA 4EPTA 3T1VA 3B9PA 2QY9A 5A5GA 4CEJB 3LO5A 4Z8YA 3GJ0A 4CRWB 3VHLB 3ZVRA 3BFKA 1YQTA 4A8JA 1GKIA 2ZRNA 4V03A 4TLCA 4CEHB 3IPXA 4UNSA 3R9IA 1LS6A 1AGRA 1VCOA 4JLDA 5LD2B 2YZ2A 2PXLA 1P2SA 3AVTA 2OO7A 1R2QA 4FI3C 4PQRA 2NO0A 3DDCA 2XXAB 3FMPB 2O8EB 1DARA 2D7CA 2F9MA 3LXXA 2QP3A 3QOFA 4HDCA 1XXHA 3IHWA 3WNBA 4DXAA 2ZJ8A 2EYUA 2PXKA 2V1UA 1AGPA 1JECA 3HJNA 2VHQA 4NYJQ 1GP2A 3U3JA 1IXRC 2JJ2D 3VNVA 2REBA 2V9PA 2VLIA 3R9XA 2QAGB 1N6NA 2JAQA 4IW3B 2AD5A 1NSTA 2QPOA 2DCUA 2ZSEA 5JJLA 4M9ZA 1GVNB 2C5LA 3GLIA 2O8DB 2HLDD 4Q66C 4M1TA 5CK4A 2HF8A 4X8HA 4PO1A 1QF9A 1DOAA 1FTSA 1R5BA 4GP6A 4OKSA 2YINC 3VR6A 2ZJBA 4CYMA 2IW3A 4AIIA 2ZE8A 5CIWA 2D06A 2GA8A 4Q4HB 5AUNB 1U0HC 2WKRA 2BOVA 3JZAA 5HE9A 4DSTA 4TT3D 1KI3A 3BAFA 3AGQA 2ZRCA 2ZS7A 4OI4A 1KMHB 1BMFD 2CJWA 2VP5A 4TMZA 3QEJA 2BM1A 3C15C 4MRNA 1T0JB 1ANKA 3ND8A 2JIZA 4US0R 1ESMA 2EWVA 1U0LA 3BJIC 3RABA 3RS7A 2DWOA 5IT5A 3AF0A 1E69A 2ZREA 1Z28A 4B35A 4DLTA 1Y3AA 2GXSA 2IHBA 3PIRA 1UEIA 1UKZA 4MUAA 4HLCA 3SOPA 3RNLA 4DRZA 3HWSA 2ZE7A 4LBZA 4TTRA 4LCBA 1KY3A 3UIEA 5A4JA 2IYUA 2ZRPA 4GMXA 4PR0A 4Y0AA 4JBYA 2B21A 1G18A 2FEOA 3N70A 2DR3A 2FSHA 1DAFA 2WWWA 1J8YF 1E2MA 5FBWB 1QHHB 1ZW6A 3LD9A 3NEJA 2JGNA 4IVQA 4AK9A 1BKDR 1N5IA 4GZLA 2UVQA 3C7KA 1WBBA 1W36D 2DWPA 1XMIA 2ZYVX 1Z0AA 3FKSD 3WHKA 4OYHA 5F98A 4WZ6A 3VR2A 3R7WA 4DIDA 3HDTA 2WWXA 2A5GA 2KI5A 3ZDQA 5C46F 2GZHA 2FF7A 1AS0A 3GJ5A 4JLJA 4Q9IA 4P4SB 2X2FA 5F3WB 1FP6A 1SVKA 1TU4A 1QG4A 1W4RA 1MABB 1OJLA 3LX5A 4KSBA 5B58C 3THOA 3AVXA 2FNAA 5H8WA 5FTLA 5E7IA 1ESNA 4LJ9A 4AC9A 1YZKA 3EAQA 1Z47A 2JJ1D 3TQFA 4LYFA 2F1IA 3W8RA 3AF4A 2Z6VA 1NI3A 4JL6A 3L43A 5L3SB 5L3SA 2IBMA 3HU1A 5IRCD 3K9GA 3A1SA 4BFXA 4N1AA 1KJWA 5H70A 1SXJC 5C18A 1KO5A 3RWOA 1X86B 3K0CA 4Q01A 3CPHA 3LAWA 1KOFA 1SVMA 1S3SA 2LCFA 5BQ5A 2XNDA 3K0AB 4B47A 3ONWA 1ZNWA 1G5TA 3KUDA 3NTUA 5KHOC 4AY2A 2J7PD 1ELOA 5FPHA 4Q1DA 3IIKA 1NIJA 2EFEB 2GKSA 1KY2A 5BYKA 5AUPB 2GZDA 4I4LA 4ZIRB 1KO1A 4B3DA 1OIXA 5EXTA 2W2XA 1GNRA 1T91A 4D2IA 1X8JA 1YRAA 4AURA 1RE0A 1T5LA 2C95A 4NDZA 2B7BA 2XSZA 3BFVA 2ZJAA 1XPOA 4MYUA 4NE2A 1AS2A 1M2OB 2IYQA 4LPSA 3CR8A 3GEHA 4MGKR 4BLSA 1ZD9A 5FTJA 1GTVA 1D2EA 4BFVA 4EPRA 4LPKA 1VG0B 1ZCBA
chains in the Genus database with same CATH superfamily
