1QZXA

Crystal structure of the complete core of archaeal srp and implications for inter-domain communication
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
432
structure length
425
Chain Sequence
MLENIRDAVRKFLTGSTPYEKAVDEFIKDLQKSLISSDVNVKLVFSLTAKIKERLNKEKPPSVLERKEWFISIVYDELSKLFGGDKEPNVNPTKLPFIIMLVGVQGSGKTTTAGKLAYFYKKRGYKVGLVAADVYRPAAYDQLLQLGNQIGVQVYGEPNNQNPIEIAKKGVDIFVKNKMDIIIVDTAGRHGYGEETKLLEEMKEMYDVLKPDDVILVIDASIGQKAYDLASRFHQASPIGSVIITKMDGTAKGGGALSAVVATGATIKFIGTGEKIDELETFNAKRFVSRILGMGDIESILEKVKGLEEYDKIQKKMEDLTLRDVYAQIIALRKMGPLSKVLQHIPGLGIMLPTPSEDQLKIGEEKIRRWLAALNSMTYKELENPNIIDKSRMRRIAEGSGLEVEEVRELLEWYNNMNRLLKMVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Signal recognition 54 kDa protein
publication title Crystal structure of the complete core of archaeal signal recognition particle and implications for interdomain communication
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Signaling protein
total genus 130
structure length 425
sequence length 432
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00448 SRP54 SRP54-type protein, GTPase domain
A PF02881 SRP54_N SRP54-type protein, helical bundle domain
A PF02978 SRP_SPB Signal peptide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.30 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) Signal recognition particle, SRP54 subunit, M-domain 1qzxA03
1.20.120.140 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 1qzxA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1qzxA02
3MWYW 3LA6A 4PSKA 4JZKA 3SQXA 3DPUA 5DHAA 3RHFA 1E2LA 4LHVA 3AVPA 3AQ4A 1XMVA 1KKLA 1XEWX 1NMZA 2J87A 4NMMA 4XOIA 3SQWA 3H4MA 4CEHA 4JLAA 1IXSB 2OO7A 2JLQA 1IY2A 4JBYA 3D31A 1F2UB 4PZZA 5FTJA 1BS1A 5JZVA 4JSYA 3BAFA 2CNWD 2IYSA 3VFDA 1CJVC 3QJYA 1E2NA 2OBMA 3NBZC 2FFHA 2PXLA 1OXSC 4NCHA 5EE9A 1COWA 3MUFA 3OIUA 5H70A 3K9GA 3LX8A 1N2CE 2QSZA 5AWFC 2O8CA 2I3BA 3CONA 4MRRA 3SBDA 4O3MA 2QSYA 4A8JA 3IKJA 1QVRA 4FMCF 3B82A 3FKSD 3KJGA 4WZ6A 5JWRA 5GJCA 2P5TB 2CLSA 5KYKA 2BHRA 1CF4A 1Z6YA 4FCWA 5HE8A 4C9BA 1QG4A 3U7HB 2YWEA 1E2QA 1Z08A 1J99A 3NXSA 3KUDA 1MABB 4F91B 1ANKA 3PCRB 1G5PA 3IILA 3GJXC 3KQKA 4IOLA 4QJ5A 1W36C 4A6PA 2DFTA 2EFEB 3LD9A 3UATA 2RMKA 4I1SA 2B8WA 3CZPA 1TEVA 3Q3JB 3GLFB 3TAHA 3BFXA 5GVRA 2BJVA 1HQ1A 4HDCA 2GJ9A 3UANA 2ZS9A 4QC2A 5JWHA 1KI6B 4Q4JA 421PA 3KB2A 1YE8A 4B3BA 2PEZA 1ZP6A 1FMJA 3CF0A 4QBFA 1YR7A 1O87A 4ABYA 4DZZA 3K0FA 2QAGA 4Q4AA 4DJTA 3FPAA 4B6EA 2WJVA 1Z0IA 2A9KA 2JLRA 4GT1A 4QGGA 5E4FA 3SR0A 3U60B 4PHFA 2V54A 2YWGA 1FUUA 4TLCA 4MYHA 1TL7C 2DFLA 3IGFA 1NJFA 5SZHB 3BWDD 4QHTA 4EAQA 2PZGA 2ONJA 1RRCA 2CL7X 3KB1A 4G5GA 3FGNA 2C9YA 2OT3B 3KXKA 1KI1A 4I1UA 4POAA 3ZH9B 2GJAA 4ZDKA 5J5CA 3IPYA 3GEIA 4LZZA 3W3ZB 4HLUC 2D2FA 2IL1A 3GLHB 5JI3E 1UEJA 5CK4A 2G6BA 3CRMA 1RYHA 4R9UC 1VCIA 2BM0A 4IW3B 3B5JA 3DDCA 1OIWA 1Z0FA 3MJRA 2SHKA 5JMTA 3VQTA 1CULC 4EUNA 2HCBA 4DDWA 3GFPA 1JR3A 1DG1G 4UNQA 3BB3A 3BORA 2ZJZA 3TW4A 1C9KA 1GFIA 2QNRA 3HU3A 2JGNA 3Q7PA 3PXGA 1Z2CA 2ZRGA 1TU4A 1XCMA 3SJZA 2LKCA 1XD2A 2OHFA 1XTIA 1IBRA 2JDID 1SHZA 2XB4A 1KI7A 4BUJA 4PPQA 4AY2A 2FGJA 3REGA 4NYJR 3DKVA 2WJGA 3WRXC 3ADDA 4K81B 2GEUA 4M9SA 2GVZC 3L8ZA 3GLIB 5DO9A 1GNQA 3X1DA 2N1BA 3R20A 2CJWA 4YONB 5GJBA 3SYKA 5FOVA 2DWPA 4XD7A 5TV2A 1NSFA 5FBLB 1E69A 5B64A 1Q44A 1GRNA 4B2LA 4BQSA 2A78A 1L4YA 1VG1A 2PEYA 2ZR0A 4OHVA 1NIPA 4GRAA 3UWOA 5JBQA 4W9MC 4IJMA 1QDEA 2FN4A 3SS8A 4BFTA 5K8LA 3ADCA 3SJAA 3K8YA 3E70C 3F8TA 4PANA 1XCGB 3EWSA 4DCSA 4MKHA 1OT3A 3SJBA 4MGZR 1SHKA 2JJ2A 4B73A 5KNDA 4RCYA 1ZM7A 1M7GA 1VDZA 1Q20A 1GILA 4JMPA 1KDOA 4ITRC 4E09A 5J4HA 1OB5A 2FGKA 3P26A 3WMGA 1R8SA 4D80A 2O8FB 2BBTA 5JHHB 4IEIA 3O47A 4B47A 1G6HA 4OI2A 3UG6A 2BKEA 3GLGA 2I1VB 4KBFA 4PQFA 2GNOA 2CHGA 5JCPA 4B74A 1TUIA 3A37A 4QBHA 4KFSA 5E7MA 2GZDA 3MWKA 4DT1A 3CLVA 3PUYA 3K0CA 1J70A 3K0SA 4QL3A 3Q7QA 2ZR9A 3SNHA 2IYZA 1N6OA 4Q48A 2NO1A 4CYMA 4KFTA 1S3SA 2EWVA 3CWZA 1E0KA 3DHWC 1RPZA 2ZRFA 3E1SA 2IS4A 1E1RA 1OXXK 2R62A 2Z4RA 3GJ8A 4HATA 2C96A 2FSIA 1E0SA 3UIEA 1GRRA 2HUPA 1JR3D 5CM9C 3VR6A 1OXVA 1RYFA 1P73A 1ZIPA 2HDNB 3CZQA 2EFCB 2ZS8A 4LJYA 3TNFA 3A4LA 1OYWA 5HZKA 4TSFA 4RD6A 3H1TA 4RZ3A 3RC3A 