1QZXA

Crystal structure of the complete core of archaeal srp and implications for inter-domain communication
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
432
structure length
425
Chain Sequence
MLENIRDAVRKFLTGSTPYEKAVDEFIKDLQKSLISSDVNVKLVFSLTAKIKERLNKEKPPSVLERKEWFISIVYDELSKLFGGDKEPNVNPTKLPFIIMLVGVQGSGKTTTAGKLAYFYKKRGYKVGLVAADVYRPAAYDQLLQLGNQIGVQVYGEPNNQNPIEIAKKGVDIFVKNKMDIIIVDTAGRHGYGEETKLLEEMKEMYDVLKPDDVILVIDASIGQKAYDLASRFHQASPIGSVIITKMDGTAKGGGALSAVVATGATIKFIGTGEKIDELETFNAKRFVSRILGMGDIESILEKVKGLEEYDKIQKKMEDLTLRDVYAQIIALRKMGPLSKVLQHIPGLGIMLPTPSEDQLKIGEEKIRRWLAALNSMTYKELENPNIIDKSRMRRIAEGSGLEVEEVRELLEWYNNMNRLLKMVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the complete core of archaeal signal recognition particle and implications for interdomain communication
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Signaling protein
molecule keywords Signal recognition 54 kDa protein
total genus 130
structure length 425
sequence length 432
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00448 SRP54 SRP54-type protein, GTPase domain
A PF02881 SRP54_N SRP54-type protein, helical bundle domain
A PF02978 SRP_SPB Signal peptide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.30 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) Signal recognition particle, SRP54 subunit, M-domain 1qzxA03
1.20.120.140 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 1qzxA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1qzxA02
3K0FA 1KK3A 2V7QA 2XTNA 5BWMA 5F2EA 4L16A 3NEYA 4C0AC 4RD2A 2W00A 1OT3A 3FHCB 2C8VA 4QOSA 2WWIA 4KXFB 4Q21A 3RWOA 5FL3A 2PX0A 1G8GA 3OE7D 1NMYA 1T8TA 2FMXA 4R2HA 3FE2A 4JLDA 5CJPA 2H57A 4XVRA 3RWMB 3PEWA 3B1ZA 4D26A 5C4MA 2W0SA 4AKIA 2PXBA 2FSHA 4MUBA 2QU8A 4AK9A 1X3SA 5FOVA 1T91A 2VF7A 3B13B 1UFQA 1N6OA 3EZ2A 3EIHA 3L8YA 3QKSB 4MGIR 4P31A 3OESA 3KXLA 3QVVA 1X6VA 1M7BA 1OH8A 3B82A 3LFUA 4EJSC 1GRNA 2OFWA 4PQYA 5AUNB 4AYTA 5H8WA 2NZJA 1Z22A 1QG4A 3P20A 1YRAA 4POAA 1XPRA 1NG9A 1CLUA 1JQJC 2HF9A 2H18A 2ZSFA 3TIFA 5FBRB 3I72A 2WWXA 1E9BA 3LQQA 3W34A 1KDPA 1Q3HA 2QRNA 1D6JA 4DB4A 2KB0A 3TW4A 4U02A 1CKEA 4M1SA 4JVMA 4LBZA 2FEMA 2DWPA 1BS1A 3SJZA 4YONB 2IYVA 3BB4A 1H8HD 4L8GA 4JL8A 3RRMA 3TK1A 3WP0A 1TADA 1M74A 4TMVA 1XP8A 4LK2A 1JBKA 3CO5A 2F1JA 2PXLA 2IEYA 2P5TB 4PAQA 1R0ZA 1XMJA 2H92A 2BMJA 4IDHA 1P2SA 4RY2A 3PEUA 5D3MA 4ZKEA 2P5SA 2JJ2D 2RH5A 4X8OA 3M1IA 3M6AA 3TUIC 1ZP6A 3L0OA 2OAQ1 3NXSA 2G3YA 4WZAE 2NO6A 1VMAA 5A4JA 1S1MA 3BE4A 5K8IA 4DLXA 2P6UA 4GZMA 1XZPA 4F92B 2RMKA 2OESA 3D8BA 2RGBA 4EJSA 1J8MF 4HLUC 3R20A 2NO7A 3RS7A 5AR1A 4N0EA 4A9AA 1PZNA 2VP9A 5FTMA 1NVWQ 5J4YA 3ADBA 2FF7A 5KHOC 2QEQA 4TLCA 2FA9A 1N6KA 1G9XA 1W0KD 2GA8A 2XSZD 3LBHA 2GESA 5JRJA 3PXGA 2J9RA 1JEDA 3O47A 4TQ9A 3ZDQA 4DVGA 2FGJA 4NCKA 4QFMA 4HZIA 4R7ZA 2OBLA 4A92A 3ZLJA 3QBTA 3NVAA 1T6NA 2KWIA 5E3HA 5FUXA 2IYQA 1EESA 1EFTA 2D2FA 4JLKA 1Z83A 2WIAA 4JVLA 4DCNA 2YOHA 4W7SA 2CMKA 1R5BA 5LBIA 1OXTA 1R6BX 4HZUA 2PX3A 2ORIA 1LF0A 4Q1BA 3JVVA 2WJGA 1HQ1A 5SZJA 1NRJB 3H0KA 2CLCX 1TU3A 3A1UA 5AJXA 1T0HB 4YXWD 5FR1A 4OI0A 2RB4A 2CCJA 4OBEA 3ZIAD 3ADCA 2WWYA 1G7CA 3GJ8A 2QP4A 4EJSB 3CUEF 1DPFA 2R6DA 4EPTA 1RRFA 3AVVA 4P33A 2AR7A 4DT1A 3UMRA 5E7JA 1GL6A 2WOJA 4Z1MA 1Q22A 3GFTA 4DSUA 2QNRA 2GK7A 1G64A 3K70D 1ESMA 2JJ1A 4MDFA 2B92A 2ORVA 3RSOA 4GDFA 1EWQA 2PL3A 1T9HA 2W58A 3BAFA 3PIRA 5TMPA 4WW0A 3IILA 4CEIB 2VSFA 3HPQA 4QM6A 3I92A 2CLDX 1KY2A 1XF9A 5FBVB 3ZS9A 1KDTA 4D4JA 3SE0A 2ONKA 3PUZA 4QNMA 4RD0A 2QBYB 1AS3A 4OQFA 1WGWA 4JT4A 2CL6X 4BFUA 1XJ0A 5JMTA 3NBZC 3JZAA 5FBLB 3CF6R 2H17A 4XVQA 5BYJA 2O8BB 2ZJ8A 1VCIA 2IYRA 3HYRA 3GEIA 1RC8A 2W6JA 4MH0R 2BVNA 5GJVC 2ODBA 3DL0A 4LJAA 4OL0A 4LYJA 3HWSA 3TH5A 4D2IA 4MITA 1XNJA 1DELA 5JS7A 3E1SA 2GDJA 4MKIA 2W6ID 4XD7A 3SS8A 4NPHA 3IBYA 4ESVA 3A36A 3L82B 3GLGE 3KXKA 3C16C 3NEJA 4Y0VA 3TAHA 3WMEA 1YZUA 4DCVA 4ZDKA 4QJ4A 2NPFA 2J7KA 2X2EA 2EFDB 2L0XA 2V6IA 4BWYA 1FTNA 1M34E 4CDGA 2FH5B 2H1LA 2WJYA 4DZZA 3ZIAA 2Z4RA 4C0SA 4PZLA 5JWHA 3SQXA 3GLHA 1P9NA 2QAGB 2QL6A 1RYHA 3QKUA 4MYCA 3T1VA 4I1OA 5AWFC 3UIEA 2VHUA 4CYMA 3BD9A 4C0BA 2C78A 4URUR 2J7PA 1K6MA 4Q18A 4PAOA 4Q47A 4V0NA 3WNDA 4EIWA 3FMPB 1CEEA 5J4KA 1OIXA 2C03A 1BIFA 1TUEA 3J81k 4LC1A 5JJLA 3GEHA 1IY1A 2OLKA 4HUQA 1UEJA 2GTPA 2ZJ5A 4RVCA 3KQKA 1Q0UA 2GETA 1EFRD 3PR1A 1AQUA 3U6BA 1UBCA 1YR8A 3IGFA 1JR3E 5EE0A 2BM1A 2G9NA 4XJXA 3THXB 1KNQA 5JBQA 1KKLA 1E2EA 4ZDJA 1OFUX 2CHVA 4IDPA 2ZS7A 4Q4AA 3RHFA 2QGNA 3Q7QA 2OILA 3CZPA 1Q20A 3MCAA 5FOUA 3RDPA 5UKDA 4HB3A 4PC1A 3R9IA 3ZVNA 1U8AA 4WXRA 1S9HA 1Z0JA 5E7IA 2V1XA 1NP6A 1Y63A 2A5YB 4ABYA 4PO9A 1OXSC 5LB4A 1LNZA 4IOKA 2YINC 1DULA 2J3EA 5EZ5A 3BORA 4B44A 2XNSA 1W4BA 5TARA 1VHTA 4Q9IA 5JJIA 2ZJZA 5E7MA 5C1BA 2KJQA 2A3RA 2GBLC 3K0AA 5KUTA 3GLFE 1ZCBA 1EX7A 2BIFA 4GP7A 4TTRA 2PT7A 1QHXA 4F91B 3T1TA 3EPHA 3U3MA 4JYCA 1HUQA 4Q9LA 1OB2A 2NO1A 3FMOB 3NDPA 1CU1A 2IA5A 1G5PA 2IXFA 5H68A 1OKKD 1KJYA 1SVLA 1IXRC 4Q19A 1IAQA 5FTKA 3WHKA 1MV5A 1E0JA 2VHJA 3LNCA 4XIGS 2D06A 4Q4HA 3U4QB 1EFRA 1KI6A 1P5ZB 3WBKA 4PPFA 4DDTA 5KTYA 4DLVA 2H8KA 4IVPA 5CLLA 1CRPA 2D4HA 2ZQ5A 3C41J 4ASUD 3MRSA 2GXAA 2XJ9A 2P2LA 1JEEA 3U5ZB 2HUPA 