2PLWA 3HA5A 3UK6A 3TM5A 3G50A 4EGFA 1TAHA 2HSEA 2RK4A 5EP3A 3DZKA 5AJUA 4XSVA 4U0JA 4KW7A 4PZ0A 3OCJA 4FYPA 1QO7A 4QGGA 2D62A 3THYB 2HK7A 3CUUA 4X60A 4FYWA 4YCSA 1RJ9B 2PUHA 1T4MA 5AI5A 3MF4A 2R63A 1BU5A 4MVXA 5BWMA 4D0NA 5IN4A 4DT1B 5E0OA 5BUCA 2C3UA 6GPBA 2G5TA 1KH3A 2R44A 1G7CA 5DI3B 4GYWA 1XQ6A 3PXXA 4X92A 1JBKA 4CIAA 1FBTA 4OHWA 3E48A 2OGZA 3AR7A 2PY6A 2IPAB 3HVHA 3HXLA 3FGNA 3GRVA 2Q5JA 5HIIA 1PTJA 2MSDB 4LOKA 3E8XA 1GA4A 1MVLA 5BNIA 1SBCA 3DOJA 4ZZ3A 4LX8A 4TTQA 4L5BA 4G0YA 1I2ZA 1IHYA 1L7AA 3TRFA 4LQ4A 3QOYA 1VHLA 3AP2A 4XIIA 3CUSA 3BIJA 5JS8A 2Z30A 2P7IA 4QVIA 4WRRA 3C1OA 3LF2A 2PX5A 1C2TA 4QEKA 1KU2A 3K8OE 1BS1A 2WIBA 1N2SA 1MGOA 2GEBA 4WKOA 2ON6A 4AMYA 4I8TA 3NJ8A 5T41A 5G1OA 2X8LA 1J49A 5EXPA 3KB6A 2HUNA 3ABRB 5TGTA 4LXYA 3SP1A 1QE5A 4L78A 3W9BA 1EWKA 4J90A 1YQGA 2POQX 4KLNA 3U44A 2AEFA 4E4TA 1T2EA 2XJ9A 1VG9B 1EX1A 2YUIA 3DWIA 1QQ6A 3LWZA 1VI5A 2R8OA 5EZYF 4BC1A 1PHPA 2Z6AA 4BDSA 2CSFA 3S68A 3AB3A 1NQOA 2WOJA 4G4JA 3AQ4A 1X39A 4M9UA 4MRVA 3G1TA 4DIKA 5B7GA 3UG7A 3E35A 2WM3A 5TGDA 1M57C 4JEAA 2AOXA 3H2BA 4UAJA 1GSOA 2HLDA 2FPIB 4KQFA 3CR7A 2CYBA 4TV8A 4HO1X 4M0FA 3L92A 4K05A 4TWJA 4M0MA 2IX9A 2D5RB 2PP4A 2PGAA 1QRUA 1MPXA 3KYCB 5F2NA 5CB4A 4Z2YA 1SG0A 5ALDA 1EEXB 4Q3CA 4AIRA 1JBQA 1L3PA 1EFPB 3WWEA 2FQYA 5IXSA 3KJQA 1AZWA 1SVNA 1KYYA 3F46A 1JHXA 2O54A 4I6TA 2OQMA 1CRZA 2BVNA 1F8GA 2QTFA 4OQPA 1UKCA 5IWAB 2XE6A 3DFKA 2D3WA 3P2EA 2KMLA 3HNPA 4N3NA 1QKJA 5KHAA 1OT3A 1RP1A 1IBSA 4L5YA 2OLJA 2GFIA 4AECA 2ZXEA 1E9AA 4J94A 1JF8A 2BGWA 1KDTA 3HUTA 3WKDA 3PC6A 4DEXA 3G9TA 1Y3IA 2G04A 1KL7A 1U94A 5FNVB 1UJNA 1AQJA 3H2YA 1DJQA 1NG1A 5CA1F 4U2FA 3PUYA 1PNVA 4PU8A 1C8KA 3TTTA 3RJTA 1W5SA 2C88A 3ETNA 4EPXA 3QVWA 2LLWA 2OMKA 1L9KA 3RJZA 4Z51A 1R1DA 2C4HA 4KVGA 2FPPA 2K2QB 3H18A 1KZ4A 3OY7A 4UUOA 1XDZA 1Y5MA 4QNNA 1LJ8A 4DMFA 2JATA 4R9VA 2EPLX 4OYYA 4TMYA 4YAOA 5AI9A 3GLTA 1OYWA 2FSSA 5JXJA 3MWLA 4LVCA 2F62A 4BLWA 1M6NA 1COWA 4DV7B 4HAXA 1EZZA 2PK3A 4G2NA 4ZU1X 3RVJA 3SXUA 2NV0A 1N78A 1RPJA 3RS8A 2HY7A 4MQ5A 3ORFA 4KR6A 4QXAA 1SC4A 2QNIA 3HCAA 5K3BA 3DEFA 1XLVA 5C5IA 1ZINA 2Z2KA 1RQLA 3K2IA 1E0SA 4EW3A 1GZDA 2CJWB 3EXIB 1HR0B 2AQHA 4IWYA 3LXRA 3EPHA 5IKOA 2NLOA 1PQYA 4EF6A 1VA4A 2BBOA 3UGTA 4PAMA 4ESVA 4A4AA 2I6GA 2WT4A 2R7OA 5AK0A 1HFJA 3BMXA 1U9IA 2HTEA 3X3HA 1G4AE 1Z6TA 4BLPA 3QUSA 1YIDA 4IGFA 5A4FS 5ECGC 4I4CA 1MB0A 3JYYA 2R7XA 2NO6A 5F64A 4WESB 3J7AC 2P27A 3A3OA 1WOYA 2VP6A 3PQ6A 3TLAA 2ZIXB 1ZGZA 2H7BA 2BEWA 1U3GA 4G26A 3NTLA 2NAPA 1NZFA 1JQLB 2A88A 2BGUA 1DULA 1DBIA 5CHYA 3RGGA 4CTOA 5DGTA 3TKLA 3K0FA 1ZL0A 4WJZA 3NXKA 3F3MA 1VYVA 4LHVA 2WYUA 3REGA 1SHJA 3O91A 4YCBA 1VJ0A 2IRWA 2H5EA 1DXOA 2PMEA 3ZI7A 