5H8WA 1XMJA 2OUKA 3CF2A 4QM7A 4LUCA 1SVMA 5EP1A 4LI0A 3T5GA 1KO5A 3KZ1E 4M1SA 1CR4A 3JVUA 4C0BA 1IM2A 4BLPA 4HSEA 5DIFA 1V43A 2MMGA 1NMXA 1U0HC 1Z83A 4NE2A 4GP6A 1MRSA 3TBKA 1NNEA 2EVWX 1UKEA 5LPNA 4ARZA 4L16A 4S2EA 4RD4A 3D3QA 3OF5A 1TF2A 5FH9A 3PEWA 1YZNA 2V6JA 3SZRA 5D3MA 1G17A 1QHGA 2MMCA 2ZRNA 1E2GA 2O8DB 4C0JA 3CKLA 1XTQA 2QG6A 1T8TA 1GKYA 2PBRA 2ANCA 3UPUA 5KO2A 1EXMA 1KAOA 1UBCA 3KQLA 2RGGA 2UZIR 5TARA 2QP9X 1FTSA 1RRFA 1QF9A 1N3BA 2MSEB 2W00A 2KE5A 2JJ2D 2VQSA 3HP1A 3EXAA 5AJVB 1E2KA 1YVDA 2OLKA 2QZ4A 2FFBA 1OYYA 621PA 2QMEA 1E98A 4C3ZA 2OV2A 2D74A 1ESMA 3TSWA 3B85A 3UMFA 1YRAA 4CEIB 4XTRA 3SOPA 1AS2A 2G0TA 5KHOC 3NVAA 1KMHA 4AKEA 3AVOA 4IOJA 4L15A 3RWMB 4TZ0A 2REOA 2ZITA 3U4QB 1KYIA 2YWHA 3P4XA 1NKTA 2Z5FA 2BMDA 4OBEA 2ZI5A 1VIYA 4DLWA 1SKYE 1E4VA 1P2SA 3FB4A 3LBHA 4NU0A 5TXGA 4ZCIA 2WSSD 1R8QA 2VP0A 2XTNA 1AJEA 1P3JA 1J2JA 5SZKB 1R0ZA 1VYVA 2XOKA 4BFYA 5TMPA 1BKDR 1P2UA 4B2PA 3CX7A 4QG7A 3AVVA 1TQ4A 4DIEA 5DHFA 3LH5A 4JL6A 1XP8A 1R0XA 2PZEA 2ZE6A 2A3RA 2OCYC 1VTKA 1XEFA 2A5YB 2OFXA 4UXIA 1K5DA 1U8YA 2ANBA 2GAAA 5JHGB 3PVSA 4JVMA 4C4PA 4NBSA 5G53C 3AP3A 1W2HA 2OAP1 4TSFD 4OQMA 4URUR 2GXUA 4OJKA 1OKKA 1A4RA 3GD7A 1NG9A 2ZI4A 4TLDA 3QQ5A 1F6BA 1M74A 1W44A 1OSNA 3K53A 4A6XA 2WOJA 1ZMXA 2WMOB 2GZAA 1HYQA 1XXHE 1Z22A 4JVLA 2D7CA 3GLFA 2FSGA 3BRWD 3AB3A 1G7SA 2KBEA 4HAYA 4WZBE 1KI6A 2WTUA 5L3QB 3U5ZB 2HT6A 2WKQA 2ZUBA 4JL8A 2OCBA 1DPFA 3V00A 2VHCA 3JVVA 1GSIA 3B6EA 3UXMA 4YMSA 1FX0B 1UADA 4JS0A 2JQEA 1VHTA 4HUTA 2A2ZA 5JJIA 3ZZUA 5EQTA 1L8QA 2PXPA 1S9DA 4HDOB 3I72A 1TQDA 3K9LA 3KL4A 2ZUDA 2C9OA 2J0VA 1VCMA 1GWNA 1G3RA 5A5GA 2FPMA 2ODNA 2ZI6A 3CH5A 4JLPA 2EU8A 2IF2A 5J47A 3KQUA 4BFSA 3ZYCA 1KO1A 4B32A 4DDTA 4LJ7A 2ERYA 1NSTA 3D7MA 3TVDA 1A82A 1EK0A 3F3YA 4KSBA 4JYBA 1S4QA 3U2QA 2EW1A 2Z4SA 4OQNA 4PO9A 5KDOA 5JSZA 1KAGA 5BN4A 2QPAA 2GZHA 1XMIA 4XSHA 2IS1A 4D0GA 2ZSDA 1N5KA 1XPOA 2X2EA 1RRPA 2FMXA 1ZM3A 4RFSB 2O8EB 4C0HA 3LO5A 3PUXA 5L3SA 5AJXA 3PUVA 3IEVA 3B13B 2ZSBA 1ZD8A 3TAUA 2HJGA 2JLYA 5CIQA 4C2UA 2VLIA 4UQOA 1YRBA 4CEJA 4K46A 2ORWA 2J59A 1I4TD 3IHLA 1EFTA 2CCJA 2GHIA 4R98A 4R71A 2DY1A 2C9CA 2H57A 4G5QA 1P62B 1X1SA 4TYPA 3H0KA 1FW6A 4QNMA 1G5RA 1XMSA 4RD3A 2PT5A 3EA0A 1ZINA 4HAUA 1U9IA 2RH5A 4EFLA 1OKKD 2QRNA 3A1WA 5AK0A 2YVUA 3NDBB 1DEKA 3SFVA 2AX4A 2FZLA 3EIQA 4QOSA 4I99A 1N0UA 5E95A 1QVAA 1TADA 3K09C 4V0ME 4DVGA 2OFOA 4DSUA 2H1LA 4HAVA 2IS2A 2WIAA 2OEPA 3X2SA 3A1UA 1JEEA 2FSHA 2REBA 4R7ZA 2IWRA 2AK3A 3QBVA 4BZQA 4FN5A 1E9FA 4LJ5A 3W90A 2GDJA 3B78A 2NPIA 2D7DA 4MITA 4DHEA 1G8YA 3QY0A 2O8FA 3VTKA 4UNPA 1FNNA 2VA8A 2N46A 1LFDB 3TIFA 4CW7A 2FF7A 2QAGB 2ZRMA 3CNNA 3ONWA 4Q4AB 1RKBA 3CUEF 5GJWC 2H92A 5DN6A 4RY2A 4TYNA 2GXAA 2XEXA 4Q4HB 5B57C 1FQJA 3BD9A 4LJ8A 3T1VA 4MYUA 1QZXA 1D6JA 2CCGA 4GPTA 2GVDC 3CNLA 2PL3A 3ETLA 1IN8A 1LVGA 3NH9A 3W34A 3AP2A 1SZPA 4HB2A 4A0FA 5FL3A 5KNBA 4AKGA 3WP1B 1KY3A 3ADKA 1JQJC 4GOJA 2R6GA 3RDPA 3PEYA 1WDTA 4DLZA 2CHVA 5E7JA 1I4LD 2YINC 5FI1B 2EFGA 2QROA 3L0IB 4Q21A 2D4HA 2BC9A 2VRWA 2X77A 1JXOA 1XTSA 2QGZA 4NYJQ 5J4KA 2NZ8A 1Y63A 2KWIA 1KI8A 1JJ7A 4QJ4A 1QHIA 1XD2B 2VO1A 2E87A 2RGEA 3O8RA 3DOEA 5FI0B 2GK6A 1KDTA 1SVIA 3W9YA 2WWGA 3QXCA 5LD2B 1SQ5A 2PJRA 3P1JA 3AVYA 4D4MA 4MRVA 3DM9B 4XTCS 4U7DA 2O8DA 1FL9A 4OQLA 1YU9A 1Q1BA 2EWWA 2VF7A 3I3SR 3KKMA 4I81A 4XSGA 2WWIA 1EFUA 5HZHA 1NY5A 121PA 3AVUA 1MFQC 4FIDA 2FA9A 1DAMA 1UBFA 1TQ6A 1W47A 4LBYA 2F9LA 2BVNA 1T5LA 1P9WA 2PXKA 1TQ2A 2XGJA 2Z6VA 4RKFA 2WAYA 2QMHA 2VP9A 4XWKA 4XWOA 5FTKA 3C8UA 3GPLA 5D3QA 3SDZA 4UJ5A 2OG2A 3DL0A 4MYCA 2ZRLA 1NVUQ 4NZYA 4US1R 3C15C 4E22A 4EPXA 2WWXA 1IN7A 1OFTA 4BEBA 3DKPA 3QF7A 2ZU6A 4BFWA 2WMNB 5J4VA 1BOFA 4WAUA 5KUTA 3FHCB 3QNUA 2CL6X 4I1VA 4PO1A 5HR5A 2ZVQX 2CNWA 5JECA 4F92B 4HEJA 4PSAA 1BMFD 1KY2A 1NN0A 2PCJA 1YR9A 2WWWA 3C5HA 3QF4A 4ERNA 4M1WA 3U7EB 5F2EA 3GLGB 3C5CA 3OAAA 3AH8A 2P0EA 3VHXA 5FR2A 2TMKA 1UAAA 2WV9A 4KHZA 3I92A 4GZLA 3BJIC 3WNDA 3WYGA 1ZD1A 1IJFA 1XD9A 4GBMA 4PPNA 5CDFE 5EE0A 3ZLJA 1D2EA 4WXRA 5JCZA 4Q03A 1OF1A 5P21A 1ZAKA 3FKSA 3LVQE 4KBGA 1RC8A 2EFDB 2IX3A 4MDEA 2RB4A 4GOXA 2ERXA 2PXFA 4DCUA 2AN9A 3FWYA 4V0LA 3UK6A 1CU1A 2HYDA 2FG5A 1JQLB 3RSLA 2F3RA 2IYRA 1E9BA 3HPQA 2ZM5A 1KJZA 