1F48A 2FFHA 1KMHA 3I4LA 1BYIA 4P4TA 3TSOA 2WHXA 4QL3A 2ZRNA 3THWB 3VKGA 3AVXA 4OYHA 2OM2A 4UNRA 4PO1A 3U3JA 1WRBA 1KI4A 1TL7C 1TAGA 4IOLA 4M2LA 4NCIA 2EWVA 1G16A 3GJ6A 4NE2A 4DLYA 1JAIA 2TMKA 2IEZA 4LCBA 5EUMA 5AUOB 1TEXA 3PFIA 1GITA 3G0HA 3V4FA 1XDBA 1YU9A 3EZ9A 3RS0A 4NCHA 3A37A 2HYDA 1OE0A 1SVIA 2RHDA 3CH5A 3PV0A 2CJWA 3GQBA 4BASA 3LAWA 3N2IA 1GL7A 4Q9KA 1U8ZA 821PA 3SFVA 5L3QA 4C7OA 1CR4A 3SBEA 3CRVA 1U8YA 3SNHA 4BPBA 2ZYVX 4IOMA 3WMGA 4GOKA 1L8QA 1N6LA 4URWR 2A7QA 3BFKA 1SKQA 2WMOB 2NO0A 3AP1A 2XZLA 1QBKC 4QRHA 3CX7A 4V0OA 2DYKA 3VNVA 3HU3A 4OHYA 4DCUA 4CEJA 1SQ5A 2JCSA 3C5CA 1DAGA 1E2HA 4YMSA 4BLPA 4GOXA 1GIAA 3WP1B 2D7CA 3SHWA 4DJTA 3AVOA 3KKQA 3PITA 1YVDA 4I4LA 3VR4A 4F7WA 2PEYA 2PT5A 4KSBA 5J4HA 1DG1G 1TMKA 3NC1C 3LW8A 2EW1A 4JBXA 2FJUA 2GEDA 3IQWA 3UPUA 1T4GA 3O8CA 1II9A 2V4ZA 4DLRA 1MO3A 4O2LA 3D7MA 4L9WA 2H16A 1US8B 1V5WA 4M1KA 5EXTA 2QSYA 1GVNB 5HCIA 1YZGA 1F2UA 4GPTA 4US2R 4NBSA 1YR7A 1Z0FA 4FI3C 3PQCA 4HAZA 4AURA 3H2YA 1HA3A 5IDVA 1U0HC 3O8BA 4B43A 4DIDA 2VPPA 4XTRA 3WNCA 1VYUA 4KFRA 1MO6A 3CRW1 1XD9A 1G19A 4HAWA 3FVQA 3K09C 1NBMD 3IHWA 1D2MA 1KK0A 5JECA 3MG9A 3K0AB 3K0EA 3NTUA 4B3FX 4DHEA 2WKQA 3S1AA 4UKDA 4P4SB 2JLUA 2BWJA 1Z6XA 1AIPA 1PV4A 4P32A 3FKSA 4J0QA 2I4IA 1AK2A 3CWQA 1E2PA 4BFTA 4PPGA 3TUJC 4BLOA 2GCOA 1VG8A 3KKOA 5JCPA 3NH9A 2VSOA 4OK5A 2J7PD 1UKYA 3FFBA 4JLOA 4NYIR 1D2EA 2ZREA 4O0MA 3RAPR 4Q1CA 3T5GA 1Z07A 4NDZA 3NBXX 2AK3A 1JAHA 5AJWA 5TXGA 4AKEA 4BE7B 2AD5A 2XITA 2O0KA 5TB5A 3TE6A 4QGFA 4N3NA 3WYAA 1RJ9B 4DRZA 3CNLA 3GLFB 4PHGA 1G4UR 1DO0A 1Z2AA 2BOVA 3Q3JB 4WOPA 4KAXA 3GLHE 4M9ZA 5FPTA 5L3VA 4C30A 1E6CA 3QIAA 1KJZA 4EDHA 2CL7X 2WSMA 4DLUA 3RYTC 3HP1A 3TVTA 4G5QA 3FMIA 4WBSA 1DTSA 2J5XA 5KSOA 1BKDR 4DUGA 1ZIPA 3HR7A 3VKWA 3A4LA 1WF3A 5FPSA 2PEZA 4JYBA 1D8TA 3GD7A 3QG5A 1OFTA 5FH9A 1E32A 1Q57A 4RKFA 1S4QA 3K09A 4H9GA 2AK2A 3EIEA 3FDIA 2GXUA 2GVDC 3CIOA 3F3YA 1ZNWA 4BZXA 3A6PC 3EASA 4URYR 1H8HA 1JXMA 3ICEA 2OCYC 2RGNA 4Q4JA 1Q21A 4TLEA 1BMFA 2PZEA 4YMUA 3R8FA 4JBWA 1J8YF 5G3ZA 1K5DA 1GNPA 3WXMA 5EE5B 2IYWA 1IY2A 4AIIA 4QBGB 1NN3A 2DFNA 1E1RA 3TUZC 2XX3A 2Q9AA 4PC7A 1G7SA 4OI4A 3GLIE 4LSGA 5KNCA 2FPMA 2O0JA 3GFPA 3U7HB 1L2TA 5KDDA 1TF5A 2GAOA 4TYPA 3T61A 2YNMA 4CIDA 2Q9CA 4AKGA 4B74A 1Z6TA 1FPMA 2YWGA 3AF0A 2ZRHA 4LPKA 5SZIA 5GJWC 1NBMA 4JSYA 2AXPA 2BBSA 3B6EA 2WWFA 2GCPA 5JSZA 3C14C 4ACAA 1GKIA 5BN5A 4BLTA 2CVFA 3AKEA 2FOLA 4HUTA 2HLDA 2WPDA 1QHHB 3QY0A 4EAQA 1O87A 2QI9C 2V54A 2ZUCA 3L0PA 2BCGY 2ZETA 1BH2A 2C5LA 4I1UA 3W90A 1E79A 3RS5A 1RRCA 3LDAA 2ZJBA 2BJVA 1R8QA 4NYJR 5JJKA 4TL6A 2ZR7A 1FX0B 2JJ1D 3RSLA 1PLLA 5KU1A 4JL5A 1KO7A 1L4YA 1S8FA 4KLNA 4P4SA 3VKHA 1E9CA 2JJ8A 4V0LA 1KMHB 2VBCA 4KFTA 3L0IB 1T0JB 1G3IA 3AVPA 3CNOA 1QZXA 5FL7D 1NMZA 1QHNA 2JLXA 4TL8A 3KJGA 4DEYA 2R6GA 1Q3TA 1QB2A 3CX6A 3IIKA 3EZ7A 2J0UB 2QAGA 2C9CA 5B57C 4A0RA 3IO5A 4UNQA 5DO9A 3K0CA 3OAAD 1GL9B 1W4RA 1Z6GA 3MWJA 4FINA 4H1UA 2XOKA 4Q4HB 4AYWA 3QSYA 3U4QA 3W9YA 2VHQA 1JR3D 1IONA 1M2OB 2O8DA 2QRZA 1XFAA 4TWZA 3FGNA 2Q3FA 1QG2A 1OIVA 2DY1A 2VEDA 1I4DD 3QQ5A 3REGA 1E79D 3ZZTA 1ZM3A 2HF8A 3FHOA 4FMCB 4AWXA 2OG2A 1SGWA 3B1XA 1L7VC 1NF3A 2WZQA 1W5TA 4JVNA 3AVQA 3DZ8A 3QUSA 1G3RA 4Z8YA 1Z3IX 1UEIA 4OI1A 5CYPA 1KY3A 1XXHA 2JA1A 4LBWA 3FTQA 1UJ2A 2BMEA 1YE8A 4K81B 1Q1ZA 2BMFA 3TAUA 4B73A 2DCUA 4RD1A 3CX8A 1CBUA 2QBYA 2V8OA 4L15A 4HLUA 2GJSA 4BZPA 1DAKA 4JJZA 4V0MA 3I32A 2A5DA 1Z0IA 3KQUA 4RZUA 4TSFA 2BCJQ 2PXPA 4OHXA 3IQXA 3ZZ0A 2R6CA 4HAYA 4TYWA 2XZPA 1X8LA 1FTSA 3BK7A 3K0FB 1S96A 1YQTA 2F43B 4IDNA 4LI0A 1E1QA 4LUCA 2OCAA 5FOSA 3WBJA 1I2DA 5JWRA 2GWHA 2ASEA 1G17A 2ZRJA 4FMBB 4TL7A 4Q9JA 4KODA 1A1VA 1N2CE 2UVQA 1XCMA 1J99A 3ZJYA 1KI3A 1Q1BA 2IK8A 2IBMA 5JCZA 5LPNA 1E2QA 4ZKDA 1JB1A 4US0R 3SYNA 1HT2E 4XWOA 4MKHA 4OHZA 5ELXA 3AVTA 2J0QA 2PBRA 2IYTA 5FR2A 4KBFA 1XEFA 3BFVA 3K9GA 2ANCA 4UXIA 3U7GA 1NVVQ 1P2VA 3LA6A 1ZM2A 4Q1AA 2G83A 3R8CA 1NY6A 4II7A 4JVSB 4YMWA 1SXJA 4ZIRA 4FCTA 1KSFX 2LKCA 3CWZA 2AL7A 2Z5FA 2N46A 3OIVA 2PXEA 3BERA 1XTSA 5E4FA 1X1RA 4LHVA 5LD2B 1C1YA 3X1DA 1JJVA 2Z4SA 3PG5A 1W49A 5F98A 3FPAA 3K53A 3NIBA 4B47A 2WV9A 4F4IA 5JI3E 4NCNA 3ASZA 1KAGA 3F8TA 4NYMQ 1G8YA 3CONA 4DEXA 2E87A 4M8NE 5HE8A 2YOFA 1KTVA 4RD3A 2VHTA 5DYIA 3RRNA 1QRAA 1UBEA 2JLRA 1W0JD 2W2XA 5A0FA 5E95A 1XBTA 2BHRA 2C96A 2V55B 3QPVA 5CM8B 4ARZB 4AC9A 2E9SA 2ZI4A 1Z0DA 1TQ6A 5JEEA 1CR0A 4DDUA 2GILA 3UWOA 3T35A 2ZRLA 3M0EA 1U81A 2P6NA 1DARA 5J5CA 5JZVA 1KO5A 1ZU4A 3KB2A 4BRWA 1MFQC 2VTKA 4QGAA 1S9DA 2V9PA 1GP2A 1FX0A 4G3XA 2AFIE 3EA0A 5EUQB 3PEYA 1KK1A 3CH4B 2Z6VA 3AB3A 5JI2E 3BB3A 3A1TA 3W6NA 2PZFA 2BMDA 2ANBA 2J59A 2JLWA 4DLTA 4CZ2A 2B6HA 1Z6YA 4Z54A 1ELOA 4D25A 3B1VA 3IIMA 5TVKA 2QZ4A 3KL4A 1FMLA 2HJVA 2BBOA 3HU1A 4W5HA 1P7CA 3ICQB 4KI0A 1IXZA 4B3DA 1E2LA 4ZI3A 4A2PA 5C46F 2BKUA 1Z5ZA 1E98A 1G5RA 2ZI3A 4TLBA 1KI1A 1OXUA 1Z47A 2AXNA 3A8TA 1S3GA 4XSHA 5DI3A 2OHFA 1P2TA 2ZU6A 2ZPTX 4BEBA 2QMHA 4LY6A 3ZH9B 5HTKA 1PLKA 4EFNA 2ZR9A 4D82A 2QG6A 1Z63A 3BS4A 5D3MB 2X8AA 1SVWA 5EP2A 3ZYCA 2GK6A 2WBLC 3Q8XB 4LRWA 3CRMA 3ZZUA 5J4VA 1EFUA 1GTVA 4FXPA 4TT3A 1N5JA 1QDEA 2IT1A 1II8B 4XH9B 2VRWA 4GBMA 4YLGA 3TQFA 4D4MA 4QJ3A 3AF1A 1J2JA 4A2WA 4LJ8A 1ZMXA 3GEEA 1EXMA 5EE1A 