4M9RA 5H81A 3LQYA 1TLLA 4O4JF 4NFSA 1WZ2A 5DBFA 1IN7A 1RC8A 2BR5A 1R18A 5FWXB 2YY7A 4BEWA 2OWEA 4X00A 2Z6UA 4B3RB 1UT5A 4O6YA 5KS2A 1FE8A 4CCSA 4YR9A 3AEQA 3OQ1A 3HGTA 3G5MA 4BIMA 2B4QA 1T6NA 3ZWPA 3DMFA 1NBEA 4OH1A 1CY2A 4MPTA 1G291 4O4HA 3ZIDA 2HF7A 3CM0A 2UYOA 3CVJA 2ERXA 4W99A 4DV3B 1WB9A 3AUAA 2B6NA 1J7KA 2O05A 2PXAA 4DR7B 2EFDB 1FDSA 1NU7D 2RH4A 3FXHA 4ZOLA 2GXUA 1EUZA 5EJ9A 2Z2ZA 4NMWA 3TAXA 3JVEA 1U9ZA 1J7JA 2IGTA 2VFAA 4PZAA 3NORA 1FRNA 1IHOA 4DCPA 1EB9A 4CFYA 2IYWA 5E8JA 4N40A 2P6RA 3DUWA 4JCOA 1LBQA 8ABPA 3P2KA 3OMXA 3U3OA 2ZR9A 4RLFA 4WJLA 3EQ6A 4HDMA 1NUQA 3TMKA 4YJDA 3T3MB 2B8EA 4BQOA 2ROQA 3IAUA 2BV3A 3IDOA 4XLLA 3B8EA 4NK5A 3FVYA 1F2TB 1VPLA 1F51E 5AICA 1B3RA 4PPQA 5U4QA 2OTCA 1RKCA 1TKRA 2PZJA 1MBZA 1ZBQA 2JDID 1O0BA 1RKXA 4LKOA 3IIIA 1C3LA 3WAQA 4QVKA 3VMFA 4JKOA 2VDLB 4K6GA 2KNHA 2XLMA 1QH1B 2GAOA 2WPNA 3UMFA 5AHRA 2ATIA 2NTYC 3IQDB 1P80A 4D9FA 3O9MA 3OOYA 1NERA 1DHTA 2WJAA 2D5VA 4L73A 1YE8A 4H3HB 1H1LB 3HNKA 1NXXA 3BXOA 3MIIA 2PNOA 1HMYA 1V9LA 3Q85A 2ZJYA 3W1VA 1EWRA 2IZOA 5D51S 1JQKA 4Y9TA 5DRTA 3H5AA 5A3RA 1X7GA 3A3PA 4PTYA 2QF7A 4N01A 2C0QA 3B53X 3S1AA 1ZZ9A 1G8SA 3U37A 1JEEA 4DJ9A 3TN7A 3HCRA 2LVBA 3RE1A 1BDMA 3SJ7A 5LQSA 5AC4A 2JAOA 1RLJA 4Q7MB 1J2TA 3UMBA 1R6DA 3CUTA 4LZPA 4X5OA 5DYIA 3I30X 1RFLA 2LKCA 4BRUA 3RHTA 5DHRA 4FZ3A 2VDKB 1N75A 1X70A 4QODA 3I5YA 3DQQA 1ZD3A 3CF4A 4QBTA 1QGAA 3K0CC 1H6DA 5IJXA 3KYJB 1TQGA 1R5NA 1TF7A 2C2OA 3D31A 2OCIA 4O2AA 3DE0X 1R4TA 3ANTA 4FEGA 2J9FA 5JQGB 1UT6A 5JRJA 4PLFA 5KTYA 1N2ZA 1P7YA 4NFHA 4F9FA 4HWGA 4HJRA 1FJ2A 2YYSA 5E6UA 2ZYTX 4CI0B 2P61A 1OA0A 1I24A 2VUIB 5IDXA 2R7NA 1U0OC 1KYQA 1YZNA 2QMUA 1T3GA 4CVNA 3I04M 1PK8A 1QAOA 2HCRA 3NTOA 2PJDA 5A6SA 3BXEA 3A4TA 4Q4HA 1YASA 1ZM3A 2XLDA 3J7TA 3P0JA 2BFBB 3HLTA 3TLXA 1J25A 1ZJ6A 2QZ9A 4GC5A 1X14A 5M2QA 4RKQA 4V1CB 3QXCA 2ZUTA 3ADKA 1EK0A 1A2KC 2AMLA 3AFGA 4L5AA 1Y1RA 1IMOA 5AH0A 5A5VA 1OVGA 2DBQA 1I4WA 5AI8A 2G25A 1RWKA 4CM9A 5LYJA 4IJUA 4Q9LA 2HYIC 1CR0A 2NXJA 2GD1O 4C1NA 4ZCLA 4NSNA 4JYPA 3CRVA 2WIAA 2BH2A 3LSYA 3WLQA 4HGNA 3T9CA 1VE9A 2DF8A 1I7LA 2BFOA 3L0ZA 1VMEA 3DHNA 1IHUA 5JHHB 5FI0B 5FOUA 3D8HA 2BTQA 2R751 2VJBA 4RZQA 2NGRA 4Q3BA 3B3AA 2XWQA 4CPDA 4JROA 3VYVA 3H5WA 3GUZA 1XT6A 2RJNA 5IZ4A 2OHXA 4EVIA 1JU3A 2MHCA 4W9MC 2EXXA 4LBYA 4DZRA 3G5UA 2I8CA 3N87A 1BXZA 2WJPA 4MAFA 2GD0A 1GL6A 3H87A 3E05A 3UGKA 4B2IA 2XUZA 1UBTS 3ABKC 5BQIA 1BHQ1 4ZDJA 1PSDA 3I1IA 3OURA 2V3WA 2YN2A 2NUBA 2HWXA 5CCEA 