3LW8A 2O0HA 4X8LA 3K0EA 3OIWA 4LOAA 1P7CA 2B21A 4BFVA 4RD1A 3EAQA 1R4AA 1U2RA 3R7WA 2FU5C 2KB0A 5CLLA 4M4SA 5FOTA 4QRHA 2CHQA 1Q1QA 5L3QA 1F48A 3K70C 2ZR7A 1A1VA 2PH1A 3QKSA 4D6PA 5JRZA 1B23P 3U3JA 3QPUA 2C8VA 2PXVA 1Q1ZA 2GRJA 2WSMA 3HYRA 1P6XA 2WHXA 2QU8A 4G0NA 2ZYWX 3EW9A 1G19A 2ZRKA 3GJ0A 3GEEA 2D06A 1QB2A 1E9DA 5D3MB 3BC1A 1HTWA 3PIRA 5K8UA 1XJ0A 3DOFA 2W0MA 2UVQA 5SZIA 4HB0A 4D2IA 5CJPA 1GTVA 4W5WA 1E2MA 1Z0KA 2XTMA 2QMUA 2G0NA 4QGFA 3MSXA 2QORA 2PXBA 2V6IA 2DYKA 1KGDA 1OHHD 4FMDF 1G8HA 2ZROA 4JLVA 1KO7A 4GSYA 2IXEA 3PR1A 1DTSA 2WICA 3KXIA 3PITA 4A92A 1II8B 2FE4A 3CPEA 2G1KA 1XBTA 4Q1EA 2DWQA 3CB4A 3LBIA 1W4BA 3HU2A 2GCPA 3WBKA 1FTNA 4BRUA 2JASA 1P72A 5CM8B 1KJWA 5FOXA 2NTYC 3VNUA 2K5UA 2C03A 2ZPTX 4DLXA 2ZRCA 3FE2A 3OIYA 1KMHB 2JLWA 2H17A 5EP4A 1L4UA 4UJ3A 4BLTA 3OAAD 3V4FA 1XX6A 4RFSA 2O8EA 1QHHA 5GJVC 3OHMA 4KCGA 1ZCAA 3IO3A 5FR1A 5JS8A 1AM4D 1E79D 4H1VA 2JDIA 2BKUA 2QP3A 5IDVA 4Q7MB 1N6RA 1E9RA 2F1IA 3AUXA 4Z8YA 1CJMA 3TR0A 1Q57A 2LWIA 1G7RA 4FCTA 2XJ9A 1U90A 3WP0A 5HTKA 1NBMD 1Z0AA 4YDHB 3BERA 4V0NA 4B44A 4LJ6A 5DSZA 2A5GA 2JLVA 1IN4A 3N70A 1G8FA 5FOWA 1Z8FA 1SGWA 5CYPA 1X86B 4A1FA 1VMAA 3R9XA 1OIXA 2DPXA 4Q9IA 4TQUS 3B7GA 3D6TB 1W5SA 4FINA 1I4DD 3TSOA 1UFQA 4P31A 1SXJE 1DAFA 3TW8B 2XSZA 4LBVA 2WKPA 4B71A 4IDOA 2P65A 1N6NA 1H65A 3EC2A 1GL6A 4EIWA 4ASUD 2Q6TA 4BFUA 3ND8A 2IBMA 1WXQA 1ZD9A 2R6CA 4GP7A 2IK8A 3KTAB 3B1XA 1ZM4A 4URWR 1LTQA 2OSBA 2QEQA 1YZTA 5LBIA 821PA 2W2XA 1L2TA 3B8HA 3MAAC 4LX0A 1UBEA 1XF9A 2C2HA 1LB1B 4Q4HA 2YC2C 3BOSA 1M8PA 1CR0A 2IEZA 5KDLA 2ZJBA 2QE7D 2YOHA 1F60A 1G8PA 3QPWA 3X1XA 1I2MA 1AQYA 1A2BA 4DCTA 1SXJC 1J7KA 4H9GA 3CBQA 1E1QD 4YMWA 2IYVA 4TTPA 1R7RA 3EX7C 1NN3A 4AD8A 2WWFA 2ZXUA 1GUAA 4Q9HA 2DR3A 4TMZA 2QI9C 2ZRAA 1XTRA 2YZ2A 3K1JA 4CDGA 1W4AA 4H1UA 2GKSA 4LJAA 4DLUA 1TX4B 2V9PA 4IFBA 4MKIA 3VR4A 4BASA 1ZIOA 4W5HA 1HUQA 4ZO4A 5TVKA 1YJ5A 5EXSA 1C4OA 2V8OA 2OCAA 5JSZB 3UG7A 3U6KA 2P2LA 2L0XA 1TAGA 2H18A 5KOYA 4EKDA 1UKVY 2EFHB 4GMXA 1N6PA 1WRBA 2XNSA 4E07A 1U94A 1YZKA 2YOFA 2N42A 1X1RA 2AXNA 1IY0A 2Q3FA 2ZE8A 2XTZA 3NBXX 3W6OA 3TR5A 3LXXA 5L3SB 1S0UA 2CCKA 3VHLB 4HDQB 2QRZA 4JJZA 4NDZA 4PPFA 1B0UA 4LK2A 4CEJB 3Q5EA 3GLFE 1E2EA 1KDRA 5FUVA 2JATA 3QG5A 1D9XA 2RCNA 4J0QA 2HF8A 1GIAA 3QOFA 3SC3A 5IT5A 2H16A 521PA 2C98A 2GBLA 1Q22A 1CKEA 2J7PD 2FX3A 4DLSA 4EJSA 5JEEA 1EFCA 1QHSA 1U0JA 1G20E 3MGCA 4ILEA 3TLXA 1WCV1 2XSZD 3TH5A 1IHUA 1N5IA 4A0HA 4Z54A 1MO4A 1T3LA 2CLDX 4D0NA 5HE9A 5DI3B 1MO5A 1VCNA 4JJKA 1XRJA 2NOAA 3N2IA 3U3RA 2W6JD 5G41A 5AUNB 5BN5A 3OE7D 1T3HA 4B2IA 4B43A 5EZ6B 2NO9A 1UKYA 1QHXA 4RZUA 4A2WA 3THWA 4DB2A 2QY9A 2IYWA 3GLHE 1X6VA 3OEEA 2IXFA 4FMBB 2IHBA 4M22A 4TYWA 3GJ3A 2J46A 3FMFA 1ZC3A 4IKEA 5FUWA 1N25A 3SJCA 2WIBA 2W6ID 3TUIC 2J9RA 2RGNC 5KPJA 4NP6A 1U8ZA 1RW4A 4D82A 2UKDA 1AGPA 3EIHA 2C78A 4WA7A 1H8HA 2ATXA 2WSSA 2XNDA 4IVPA 5EP3A 1EGAA 1W0JA 1CP2A 1DARA 4ZDWA 4BLOA 4TQAA 5FTMA 1LW7A 5B58C 4EFMA 4F4IA 2IUUA 1IN6A 1DO2A 4RD0A 4QXAA 5JJLA 1DAGA 4GDFA 1YR8A 3RS4A 3HU1A 4ZIRB 1OIVA 1ETUA 3GLIE 1UF9A 1YQTA 1Z07A 3L8YA 1EWQA 1U81A 4UNRA 4PQYA 1AA9A 3Q5DA 3ZVLA 3FYHA 4ZCMA 5BN3A 2B8TA 4W7SA 3TMKA 3O8BA 1G4UR 3MRSA 1ZW6A 2ZSAA 3VX3A 2ZUCA 3OEHD 2ZREA 1RE0A 1OV4A 1BIFA 1DADA 1SVWA 1T0JB 4EPYA 3V4RA 5J4LA 1T9HA 3HWSA 1XD8A 5TB5A 2AFIE 3L0OA 1SVKA 4RJLA 4LRWA 1ZUHA 3LRPA 3LLMA 3Q9LA 4FMCB 1NKSA 4P0TA 3WHKA 2XZLA 5K8TA 2P6RA 1Q12A 1R5BA 2GJKA 4DLTA 4JLNA 5CLQA 3RRMA 1LNZA 4Q02A 3RAPR 5EXXA 4Q9LA 2IF0A 4NTZA 1E94E 3TKLA 4QNRA 2F1HA 2R2AA 3QKTA 2V1UA 3WMEA 1GOTA 1DVRA 1W49A 1II8A 3F5FA 1WP9A 3ZVMA 4B76A 1OFHA 5HKKA 5CIWA 1PLJA 1PZNA 3KJHA 1KZGB 2FEMA 3BK7A 3OEED 4PAOA 1N6KA 1PLKA 1AKYA 4HLUA 2KJQA 4IOMA 4OK5A 4ZCLA 1BYUA 3DZDA 3A8TA 4WOPA 1G64A 4IOKA 3BS4A 5AJYA 2CVFA 3PJRA 3WMFA 1PVOA 3VR1A 2DFKB 1VYTA 4M9ZA 3KKNA 3QF4B 5B30A 1LV7A 3KKOA 1F2TA 4HZUA 5ANRB 4B3CA 5FTLA 1QG2A 4RZ2A 5FBQB 4YQFA 2GF0A 1H8HD 3RS3A 2XNDD 2IUSA 2QL6A 4NHOA 1W0JD 1ZM9A 2WJJA 2NG1A 2FNAA 2F43B 2XAUA 1E2HA 4LYAA 3ECCA 5G3YA 3EASA 5EZ5A 1W7AA 2P5SA 4M53A 1D5CA 1YKSA 2BJWA 3FMOB 1CTQA 2FPLA 3OFND 1W46A 1K6MA 3RS0A 4WIAA 2RGBA 2Z0MA 2P6UA 1XZPA 3AKEA 1CLUA 2QTVB 3IBGA 3ZD6A 1N5LA 2VHTA 2QQEA 1SVOA 5CJ2A 