2ZXUA 1N0VC 2VP6A 3HU2A 5LB2A 1NIPA 1VG1A 5B2ZA 5KSZA 1YZKA 4LBVA 4A6XA 2ODEA 4S35A 3QKSA 1TU4A 2Q3HA 3O8DA 4LX0A 1XXHB 2BJWA 2D2EA 4JIMA 4B6EA 3TR0A 1ZYUA 2VHCA 3CZQA 2LCFA 4LPSA 3LH5A 4M1WA 4E09A 2ZRKA 2CHQA 2FPLA 4V0KA 1W7AA 2Q0HA 3SU8A 1LS6A 4BLSA 421PA 2HV8A 1GOTA 2VA8A 1YR6A 5CM9C 2ERYA 2AKYA 2PMKA 3LXXA 4GSYA 4QGGA 3VQTA 3BC1A 1P72A 1UBFA 4LV6A 3AKDA 1MRNA 2NMVA 1RZ3A 3MUFA 1OYWA 4Q9HA 4X8LA 4DLZA 2NO9A 1A4RA 1ZUNB 1HE8B 4Q1DA 2BEJA 2Y8EA 5HKKD 4DCSA 4U7DA 3KQLA 1KSGA 4FW9A 4PHFA 1OW3B 3R7WA 2FGKA 5FBWB 2HYIC 1G21E 4JLAA 3WHLA 3W6OA 1RPZA 1HE1C 4FCVA 2QE7A 3QXCA 4QNRA 2OBNA 2J0SA 1WE2A 4GNKA 4BFXA 2ZS9A 1AN0A 1W47A 4URZR 2ODWA 3A58B 1OFIA 4C0JA 2QT1A 4YMTA 4D0LB 2KI5A 2ZYUX 3EWSA 4W5WA 1XXHE 1GKYA 3AGQA 4EUNA 2QTHA 2PXFA 2WPDD 1HH4A 3KUCA 4GT1A 1YZTA 2J0UA 3TBKA 2EFGA 1AGRA 2ZI9A 2C9YA 4M1YA 1XTIA 1WBDA 4NTZA 2V6JA 4ZCLA 2C2HA 3CLVA 2SHKA 3W8NA 5ANRB 5G40A 4B33A 4A8JA 2JATA 2WKPA 4KO8A 1CP2A 3R7WB 5F9FA 4IRUB 4LJ6A 1NL3A 4OQMA 2GRJA 2RKOA 4GMXA 1AJEA 4ON9A 1W2GA 3MWLA 2VIIA 1T3HA 1G4AE 2D74A 5JLJA 1OHHD 2PCJA 4X8HA 1XTRA 2ZUBA 1CXZA 4DLSA 4EPRA 1U90A 4TTQA 4YC7A 5HR5A 1DS6A 2G0NA 4GOJA 1HTWA 2OV2A 2ZRBA 1W0KA 4ITRC 3VFDA 4A6PA 3GLIB 3KJHA 1KI2A 1TF7A 5P21A 4QM7A 5TY0A 2O52A 4DLWA 2FFBA 2O0HA 1G3UA 1OF1A 2NQ2C 2OCPA 1E4YA 4OHWA 3U61B 1GFIA 3IUYA 3OF5A 3KXIA 2JQEA 3U44B 2DFKB 3Q5EA 2FV8A 4MA4A 3VR1A 3U6KA 4FCWA 2AHOA 3ADKA 1QHIA 2IYZA 4PO8A 4BLRA 3E5HA 3RC3A 3R9WA 2EYQA 1XMSA 3PUXA 5JHGB 5IHPA 2B8WA 3AF3A 3Q7PA 1NBME 2PCLA 4WIAA 4EFMA 2R2AA 3OE7A 3NDBB 4LJ7A 4E5UA 2JLZA 1T5LA 3IHLA 2NG1A 1GKUB 2HJGA 2PJZA 2NZ8A 1RYFA 3RRZA 2GHIA 1AKYA 1ZNZA 2VP0A 3AKYA 1YR9A 4YDSA 3CPHA 5DHAA 1SXJB 2C95A 521PA 1ZIOA 4E22A 1RE0A 4JBYA 2KBFA 2IWRA 4GZLA 4NYIQ 3REFA 1IN5A 2GF0A 4A0GA 3LWNA 2ORWA 2QT0A 4NZYA 5K8LA 5KOYA 1UM8A 1KO4A 1P60A 2BM0A 4PXAA 1DAEA 4IFEA 3PEVA 3GLGB 5IT5A 4HB4A 1W2HA 2Z0MA 2D62A 4DCTA 1UKEA 3JZMA 3L0SA 1NVVR 1CJTC 3I5YA 1F5NA 3LBNA 2FX3A 3T12A 2QPAA 4A36A 3A1SA 1R8SA 1M6NA 1SVSA 1OPXA 2OFOA 1GSIA 3PCRB 5CIQA 5EE9A 2QY9A 1EWRA 3WYGA 1VYTA 5DNYB 4KCGA 4EPVA 3LVQE 3B9PA 1NY5A 2GZHA 3VTKA 4XWKA 4DSOA 2IXEA 4IXNA 4C4PA 4M22A 1U98A 2FFQA 1A5TA 1GAJA 1Z2CA 4O2RA 1BYUA 4I81A 3SJCA 4IXMA 3K1JA 1IN7A 2GCOB 2ZTSA 4C0LA 3DO6A 4ESHA 1PUIA 2NOAA 2VF8A 3B85A 4CVNA 1JECA 1Z0AA 2BC9A 2RGAA 1NI3A 3QVUA 1JR3A 3WRXC 1ZINA 5L3SA 2X1VA 2F9LA 4HSEA 4F38A 1E9EA 2GZAA 5EZ6B 2QAJA 2WJJA 3ND9A 3HR8A 4DWJA 4F4CA 4PHTA 1OSNA 5KNBA 3JVUA 1E9AA 2HLDD 4AY2A 2XXAB 4GI7A 5FBQB 1W36B 3NG1A 2FWRA 2W2VA 3TGPA 2REBA 2ZSAA 3C15C 1XEXB 4B3GA 2YV5A 3GLFA 4BQSA 2QROA 1R7RA 2UZ3A 1E3MA 1ANKA 2PJRA 3KQHA 4M1MA 1KO8A 2C99A 3KUDA 1L4UA 2R62A 3DMDA 1JPJA 4KFSA 1N6NA 3UKDA 4RZ2A 3SZRA 2LWIA 1E0SA 4FIDA 1DE0A 1N6RA 1SVKA 2QP9X 1QHGA 2D3WA 2FSIA 2G88A 3D31A 3W5JA 2DPXA 2A5GA 3B1YA 2F3RA 3D3QA 1VECA 4KJZA 5KDLA 3DOFA 4FMCF 4E07A 3RLFA 4CEJB 1VYVA 1XCPA 1KOFA 1KYIA 4UXJA 2N1BA 1P2UA 3DVLA 3WNBA 4LDJA 4HLQB 4D6PA 1NN1A 1ZNXA 3QF4B 2X2FA 4MKFA 4HDOB 3MLEA 2AWNA 2CNWD 4X8MA 1XZQA 2O8CA 4EQ6A 2WOOA 2C9OA 2XAUA 2ZJ2A 721PA 1E9FA 4PPQA 1G7RA 1ZUHA 1Z8FA 1KHTA 1E1RD 3LXRA 1FQKA 4R2IA 4ASUA 3ZQJA 2C04A 1US8A 5C2JB 2EWWA 3VR2A 5GVSA 1IJFA 1Z0KA 1PJRA 2PXVA 1AS0A 1E99A 4C2TA 3GCGA 5EP3A 1X8JA 4LC0A 3E2IA 3QF7A 3AF4A 3KB1A 2JLVA 3KZ1E 3CBQA 4XTCS 3SN6A 1ZM9A 3VMFA 5F3WB 2VP4A 4LBYA 3EPLA 2R44A 5BXQC 1C9KA 3RS3A 4L9SA 2IS6A 4WZ6A 4IVQA 5DN6A 3THWA 2BEKA 1U9IA 2LKDA 4F4JA 2WSSD 2QAGC 3OFND 2BBWA 2IL1A 4PC3A 1IBRA 3U7EB 3K0CC 4NU0A 4HDQB 5JWOA 4NHOA 5FFMA 1EGAA 1LF5A 2OXCA 1P9WA 3A4MA 1NKSA 1M1YE 3BH6A 3Q5DA 3EZ6A 3SOPA 2V7QD 4LJ4A 1W48A 3B2EA 2YWEA 1CIPA 5BW8A 4HEJA 4A8JB 2XNDD 1R0WA 4URVR 3U3OA 1WQ1R 4R71A 2IYYA 2V3CC 2CE7A 1FQJA 4YDHB 2HXYA 4Q4LA 3EIQA 4FN5A 3O8RA 3GP8A 1NLZA 2Z43A 3SYLA 3FYHA 3H1TA 1OYYA 4Q1FA 1E4VA 5CJ2A 1F2TA 5C4GB 3CR7A 1LV7A 2CNWA 3LD9A 2HT1A 4DC9A 1T3SA 1E2GA 4C3ZA 2B21A 3VNUA 3U2QA 2ZUDA 4G5OA 4GL2A 2KSQA 4TL9A 2PXKA 1NMXA 4LJ5A 1PUJA 4ZI2A 4LHXA 4Q00A 1BOFA 4JLMA 1LB1B 3KJEA 1W36D 1OH7A 4HLDA 3DPUA 4I1VA 1VIAA 4QC2A 3VX3A 1V43A 2CK3A 1AQYA 4KVGA 4M1OA 1WXQA 5GJCA 2JGNA 2CVHA 2FG5A 3KKNA 1KKMA 3K9NA 2IF2A 4S2EA 4LGMA 1DOAA 4W5JA 3A1VA 3PUWA 2KE5A 2NPIA 2AWOA 1IM2A 4MYUA 3THYB 2HT6A 3VHXA 1F6BA 1VCNA 1XU4A 2VP2A 2C98A 2B8TA 2Q6TA 3V9PA 2QE7D 1KZGB 1N0WA 1NSFA 4Z8XA 4G5RA 1ZBDA 2ZE8A 1X86B 2J0VA 4C9BA 1SXJC 1HQYE 2IXGA 3NH6A 3IKJA 3WMFA 2IYLD 4OI2A 1NG1A 3LQXA 3ZVLA 3GLHB 2A30A 1IHUA 2IF0A 4IKEA 3I61A 2ZE7A 4EPYA 4Q66C 3X1XA 2XNDA 4RFSA 4P0TA 3ETLA 1Z28A 3DM5A 2IX3A 1E2NA 2QPTA 4QBFA 4EQ6B 4EKDA 1KSJA 2J41A 2ZJOA 2GF9A 2FU5C 1HV8A 2QPOA 1R0YA 3B8HA 3LV8A 3C5HA 3I8XA 2P65A 2OO7A 4LWZA 4IDQA 4NONA 4RFVA 2ZSDA 4IEEA 5SZKB 3MFYA 1F60A 1HY3A 1NLFA 2Q3MA 4TQUS 3LVRE 3A4NA 4NL4H 5CDFE 1G3QA 1KI7A 2DBYA 6Q21A 2ZJAA 1W4AA 1OFHA 1ZD1A 2XEXA 4MDEA 2ZITA 5AUPB 1SHZA 4TQAA 1WDTA 4C7OB 1BMFD 3QXSA 1UPTA 2AX4A 4PHHA 4JKIA 2ZE6A 2YYZA 4A0FA 1DAFA 2PXDA 3AV0B 3TLXA 3RC8A 1MO5A 1UF9A 2F7SA 3Q85A 2ONJA 4XVUA 1CJVC 3QKRB 1QHSA 4UJ3A 1GILA 1PLJA 1J7KA 4JLNA 4TMZA 1AS2A 1G8FA 2ZJYA 4TMWA 3P26A 5B58C 3M4YA 1GG2A 4DUGD 3AQ4A 3AH8A 4K8OA 5FPKA 1R10A 4BFYA 1NNEA 4B2LA 1OHHA 1GNRA 1VCMA 