4MCJA 4W82A 1ODFA 2AUNA 1D7OA 4WOJA 3KXAA 2QUPA 1LCIA 3HV2A 5B12A 5F5FA 4HTFA 2OC9A 3GJ6A 2AOTA 4GWLA 3OTIA 1G9TA 4EFMA 3IH5A 4YRKA 4CIWA 5A7LA 3UJAA 3HU3A 1OVMA 4US1R 3M3DA 3KTAB 5ALEA 3FDZB 2ILTA 2DBRA 2GJ9A 2EW2A 4NHEA 4ULVA 1L1QA 1C1DA 2A9RA 3EARA 4UFOA 2LKDA 2CLIB 2E82A 3L7KA 3H11A 4TMVA 1R0ZA 3OX4A 2R86A 2GRLA 4WZAE 1QGUB 4XE5A 3QLVA 3VDNB 1SKYE 4KEAA 1KOLA 4CV3A 1KKLA 1E2QA 2PMWB 4YYZA 4U5GA 4YCNA 2EFHB 1FNSA 1Q1NA 4HWRA 3DM9B 2G77B 1NI4A 4C4OA 4F4JA 4B09A 2I2WA 2GBIA 1W5EA 4H1TA 2XCQA 2FPSA 3DOOA 3JAKA 4N6NA 2RHRA 2PXUA 2V59A 3IHUA 1IQPA 1MOSA 5BSVA 3VDXA 1L4GA 2OM2A 2EQBA 2O38A 1PU2A 3WMEA 3D4NA 3S5UA 4Y2TA 5GTDA 4EGQA 1W7AA 5FUMA 5IDVA 3WK6A 4AG3A 1DLJA 3DAPA 2R7LA 1R3UA 1QBKC 3FNIA 1YVDA 5KVCA 2AYXA 5BW4A 5EKUA 4DC9A 3PC2A 4L3WA 5LIRA 1GG5A 1I1NA 2IX3A 4P6IC 4L8WB 3B60A 3KOYA 5F77A 1RXYA 3QTLA 4RKRA 4UC0A 4A3SA 4DBQA 1X77A 4YMGA 2CLCX 1XTIA 3F3SA 4C76A 3ODGA 4OKNA 4YDRA 3JS5A 1RWOA 5GIOE 3NOXA 1GGHA 3K4QA 4MJLA 4R01A 3M3HA 2F8MA 4QLOA 4HH1A 1TA0A 4YAIA 2NT4A 4DSNA 1ISFA 1MQVA 2GT1A 4G0XA 1A9OA 1S4MA 1SA0A 2ODQA 1IDOA 2JFVA 3WSVA 4Y2HA 4ZO7A 5CEEA 3SEOA 4EHFA 4ZOAA 4PZCA 4FZ5A 3UV3A 3UK1A 3UCFA 3VU9A 1CJSA 1YZCA 4E0HA 2HFKA 5DM60 3IPAA 2H5LA 4MHSA 3TW6A 2H0RA 1AS3A 3RSCA 4URUR 1G20B 2VYND 2GD6A 2QR3A 4P83A 3C3WA 1BIFA 1SPXA 5CBKA 4HWSA 4B43A 3W7VA 1YI0A 4RJTA 5IAOA 1R64A 3QX8A 2OECA 2PZAA 4B6OA 4PPGA 2J08A 1HYGA 1RYBA 4NXMB 4AT1A 3WNZA 5FOQA 3GDGA 2NOAA 1U9IC 5LBIA 3RVDA 1OCTC 1JIXA 4IKEA 5DNUA 2I55A 1AHNA 2XDWA 5E9AA 1OTYA 2MYTA 5FF9A 2SKEA 4W1QA 2PYZA 1DZ3A 5F33A 1UBFA 2IEBA 4B80A 5JFOA 1ZHTA 5HNKA 1YYXA 1QYCA 3P0RA 1QRAA 2JI4A 4QOHA 4WMLA 4UATA 1Z0DA 2UYYA 4CLOA 2AS0A 1PR9A 4L72A 5C2JB 1DTEA 4LNUB 3IPCA 5EFZA 3K73O 4DLXA 3R0VA 4V0SA 2XQVA 4Z8YA 1YQTA 3DEJA 4C88A 1LMB3 1VCOA 5LD2B 1ECBA 4PQRA 2ZB8A 1HETA 3BMOB 4K6CA 2X5OA 1OXBA 4OAOA 4JNCA 1L0BA 1M2FA 2W6OA 1NNLA 2OKGA 4MS1A 1KORA 2FPUA 1CUEA 1NFRA 5D92A 4QUHA 4ZRDA 4K1LA 5AUNB 5HE9A 4E5PA 1Z74A 4OO3A 1P7WA 4RU1A 5I7RA 3GFVA 1EVQA 1OLUB 3P0FA 1AA6A 2BM1A 3C15C 3U09A 3EQLF 2HHCA 5L40A 2QTWB 4KQMA 5ALHA 1QFYA 3QKWA 4MUAA 3HWSA 4O0LA 1HE3A 4MS4B 1G6Q1 4ND8A 5DQZA 4HT3B 4FEAA 1MDFA 3PT9A 5EHGA 5LJLA 1M75A 1C7JA 1CERA 3DMTA 5BUQA 4WZ6A 3IQZA 4DWWA 3L1HA 3AO0B 1IY8A 3ZDQA 3JRXA 4RGVA 1SVKA 4MKZA 5B58C 5H02A 2M2IA 4I1YA 2IYAA 3TQFA 1U8CB 3ZDAA 1NI3A 1NBAA 2IBMA 3BXFA 3K9GA 4BFXA 2DGJA 5C18A 4HFJA 4RE6A 2EP5A 4ZU3A 2JHGA 3GFFA 2W2KA 5KHOC 1ORYA 4BE4A 2XUFA 