1G16A 4FI3C 4EFNA 2XXAB 2V1XA 2PT7A 2V55B 1W36D 3IPXA 4Z1MD 2IA5A 1A7JA 3R7WB 1FZQA 3SHFA 1Z06A 5GAHi 2VP6A 3KTAA 4KFUA 4URYR 5KSZA 1P9RA 2FOLA 2OXCA 3QKSB 1NI3A 3TSZA 1BO6A 4AKHA 1JPNA 3A4MA 3QEOA 1Z63A 3T34A 3RVBA 2R65A 1CRQA 3UMSA 3RSOA 1G5TA 1GDDA 4NL4H 5E3HA 1XPRA 2GEDA 1XTKA 2D2EA 2WKRA 3AKYA 4M0LA 4Z51A 2CE7A 1ODFA 1XTJA 4Q1DA 4DCNA 1GG2A 1NY6A 4NKRA 2OBNA 5KSOA 3QVUA 4UNNA 2RGCA 3FMPB 3UKDA 1HQCA 4TTRA 3T1TA 5FPTA 4URZR 1DAKA 4CVNA 3THXA 4ACBA 3MWJA 3K0AA 2VPPA 1ZUIA 1ZRHA 4R2HA 4DCVA 5HKKD 1XWIA 2E1RA 1MKYA 1US8A 2NO6A 4F38A 1ONBA 3QPVA 2G3YA 2J45A 2VYFA 2KBFA 3FKQA 4DKXA 4DLRA 3EARA 1ZNZA 3NEJA 2Q9CA 1R0YA 4OL0A 2PXTA 3ICEA 3DZ8A 4NPHA 2QM8A 4TLEA 4PQRA 2VP2A 4MUAA 4XWAA 2CMKA 3QXSA 1Z28A 3CW2A 3CNOA 4LC1A 4Q01A 1QHHB 2ZYTX 4UXHA 1PV4A 4TMXA 3T06B 5BWMA 3AKCA 5E7IA 2B92A 4C30A 2ZRJA 4LJ9A 4KYIB 1OE0A 1GKIA 1NVXQ 2BOVA 3EZFA 4HB3A 1NL3A 1IONA 4KFRA 2BBOA 3CPHA 2RGAA 4FCVA 1S1MA 1X8JA 3WXMA 1XEWY 2J3EA 2RGXA 3G82C 1ELOA 1E9SA 3AVQA 3QSYA 4IDHA 4NH0A 4MYTA 3CWQA 1KTVA 2VL7A 4AC9A 4PZLA 2F6RA 4Q9KA 3VR3A 3O8CA 3SBEA 3LQQA 4JIMA 2DHRA 3ZZ0A 1K5GA 3MWLA 4O2RA 3EWAA 5DI3A 4F93B 4LYHA 1XEXA 3P4YA 2ZETA 2ZJOA 1VYUA 1TF5A 3BXZA 2IUTA 3AGQA 1Q3HA 4GOKA 3RYTC 5F98A 2CVHA 1NLYA 1CJKC 2IYTA 3I5YA 4U00A 4B34A 5EUMA 3AVWA 4JSTA 5DI9A 3VX4A 3FOZA 1JI0A 1KI9A 3ZGXA 3T35A 3EA5A 1XJQA 3G5UA 1W2GA 1KI3A 1XJCA 1DBSA 1FUKA 4L9SA 3THOA 1WGWA 4A4DA 5JFGA 4KAXA 1BMFA 1GNPA 4L4UA 3E5HA 4QJ3A 1R10A 3I8XA 3NWJA 2AD5A 3WNBA 2IYQA 3R8FA 2QMOA 3TK1A 2CEAA 2EQBA 1Z6GA 3I73A 4UNSA 3U44B 2YKGA 4HZIA 2IT1A 4LPSA 4ESHA 5KTYA 4HLDA 1DG3A 5B2ZA 4P32A 1OPXA 2PJZA 4PXAA 5JI2E 2BCGY 2AD1A 2GESA 4MGYR 3P32A 1IN5A 1OXUA 2HLDD 2PMKA 3NIBA 4QFMA 3IO5A 3WBJA 5JLJA 1Q0UA 4JT4A 3TJZA 5AJWA 4ZIRA 2GETA 1T8UA 3QI2A 1E2FA 3N2EA 1GAJA 5IF9A 4M1OA 3PG5A 4DC9A 1TTTA 4II7A 2JJ8A 2LCFA 4O0MA 4LJ4A 4DSOA 3I61A 3MG9A 2XITA 2E9SA 2GCNA 2OXRA 4TL9A 1JPJA 5TDHA 4Q00A 1IXRC 1FNMA 4KU4A 4WVFA 4B33A 5DISB 3PFIA 4D81A 3RWOA 1WBBA 3LLUA 3MFYA 4JBXA 1MOZA 4KO8A 2I4IA 4TYQA 5F3WB 3ZIAD 4AURA 4LV8B 5G3ZA 3EPKA 4JLOA 4RCZA 1PJRA 3MMPA 2F1RA 2HJVA 1FMLA 2P67A 2UZ3A 4G01B 2ZJ8A 4LBZA 4PHTA 4A8JC 5JEDA 2DB3A 2KSQA 1OFIA 1E96A 3U7GA 1W5TA 2A5FA 1RIFA 4OI1A 1VCOA 3LFUA 3U6BA 3EPJA 3A4NA 4EJSB 4XH9B 2B7CA 2W83A 4JL5A 3FFAA 4IVQA 1KO4A 3KX2A 1KK1A 1QBKC 1OHHA 1W4CA 2REXB 4WBSA 2FSFA 4N3NA 3TQCA 1R5OA 4RKEA 5EJEA 4KSCA 1XXHA 2C99A 1J90A 1JBKA 2NGRA 2Q9AA 4URVR 3TRFA 2IYLD 4TQ9A 2VEDA 4JLBA 1WA5A 4C0KA 3U61B 2J41A 4DEXA 3THWB 4GI7A 4A36A 1QHYA 4HUQA 3EZ9A 2OLJA 2HT1A 3EIEA 1U98A 4C0QC 4G5SA 3FMIA 4DIDA 5IRCD 1W4RA 1HY3A 1AZSC 2MSCB 1XB2A 3SE0A 2CBZA 1BH2A 1CXZA 4LV5B 2QAGC 2B6HA 1JR3E 4RD2A 1E3MA 1DO0A 3AF1A 2F43A 3ZJYA 3BH7A 1E79A 721PA 4TMVA 1I2DA 2FPKA 5KDDA 1KNQA 3BB4A 5FL7D 4AYWA 1UPTA 2J1LA 4BEJA 2NZJA 5AUOB 4MGIR 3DM5A 3IEUA 2OAQ1 1MO3A 1NBMA 4GNKA 4MUBA 4CGZA 3I8SA 2PX3A 3T12A 5HCIA 1OLOA 2G88A 3ASZA 3A6PC 2G9NA 4YMUA 4LYFA 1T4GA 1DE0A 3I5XA 1E32A 3FTQA 1W0KD 4KITB 1XCPA 4N1AA 4AYXA 1M6NA 1M34E 3BBPA 2XXAA 2ZAOA 1MT0A 2W0SA 2AK2A 4OHXA 1ZU4A 4P4TA 3MJHA 4TLBA 3VNVA 3BB1A 1S2MA 4G1UC 2WM9B 2WOOA 4A2PA 1T0HB 2P3SA 1GM5A 1KO8A 4X8MA 3AP1A 3K09A 4ASUA 1W36B 1E2IA 5F9FA 1DS6A 5AJZA 5KPDA 2V7QD 4BLRA 4RSGA 1A5TA 3GJ6A 2PXDA 1ZBDA 4L5BA 2XX3A 2ZU0C 4B48A 2QQ0A 3A1TA 3AF3A 1D2MA 1HQYE 2VTKA 2CK3A 4X8OA 1KI4A 4LY6A 4BZXA 4CF7A 1Z6TA 4BPBA 2RHDA 5J4YA 4ESVA 3C41J 2OM2A 3CF6R 4DUGA 1JXMA 2R6FA 4MQBA 5F9HA 2ORVA 2I1QA 3SFZA 1KSJA 2CXXA 2IW3A 3CO5A 2QE7A 4M9XA 4KLZA 1PUIA 4JVSB 3LWNA 2QM7A 4DLVA 2H8KA 3KQHA 3GLGE 4CT4B 1E1QA 4OHWA 1NF3A 3IIKA 4BFZA 2GJ8A 1ZYUA 4HAWA 1OFUX 2PZFA 4WW0A 4PC2A 4V02A 3EZ7A 4V0MA 2HXSA 3REFA 1P61B 2ZI3A 5C2JB 5FTNA 3OZXA 1Y3AA 3C7KA 4A15A 3WNCA 2ZE5A 3PEUA 5FPHA 1FP6A 4G5OA 2JLSA 5BYKA 1E6CA 1GRQA 1IY1A 5BYJA 2GJSA 4MKGA 1E9EA 4Y0VA 3BH0A 1M7BA 4D26A 1CR1A 3GP8A 1VKJA 2CDNA 3Q72A 1VG9B 1QRAA 5DYGA 4HZUB 1F2TB 1HT2E 2NQ2C 4YMVA 2C95A 5HCNA 2GA8A 1U8AA 3U3OA 5BXQC 2YV5A 2ZTSA 2CL0X 5LB4A 1J8YF 5SZJA 6Q21A 2BMEA 3DMDA 4IDPA 1S3GA 4TL7A 1LF5A 3DEFA 4I1OA 1G3QA 3F0TA 5KSYA 1G291 2O52A 2PMDA 2OE2A 2JIZA 2PLFA 3QUSA 3UMRA 3QBTA 1CR2A 1KZ7B 3K0CC 1G3IA 4TYYA 4TMKA 