3B5JA 1G7TA 3GJ5A 1JALA 1NJFA 1XTKA 4Q03A 3T1OA 1G6HA 5AJZA 2XSZA 4B71A 5FTLA 1WMSA 2QSZA 1FZQA 3VR3A 3IBGA 3X2SA 4DDWA 3EW9A 1IJEA 1HQCA 1ZUIA 3DOEA 4C2UA 2OE2A 3P27A 1QVAA 1KDRA 4WAUA 1M7GA 1XJCA 3ASYA 3G82C 3LLUA 4KV9A 4PC2A 3AVYA 121PA 3OEED 4Q7JB 4N0DA 4PAMA 4QJ5A 5FI1B 2YOGA 3H84A 4Q7KA 4ZV4A 2OLJA 2J46A 2CCGA 2VP5A 1A2BA 5JEDA 3SYKA 4D81A 1KGDA 2VYFA 3VU9A 8OHMA 1FMJA 4CT5A 2O8FA 2FN4A 1YZLA 5DISB 4CRWB 4PQFA 2IC5A 1XTJA 1H8EA 1U0LA 4LJ9A 3U7FB 3BIFA 1LTQA 1CJMA 2JJ2A 4GP6A 4U5XA 1W4CA 4JT2A 3ZD6A 3QXJA 3SQWA 4MGYR 4AG6A 5FPYA 1H65A 4Q7LA 3I62A 4V0ME 1OJLA 5FTJA 3OIYA 3VX4A 3TKLA 1QHHA 3P32A 2QENA 1IQPA 2F6RA 3W3AA 3T34A 4ZCIA 3QPUA 1XWIA 3EPJA 4HYYA 2H5EA 3DEFA 1FNMA 3A1WA 2ZSBA 1OB5A 2CJWB 4B3XA 1F2TB 1GZSA 3LX5A 1HEIA 4MYTA 5BQ5A 4IEIA 1ONBA 1T8UA 3KJIA 1IXSB 5CITA 4TYNA 2IHBA 4O3MA 2ZIAA 5JS8A 3W8RA 2WAXA 3QJYA 4Q48A 4UNNA 1I4TD 1U0JA 2RAPA 2F1RA 2GEVA 1ZC4A 2CDNA 3SI7A 4MRNA 3FHTA 4Q02A 2ZRDA 4MQBA 1UDXA 4RZ3A 3BJIC 1K5GA 1D9ZA 2OT3B 1ZU5A 1MABA 2GJ9A 5DGXA 4QKQA 2PXUA 4FMDF 1E2DA 3QBVA 2IUTA 2QTVB 3LLMA 3QG1A 2X77A 2WIBA 5A5GA 4B32A 2XGJA 2VH5R 4FD2A 4WXPA 5DH9A 3T15A 3P4XA 1GDDA 2RGXA 1KZ7B 1KI8A 3BH7A 4A82A 3X1YA 1SHKA 2WWGA 4IFBA 4YXWA 1VG9B 4C0QC 3UWKA 1Z29A 5CLQA 2G0TA 2OCBA 4YQFA 2QP3A 1JPNA 1FOEB 5EP1A 5KYKA 4HAXA 5CB6A 4DKXA 2F3TA 2JDIA 3NHAA 3RS2A 4KHZA 3KTAB 3NBFA 2O8CB 5AUQA 3U3RA 4A8JC 3UANA 2ERXA 2NTYC 3TMKA 1GNQA 2G6BA 3OEHA 4OQLA 4NCJA 3OAAA 2AFHE 3SJBA 1KI6B 4JLJA 1N6HA 4M9SA 3W3ZB 4OQNA 1VKJA 2JAQA 5IK2A 4RCZA 1NN5A 2CBZA 1VG0B 4TYYA 1CR2A 2XTMA 4PANA 3AP3A 1TQ4A 1SVOA 4JLBA 1M8PA 2REXB 2CXXA 2WWHA 5FOTA 3IIJA 3QI2A 4QBHA 2P6RA 4URXR 1NIJA 2WICA 1VIYA 3AKCA 4U00A 1E2JA 4NYMR 3QKRA 4Q7MB 4Z1MD 1LS1A 4Q4AB 3MJRA 3BOSA 3IPXA 1UAAA 3KKMA 1H8ED 1I4LD 3THOA 1OH6A 4BZQA 2F1IA 1TX4B 2FNAA 2XOKD 1XJQA 1KO1A 1WP9A 3CNNA 3DZDA 2R6AA 3HYTA 5GJBA 2MMCA 3RABA 4HUQB 1FL9A 1KJWA 4EPXA 1ZC3A 2XJ4A 3OEEA 4I1SA 5J4LA 1NVUQ 1NKTA 3ONWA 4JS0A 2BKEA 1AGPA 1E9DA 4KU4A 3I5XA 1BO6A 4HLCA 1A82A 2OUKA 4P4UA 4MUAA 1TTTA 2HEIA 1XD8A 2EFEB 1CS4C 5F9HA 4AKHA 3EX7C 2MSCB 1YHNA 2ZRFA 2CLSA 2IUSA 3VU9B 1KMQA 1XB2A 2EU8A 3TNFA 4CF7A 1UDWA 2R9VA 3GJ3A 3AGPA 1X1SA 3OFNA 4M53A 3CPJB 5CDFA 5CK5A 5AK0A 4LHZA 1MR3F 5D3QA 3NC0C 5J40A 4BFSA 1MOZA 1P62B 3P4YA 2IS4A 2IWHA 2F9MA 1Y3AA 3QEJA 4PPNA 2I3BA 4B6FA 1GM5A 4HI0E 2OBMA 3MMPA 2EFCB 1GWNA 1I2MA 1VTKA 2FFAA 4UXHA 1E2MA 2RGDA 1C4OA 1M7HA 1CULC 1IN4A 2RGCA 4OJKA 1G8PA 4A15A 1E0AA 4IJMA 3FWYA 3LQRA 4TYQA 1ESNA 1JI0A 2CHGA 2WSSA 4ZCMA 2JLQA 3H4MA 5DSZA 4XD7D 3BXZA 2J45A 3MGCA 3PENA 5FUYA 4YMVA 5EQTA 4PQRA 2YVUA 5DN6D 4JL6A 1W36C 3UMFA 3FKQA 4NKRA 3D6TB 3SR0A 1R2QA 2A2ZA 4DDVA 5GADl 2YHSA 3SJAA 2W0MA 2RGEA 4QHSA 1FP6A 2EFHB 1DO2A 4RZXA 4A2QA 1CJKC 2ZANA 1G3MA 2WMNB 1FFHA 4L4UA 3CB4A 1DG3A 3ZQ6A 3RVBA 3ZVRA 2GJAA 3IPYA 1NVXQ 3GLGA 1II8A 3ECCA 1G8HA 4CEHB 5AJVB 3BRWD 2HCBA 1N25A 1R0XA 4O25A 1VPLA 2WJIA 5JSZB 1P61B 5C18A 1HURA 3CRRA 1ZD8A 5JRZA 4LHWA 2FSFA 3Q72A 1XTQA 1B23P 2W6IA 4US1R 1NJGA 2ZI5A 3B78A 2FE4A 3FMFA 3G5UA 4CGZA 4W9MC 4QXAA 4NP6A 3EC2A 2IS1A 4NH0A 1XPUA 1R5OA 5EXXA 4Y0AA 1ZAKA 3VR6A 4DIEA 4D0NA 4IHQA 4WA7A 2E1RA 1S1CA 1W5SA 5KPDA 5FOXA 3CF2A 4M4SA 3UG7A 4C0KA 2VQSA 5L3SB 5HZKA 2KBEA 1JQLB 4KYIB 1KAOA 2W2TA 2X19A 4BECA 4QHTA 5H1YA 3MJHA 1UKZA 2WAYA 4A1FA 5BYKA 2PMDA 1CJUC 4DSNA 4PSAA 2H7VA 1EK0A 1G41A 4B76A 4TZ0A 1KIMA 1OLOA 1WBBA 3PJRA 1P9RA 3THYA 1Q12A 4TN1A 1YZNA 1JR6A 4A4DA 1A2KC 3DHWC 4NYJQ 2OSBA 4B3BA 1E94E 4NMMA 4D0GA 3DM9B 1Z6AA 2G1JA 5JFGA 2YC4C 1N3BA 1G18A 3U3KA 2O8FB 3MD0A 3TJZA 3PVSA 2ZR0A 2VO1A 2ZRAA 4B2PA 2HDNB 2GJKA 4PTLA 4UNPA 1TQDA 2QORA 5HCNA 5BN4A 1EG7A 4MGZR 3UMSA 4CW7A 1MH1A 1QF9A 1Q1EA 3OZXA 4E03A 4MGKR 4D80A 3TRFA 2F55A 1E2KA 1SULA 4LHYA 3PUYA 2I1QA 1P4SA 4EFLA 5FPHA 4PZYA 4A0HA 4AI6A 5IF9A 3CW2A 1O3YA 1XMVA 1TEVA 4MRSA 4QGHA 4XSGA 3BWDD 1KNXA 2DFTA 4K46A 4MKGA 3HDTA 4KVAA 2JDID 2NIPA 5EE3A 4V03A 3TR5A 2P3SA 1LFDB 4PSVA 4L5BA 1RW4A 4ZIRB 1E9RA 3CM0A 1E69A 5FTNA 3NHBA 2EVWX 4UNSA 4B3CA 4QG7A 3TSWA 1COWA 2QMOA 1RJ9A 5DYGA 2ZS8A 1U9IC 2WM9B 1Z06A 3DMNA 1T5IA 2EYUA 2YWFA 4BRUA 3EAQA 1JXOA 2G1KA 1WA5A 1FP7A 2NGRA 1N5IA 2R6FA 3W6PA 3F0TA 4WVFA 5CK4A 5DHFA 5FL7A 1RVDA 3MWYW 4TT3D 3UATA 1XCGB 2PXQA 1P3JA 3AEZA 3L8ZA 3MSXA 4JLVA 3VR5A 1G6OA 3FFAA 1N5KA 3K8YA 5G41A 2G77B 4P3YA 4JMPA 4JLPA 3SFZA 3WYFA 2OZEA 4MYHA 1JJ7A 1XEXA 3GJ4A 4KBGA 2MSDB 2GJ8A 1SKYE 5DI9A 2RHMA 4UJ5A 3RS4A 2ZVQX 4PFSA 2FPKA 1NN0A 4Q4JB 3B9QA 5L8VA 3FB4A 4LV8B 1EFCA 3ADDA 1AZSC 2IHYA 4LYFA 4OQXA 3QE0A 2CL0X 4RFSB 5DLQC 1CR1A 2FZ4A 3NWJA 4TTPA 4KSCA 5M04A 4Z51A 1GRRA 4LV5B 4HB2A 4R9UC 4B35A 4BUJA 1XD2B 1R4AA 2OXRA 1U94A 2ZVPX 3GMTA 1F3OA 2ZAMA 2Q9BA 2WKRA 3QXHA 4LOAA 3GPLA 3DKPA 4HDCA 1II0A 2DWQA 2DWOA 3AVUA 4Q01A 1EFHA 5KSPA 2D7DA 2V1UA 1ZM7A 4OK6A 1WCV1 3EARA 5EP4A 2GNOA 3EG5A 5K8UA 3L43A 3QEOA 1LY1A 221PA 2ZAOA 2ZYTX 4TSFD 2IYSA 2GKSA 1ZVQA 2WWWA 3R9XA 1XRJA 1FUKA 4JSTA 3VAAA 2UZIR 4G1UC 4ZO4A 1UKVY 2QGZA 4PX9A 3C4JA 3KFVA 4FWTA 1YJ5A 1KDOA 1NLYA 4B75A 1IOZA 1SKYB 4PR0A 1DAIA 1E2IA 1FW6A 2A78A 3AM1A 1N5LA 1TF2A 3EWAA 2I1VB 2QM7A 5DI3B 3SC3A 4RD6A 2ZSEA 1U2RA 4GRAA 4OHVA 3THXA 5B30A 2R8RA 2QA5A 1B0UA 5K8TA 