3F7TA 1THGA 1PYDA 2FUNB 1DBQA 3U19A 1UP6A 1N1MA 3A14A 5HXAA 3DEAA 4CL3A 4A1OA 1I2BA 1POXA 2OZLB 4EPRA 1KFEB 2WVHA 4Y30A 3R3SA 1CR4A 1FL9A 5FO0A 1YE5A 1DIGA 3C2QA 1VSTA 3NWEA 4ERNA 3OUTA 2G0AA 2JBWA 3Q2KA 4QDOA 2KWIA 4W7SA 2JGKA 1TQ8A 3BMNA 4KUEA 1NU6A 4YY3B 5CXXA 3QEKA 3TCXB 4XIJA 3JQRA 3BIWA 3TBFA 5ELXA 4OINF 1I5OA 1T24A 4N5IX 1UJBA 4BGVA 3K9QO 2DERA 2OHOA 1BOOA 3WX0A 3H17A 1GQFA 1E3TA 4LY9A 3H2SA 3BGWA 2JCVA 4F1KA 4W5OA 2BCGY 1B6RA 3PGMA 4JLKA 1GAWA 5B58T 4TM8A 2AE2A 3ET4A 4F97A 4CM1A 3SXKA 4FOSA 2XAUA 1RQXA 2BF7A 2Y4NA 1NJ6A 1CHDA 1L4FA 1MMDA 1K6MA 4OK5A 1NPTO 5K7SA 5FADA 3SZGA 5LQUA 2R5NA 4LYDA 2C4MA 1LE2A 3FYAA 2DBVO 2ZYHA 4CQLA 1JUDA 4H0FA 1YRQA 1BR1A 2OHJA 2H06A 2DT5A 4G1VA 4ZKEA 1DTWA 5KKAA 1ZH8A 4IOJA 3EXG1 2VRCA 2P3QA 1Y9ZA 3IVMA 5KX5F 1WN0A 1R9GA 2YH2A 3HLYA 2VXBA 1U6KA 4R8LA 1XHLA 1J8DA 1EYZA 1QV6A 5IY5C 4ONEA 3GJ7A 4FK8A 1SVUA 5TE9A 3JXDL 2WJVA 3G88A 5F9HA 3L8IA 4W7IA 5HKLA 3C18A 3N2GA 1OIWA 3LY7A 3NR2A 2QVLA 1G21B 1QGDA 3K1JA 1TQDA 2IHNA 2O57A 3IODA 3FFBA 4EG7A 1CCWA 2CV1A 3VTZA 2O1EA 4S0XA 1KGDA 4U0KA 1I94B 5BO5A 4TMXA 1TYZA 1N8SA 2WF8A 3D0RA 1J00A 3BIFA 4JTAB 3TNLA 3KLMX 3W7AA 3G23A 1ZUIA 1TYEB 5DP1A 1WS6A 4L9AA 4Q3KA 1I3KA 1RLOA 5C51B 5BSTA 3HYTA 1V47A 5BNTA 4GKKB 5CX1B 2ZTVA 4IIJB 4MPPA 4HN2A 3PFWO 3C4QA 4K9LA 2OBNA 3KQHA 4O2BF 1UM8A 1RZVA 1XZFA 2ZBEA 3HXKA 4E03A 3TXAA 1MPTA 1N34B 3MS2A 3EDMA 3L06A 3O3OB 2HRDA 3DAFA 4FFDA 2P9CA 1ODKA 2GZRA 2OHHA 3KUUA 3C8GB 2VQEB 3A27A 2LQGA 3BFPA 3EULA 1T6ZA 4X3OA 2YFHA 3MX3A 4HS9A 5F9FA 4IBOA 2CHUA 3QKRA 3PGA1 1RKEA 3FHDA 3EQ9A 2QSJA 4RMJA 1T9DA 2JFYA 2IUOA 4I8IA 4OIRF 1P29A 2ZBPA 4C7BA 3FCOA 2ZOSA 2PT6A 4WEQA 2Y2VA 3R23A 3REOA 4S1OA 4C89A 4LEIA 5AK4A 5FBHA 2Z5VA 4GX5A 3F8WA 4ITUA 3U17A 4X93A 1WG8A 4DYHA 1DI0A 2RAUA 3H3XA 1JDBB 3P7MA 1WKVA 3EVTA 3WK7A 1I6LA 4W1RA 2OBLA 1U5BB 2H1RA 4BNZA 3KEQA 4L07A 1KO4A 4ZEOA 3B1ZA 3ZDRA 4PX2A 5GVRA 1VHJA 2BRUA 2P6VA 1KIMA 4WCFB 4BO8A 4ZI3A 3LBIA 1UBEA 1XE3A 1BROA 3MGCA 4BP1A 5HCIA 5EI5A 1QPZA 5H16A 2WOOA 1E84A 3JQBC 2YCBA 4YRFA 3EC7A 3NYWA 5D2CA 2I3BA 4RA9A 1IY0A 3OMLA 3AZQA 1A7KA 4LYEA 3KT0A 1RXIA 2G5PA 1Y1QA 1VL1A 2OFXA 5BV1A 2AMJA 1N32B 1YLMA 3FYMA 5DP2A 5EIAA 3FOFC 4G7HF 1K5DA 1VL2A 1Z4KA 2PFDA 4GQHA 4RSHA 5A5DA 1P75A 2MINA 3LHDA 1E64A 2BMVA 1K98A 1U28A 6ADHA 1ZC3A 4ANFA 4DQLA 1Z33A 1YI8A 3B1JA 4Q00A 1UPAA 1EMDA 1J21A 3QLVC 1FLDA 1VJ1A 3Q4GA 5K0CA 1RPTA 4MV7A 3GYGA 3RW9A 1D1TA 1DC7A 1P5RA 4JA0A 3E8MA 4IDOA 4KFUA 