1SKQA 2HEIA 3NEYA 1TEXA 1F5NA 1TPZA 2QTHA 3WRYC 1VIAA 1FQKA 2J7PA 1Z29A 1J8MF 4PC3A 1T3SA 1G1MA 4OHZA 2A5JA 4TMTA 1WB9A 1T91A 1G9XA 1E4YA 3N5CA 2WAXA 2ATVA 2HXYA 3SN6A 1NVVR 1KIMA 1P2VA 1HT1E 4V0KA 2QGNA 2JJ1D 1ZCBA 2GCOB 2GWHA 2W6JA 4IVRA 3B9QA 1K8RA 5G40A 1SVLA 3NBFA 3OE7A 2AFHE 3TVTA 5C4MA 1S1CA 3VAAA 1KJYA 1S9HA 2CK3D 3D8BA 3X1WA 4XVQA 3BGWA 1X8LA 4ZDJA 1Q1EA 2VSXA 3TGPA 4WZAE 4KODA 1JAIA 2RKOA 4DUGD 2VIIA 2R8RA 4LCBA 3RS2A 4QKQA 3P20A 3R9WA 2J0UA 2W6IA 3ZZTA 2KI5A 3U44A 2J5XA 2BMFA 4PC6A 3KJEA 1KOFA 3QVVA 4O25A 4XJXA 1PLLA 4OK3A 2QN6A 3NC0C 4K8OA 1OH5A 4JVNA 4ZDIA 4OQFA 2FWRA 4Q7LA 3THXB 3IUYA 2WPDA 2ZYUX 3K0AB 2IWHA 1OB2A 2LKDA 4BECA 1EWRA 3A1VA 4BRWA 5JRJA 5CB8A 4M1TA 1GVNB 1KSHA 1US8B 1XFAA 5HPYB 1X3SA 2AR7A 1G18A 2ZVPX 2QT1A 1CRPA 3B1VA 2OILA 2ZJAA 2JAQA 1OH7A 5BQ5A 3R9IA 2BMJA 4MRNA 1GP2A 3GJ5A 5CB6A 2VH5R 2QPOA 2ZEJA 2F3TA 4Q4LA 4DSTA 4C0SA 3CRVA 4ZPXA 3WHLA 4DLYA 1GITA 4Q1AA 1Q3TA 1P5ZB 2NIPA 4LHWA 2PLRA 2Q3HA 5FBWB 4PX9A 3OEHA 1WF3A 1CJUC 1AIPA 3VR5A 3WYAA 2ONKA 1OXTA 4QHSA 2VF8A 4LC0A 2JIZD 2W2VA 1NG1A 1JECA 1AN0A 1COWD 1A2KC 1NN5A 1G3MA 3C16C 2BM1A 3AF2A 4HAZA 5CDFA 3X1ZA 3ZS8A 2V4ZA 4HB4A 4ACAA 1TU3A 4RVCA 2XJ4A 2IYYA 2BV3A 3ZQ6A 5IHPA 1RRGA 5JWOA 2R9VA 2VHQA 3VU9B 3LXRA 2ZJ2A 4JT2A 2W58A 1Z0JA 4WXPA 1YZLA 1CJTC 1UDWA 2XZPA 4QBIA 4MH0R 3DMNA 2PXUA 1XEXB 1ZJ6A 4V03A 3ZVRA 5DNYB 1KSFX 4IXMA 2AKAB 3ZVNA 4G5RA 4TL6A 4YLGA 4P4SA 1JAHA 1VHLA 1W1WA 4QHYA 4DDVA 1NRJB 4DBLC 3RRZA 4P3YA 1AS3A 1F3OA 5FPYA 5LB2A 3IQWA 2WBLC 3THYA 3Q85A 4F4JA 4YXWA 4US2R 4TTQA 4A2QA 2YNMA 4JYCA 3NH6A 3ICQB 1R5NA 3TE6A 1T6NA 2GF9A 3LVRE 3QEJA 1UDXA 4DEYA 2ZQ5A 2ORIA 1HH4A 1IQPA 2QUZA 2O8BB 4W5JA 2WPDD 1VG8A 2YJTD 2OFWA 5FOUA 3SYNA 1RJ9B 4FMDB 2J0SA 1EX6A 1AGRA 4OHYA 3W5JA 5L3RA 3PUWA 3NC1C 3QKRA 2ODWA 2VSOA 1TUEA 1E99A 1WMSA 3IBYA 4CRWB 2MSDB 4M9QA 4OKSA 2QP4A 2VHJA 3OFNA 2Q3MA 4M8NE 1D9ZA 1LS6A 1M2OB 1VG0B 2DFNA 3KDSE 3PV0A 5K8IA 3AM1A 2H5EA 4Q1FA 3K9HA 5FPSA 2GILA 4FW9A 1ZUNB 3H84A 3S1AA 2RGDA 1G6OA 1NLFA 3U7FB 3PEVA 4EDHA 3QG1A 3CR7A 4Q18A 4DRZA 5CITA 2R6DA 4CZ2A 1S8FA 2WVJA 1TNDA 5A0FA 3MD0A 4BWYA 1JB1A 1UBGA 5FFMA 4Z1MA 1E2PA 5DH9A 3E2IA 3CH4B 1P4SA 3P27A 2AWNA 3BH6A 2DBYA 2ZAMA 1SKYB 1Z47A 3KKPA 3K70D 2C04A 4P33A 3I1FA 5KSPA 1FPMA 3NHAA 1AZTA 3UWKA 4AG6A 4CIDA 1Z6XA 1G4AE 4B3DA 4C7OA 4BFXA 3MCAA 4TZ6A 4LGMA 1Z6AA 4QGAA 5AUPB 3QXHA 3B2EA 4KI0A 4TLAA 1U9IC 2IHYA 3R8CA 1N6IA 2HF9A 2DWOA 4A0RA 3LDAA 4NYIQ 4PAMA 4PC7A 1YZQA 3KXLA 1YHNA 2IC5A 5CYOA 3M1IA 1KHTA 5UKDA 4XD7D 5DGXA 3GCGA 1SXJA 3HR8A 1EX7A 4B3GA 4AIIA 2FDCA 3QENA 4M1YA 3C4JA 1XXHB 1ZC4A 1N0WA 3VKWA 4XVUA 3TQFA 1XU4A 2BIFA 2WJHA 4Q1BA 4YXWD 2P6NA 3NDPA 2A7QA 1C1YA 3ND9A 3PUZA 4JLMA 4FWIB 2PX0A 2W2TA 4HUQB 4YDSA 1RFLA 1HA3A 4EQ6B 3CRQA 221PA 3OIVA 1E9CA 2V3CC 3FVQA 3FDIA 4D4LA 4GZMA 2G77B 4D25A 1P9NA 3B60A 4N0EA 1F2UA 3W5IA 3WYFA 2WWHA 4KVAA 1TMKA 1N5JA 1N0VC 1T5IA 1XNJA 4LDJA 1DULA 1VPLA 1E9AA 1AQUA 8OHMA 3HDTA 2ZI9A 3LW7A 4MGKR 5IK2A 5ELXA 2PXEA 1AK2A 2R6AA 1CEEA 1LF0A 1ZNYA 3CRRA 3LX5A 4OJQA 2YYZA 3VKGA 3ZD7A 2F7SA 2ZRIA 3OESA 5C1BA 5TY0A 1ZNXA 2ZIAA 4ZI3A 4PC1A 3J81k 4HAXA 3C14C 3W6NA 4GFDA 3SYLA 5C18A 1GZSA 2A5DA 4KVGA 1FFHA 5EP2A 2FV8A 4BLSA 2ZSFA 2AWOA 2ZRPA 1IAQA 1NN1A 2AL7A 4EPTA 3LY5A 2ZRBA 2OCPA 1E1RD 3T61A 2QAJA 3CIOA 4LYJA 5DYIA 1MABA 1XZQA 2GCOA 4L8GA 1MV5A 1P2TA 3KFXA 2ZI7A 5H1YA 3AV0B 4IHQA 3GEHA 4C0LA 4OI0A 4NYMQ 3KQNA 1P75A 4TT3A 4RFVA 3WY9A 4NCKA 1O3YA 2YC4C 1FP7A 4Q9JA 4MDFA 4RZXA 2JLXA 4B6FA 2VP4A 4QGHA 5GAGi 2Q9BA 2A30A 2O5VA 4HYYA 1WBDA 4C2TA 2ASEA 4L9WA 3GMTA 2ZRDA 4UKDA 4ZKDA 3W3AA 1U99A 1GKUB 2VSFA 2BEKA 3ZDQA 4IDQA 1AKEA 2RGNA 5EE5B 4LV6A 1MO6A 1SXJD 1KK3A 4LWZA 2ZYVX 2NPFA 3IIMA 1QHNA 4M1KA 3FHTA 3HYTA 3PQCA 2CLCX 1KNXA 2C77A 3BE4A 2QBYB 1NMYA 1R6BX 2HLDA 4DWJA 1OJLA 3TUZC 1HEIA 1IJEA 2GEVA 3SU8A 1NLZA 1E0JA 2FEOA 2Y8EA 3PENA 3I62A 1EFHA 3GJ7A 1OW3B 2GK7A 3B9PA 1SVSA 2WJYA 3SEAA 1NBME 3NTUA 3L2OB 4QBGB 4KXFB 1ZNWA 3GLHA 2FH5B 2FZ4A 4GL2A 4XVRA 4CT5A 4HI0E 1G7CA 2X8AA 4CEHB 4KLNA 4NCJA 2OBLA 3SI7A 3B1ZA 3A1SA 5KNCA 3IIJA 2JLZA 2H7VA 3SHWA 1JEDA 5J40A 1HURA 4ON9A 5IK2D 2GXSA 1JR6A 3LNCA 5C46F 2X2FA 3IDQA 4ZV4A 4AKIA 2GXQA 1EFRA 2GTPA 1H8EA 