5KSYA 3I73A 3B1WA 4DT1B 5DE3A 3TQCA 3CF0A 1XX6A 4M0LA 1R5NA 1IN8A 4ZDWA 1TUIA 1A7JA 5TDHA 3SEAA 3EZFA 1W46A 2ZRCA 3GJXC 3IO3A 3OHMA 2QUZA 3ZGXA 3GFOA 4GMDA 1Z08A 2JLSA 2VLIA 2ZYWX 3AP2A 1UADA 2CCKA 2PLRA 2YKGA 1ZM4A 3UK6A 3EA5A 4BEJA 3GJ0A 1QHYA 3TVDA 5FUWA 5IK2D 2XZOA 4QBIA 2ODNA 3EC1A 2QMEA 4CEIA 3OEHD 3FKSD 2ZI6A 3U44A 3X1ZA 1N6IA 3T1QA 5HPYB 4PC6A 3DDCA 2HXSA 3BBPA 2AKAB 4RD4A 5HE9A 3BH0A 4KLZA 4HAUA 4DB2A 4MRVA 4ZPXA 1ZNYA 1Q1QA 4IVRA 1SVMA 2WTUA 3ZS8A 2PZGA 1RFLA 4Q5IA 1XEWX 2JIZA 3ZD7A 4CEHA 3EXAA 4WZBE 1MRSA 5CIWA 1RIFA 4BFVA 3ZVMA 1VHLA 3QF4A 2ZE5A 3W5IA 2UKDA 2GBLA 3AF2A 1JNYA 2R65A 2A5JA 1FUUA 3NKVA 3PUVA 5KO2A 1G1MA 4FMDB 1OV4A 1RKBA 3I3SR 3BFXA 1XEWY 1YRBA 2REOA 2J87A 4TZ6A 2AD1A 3V00A 3T06B 3AUXA 3CR8A 5GAGi 1G291 1SXJE 4IDOA 2CEAA 2XTZA 4ZDIA 3X1WA 4RCYA 3C7KA 3KFXA 1MO4A 2GXSA 1PVOA 621PA 2WJVA 2GAAA 1P6XA 1CTQA 2W83A 3WY9A 1E0KA 5LD2C 5SZHB 1AM4D 4PSKA 2DHRA 2JIZD 2QN6A 5FUVA 2QTFA 2VSXA 3RNLA 3LW7A 4M21A 2BDTA 1DVRA 4KFUA 3S1AB 3UG6A 3QKTA 2F1HA 5GVRA 2QMUA 3I1FA 1W44A 1Q44A 3SDZA 4FWIB 1DEKA 2ATXA 3B7GA 3BGWA 1OKKA 2WVJA 1OXVA 4OK3A 1X8KA 1XMIA 2FEOA 4XWAA 2YZ2A 5CYOA 1AZTA 3KDSE 2CE2X 4C0HA 2A9KA 4HZUB 5FI0B 1T3LA 4H1VA 3KX2A 2FDCA 1RRPA 1DADA 2GVZC 3EPKA 1HYQA 3IEUA 2MSEB 1KI9A 4HATA 3H86A 3IDQA 5KPJA 2ZRMA 3QOFA 4M1TA 4TMXA 1KSHA 1F2UB 1EX6A 4D4KA 1YKSA 2IUUA 5J47A 2EQBA 2XXAA 3QNUA 2IW3A 4IW3B 1G20E 3GLIA 5KNDA 3KKPA 5AJYA 2K5UA 1MT0A 3FOZA 3K70B 1XPOA 3KQNA 2O8DB 1ZW6A 4DBLC 1S2MA 1D2NA 2HCJB 2QQEA 4G0NA 5G53C 4HB0A 3CRQA 5DIFA 4BGDA 2GXQA 1FNNA 3GJ7A 3ND8A 4BFZA 3BB1A 4HAVA 1E9SA 3LY5A 1LW7A 2XB4A 2O8BA 4IOJA 1E96A 3LO5A 2Z83A 3F5FA 4JKYA 4Q1EA 2ECKA 3MAAC 2JLYA 2RGGA 1DBSA 5TV2A 3QXXA 3LRPA 1G5TA 2ZEJA 2BV3A 2B7CA 1S0UA 2PH1A 1SXJD 1YZQA 4LYAA 4CT4B 3HJNA 4AYXA 5G3YA 4TMKA 2QM8A 2MMGA 2AN9A 4RJLA 1MABB 1TPZA 4QHYA 3N5CA 4LZZA 3E70C 1ODFA 4KYUA 4LYHA 4DSTA 3K70C 2GEUA 4G5GA 1DAHA 2ZRGA 2QQ0A 2BBTA 1U99A 2DFLA 3SBDA 1OXXK 4ACBA 4N1AA 2JASA 4TLDA 3SHFA 1KK2A 2PXTA 2GCNA 3N70A 1E2FA 4V02A 3MWKA 5L3QB 3KTAA 4LJYA 5EXSA 1COWD 3RRYA 4B2IA 1N0UA 2FSGA 1IY0A 1N6PA 1VDZA 1ETUA 2O8EA 2WJHA 3CPEA 1J70A 1OIWA 2J1LA 2YWHA 3OIUA 3LBIA 5KDOA 5HZHA 4B48A 1AKEA 1P73A 2DB3A 1HT1E 5H70A 5JHHB 4ARZA 4D4LA 1LVGA 1P75A 2O5VA 3K9LA 1CF4A 1W1WA 1UBGA 2A5FA 2N42A 4DXAA 3TSZA 2P67A 4TMTA 4RSGA 2ZU0C 3P1JA 4G5SA 2P0EA 2ZI7A 1GUAA 1E1QD 1XD2A 4ERNA 1J90A 2ZRIA 4AG5A 1MKYA 2Q21A 2ATVA 2FZLA 2GZDA 2JEOA 4M9XA 3C8UA 2DR3A 4GFDA 3RANA 3AVWA 1ZCAA 4RKEA 2OEPA 4OJQA 1GRQA 5GAHi 3Q9LA 4G01B 2ZROA 5HKKA 2B7BA 2YJTD 4BFWA 5B64A 4KITB 4ILEA 3U60B 3NBYC 5EJEA 1RRGA 3T5DA 3QENA 4JJKA 4I99A 4M9QA 4F93B 2CK3D 1AA9A 3N2EA 3CKLA 2O8EB 4JZKA 2IYXA 3LX8A 1SZPA 1D9XA 4EPWA 1QVRA 1TNDA 4B34A 3V4RA 1S3SA 1NSTA 1VCOA 1ZJ6A 4MRPA 2ZRPA 5LDDC 3IEVA 5IRCD 3K0SA 5EXPA 1ZRHA 3AUYA 4TLAA 4MRRA 2C77A 2OFXA 2IS2A 2IYUA 2W6JD 3L2OB 5L3RA 5FOWA 1D5CA 4BLQA 1CRQA 1OH5A 3TW8B 2RGNC 1IN6A 3UXMA 3QPWA 2F43A 3I8SA 1TQ2A 5BN3A 5CB8A 1ZD9A 2PLFA 2ZM5A 4R98A 1W0JA 3OIWA 1WB9A 4AD8A 3DKVA 3VHLB 2RCNA 3HPRA 3K9HA 4OKSA 2YC2C 2OAP1 4XOIA 4PZZA 3B60A 4UQOA 2XB2A 1DAMA 1K8RA 2VL7A 3WRYC
chains in the Genus database with same CATH superfamily
4ZCRA 1M2KA 5ALSA 2HC9A 3OOJA 5JSUA 4MWGA 4R7GA 2RI6A 2JX0A 1PJZA 4L16A 1ICIA 4HT3B 4M0EA 5E1BA 3FHCB 2JW5A 4QXMA 1MTZA 3BRQA 9LDBA 1ZL0A 3U7RA 1RJFA 3OE7D 4Z9IA 3GRAA 2ZP1A 3T4UA 3ZU4A 1T8TA 1XLTA 4PRLA 1MQ8B 3I34X 2V6GA 4NS4A 1PZXA 4D26A 5CJPA 3PEWA 4BFUA 2F00A 1K6JA 3QU9A 4NCAA 2Y67A 1NX9A 4IKOA 4E0IA 3FBTA 4FQ8A 2XCQA 1DOZA 1P80A 2PXBA 2NYRA 4IVZA 1XJ5A 4O4HB 3RIXA 1TU0A 3DONA 4AKIA 1NBAA 2BPOA 4Z9JA 3ESBA 4HVAA 4M87A 2RI1A 4PNHA 4WV3A 5M7EA 3EZ2A 3EIHA 4HYEA 4BMZA 5LMCA 3KXLA 2ZYDA 4F6LA 2UUBB 1DQRA 1I3LA 1OH8A 4EJSC 1VSUA 1BTOA 3HKEB 3IBFA 4FYYA 2SICE 4YRPA 4BLPA 2ZTVA 3V2UA 1C0IA 3IBSA 1FDTA 2IU6A 3E53A 4EBBA 4S1TA 3P20A 2FJPA 3KT6A 4JC8A 4MVJP 5H8WA 2PQ2A 1T6UA 2LYPA 3ESYA 1ZMRA 2BN4A 3IVXA 2GEFA 3UUWA 5K8CA 5K7SA 1QM5A 4U2FA 1U3TA 5LA6F 3KVNA 4DOZA 5EL0A 2AN5A 3LQQA 1Q3HA 2PFDA 2PM8A 1D6JA 1XQ9A 4U02A 3RRFA 2GN2A 2QLFA 5BVGA 4I3FA 2HHJA 4JVMA 3G68A 4LBZA 2PQMA 2TMYA 1F7UA 2I3GA 1NT2A 3U7IA 1VI6A 1LVKA 5CLHA 2OENG 2GBCA 3LOPA 3L7IA 3SJZA 5LP6A 2IYVA 1ZL2A 1H8HD 3BB4A 5B1AC 4L8GA 4YJDA 4BVFA 4JL8A 1JKIA 2R7MA 4IJ6A 1ORYA 5I9SA 1POWA 1I0ZA 4Z59A 1TADA 4LAFA 3RRMA 4TMVA 3KZVA 2BMAA 4FR0A 1ULAA 1XP8A 1JBKA 3A7DA 2F1JA 2PXLA 3EIXA 2OFYA 3MOSA 4J4HA 4LK2A 4IDHA 4MROA 1ZS4A 2ZYAA 4RY2A 4M6WA 2C97A 5DPMA 3VU1A 2I91A 4KXXA 2X4DA 4NMLA 4RU1A 1Y7YA 2ZUTA 4D9MA 2H8RA 2VYCA 3KEQA 4OLHA 4H0CA 2IPMA 3KYCA 2VJDA 4M7WA 5BNFA 3L0OA 2O9XA 1G63A 3QV1A 3CQZA 2OAQ1 1YYXA 1FRFS 1BDJB 4HN2A 2HQ1A 1X1EA 1RABA 1VMAA 2OB2A 1BCSA 4Z7NB 4WESA 1SEVA 4YP9A 2IODA 4XYLA 3RYHB 4QUJA 3LXUX 1C0PA 4YV0A 4I2NA 3D8BA 4BVHA 4EJSA 2RH8A 2FP4B 3X2FA 4BEVA 3KJFA 1W8DA 1PZNA 2VP9A 2BL2A 3ZWCA 3ZV6A 1YYJA 1SCUB 2X9VA 2FF7A 1Z56C 1IXYA 3HJCA 2QEQA 4J1SA 2FA9A 5A0TA 4DZRA 1DEOA 4FOLA 3A9VA 3K0HA 2GESA 5JRJA 1RHRA 2J9RA 4REMA 4RETA 4N6GA 5ADWA 2XBLA 2RJ3A 2GQ0A 3FSJX 4QFMA 3D8UA 4HZIA 2XA1A 4TVKA 5ICGA 4M3NA 3HN7A 1ZXLA 3BZBA 4DMGA 5E3HA 4DIKA 5FUXA 1EESA 4K7JA 2D2FA 5COGA 1O08A 