1MAWA 2WM2A 1ZVKA 1UZNA 1N6HA 1TFKB 4FQ8A 1TFUA 4JP5A 1V1RA 1M73E 4EELA 3DO5A 4R2IA 5FH9A 1AZSC 3DXJF 2BSAA 3LUPA 3D3QA 4LSGA 1JGTA 4W5JA 3UC9A 2J7WA 1DAMA 4IH9A 1OWPA 3GJRA 1BXGB 5DCWA 1S01A 1H9BA 4OH7A 5DOVA 3GLRA 4OQZA 3S2ZA 4B76A 1IU9A 2CFSA 5ENDA 2PYIA 2YEVA 2WIJA 4NG4A 3RREA 4IDGA 3VPFA 4K9MA 3GBPA 1WHTA 2GOYA 4BASA 5GMOA 1CW2B 2AWNA 3U61B 3QI7A 2OZVA 2AF3C 4RVSA 1P0MA 1DKNA 4CM8A 3A05A 3DQZA 3G0OA 2ZJZA 1B2RA 2NUPA 4GSKA 2H1FA 2HHLA 3DXZA 3PGXA 5JNVA 2HK9A 5FOVA 4MO9A 3PEYA 1IEWA 4WCVA 4NY1A 4MR9B 3FKQA 1NUPA 2NWQA 4WOBA 1L5MA 4MP3A 1QB2A 3KH2A 1L4LA 3V5YA 1ICEA 3ZGVA 3SVTA 4J0FA 1BDBA 3DBRB 4Q05A 1JKIA 2P7VA 3UMVA 1VI6A 3C7DB 3PR1A 1N2GA 5T6BA 1CETA 3IUEA 1U6IA 5BQXA 1FDRA 3MT0A 4ED9A 3MERA 5CVDA 4JCHA 3GIWA 4LXHA 2GJKA 2IXNA 3TLKA 3W5JA 2UZIR 1NI5A 2AXPA 3PBKA 5TMBA 4JJZA 2PKQP 3O1IC 1BD3A 4IOKA 3FD8A 1JFVA 4KPEC 3DWFA 3RLFA 4KXMA 4XPIA 2RARA 3WO1A 4JP2A 2C8VA 1BH2A 2D2EA 2ADMA 3B36A 4JJ8A 3TZLA 5JAQA 5NULA 1JFTA 1KBZA 1WA5A 4QASA 4X9XA 1Z82A 3O94A 3MLBA 4ANJA 2PUWA 4PZEA 4XB6B 4PBTA 3N7AA 3FOPA 4KLZA 1DCFA 1L5HB 1T9CA 4HAIA 4MTCA 1ZVZA 1W4LA 3O2SB 3TSYA 2NZ8A 3QG5A 2XZPA 13PKA 1ZK1A 4ZALA 3N0TA 4Q21A 1RWVA 4CN9A 3GYBA 4Y2JA 5LLTA 1EGVB 4CMGA 3JTMA 3EISA 4BG0A 3O7WA 3LQFA 5TPWA 4KSYA 7ADHA 5MGNA 1O7JA 2JFFA 2DPYA 3VH3A 1UBJS 1PHRA 4OHOA 4G25A 5ENVA 3TZBA 3NAMA 5GPBA 2XY4A 3GWGA 1Z4PX 1DX9A 2XD4A 4I6JA 5KSZA 3V1LA 2QVZX 2HSGA 4NZZA 4FGJA 4LBVA 2GFQA 2OCBA 4R1PA 4JE9A 1RHMA 1TKCA 3QK7A 4R16A 4RHYA 5KSYA 5FLXA 3B29A 3UAVA 3AIKA 5BUOA 3A6DA 5JH7B 4B6JA 2ZETA 3EXHC 4LOLA 4V24A 1V1MB 3RAPR 4FCCA 2PVPA 5TJHA 3K6RA 4E2XA 2OPBA 5AD1A 2EX1A 3KVNA 5FBKA 3T9EA 4EHIA 1RIOA 2I7TA 10MHA 4AKIA 4ZTUB 2DHEA 5FXMA 1YK1A 5HFNA 3WYBA 3R5JA 4O7GA 1MQ8B 4XM0A 1JU4A 3OP1A 4UTVA 5LFAA 4RF4A 3RLIA 3GEEA 1IJFA 2AX3A 1H42A 1EUQA 3EPVA 3B5IA 2GO1A 2GI4A 2I6QA 2PS9A 2ZCUA 1XTBA 2Q4OA 4Z53A 1Z68A 3RD5A 1E9BA 5EGYA 1CQIA 3GELA 2HJGA 2B6HA 3ROZA 4DV1B 1CJVC 3ILSA 3FRJA 4G97A 3U40A 2IPLA 2Q5FA 1NTOA 1Z7WA 1G8HA 2O7QA 2RK3A 1IL0A 3OEHD 3HB7A 2J9YB 1H5QA 2P0EA 3DMTC 4NCIA 4RCZA 4EZEA 3MWEB 4P93A 3SM3A 5LQJA 3AB8A 4KFSA 3NOVA 4F2HA 4DCOA 4EHBA 3QXJA 1Q2XA 4YACA 4LFCB 5CAEA 4AY3A 1A72A 5EUMA 4RQTA 5BT8A 1PT7A 2X15A 4KSCA 1MNEA 2YL3A 3TEJA 1EX9A 3OBBA 2E2WA 2J48A 4TM7A 3TRKA 1ZLXA 3CJRA 2I4NA 2A1DD 1HFWA 2XD9A 4Y6SA 3WYAA 3OU7A 3WV5A 3NMIA 1Y1TA 1IOZA 5I4BA 3A7DA 1E2JA 3DBLB 5BORA 3KKEA 3TW0A 3KFVA 4CEJA 4IQ4A 2IUSA 1XKLA 2WD9A 3N07A 