4IFEA 3ZIAA 4ZKEA 3AF0A 3M6AA 4D4KA 4NCIA 2JCSA 3RS7A 3U3MA 1KKMA 4MRSA 4B35A 4I4LA 2IEYA 2RAPA 1JNYA 3VU9A 2ZRHA 2XOKD 5C4GB 4OYHA 1MH1A 5FOSA 1NVVQ 5M04A 2O8CB 3RC8A 3A36A 4PHGA 3T5DA 1OH8A 3KUCA 3CRW1 4NONA 1XPUA 3GLIA 3IHWA 2D3WA 5FPKA 3NKVA 4A8JB 1NIJA 2OESA 5KU1A 3LBNA 3RABA 1D2NA 1M7HA 1HE1C 3VMFA 2G1JA 1DOAA 4A0GA 1G8GA 4TT3D 4QM6A 2RHMA 4KYUA 4B3XA 4JLJA 1SULA 1Z5ZA 3AKDA 5L8VA 1KI2A 1G21E 2BBSA 3VKHA 4JKYA 3A58B 1DELA 3QE0A 1G7TA 3BIFA 5EXPA 5FUYA 2ZS7A 3K9NA 3I4LA 5AR1A 1Q21A 3NHBA 4US0R 4FD2A 4JLDA 3EZ6A 1TF7A 2J0QA 3CR8A 1ZVQA 2F55A 2BDTA 2EYQA 3L43A 2J0UB 4B75A 2IS6A 1G3UA 2ODBA 4NCNA 1JJVA 2R44A 1V5WA 2O8BA 1P60A 1IOZA 1KK0A 1M1YE 2X1VA 2ZJ5A 5GVSA 2VHUA 1RJ9A 2FFAA 4EPVA 2XB2A 2B7BA 3T1OA 4Q4JB 3EC1A 1YZGA 1VECA 4M2LA 1EESA 4PSVA 2BCJQ 4BLQA 4C0AC 5FL7A 1XDBA 3K0FB 4PAQA 4DXAA 3QXXA 5DE3A 3EPLA 4HLQB 2BWJA 3KFVA 2ZSEA 4BZPA 4PHHA 3G0HA 4URXR 3M0EA 1CIPA 3HJNA 3QKUA 3MLEA 4TL8A 3RRNA 3L0SA 4AG5A 1JALA 1DAEA 4LHYA 2XZOA 1W0KA 3ADBA 1E2JA 4PTLA 4OK6A 5FUXA 2JEOA 5FBRB 3ZQJA 3M4YA 4D0LB 3W6PA 4EPWA 4DSNA 1UJ2A 4B3FX 4F7WA 5AUQA 4Q66C 2WJIA 2NO0A 5EUQB 3EPHA 4Q19A 2PXQA 1BYIA 1RZ3A 1ESNA 2ZJYA 5FBVB 2EYUA 4U02A 4PPGA 4Q1CA 2Q21A 3AVTA 5A4JA 4AI6A 1EFRD 2NO7A 1L7VC 4A9AA 3RNLA 1H8ED 2V7QA 5EE1A 3EG5A 4PR0A 4JLKA 3K70B 2GAOA 4S35A 3RANA 4E03A 1HE8B 5BW8A 2ECKA 2AHOA 3NG1A 1KMQA 2JLUA 4U5XA 1NVWQ 4TN1A 4YMTA 1IXZA 1MR3F 4HLCA 5EXTA 2ODEA 3QIAA 1AS0A 2YHSA 4GMDA 3GJ4A 4G3XA 3RS5A 1KDPA 3GQBA 1N6LA 3CPJB 2Q0HA 3TUJC 1UKZA 1II9A 5DLQC 4Q7JB 5JS7A 3FHOA 1D8TA 2CJWB 4AYTA 4LHXA 3ASYA 2WZQA 1ZM2A 4JBWA 4TWZA 2QENA 3GFOA 4NYIR 1LS1A 4P4SB 4R2IA 4LPKA 4N0DA 3AVXA 3H2YA 1RVDA 1UEIA 2BBWA 4Q47A 3B1YA 4EQ6A 5LDDC 3CX8A 4AWXA 3THYB 4AK9A 4Q5IA 5JJKA 3FFBA 2G83A 4KJZA 2FFQA 4DDUA 4XIGS 2NMVA 4MRPA 3GFTA 4PO8A 4PFSA 3B1WA 2IYUA 2FJUA 4F4CA 3CX6A 4CEIA 1GL7A 1LY1A 3Q8XB 3L0PA 3AF4A 1X8KA 4LBWA 4Y0AA 1HV8A 1ZU5A 1WE2A 3QXJA 5GADl 2VP5A 2O0JA 4M21A 2Z83A 4PZYA 3BFVA 3U4QA 2HV8A 5DN6D 3QKRB 2ZE7A 2F9MA 4IRUB 3LAWA 3KKQA 1KSGA 3LV8A 4E5UA 1CBUA 1E2DA 1DAHA 4JKIA 3JZAA 1Z3IX 2PCLA 2QTFA 3ZS9A 2OZEA 2JA1A 4MA4A 3KJIA 3T15A 1NJGA 4IDNA 5EE3A 3O8DA 4DT1B 5L3VA 4FWTA 2F1JA 3S1AB 4DB4A 3HR7A 1R0WA 2DCUA 3BFKA 1OH6A 1EG7A 4IXNA 4IEEA 3DVLA 3LQXA 5H68A 3X1YA 2HYIC 1N6HA 4OQXA 1Z0DA 1KK2A 1Z2AA 3HPRA 3W8RA 1GNRA 1YR6A 3V9PA 1W48A 1S96A 1G41A 2J7KA 2JJ1A 3AGPA 4Z8XA 3W8NA 1GL9B 2CE2X 3AEZA 1R2QA 4EPRA 1WQ1R 2IXGA 5LD2C 2O0KA 2AKYA 3CM0A 1FOEB 4OI4A 3L82B 5CK5A 4D4JA 1UM8A 4YC7A 1U0LA 4NYMR 2VBCA 1NP6A 1MRNA 3T1QA 1E0AA 3DO6A 1PUJA 2YOGA 2YWFA 4C7OB 3H86A 4P4UA 4V0OA 3RLFA 1II0A 4BE7B 2C5LA 1DAIA 2X19A 2BEJA 4M1MA 2QA5A 3LQRA 1YZUA 4LHZA 2D62A 2GBLC 4ARZB 4FXPA 4EJSC 1FX0A 2AXPA 3AUYA 1CS4C 2ZANA 3U3KA 2WWYA 4LSGA 2QBYA 2Z43A 4BGDA 4X8HA 1SXJB 4KV9A 4TMWA 4MKFA 4O2LA 2QT0A 4Q7KA 2QPTA 3NBYC 4UXJA 3RRYA 4ZI2A 2IYXA 3JZMA 3EZ2A 3IQXA 3VR2A 3I32A 4A82A 2HCJB
chains in the Genus database with same CATH superfamily
1W4ZA 1T5HX 2ID9A 4MB6A 1VI2A 2BZSA 3F4LA 3T4PA 3H4MA 3K7EA 4HXEB 4KO4S 3AK4A 4FYYA 4MVJF 4OOEA 4DLKA 5I7VA 3O7MA 1TE2A 4H35A 4C05A 2OB2A 3QUQA 1WATA 3GO4A 1J9GA 1CF4A 4C9BA 3E81A 1BDJA 1MABB 4HTFB 1UH5A 2EFEB 1RP1A 1TEVA 1HQ1A 4KPYA 4E2WA 1T0PA 1PZMA 3KB2A 1YE8A 2IBFA 4OV6B 1AK1A 1MVLA 5EJ8A 3U60B 1FTGA 4PHFA 4M7PA 2EKZA 1E1DA 1Z2OX 2P2YA 1NU9C 1KI1A 4RVDA 3PNQA 4ME6A 2R47A 4DLLA 3U3ZA 2WJZB 1LIHA 4AZVA 4JK3A 3EQ6A 3RVLA 4QX6A 3QE3A 3CXRA 2RHTA 5B37A 4RLSA 4RA9A 3HSYA 2B1RA 2PFGA 3M3HA 5FOVA 2ZIXA 1NSFA 1ZJZA 1G2PA 1NIPA 1G8MA 4BFTA 3MBGA 4MKHA 5EGYA 4CS8C 2EFJA 2I34A 2R8OA 4FJ0A 4JMPA 1KDOA 4UFPA 4IWRA 5CH8A 2FHPA 3GVIA 4Z99A 2WYUA 1VLTA 3AY0A 2DJ5A 1FUYB 3CLVA 4J4HA 1JIKA 4EKGA 5AVUA 2NO1A 4IJKA 1S3SA 1E1RA 1QFSA 4BMDA 3QMKA 4M7OA 4MS4B 4EVSA 4ZQEA 4PZEA 2PG3A 4L50A 3ROEA 3RS8A 1IM2A 2WJ4A 5CA0A 4GPBA 1SMKA 3D3QA 4RD4A 5K0BA 1QH8A 4UMDA 2QRJA 2HEGA 1DINA 2ZRNA 1E2GA 1JU4A 1M3SA 2QG6A 4LDPA 1VIDA 4Z7NB 2XDYA 2EKBA 1HYBA 2VQSA 1M2FA 3HP1A 5JAIA 4EGCB 4JURI 1RHMA 4XB1A 621PA 3VYUB 4A4AA 1M8FA 3UCFA 4G5YA 2CNBA 4LE1A 5LOVB 2Z5FA 1GAQA 1VIYA 4M0KA 3SK0A 2Q46A 2YDXA 1J2JA 3OCCA 1BKDR 5EMJA 2A1TR 5FNZA 3L0YA 2PZEA 1YRQA 4I3GA 2YVKA 