1Z83A 3EYWA 3RQGA 1L9XA 2QIPA 4Y9RA 5JE8A 4Z53A 1CY0A 2A7XA 3EZXA 4H2DA 2CJXA 3NX4A 5EMMA 3JAMA 2LCIA 1H0HA 1R6BX 1RCTE 4KUGA 4IF6A 2WB4A 3QTHA 1OMOA 4MYRA 1OCOC 4LCEA 1NRJB 2XWPA 1PR4A 2V4UA 1BDJA 3SMVA 4DLAA 3ZNQA 2I62A 1T0PA 4YJFB 4OI0A 1O54A 2RB4A 3IEKA 4KXNA 4CLHA 2XKAA 3ADCA 2OCXA 3LT4A 1VLQA 4HFKB 2QP4A 4FT2A 4EJSB 1XPJA 3CUEF 4IV8A 1QGZA 2C92A 4EPTA 3AVVA 3I9MA 2HSGA 2E48A 3UO8B 2EATA 3R6LA 4G1BA 2R6R1 1KC1A 4TVSA 4IIJA 3IAAA 4XB6B 3K6JA 2WUEA 1O6FA 4Y2XA 3UR3C 2WF9A 2WOJA 4EJ0A 1JSRA 2YWAA 3PPXA 2G80A 1YR3A 4QFDA 3T6GB 3SS7X 1ESMA 3RKRA 3D5TA 3ZD8A 2B92A 2ORVA 1Y4DE 3NJ8A 5DTRA 1ZVVA 2PL3A 3OTGA 2W58A 3PVCA 4JSRA 1UT6A 4OSOA 1EVJA 1SD1A 2QYHA 2VDUE 5KJCA 3CG0A 4OHKA 3DZAA 3HPQA 3ANMA 2J3KA 4HNGA 4QM6A 2AUTA 2GAFA 3HBFA 5KYYA 1PJBA 1X0XA 2W9XA 3OEYA 3YASA 1KY2A 2PSEA 5IKXA 5CVDA 4CSAC 1LQ2A 4OJYA 3ZS9A 1E1YA 4JB3A 1RM3A 4AQDA 3QITA 4L3WA 3PUZA 1KF0A 1RACA 2QBYB 2P61A 4D79A 2J3LA 4JT4A 4IO1A 5KC9A 1XJ0A 3NBZC 4LFCB 4ZVKA 3CF6R 1H3NA 3PP8A 1E6LA 3DR3A 4XVQA 1WUHS 5B1DA 4QDZA 3VR6D 3JASB 3BF8A 4UEWA 3NBAA 4MR9A 1UXKA 2ZIZA 4OL0A 3HCRA 2COEA 2WIFA 4LYJA 1MNDA 2JD1A 3TH5A 5AC5A 3WIDA 3AR5A 3II6X 4CKWA 5JS7A 4RGVA 1F14A 2GDJA 3ORYA 1ENYA 5IAEA 2WVAA 5FWXB 4ZO4A 3IELA 3JSZA 3ZCSA 2VTBA 1J06A 2IZ6A 3HDVA 4H31A 2ETSA 1ZIDA 5LXTA 3A6GA 3C8GB 2OV8A 4E12A 2L0XA 2F62A 1GHTA 2PO5A 4RPKA 1FTNA 4JQYA 2FH5B 4KC9A 1NJ2A 1KQFA 1JQ3A 2Z4RA 4KZKA 3U31A 5JWHA 1CY4A 3PE6A 2HSQA 4Z4QA 3KIPA 1SCBA 1Z6ZA 1H9AA 4CIYA 1KAEA 1QG0A 3F9CA 1FTQA 2VA9A 4MYCA 1NM5A 1X74A 5CH8A 1PFYA 3GJRA 4FBMA 4JOQA 4N39A 3BD9A 1SIUA 4URUR 2A0BA 3HJBA 3NHWA 4OAPA 2CJYA 4KQWA 1P7PA 1U2DC 1W52X 1XV5A 2YHIB 4RK1A 1J9EA 4Z3DA 5J4KA 3AYZB 3BRSA 5JFGA 4CIDA 3J81k 3NVMB 4BN5A 3GEHA 4EYSA 4KDRA 1PFQA 1IUPA 1PJ2A 2ZJ5A 3O2JA 5EEGA 3KQKA 2Q3BA 3KELA 5HA5A 3HQ4O 3HHPA 5DWVA 4X6UA 5JAQA 1YR8A 1M6YA 4UUOA 2UVPA 4EENA 3THXB 2EP8A 1LPNA 4HYTA 1A3CA 4ID3A 1KKLA 3EEYA 2ZKLA 4BMNA 1SOMA 1E2EA 5TQVA 4ZDJA 5LQAA 3KSAC 2XCSB 1N7HA 1XNHA 1Q20A 2GARA 2UVDA 2WAMA 2PR7A 2ZWVA 4HB3A 4KUHA 5CP8A 5AXBA 1U8AA 2XLWA 1C1XA 1G2IA 4KN9S 5E7IA 1RXWA 5I9TA 1Y63A 2A5YB 5I4IA 1B0ZA 2L18A 5I7RA 1LDGA 2OBFA 3TR6A 3BE8A 1LPOA 3LS1A 2CFCA 5TARA 4HMPA 5E7MA 5JJIA 1S2OA 2GBLC 4LACB 5HF9A 5L53A 1JQDA 4OIPF 4G7OF 2BIFA 4MA5A 3WQSB 5GY7A 3C8HA 3U3MA 4Q9LA 4H60A 2JGIA 2FN3A 1LCIA 1OLUB 2P2GA 3FMOB 3KR1A 1YDFA 5HUHA 1HFWA 2WHYA 3ES9A 2E4WA 4A2CA 5H68A 1PQYA 2OG1A 3VDXA 1SVLA 1IXRC 1MRZA 3UMYA 5FTKA 3FCCA 2ZSIA 3DL4A 4YN3A 1Y3FE 3LNCA 3RU7A 4HH4A 3DKRA 4R1OA 1U6IA 5E9AA 3U4QB 1EFRA 1G8XA 1KI6A 4XARA 1NW4A 2ICAA 4Z99A 5FNVB 4BMPB 4DDTA 3DT8A 5F1KA 3AR8A 1NU7D 2UUOA 2G25A 2P30A 3E9NA 3EPVA 2QZSA 3MPOA 4IVPA 2D4HA 2VJNA 1XG5A 4JJAA 2QV7A 1GFWA 4DS3A 4RE5A 4QUGA 4ASUD 1QKIA 5AHOA 3NETA 1B16A 1RS0A 1CPRA 4XJTA 3DS8A 1F48A 1SUAA 3BIXA 3NIWA 4MW9A 1B7GO 1OLSA 3M8KA 3I4LA 1SD2A 3IH5A 4OG2A 1BYIA 1HFKA 4FSHA 1K40A 2O23A 4H3HB 4HEHA 5K51A 3WX0A 1CK4A 2HJRA 5KQRA 1L7DA 5EHQA 2X51A 4BO2A 2IE0A 2OGWA 2OHOA 4WHMA 4KIUA 3GRPA 4M2LA 1KI4A 1TL7C 1TAGA 4PLTA 2O3SA 2GAJA 4INOA 4GKAA 4YAJA 4S0ZA 3ZU3A 1JHXA 2D4AA 3M2TA 2G72A 2OGSA 4JBHA 5AOVA 1XWFA 4E31A 2WFZA 2C3OA 2PBZA 2W7TA 2V74B 4F5YA 3CLHA 4EMTA 1H93A 1XDBA 2JFUA 3I5MA 1C7FA 4NCHA 1CETA 3A37A 4O63O 5D84A 4FJ0A 4K3UA 5A0VA 1PJ4A 3WMXA 5HJEA 3OCZA 1T0IA 4ND5A 4YO7A 3FBWA 4TT8A 2QRUA 4D1YA 4XI9A 3ZLTA 4C2AA 1PRYA 1G4WR 2CJWA 5D1NA 3KWFA 3MZ0A 1GL7A 4LY9A 5CYGA 3ODGA 2XWBF 4R7TA 3SFVA 1QFZA 3VC3A 4C7OA 1U8YA 4MCIA 3AFMA 1TKNA 2ZYVX 5T41A 3WMGA 1FW6A 1M5TA 1M76A 1T9CA 4HWOA 4J8PA 1XL1A 2J3JA 3BFKA 1G8SA 3EFHA 4D99A 3NR2A 5JNSA 3HN2A 3HXLA 2NO0A 3AP1A 2DECA 2JHPA 3MTQA 3STUA 3LBYA 4CMEA 5AVSA 4QRHA 3CX7A 1XI2A 3HU3A 1E60A 4DCUA 2KEJA 4CEJA 2FWIA 1E2HA 2OAEA 3JZFA 4H1HA 3WKBA 4EO9A 4GOXA 3KD2A 2X7JA 2D1QA 2NW6A 4O4IB 4DJTA 3GDFA 1OU0A 5KYNA 1WWKA 1YVDA 3TOLA 1SB8A 1WUIS 2M1ZA 1OAKA 3GGJA 1T8RA 2G63A 2PEYA 3OPXA 1FVXA 4KSBA 1ULUA 5F5HA 2QL7A 4O2AA 3M3PA 3UPUA 5F76A 3S0XA 2FJUA 2GEDA 2A6HF 1F1MA 1WWPA 1H2HA 2P4QA 3CLUC 3SMQA 2GWRA 3TRKA 4JAVC 3A6DA 3HHEA 2ONYA 2X8WA 1JVBA 2Y1EA 4EZBA 3UB4A 1FMFA 4O2LA 1QF6A 2HIAA 3R3JA 4L9WA 2QSYA 3OFKA 2BDUA 3LISA 1AB5A 1DKOA 2H2DA 3RGGA 2XYVA 4I7EA 2G4LA 2J9ZB 3NYMA 2HDHA 1ZCFA 2ZB8A 4NBSA 1QAQA 1ZITA 2L1PA 2Y6UA 1UP6A 4FI3C 1CPQA 2FVYA 3NZEA 4EITA 1XWRA 3GIWA 1U2GC 2VF4X 1K5HA 4CKXA 4PTZA 3UJ7A 3JR3A 3F6WA 2WTBA 4V24A 3IESA 5GOZA 2FX2A 4ZCSA 1E59A 2GN0A 5IDVA 3TL2A 1P1CA 3PXAA 1SQ0A 5LR6A 1W25A 1ZEJA 3OKPA 4MWTA 4WLUA 1N36B 4HFFB 2C7VA 1G19A 4MZDA 2DTXA 3FVQA 2OB1A 3BMOA 3V3TA 4WJ0A 1PZGA 3FCAA 2BT4A 3M6IA 5BOVA 1L3PA 3A9XA 1IBLB 4HNQA 4OSPA 1DWUA 3K0EA 4LTDA 4E18A 5DJ5A 4AY4A 4DHEA 2B5WA 4UKDA 2JLUA 4OAOA 1AIPA 1PV4A 2QVLA 2I66A 3GGGA 3FKSA 4J0QA 4LDRA 2N9UA 3CWQA 1E2PA 1NUAA 2XRFA 5IC5A 4BFTA 5KBYA 3FOBA 3TUJC 2GCOA 4BLOA 3BREA 2WU8A 2LP4Y 3F3KA 4EM6A 2J7PD 1YQUA 3KMIA 2ZLBA 4NYIR 3KOZA 4LVOA 3P9YA 3RAPR 1JQAA 4OYRA 2OR3A 2KYRA 3EZYA 3CJTA 3PXPA 1XROA 2WT8A 2G1AA 4DPMA 4IIEA 2JNWA 2CCYA 2Q3EA 3FXHA 3HA3A 5L0GA 4JQZA 5FEMA 4AKEA 4Z9XA 5T6MA 1WOMA 1NQXA 2JD2A 3PNVA 3BL5A 4OXQA 4WBNB 3P97A 2VXCA 3W3AH 1CZUA 3ZJ4A 4WOPA 1BA3A 4RK6A 5FDFA 1MHPA 4AJNA 1L7AA 