1NFNA 2OCGA 3A1WA 1E6WA 2HGZA 3PNLA 3S5JA 4WHMA 1ZD5A 3MUFA 1ZYUA 5JXHA 2A9OA 4L2IA 3OE7A 1DEHA 2VDNB 1CUWA 1A9ZA 5DXJA 3NC0C 3V33A 3LT1A 4N76A 4MW8A 1FMVA 1JL3A 2FU5C 2GEKA 3AF3A 5L0IA 2GNPA 5JROA 3TEPA 3DBHA 3LWNA 2J3QA 2GHIA 4ALKA 4NABA 2A0UA 2X58A 3IKJA 2UXDB 4BEMJ 3EW7A 2Q3DA 1YR9A 2QR2A 4JOQA 1N2EA 4LWQA 5B37A 4KPUA 1X9HA 3NRHA 4IHQA 2RHDA 3OZBA 4OQFA 1S3GA 4ZAVA 5FX2A 4OIFA 3PUIA 3E53A 3I0NA 2GYVA 4FBGA 3D64A 3I53A 4HAWA 1AOXA 3BCUA 4IJ6A 1FFWA 2MIIA 3GFSA 3OJLA 3T4RA 1KTVA 3CZ4A 5C9ZA 2AXNA 4Y1RA 3K5IA 2ZIZA 3STUA 4AU1A 2HNBA 3I2IA 5J4LA 4IYRA 2FCRA 3I9FA 1HY3A 4HI0E 2KM1A 3U9JA 3P1JA 1LLCA 4GKJB 4Q4CA 3DW3X 2VPTA 1I7SB 5BN4A 3LVRE 5HK9A 1AUOA 4HN9A 1A9QA 2O1XA 5B5SA 4N8SA 1I3CA 1Q3HA 4DF3A 3E5NA 3LI2A 4MKHA 2HSBA 2Q21A 1KFCB 3VR3A 4ZXPA 3P0IA 5JAZA 4RTNA 3LP6A 2FW8A 2ATXA 1FNCA 1NJ5A 1FVXA 2D00A 2JKVA 4X7PA 3I62A 3DZFA 4Q9DA 5DWQA 1Q6YA 3QQ6A 3MLEA 5KYXB 1KJQA 4MVUA 4OP3A 3ZK9A 5K0SA 5IU6A 1ZWKA 3F47A 5E2AA 1NFOA 1B1AA 3MT9A 2R00A 3PGJA 5IT9A 4MMYB 1Y8QA 4ZVLA 2PX3A 1WKBA 3MCVA 4XEFA 5DN6A 2OR1L 2BSQA 3S90A 4REOA 2YKGA 1M34E 3P4YA 3NJRA 5HQJA 1Y89A 2R1VA 3VOAA 2GVNA 3QNUA 3F5DA 4ZQHA 1LRKA 4G5QA 4DCGA 4IMRA 1J6UA 1P60A 4JT4A 3ECAA 3OLWA 1VTKA 3VC7A 3T1YB 3PLNA 3U4GA 2NSYA 4XFJA 2AHOA 4NYJR 1O77A 1GIAA 1KWGA 3T3IA 1L7QA 5C4IA 3DEKA 3VSEA 4PFOA 3SIRA 3FZQA 2A5LA 1U99A 4AZ0B 2C9MA 3F6RA 1WDMA 4BMZA 2CBXA 1ZM9A 4MLZA 1UEXC 3NFRA 5DXFA 2Q9AA 1B6TA 4PIPA 3CONA 2BTEA 2N3ZA 3GM3A 1Q0UA 1OGIA 3C6KA 4C7VA 4ND1A 2QL9A 4HGZA 1Z83A 2BP7A 2O0LA 4F93B 4WOCA 1CUGA 1UPUA 3I23A 3HL4A 4YRCA 1T13A 2DWCA 2EL7A 3NKEA 1VCIA 4CDMA 2GK3A 3BFXA 3NG1A 3BHMA 1L2TA 1X74A 1J33A 2ENUA 2A69F 4OBWA 4CDYA 2Q0QA 1A76A 2ZEJA 2XMPA 2AKYA 4HLQB 3HCNA 3KZ3A 4AUMA 4ERXA 4BU0A 4O3MA 2P9JA 2PWAA 3BDNA 1JA0A 2XYHA 4O25A 3DFMA 1CY0A 1QHGA 3OZGA 2ZM5A 3TDNA 2BRUC 4UBJA 2YMPA 4NHOA 1RZSA 3JZFA 1TQHA 4DN6A 4R2LA 4IFTA 1ZK4A 4PNZA 1KZ6A 2OSBA 3H2UA 3O74A 2XS8A 5L6LB 2VCEA 3MOSA 2ERCA 1AX9A 5ITZA 3CE6A 4WPGA 1HMDA 3NHUA 3RFTA 4DLVA 3L7IA 1BQ3A 4CZ2A 2J5XA 2B5WA 5EN4A 3A11A 5EQTA 5L3RA 4X8OA 3R7LA 1HMPA 1L7DA 1P1KA 1F6DA 1W34A 2G28A 4HDRB 5JYDA 4U5XA 1LDBA 4HQFA 1P1FA 3T38A 2ZXRA 1NNI1 4M1WA 1QIEA 5IYZA 1UAGA 4QDXA 3OCZA 2BZGA 2BEVB 1QK4A 3QRWA 1P77A 1U7UA 3JCUQ 1U28C 4O1IA 1AHPA 2DPXA 2VJMB 3NS7A 1GT91 4BX0A 5KEIA 2FSVC 4JW1A 1S8AA 1U8UA 1JSLA 1T9AA 4LNAA 1UKBA 2G9UA 1TT5A 1J4AA 4JS0A 2PSSA 2XRYA 3CNEA 3IUPA 1ZAKA 3WFZA 2FI1A 4BFYA 2GLUA 4KAXA 4RENA 