1OQAA 4H0FA 3CJQA 4CIPA 2YWXA 2HRRA 1W44A 1ZMXA 1XFDA 1TA0A 4IXWA 4DF3A 1PSDA 2GF2A 4A27A 5AW1A 1SBNE 2WSBA 1Q14A 4JP5A 3HDJA 4JL8A 5ES4B 3MIZA 4QU8A 4YMSA 3AGUA 1MXFA 3DE2X 1C14A 3S29A 1QF6A 1Q0TA 4BPRA 1SQGA 3GMDA 4B32A 4LJ7A 4X92A 3RBAA 4O4JF 4MA5A 1QPGA 1FXUA 4MVJP 3E6AA 3CT4A 4PO9A 2EX1A 1QIKA 4INAA 4O2AA 2VYNA 3M70A 3LWBA 1OR8A 3RB8A 4YG1A 1K7XB 3SC2A 3F78A 2JIDA 2QTNA 2GHIA 4G5QA 4YT2A 3MM4A 1U9IA 5JCOA 1N1GA 3LVFO 3NDBB 1Q91A 3SMQA 1QC5B 2AX4A 3JQFA 5TX7A 4ZZ1A 2OENG 5K0SA 4TZKA 3ILSA 1E9FA 2NUTA 1OYVA 4WESB 2JHCA 4IUCS 1WXWA 3DO5A 2FF7A 1SIBE 3CNNA 4DDKA 5GJWC 1A8HA 1QZXA 4GI1A 4PRYA 3RFUA 1IN8A 4L2IA 1WM1A 3H5WA 3L6RA 2NO4A 4I4TF 2Z95A 3L7DA 2JFNA 4HGOA 1DBRA 1P1JA 3IUJA 2KWIA 1YK0A 2QOEA 1WKCA 3D8SA 4IDGA 2GK6A 1R37A 3ZDLA 5I7SA 2R63A 4YLEA 1JEYB 3AVYA 4EFKA 4OQLA 1ZZPA 3G2NA 2WWIA 1M34B 4FIDA 4LBYA 3UNXA 2Y4OA 1SN7A 1P0MA 4XWKA 3JQ7A 3VZRA 1XA4A 1KMNA 5LBTA 5BWLA 5C8ZA 1OFTA 1Y8AA 3QF7A 1X92A 1UBOS 4FQ7A 1P31A 2EDAA 4XWJA 4BMPB 2RK4A 1NN0A 2EZ8A 4Y2PA 5DLJA 5F2EA 2X3FA 2P0EA 3AQBA 5B3IA 1WXHA 2WSIA 3ZLJA 1JAYA 1NVBA 1V7CA 4AICA 4RY9A 4V0LA 4GMKA 4LLCA 4J49A 5DM70 2F3RA 3DF9A 4B3MB 3PQ7A 1HE1A 2VHEA 5EMHA 3JQRA 2KB0A 1OGJA 1YYJA 1KHHA 2B83A 2QU8A 2WAMA 3EW9A 1QKRA 3O5AA 3WIBA 5DS5A 1HTWA 2W0MA 4OL9A 4WBXC 5KS2A 1DLIA 1J07A 5KJEA 1UP6A 2QMUA 3DPIA 4B82A 3MT9A 4LZNA 3HZZA 2JARA 3ZJ5A 1QIHA 3ACCA 2G1KA 2BUBA 5ADVA 5JNUA 1GTG1 3I1YA 1ARZA 2XAAA 3ZHXA 3HBJA 2C03A 2AOTA 3VGJA 2IP4A 1I2ZA 2V9ZA 3WYDA 1V3QE 4J0EA 4FGZA 5FR1A 1U80A 1YGPA 1TFUA 2BKUA 4FDUA 1C3VA 3CB2A 3TR0A 3BERA 4V0NA 1QS0A 5HIMA 2WF9A 3OI7A 4G1CA 5CYPA 4JJ6A 3D6TB 4NENB 3I9V1 1IUNA 3OWOA 1R6UA 1X80A 4BO8A 2WT8A 2Z5LA 2R7RA 4ASUD 1WXQA 1U8UA 2MYPA 3CFYA 4F2WA 3KIPA 1M73E 3O3NB 3TLYA 3KTAB 2ZB4A 2PS0A 1FFXB 2RC6A 4DQ0A 3ZTYA 1QAQA 2YOHA 4I8XA 1I2MA 1BGVA 1SXJC 1WF6A 1HFJA 4TMZA 3WL7A 3GFBA 4LJAA 5AM1A 5E3JA 1ZIOA 1C4OA 2WIGA 3VU8A 4BVGA 4R8VA 5BV7A 2H18A 3BIJA 2FMHA 2WG2A 1H0SA 2XLDA 4HDQB 4NDZA 4O2BA 1V4NA 1CEQA 4MXDA 2RIPA 4MV5A 5THXA 1M6EX 1UODA 4BJ6C 1QHSA 3T7JA 2CLDX 3ZBPA 1TVEA 4PICA 1VCNA 1UKYA 3OECA 3PNLA 4FMBB 3OEEA 2IXFA 1PQ4A 5FHQA 4PG8A 3HJGA 3GJ3A 3Q1KA 4IUDS 2J9RA 2RGNC 3K72B 1LX6A 4WA7A 4BLOA 2N1MA 5FTMA 3WRYA 2HHLA 2ASVA 1IPFA 3UJCA 4U2BA 2PTHA 2XYVA 2ZREA 1BAPA 3WLAA 1T8WA 2YDYA 1E5QA 4YRQA 5CYGA 3ZGYA 3DJNB 3SG0A 5DASA 2IH2A 3I8OA 5K8TA 1BWSA 4AWBA 4LYYA 2UUHA 3DYBA 4L85A 5TIIA 3HVIA 4BNHA 2WB7A 1PEYA 1EHIA 3LP6A 1W49A 5LCXA 2AEMA 1U0SY 4HFJA 5FF9A 4RH3A 4AZ0B 2GYVA 2PS3A 3JQ6A 5IVPA 1VC2A 3OFSA 3ZU4A 4ZYUA 3QE9Y 4D9IA 1P1RA 2A1TS 1F2TA 1H8HD 4B7UA 1TKNA 4KYVA 3C7AA 2H4JA 1W7AA 4EKNB 2Y2UA 2YLGA 1NDUA 4LSWA 1SRQA 2AHRA 3X2FA 1JLSA 4HNAA 2XXAB 1MW9X 1TVKA 4WT7A 2IA5A 5AI5A 1FZQA 1UK9A 2AW5A 1M66A 5GAHi 1JJFA 1P9RA 3M8KA 4FT4A 3CSKA 3QEOA 4GM0A 3RAEC 2JFGA 5EKSA 5E3HA 2D2EA 1K4YA 3DE7X 2HPZA 1NY6A 4NKRA 2NSDA 2JHGA 3TKYA 1RU3A 1ZRHA 4X3CA 4JTCB 1US8A 4YCDA 1ONBA 4AMUA 2P7IA 1P5RA 5AKIA 3IT1A 4D9NA 3DGFC 2QM8A 4CSAC 2X5KO 2PGOA 3D8RA 3IH5A 1E5DA 3LCRA 4KI7A 1LDGA 4FSDA 1S1MA 3QU2A 2BMWA 5FV4A 3KAQA 1N1MA 4XDYA 3KNZA 5EUBA 4MDHA 3W8EA 1E8NA 2IUTA 5TQ2A 1Q3HA 4QOJA 2QD4A 5J2UF 1Z4MA 2XWBF 5K3CA 2D7JA 3MIIA 4K03A 4TS4A 3I2KA 3BILA 4C78A 2W2PA 3CS3A 4B7ZA 3LUGA 3E23A 3U19A 4PN3A 2QW1A 3GX1A 2UYCA 4P32A 4JENA 5CAEB 2GESA 1CUJA 1OZ0A 4D9JA 3MB8A 3WVNA 1MVNA 4BB9A 2OAGA 3D0KA 3MVEA 4BQOA 3T41A 2C7QA 5TS3A 4QPPA 4DSOA 2QTRA 3KAJA 2LK4A 2QM0A 2V97A 4CDAA 1KH1A 1PV3A 5FBZA 2BT4A 4KE8A 5F3WB 5CVCA 4JLOA 1PJRA 2HJVA 1YTUA 2JD2A 4B87A 1XDWA 3FCCA 3FFAA 4K2AA 3B7HA 1D8AA 1ZH8A 5B3JC 1SBZA 2XPCA 1DWPA 1ODCA 3FRHA 1UPBA 1P17A 2N0SA 2QMQA 3JXBC 2HJWA 5KBYA 2OLJA 1V4AA 2ZBDA 4DKJA 4UM8B 3FMIA 1XNHA 3SX0A 4FKZA 4P7GA 2QAGC 5EJMA 2PXXA 3RVYA 2J1LA 3VXKA 4U9EA 4I5GA 4J75A 2GN0A 1QGUA 4O4JB 4O8BA 4GQIA 4DN6A 4YMHA 2H5IA 1YZVA 2AYYA 1CY4A 1ZU4A 4DCGA 4TLBA 4JR2A 2X9GA 1Z35A 3JQ9A 3G7NA 2WOOA 2D2XA 4N8EA 1J0EA 1EJ2A 2R1VB 4O6VA 1ZIXA 1A5TA 4JXZA 2NUBA 3CNHA 4B48A 2Q4EA 2VDPB 1MORA 4BZXA 2BKAA 2OM2A 4Q3NA 5F9HA 3SFTA 1ZW3A 4F6RA 1SYQA 2GAQA 3KQHA 5EKTA 4EZEA 2YL3A 4H7DA 2HXSA 1GPDG 5DGHA 4AULA 3ZQVA 2O3TA 3EFOA 2GJSA 5GZ3A 4AJNA 1VKJA 3V7WA 1PTJA 2XYQA 