4C30A 4EO4A 3UJNA 1E6CA 1XZAA 2YHIA 2PUTA 3DGEC 1U1FA 4FKMA 4JY7A 2CL7X 3RVDA 3HP1A 3WLAA 4MJ3A 3FMIA 1DTSA 2UYOA 5KSOA 4ZYUA 4DUGA 1LE4A 3HR7A 4X4HA 2I7TA 2PYZA 3VKWA 5I7SA 1CT9A 4MW5A 1P6UA 2FPSA 2YW2A 4M60A 5AOAA 1GPAA 3L4BA 2XNJA 4ZYZA 1Q57A 5FH9A 5FWNA 1GS9A 4HNTA 2IEGA 4H9GA 1XNRB 2ROQA 2AK2A 3AT1A 3EIEA 5I7EA 2GVDC 2HSDA 1D5WA 1KIAA 1QFSA 1ZNWA 3ICEA 1ZOLA 4F1WA 3EXHC 3VTAA 3D6UA 2JFPA 2PKQO 1NKVA 5DNUA 2ZJ0A 3LP5A 2R7SA 4NH4A 4IMPA 1Q21A 1LUAA 4INZA 1BMFA 1UDCA 3H3JA 4N6NA 3EGVA 5C8YA 1ILWA 1GNPA 3KPYA 3SNKA 3O4VA 5EE5B 2AI1A 4MUKA 4AIIA 1L5VA 2MT9A 2B37A 4QBGB 5G0VA 4DV3B 3UFXA 3F7TA 4AF7A 3HI4A 4PG6A 2MSNA 2PUWA 3AIKA 2HH9A 3RFTA 3T0GA 1Q0KA 3C74A 3ZLBA 4HGRA 1ECPA 3MHTA 2FEWB 4BEWA 3WRYA 2AFRA 5K0ZA 3ZOZA 1L2TA 4G0OA 4Q34A 3D1LA 1Q17A 4KKXB 5ILOA 1N5RA 1XOIA 4H7IA 5AHXA 3VYRB 2Q9CA 2VYQA 2A9RA 1X1BA 3JQ7B 5DMHA 3IXLA 4B74A 5JXJA 1QIKA 1LTKA 1SF8A 4MS1A 3ND5A 1FSSA 2R6ZA 1AU7A 3RUEA 3LHKA 2PZ8A 2WWFA 1XLTC 2WIDA 4G24A 3C14C 3MTBA 3KV1A 1EDOA 4J29A 3FNEA 3AY0A 1GKIA 2P2NA 5JXGA 2CVFA 2I22A 2FOLA 2WZCA 2GH1A 3AKEA 1NU6A 2HLDA 3HNRA 3IUEA 4ARAA 4CR6A 5L95A 1DKUA 1UP7A 2MSWA 3QY0A 1O87A 2VH3A 3HFSA 1HK7A 1Y8RB 4J9VA 1OZ0A 3WKCA 1ZHZA 1E79A 3MELA 2XNKA 3RS5A 4NYJR 1OR2A 1YRWA 2BJVA 2YVAA 3GZ4A 5IKEA 3KQQA 1NDHA 5JDCA 4FB5A 3PMRA 3VZQA 2XMZA 5H16A 5KU7A 3HRHA 1P77A 1KO7A 1IWBB 1S8FA 1RYYA 1E1MA 5E1MA 2D5VA 2YTZA 1J1IA 2JJ8A 3MN1A 1KMHB 4KFTA 4QUHA 3CNOA 1S3IA 4KIWA 3C87A 3TSCA 2ATEA 3QPAA 4WK2B 3V7UA 3VM6A 1G60A 1GXSA 3ELBA 2PKEA 3VYSB 4ZICA 3RF6A 1Q3TA 1MF7A 3EGWA 3LJBA 2RH9B 4RMHA 4E30A 5F7OA 2EJVA 4FDUA 3GBPA 4EL0A 2J0UB 1W581 2QAGA 4OKIA 4A0RA 4Y2VA 3U4CA 1NF8A 3IO5A 3K30A 3TEMA 3OAAD 4KOAA 3U7QB 4F2PA 1W4RA 1AHHA 3MWJA 4FINA 3KKBA 3ICPA 4Q4HB 4XLZA 4ZAZA 4AYWA 4JI7B 4FGZA 4J0KA 1IONA 1P2DA 1M2OB 3C0KA 2O8DA 1XFAA 2VDRB 1NHWA 1JVNA 2VEDA 2HZ8A 3H6KA 3KYDA 3CN9A 1DFIA 1OTXA 3O5AA 4RTOA 1GDHA 4Y67A 4DDHA 5BN5B 2DSTA 1F8GA 3O8OA 3FUXA 3DTVB 2WZQA 4W5RA 3QIVA 3T8YA 2Z8YM 2P9HA 4M7OA 1N8KA 1GNSA 3USES 4R69A 1IOVA 4UHEA 1PFKA 3HCDA 3JYLA 4MIOA 5AKGA 1XXHA 3ZI4A 3PXCX 2LFDA 3G0OA 4QDTA 5JDCC 3NZLA 1DTWB 2G8LA 2G08A 3OC0A 3TAUA 1SKAA 5LNK1 5IDYA 1VJRA 2O8VA 3UAWA 5K0TA 4ENQA 5C9ZA 1CQIB 4BZPA 5LQDA 1UBLS 4JJZA 5HM8A 3I32A 1OH6A 1Z0IA 1UZNA 4GG1A 3FXAA 4DQDA 5B6PA 3S3TA 2R6CA 4HAYA 2QW0X 4C4RA 5DRTA 5COMA 2BI4A 2JCYA 1X8LA 2P2SA 3PGMA 4YI5A 3BEDA 3K0FB 1YQTA 2G76A 4LI0A 3KVOA 4MAAA 1M57C 1UK7A 2GS9A 2F67A 1Z73A 4WCDA 5FCLA 1T1JA 3OFJA 2ASEA 3B12A 2H2FA 4MHSA 4J07A 3QLJA 3V1YA 4W8OA 1RXVA 1N2CE 4UU0A 2HPHA 3PC2A 1K92A 1K7EB 2Y92A 1LDNA 1SNYA 1E3LA 4N0QA 2JG3A 3HVKA 2R8EA 1KI3A 1NXOA 2IBMA 4J6FA 2B2NA 4ML3A 3HKKA 1E2QA 4NK5A 3SYNA 4US0R 2IP2A 1RXIA 3OMLA 4ZKDA 5BN3B 2FETA 3AVTA 1RJEA 3AERB 5AI5A 2IYTA 4EK9A 4CDVA 1NE2A 1X94A 2HMUA 2SCUA 1QH0A 3F52A 3ZQVA 1VI2A 2I2WA 4R3WA 4UXIA 3LA6A 3U7GA 1ZM2A 3CX3A 4Q1AA 2G83A 2RC5A 1XRNA 3C6XA 3U09A 4NU5A 3PB3A 2M6RA 3BICA 1SXJA 4AROA 2LKCA 4LI3X 1P7WA 1GG5A 1HDRA 3HJTA 1A9RA 4KOEC 3UUEA 2AL7A 2Z5FA 4ZVVA 2N46A 4BJ5C 3RRBA 4HH1A 4WZZA 1TVMA 4FQ7A 3ENQA 4BNUA 1WQ4A 3G2JA 1X57A 2PT9A 2WIGA 2X7XA 4DDKA 3JTEA 3MUOA 1C1YA 1YQQA 3PG5A 4ND1A 3SOZA 5L4SA 5F98A 3NIBA 1A72A 5JI3E 4IA8A 1YOBA 2N3ZA 4NYMQ 4PPYA 1S2DA 4PZCA 4X41A 3GWLA 3L7NA 1PTJC 4P86A 3GA5A 1EVQA 1MG5A 2F3PA 3R9KA 1C9MA 3THRA 1UXGA 1V4NA 3NOXA 3KT0A 4P82A 1KTVA 1ST2A 1YBFA 4FEGA 4C4XA 1EXWA 4YBAA 4Q9NA 3GA0A 4DYDA 1UBEA 5T3WA 1Q1AA 2DRIA 3O6XA 2W2XA 2C96A 1G9SA 2BHRA 2V55B 3QPVA 4JIGA 3TQIA 3NS7A 2QLAA 4CSAA 2XLOA 2ZI4A 5ESWA 1CR0A 2GILA 3E3NA 5EZYF 3UWOA 5EFZA 5LYJF 1JG1A 3NHLA 3ZWXA 2ZRLA 3M0EA 1U81A 5J5CA 3NT4A 1Z45A 4KQ2A 1ZU4A 3KB2A 3A2KA 1R63A 1S9DA 4M8SA 4BVAA 3TBHA 3K1HA 1FX0A 1XRLA 4DY4A 3Q9NA 3LU1A 5MN5A 5EUQB 3PEYA 3CH4B 3LHSA 3JD1A 5AGFA 1JAZA 5KVVA 2RHTA 3QMMA 4RPGA 2AVDA 4FHGA 2NO4A 1R4NA 3GVXA 3OJXA 1Z6YA 1RLMA 1UT5A 1ST6A 3IIMA 4X24A 3NV7A 1FC0A 2IHKA 3KL4A 4WKGA 3L7DA 1T6ZA 2I87A 2BBOA 2XV1A 4NV0A 5JASA 3ICQB 4I50A 5B7NA 1IXZA 4JA0A 3SHOA 1X39A 3EB9A 3KSDO 4I6GA 4TUYF 1Z5ZA 2J85A 2XWSA 4DCPA 1T34A 4EYGA 3E9VA 1ISIA 1I1NA 4UUAA 4CKCA 1OXUA 2A33A 4XFKA 4Z58A 2AJTA 4KE7A 4XSHA 5DI3A 1UWVA 1LU9A 1K89A 3D4BA 4D9GA 4JJIA 1I2BA 1G5HA 2R4UA 3FVWA 4JK3A 3ZH9B 4DPKA 4EFNA 5JCXA 4Z49A 2OBXA 4D82A 2P1DA 1IUNA 3QK7A 5EP2A 1EMDA 1SVWA 2X8AA 4YNBA 5HZMA 2GK6A 4DRJB 1HE1A 2WBLC 3MQ4A 4LRWA 1QX4A 1T2UA 4BB6A 5L0JA 3PSHA 2JIPA 4D8YA 1MC4A 3T7SA 3PFFA 4X71A 1SAYA 3QUQA 4XDYA 5J4VA 3H99A 4FXPA 4N03A 4TT3A 2CEKA 4G5FA 2LLWA 1EFDN 4B6GA 1AQLA 3L7OA 3EFOB 4XH9B 3GBVA 1W34A 1Z62A 1M9NA 4QYTA 4CMBA 3AF1A 1J2JA 2FW1A 3BTSA 3ABSB 4AXXA 1BKYA 3SLGA 4BNLA 4WN9A 5CDUA 1QP7A 2VSYA 1EXMA 3PLNA 5EE1A 2ZXUA 2FWPA 3L7MA 3P52A 2ASVA 3T3EA 2AC4A 4A8TA 3BUSA 2PUAA 1X7ZA 2HY7A 2I8AA 2ODEA 1BDBA 1QNFA 1TU4A 2QSJA 3EXEB 4LX0A 1X19A 4JIMA 4R3NA 3FUWA 2P9TA 2VT2A 4LPSA 4P81A 5ERXA 1QRTA 2WVGA 5H82A 4CDRA 1ECBA 1E3EA 3MEQA 4KLAA 4U5BE 4L8WB 3A26A 5TQ0B 3TLJA 1TYEB 3KKEA 3R8XA 1R4TA 4RJKA 1XZGA 4C4SA 3LBFA 4C0XA 2HV8A 2VA8A 4P7KA 5IRCD 4EG1A 2PMKA 3GEBA 4Z6KA 1OV6A 1KQNA 3VPCA 1U80A 5U9CA 2O4AA 1TEZA 4YJWA 4GI5A 3KXAA 1WHTB 1BROA 3C98A 3ZKAA 4XQ1A 3H11A 1HI9A 1Y37A 