1Q0DA 1KAOA 4LK3A 5F5LA 2FZWA 2MEZA 3KVRA 3AHHA 1FTWA 1QE3A 3EVBA 1M1NB 4ITRC 1YS7A 3PUVA 4KGVA 3P27A 3EA0A 2I2BA 1SRRA 1BTOA 4RPLA 4L4SA 5B4VA 2OLEA 5ERYA 3GAFA 3ROPA 2V45A 4IX9A 4QBKA 5GADl 4FFPA 1XCBA 1IOVA 3EUAA 3AKCA 3EUFA 1EX6A 4QUKA 4B6GA 2ZRLA 2FPXA 1U4NA 5KVVA 2R25A 2ILVA 5AOAA 4ZQGA 1I33A 4V03A 1XAHA 5JXGA 3IPXA 2ZVDA 1AGRA 3R8XA 2ZYIA 2C31A 1O1YA 3UOGA 2QP3A 2VT2A 3HJNA 1BW9A 2ZKLA 3P52A 2VS1A 1DKMA 3LCRA 3I58A 3R5TA 4MP8A 3NRCA 3GLIA 3HCDA 1DOAA 5EKDA 4X4GA 2IW3A 3KZMA 2GA8A 3IQ5A 3GG2A 4MTOA 1OAKA 5TQJA 2E37A 3ISJA 3JWEA 4D1YA 3UQZA 3H97A 3AGQA 2ZRCA 3FWZA 3L0CA 2GNAA 1FRQA 1FFCA 1Z8DA 2FLWA 1XLUA 1Z28A 3HDHA 2IHBA 3PF9A 4X20B 2L82A 2IBTA 2B1JA 5F9MA 4JBYA 4HQOA 4XEVA 4CCYB 5FBWB 1ZW6A 4Q1VA 5ERGB 1D09A 1BKSB 4KTVE 2ZG6A 3R7WA 2IDJA 1LFAA 1DZIA 5CIYA 2YQ5A 1MRZA 3SPXA 3ZWNA 5E7IA 1LW6E 2IU0A 3M4ZA 4YHBA 2AFIA 3ELDA 5L3SB 1RCUA 2EKDA 3ZE8A 1OAOA 3GGJA 3T7TA 3GN2A 3AC0A 2RJ3A 2EFEB 1O2DA 2FHSA 3GRPA 5H0IA 4NV3A 4C1BA 2YLIA 3MXTA 1JQBA 4MV1A 1XPOA 3NM4A 2VPWA 1J0CA 2WTMA 3RVKA 5KTPA 1JOGA 2XR1A 1OH7A 3V4VB 3ZZ0A 3KPUA 2C61A 3BK2A 5AESA 3W8EA 1V6AA 2XYQA 3SR0A 2A6EF 2WKSA 4CKCB 2P2NA 5DGDA 1XTTA 1QLHA 3WMWA 2PD3A 4Y42A 3RSSA 2J0UA 5DNVA 4XWTA 1PV2A 4BNIA 5CBPB 1PERL 1TA4A 3C98A 3NKDA 1E2BA 4RVGA 1Q74A 3OQPA 2I7DA 1PE0A 4Q18A 2PGJA 3BTVA 1RIIA 3SSMA 2ABWA 2WPDD 3U7QB 4B7CA 5IABA 4ILKA 1ZHXA 2PFKA 2AT1A 2G88A 2GVDC 3T7RA 3RV4A 5ESXA 2BISA 4US2R 4PRLA 2FEPA 2B8TA 1NT2A 3PGKA 4O6NA 2FX3A 1PV4A 4MVJF 5CX4A 4NYMR 3FAPB 2J41A 4WACA 4H54A 1HT1E 4EL5A 2AWIA 3LC1O 3Q0EA 4EJSA 3GHYA 1V6SA 1AUEA 1MOZA 3QU2A 1ZPQA 4CIBA 5AVSA 3U3RA 3DHWC 1W0JD 3QM1A 4UE3S 3D0OA 3ZR4B 1SUAA 4N7BA 2NPIA 1ZHFA 2QN7A 5JAIA 3W78A 4H7HA 5JY6A 4D26A 2EZ9A 1YZLA 3QTTA 2BL2A 3PQFA 1DWQA 5KINB 4JCXA 4DVZA 2NVOA 2XBMA 5EMKA 1VRWA 2IELA 2XQGA 1MHTA 1BJTA 1X1QA 3MPOA 3ZWXA 1QRRA 3IQIX 4QU5A 3V5ZA 4NU6A 4HV4A 2AOUA 5DSXA 4ESEA 3T1NA 3IHKA 1JEYB 1A0OA 2EGUA 1H2BA 1U1DA 4YJ3F 4Z4HA 2PL9A 1UWVA 3Q87B 4PGFA 1UIMA 3FAKA 4I46A 3EQ7A 4DG9A 4LF8B 2JJ2A 3HCEA 1KI2A 4PG8A 1JVNA 4BBAA 4CKEB 3TGLA 4Q5IA 3UMGA 3VPBA 2JPUA 4J91A 5K51A 4WGFA 2EYQA 5JD6A 1VMKA 3FYTA 4UTZA 1OFUA 3ZDDA 1KMQA 4IF6A 4Z8XA 5LQMA 1BE8A 3BXXA 5GOZA 1FP4B 2V0GA 5HQTA 4ENPA 2JAWA 5FEUA 2JH8A 2IVZA 4C0JA 1T4GA 3O4IA 2IYYA 3E3MA 3VRHA 1YS6A 1P18A 4ZI5A 1GNVA 1CUCA 4OIPF 4EJMA 2RHMA 2POCA 2OENG 5GONB 3GGSA 3TS1A 4GBED 5LPNA 4ZZ0A 1FXSA 3BFJA 5LL6P 3FKSA 3VPGA 3ZY2A 3I05A 3CHYA 2HV9A