1TIPA 1A4RA 3CXUA 4O4JA 2WE8A 2L6GA 4PS1A 4BWGA 3LEVA 1IG0A 1TPYA 1HE8B 4J1WA 3CVYA 1Z9BA 3NTOA 1KEZA 5A9TA 4JP5A 1P1BA 3GCXA 4XSVA 2VEOA 4BIIA 5A3VA 5J2UA 4FW9A 4MVJM 1GUZA 2EBYA 1OW3B 1UQTA 3KSBC 2HL6A 3E3LA 4JLAA 5ESRA 2IHVA 3W6OA 3V4SA 3HEAA 1HE1C 4PBRA 4FCVA 2WUDA 2XLVA 2P91A 4LYEA 1TKCA 2C42A 4KRFA 3WGUA 4QQKA 1SC4A 3VH4A 2HSWA 2J0SA 2P1ZA 3CE9A 2XWJI 1JOGA 2ZS9A 3OURA 3C85A 4R1SA 2ODWA 2GNAA 3A58B 1OFIA 3OA1A 3SJ7A 2Q8PA 4KE8A 3H87A 2QT1A 4YMTA 4YYEA 1EVZA 3JQ9A 4W5WA 2A1TS 2NTJA 2QX4A 1QBGA 3JARA 4X7BA 1AZWA 4KWEA 2C4TA 3LYLA 2ZJ4A 3A1DA 3U0BA 1Y7PA 4ICIA 2PXFA 5TF4A 2B35A 4IQ4A 2H1WA 1XO1A 2J0UA 2E4YA 2P9YA 3VSAA 4DR6B 5MHTA 2EFGA 3Q10A 2PS9A 2FWMX 2ZI9A 2C9YA 2PE5A 3CBGA 3L6OO 3E3OA 3LQFA 1HRDA 2G4CA 2V6JA 2VRCD 3PWZA 3MMNA 1YK0A 1XZCA 1N7GA 3CH6A 3H7AA 5G40A 3S84A 4B33A 2Y3HA 5B2FA 2WKPA 1CP2A 4CM7A 3FKJA 3AONB 1XHLA 4OQMA 5ALFA 3ESAA 4YP7A 3ZLUA 4D9FA 3CB2A 2VIIA 3MLGA 1EDBA 3B70A 1T6YA 5TT0A 4GDFA 3O4RA 3P0JA 1DT3A 4CGYA 1D6SA 1CUSA 4JBLA 4X63A 3NNDA 5CG1A 1IK6A 1CXZA 4OIQF 1UFKA 4EBFA 3UMKA 1QXSA 1C7QA 3MVEA 3U1TA 5TGZA 5BSHA 3VZBA 1WKBA 3H4VA 2PBLA 1DIGA 4X4IA 3C6YA 5I9NA 3ZTMA 1HMOA 2CNKA 4ITRC 1GD1O 3I9OA 1NI4A 3H7IA 4YUXA 2BI8A 2VCHA 1TF7A 3D8RA 3IEXA 4B6IA 1JR2A 3PF9A 4Z4GA 2X3UA 3WQQA 2O52A 3AX6A 1M1YA 3O94A 4MVZA 2YRWA 2OCPA 2O2HA 2WTEA 1HTBA 3U61B 1GFIA 1BU5A 2AOXA 3JQ9C 3IUYA 3PA8A 1KORA 3IUMA 4G1VA 5CDHA 2FMKA 2JQEA 1SBTA 2C2GA 4G4IA 3RFVA 3UW3A 4DMMA 1PJCA 5EZSA 2DFKB 3VO2A 1Q50A 2FV8A 4MA4A 3U6KA 2DERA 2QL9A 3L1HA 5ALZA 4EB0A 1FJ2A 5GGXA 4CKEB 4DQUA 2C7RA 3DJFA 5EKTA 3I9FA 5IKMA 3ZHOA 1PF7E 2ZIXA 4LDPA 5IHPA 1DU4A 1M1NB 4B1FA 3BK1A 3NYIA 2C3YA 5ER9A 1FDWA 4WIAA 5GZ3A 1PYOA 3NDBB 3NYLA 2A14A 3UJ9A 2JLZA 1SZCA 2HGSA 3IHLA 5I4KA 4B3RB 1P91A 1N3YA 1AMOA 2VWPA 2OO5A 2C3UA 4FVTA 4WJLA 2EPOA 1YSCA 3MBIA 3RRZA 2AG0A 2X1HA 2Z5VA 4P7FA 1HZZA 5EHZA 3RROA 4OXYA 2RARA 1NV8A 2O3UA 1VYKA 2R9RB 2C95A 1A5AB 1UZLA 1ZIOA 4EEXA 1MW9X 2DWCA 2KBFA 5DP1A 4C7JA 1H7IA 3V5XA 1O5HA 1X9HA 1IN5A 1ZS9A 3ZJVA 1NFFA 1P4JA 2ORWA 3LWNA 4X20B 3EXIA 2EX0A 1ABEA 2VNAA 5K8LA 1UM8A 3A25A 4PXAA 3GV0A 3PEVA 4Y42A 1IOWA 1L9KA 2XLCA 3GLGB 2WHRA 1W2HA 2CWWA 2Z0MA 2D62A 2YL1A 1MQSA 3MCVA 4ZZ3A 3JZMA 3DZGA 4P9FA 4EWLA 3IQGX 2BSAA 1J39A 5H9VA 1CJTC 2IIPA 5BORA 5ITWA 3LKZA 4JX9A 3QW1A 3EK2A 1JFSA 4PN7A 1I51A 2C31A 5CVJA 4OHUA 3T12A 3GB9A 2I2DA 2XMRA 3GMDA 3AJDA 3ZGVA 1OPXA 2ILVA 2OFOA 3K1IC 5CIQA 1SXIA 2B1RA 5KOHB 3PZRA 1EWRA 4D6YA 4DN6A 2EOAA 5AVOA 2HF7A 3UMGA 3GP3A 3X43A 4KEAA 1OD6A 2OECA 3KEOA 3NRHA 2BZ0A 3MPUA 4RTLA 2HCNA 3C3MA 2ZVJA 4C78A 5C8YB 3TXAA 5LOVB 1A5TA 1GAJA 1U7TA 1Z2CA 4CNBA 4CS8A 3UJCA 5TRTA 2VT7A 2H2IA 3K1JA 2CXOA 2Y1KA 2I2CA 3PKJA 4ESHA 2NOAA 3PHIA 2O3QA 3B85A 4XQEA 3V2GA 2PLAA 2AXQA 4CVNA 5CR9A 2QNBA 1Z0AA 4KQ1A 3ZDRA 5JQGB 2RGAA 1NI3A 3FF1A 3OLCX 1JR3A 3B71A 2R7WA 1ZD5A 4OIOF 4YJHB 4GX5A 4YIKA 3UHOA 3L1PA 2ZJ7A 3ICVA 4YRIA 4N18A 1EHCA 3ZI0A 1JS1X 5AUNB 1W1IA 2YHAA 4K9KA 1QCDA 3IS3A 4PHTA 4CM8A 5AM1A 1R12A 3HWWA 1EQ1A 3UBTA 1OSNA 4EKEA 4PSDA 3JVUA 5B4UA 1E9AA 1TT7A 1K8QA 4E1AA 1WH6A 3HXOA 4HYQA 2XXAB 5ECGC 2AMYA 2EJTA 4G1FA 5CT4A 4D02A 3TGPA 3CZMA 3SZ3A 4PFJA 4GQBA 4JI8B 2BJHA 4B3GA 3CLKA 2NZ2A 3HDQA 4V2IA 1B4DA 1B43A 4H7EA 1ANKA 1SVNA 3NC4A 3UAOA 1E3MA 4ZPJA 3ZE9A 1TM5E 4R8VA 4W5NA 3KP1A 3EMDA 2C99A 3KUDA 3JYPA 2Y0EA 2YL0A 2XZTA 3U48A 1NVKA 2Q27A 4L8FA 4YK7A 1UBUS 2VNIA 3PNMA 4XWTA 4ZOLB 5CHYA 1OI3A 2DAPA 3Q2KA 4MUYA 1OXBB 4DRIB 2D5CA 2VZ9A 1UXJA 4FIDA 2VK1A 1N7JA 2LD6A 1N6RA 2BFDA 2QP9X 4QLAA 2M6KA 4CQLB 3W7BA 2DGDA 2CDAA 2F3UA 1O9HA 3DAYA 3E7PA 3L46A 4OQPA 3W5JA 5IANA 1RKUA 3CVUA 2F3RA 4YR9A 2HSZA 3OWTA 5E6SB 4GPEA 1LQTA 5CPFA 5KDLA 4JELA 3C3DA 1MFPA 5I3ZA 4IH9A 1RM5A 2YJ3A 1Z23A 1WSAA 2E7ZA 2N1BA 3SIWA 1P2UA 3UM9A 1TQ8A 3F7MA 1JR4A 5CFZA 1WVGA 1NBWB 3ZWPA 1X3LA 1ZNXA 1AKRA 2DHCA 1Z5GA 4HDOB 1KOJA 3MLEA 4OTZA 2NP7A 2CNWD 3MMXA 4M1QA 3MT9A 4EQ6A 3V3KA 4HNRA 3JRNA 1NYRA 4JKOA 2O1SA 3PNQA 4OA5A 1ECJA 1OAOA 5MGNA 2KM1A 2GRMA 1LM3B 1DC8A 1TA9A 3CN7A 1XYGA 3DVSX 1EVEA 2NWQA 1R4MB 1TFRA 2EWWA 3I5PA 1T0BA 2C0QA 2D8MA 2NZYA 3O1IC 1BX3A 4AJ4A 3E82A 4XEHA 4ETIA 1WULS 1Z0KA 2XS8A 1UPFA 5I9IA 2PXVA 2PSFA 1AS0A 1GPDG 2C59A 1MNEA 2P6PA 2GYYA 4ONSA 4LC0A 1U0RA 1JAYA 2CB0A 1DDIA 2HXGA 4M8IA 4BB9A 5IXSA 2XSDC 4U7TB 2HJWA 3KZ1E 1HZJA 1ZM9A 2LIPA 3RJ9A 4V1CI 5LDGA 1NUPA 3WL8A 1YDEA 2O0MA 4MR7A 3EPLA 1Z38A 4C3DA 3UNGC 1LLCA 2W2PA 1R88A 1YAUO 2B0CA 3GPIA 5DN6A 3EG9B 1FU4A 2PDAA 4HNSA 3QVWA 3GN5A 3IHUA 4BO7A 2XF2A 3B9BA 1QC5B 3L7JA 2LKDA 3K4QA 5BQOA 2V0CA 4FUQA 2WSSD 2QAGC 4RWEA 4ZD6A 1I8TA 2IL1A 3NBKA 3S5UA 3WK6A 3U7EB 2E5FA 4NU0A 1L1RA 2HM7A 2OHHA 1XYVA 4W1RA 2ZBQA 4NHOA 1EGAA 1LF5A 2OXCA 4JI3B 5T57A 1M34A 5D5HA 1W4LA 3Q5DA 3UGJA 4PAGA 1U31A 1T2VA 2OK7A 1R6TA 1NQ5A 3UENA 1BCRB 1E6WA 4DBVO 3UC5A 4X7RA 1OXMA 1WB5A 2HBRA 3HDYA 4URVR 1IJBA 2WJAA 1PD0A 1NVDA 1BR1A 1WQ1R 2GSDA 3D64A 3IDZA 4WWHA 1RAHA 4CKYA 2V3CC 2CE7A 3VR2D 1XLVA 3DLCA 1DUIA 3DLBA 1OAOC 4YDHB 4IDEA 4Q4LA 1ZH2A 1JBEA 1FB5A 1VRCA 1XZHA 4X4GA 3DE4X 1VLZA 1FQWA 1DOHA 1K2VN 1XRQA 1OYYA 1VL2A 1XKTA 1E4VA 4PGMA 5HBRA 2C3MA 4RVGA 2RHHA 1NVMB 5F35A 5JMOA 1M75A 4FLFA 3EODA 3CR7A 4IIJB 1ADCA 5FWDA 3LD9A