3STWA 3C3MA 5CDUA 2QD5A 2R7OA 4KBYA 3QVYA 4BP1A 3TMYA 5DVWA 1U0NA 2G62A 3PUIA 4IDPA 2SKEA 1PHRA 4KTVE 1L6RA 3NEYA 1QK5A 2WF5A 1S01A 3DZBA 4OHUA 1F5NA 3T3OA 3DD7A 2EC5A 2X14A 3F98A 4I4TB 3KPYA 3VH4A 3V5NA 3V8BA 5F52A 2JJ1D 2GCOB 4QLBA 2VOEA 1QH0A 1NT4A 4IQ8A 2G5PA 4IS2A 3OKCA 1KRHA 1OC4A 3BGWA 1HT3A 1NZJA 3BJMA 3DUWA 3PGVA 4GOND 1E3QA 4DUGD 1Z3CA 4LCBA 3RS2A 1SQ8A 1UXDA 1HTBA 4OH1A 3K96A 1QU3A 3U9TA 3U49A 2ATCA 4FZ3A 1KU0A 2ZYUX 1R5ID 3WLQA 2NSGA 4GPIB 3NTLA 3UFBA 1G18A 1SM4A 4LOLA 4N5DA 1ZQ9A 2G7ZA 1OASA 1QQAA 1P0PA 3VTZA 1YR3A 1HE4A 2ONKA 3Q12A 3PL1A 3V8RA 1H2AS 4C3VA 2P3OA 2R9VA 4HNVA 2ACEA 1LWOA 3N6XA 4CS7A 4WXPA 1JU3A 4GX5A 1HNNA 1C3OB 3ZXXA 5EIBC 2FPRA 3LP8A 3EWIA 4KUEA 3VOAA 5IARA 3LUKA 4MW3A 3OA0A 2EBUA 1TUGA 4RE6A 3VJRA 2YNMA 3V9AA 1AGNA 3FUXA 1U2DC 5JV5A 3PHF2 3A0UA 4ZT2A 3SS9X 4JNKA 2QG4A 3D8NA 3RO7A 4BNDA 2KK1A 4U39A 1PSWA 4CZ2A 2WVJA 3CN7A 2Q6VA 5DMXA 1NXVA 4FNGA 4IIHA 1Z4QA 4B3DA 3L6OO 1TIPA 5AVZA 3B2EA 4NYIQ 4J16A 1LFAA 3DPSA 5CYOA 1GQYA 4UUMA 1QO0D 3IC5A 2D5RB 1HL7A 1HPLA 2X1HA 2JJQA 3P2KA 3CTMA 4M1YA 1Y3HA 8ADHA 2EJCA 5F3RA 2P6NA 4EKYA 3AWIA 3V7OA 2YTZA 1IJKA 3OLZA 1NDQA 3MYIA 5CX1A 3KQWA 7GPBA 1RYDA 1O6BA 2I4LA 1N5JA 1DULA 8OHMA 3S84A 4IB4A 3VPFA 3ORYA 4OJQA 3C14C 2O57A 4EI7A 1IDN1 1LZLA 5FA5A 4E5VA 4KVGA 3FFXA 1B68A 2FV8A 4J9UE 4ABTA 1BR4A 1RYNA 4P81A 3OQ1A 3N86A 3C48A 4JQZA 3G2LA 1PW7A 2X3UA 3U5SA 4IHQA 3ND6A 3WY9A 1V9LA 3QEMA 1JLHA 4MDFA 4I8TA 3UJ3X 5A6SB 3I9V6 4B6FA 1BTOA 1P7WA 1HF0A 5H9VA 3GZNA 4MZDA 3SSAA 2GAFA 5JBNA 3V7NA 4RTMA 4ILKA 5KVVA 1KK3A 4JI5B 4GBGA 3UJAA 1UANA 1VK5A 3HYTA 5HBRA 1SZJG 1QX3A 2CDBA 4Y2SA 3W1WA 1VM6A 3PNVA 1GAWA 3DVQX 3SYRA 1NHWA 1Z4IA 4QBGB 3LWZA 3HNOA 4XVRA 3TRKA 5TMDA 3R0ZA 4S12A 4EA9A 2EW8A 1EFRA 1TLTA 3HDHA 3ZHCA 1FMFA 4BMYA 1V7ZA 3DB2A 4I6UA 4PRLA 3IHWA 3A70A 3MUNA 4DLPA 2ECOA 3VMFA 1JEQB 2QUAA 1DOAA 1G8GA 4TT3D 1CWUA 5HOEA 1K75A 2HMWA 3FOBA 3AUUA 2EG9A 4FD2A 1BZYA 1ZKDA 4ZMRA 5H80A 1KK0A 3BDAA 5B53A 4CGYA 4JHLA 1T43A 3AHHA 1LE4A 4PBSA 4CF4A 3M6VA 1DAEA 3RVQA 1E2XA 1RXWA 1RWMA 3ML1A 5JLAA 3MYRA 5EOVA 5LNK1 3VPGA 3IR7A 3KYJB 5EE1A 5HQ3B 4YO7A 2D2IA 3FSEA 1NR1A 3D1NI 3FYSA 5HOQA 1PGPA 3H1FA 3MB5A 4BZZA 1P5HA 4G3XA 1UKZA 4XGNA 3Q3GE 1YA8A 2O06A 2YS6A 3QU7A 4N9WA 3CKKA 3AVXA 3R5HA 4KYTA 1PDVA 1O03A 2H1RA 3IPRA 3NRJA 1P1HA 2C59A 3AERB 4V2IA 3CX6A 2JPUA 3QELA 1JIQA 1NUHA 1D5WA 2QPLA 2ZE7A 3LX6A 1VXOA 4OXNA 2PT9A 1IRIA 1FU7A 1HY5A 5KTSA 3OZ7A 5HFAA 4EF4A 1QYIA 4RK1A 5H68A 4UUNA 1X1CA 1U4NA 1GNRA 3D2BA 1WOMA 2IXGA 1SCNE 1FOEB 1WPRA 3L82B 3URKA 3HBFA 2ACWA 3T1QA 2FHSA 1VMEA 1E0AA 4KAAA 3V32A 4C4AA 4HT3B 4DE8A 2L8NA 4GOMD 3ZHTA 3BXFA 3UCXA 4H4KC 1SXJB 4FNMA 1ZHWA 1SXGA 5D00A 4ZJPA 3OQOA 5J2UB 4Y6QA 3SX2A 1MW8X 5KYNA 4KOAA 2WZCA 3OJXA 1KKLA 4UASA 3BE8A 4DJAA 1FNCA 3L4EA 5FTJA 1BS1A 4K3VA 2BSAA 2FFHA 1OXSC 2CKMA 2FB9A 2R6R1 1ILEA 4UDYX 2O7NA 4JCZA 1G0NA 1OWMA 2G4LA 2O2DA 1Z6YA 3U7HB 2H1WA 1NOJA 4G97A 2G09A 2C5HA 3IKMB 3GJXC 3UMHA 2P9YA 3CR3C 3I01M 1GYQA 3GELA 1W25A 2GB4A 3BWMA 1Y6DA 2P9TA 2Q4TA 2DFDA 1WUHS 4DIOA 5GONA 4B6EA 4JELA 4X1YB 1PG5A 2O1SA 4MYHA 2DFLA 5SZHB 1NLUA 4KXUA 1M6VB 3KXKA 2C88A 2WZLA 3ECSA 3MWEB 3DBHA 3D5EA 4AZTA 4CCSA 1ZA1A 1E64A 1E3OC 2BFCA 4X6UA 3AR9A 2JGNA 1GGVA 1XCMA 4UCQA 5DKFA 1DX4A 1IIBA 1FLDA 1R8YA 2ZJ1A 1GGFA 5DO9A 1JG2A 3IKTA 4Q3BA 4TVKA 1KAQA 2FUEA 2FRXA 5FTWA 3SJBA 3EUFA 1JG6A 4KIFA 1OLUA 1Y48E 3UJDA 5KNDA 1JT2A 2PWAA 3ZOZA 3MXTA 2XXQA 3P26A 1YBHA 1Z9BA 4B47A 4RTSA 4AN1A 3GLGA 1Q17A 2GNOA 3NDIA 4E5MA 3FCSB 1BD3A 3K0SA 2FWNA 3VK0A 1FSFA 1N6OA 1DMRA 3OT1A 5JZ9A 3TLCA 2R4QA 1HGXA 3V1KA 4GZ5A 1EJ0A 2PSJA 5G0VA 2NWQA 3EBLA 3E58A 3UEOA 1XMJA 4AS3A 4YJ3F 3H4IA 1ODSA 1TKRA 2B1GA 3GFGA 1JDZA 2XEDA 4M38A 1YB4A 5LPNA 2IW1A 1TT5B 4UMEA 5BSKA 4F84A 2HFKA 4IWNA 1ISJA 1UJCA 1XTQA 1L4HA 2HHHB 2WP8J 3H1GA 4IJ6A 3WGLA 2YXDA 4J7TA 4N3GA 4QIHA 1F3LA 4D96A 3LLKA 1W2WB 3VPCA 2UVDA 2O20A 4BJ5A 4C3ZA 3DJFA 3E22B 1ESMA 1XZCA 4I2VA 3GG2A 1L7OA 1KMHA 1XIVA 4TZ0A 3E9RA 3FPHA 4XIIA 3WL6A 1KYIA 5HGXA 5J58A 3NT5A 3KQOA 4CKEB 3FB4A 3GW8A 5CDGA 3DT8A 5ALKA 3OLYA 4QNNA 1VTKA 2P41A 3I23A 1U8YA 4DR1B 4BP9A 3V34A 3D7RA 1X2EA 3JAWA 1XL0A 3CE9A 1SC9A 1FMVA 3GA0A 1QQ7A 2WOJA 3WAKA 4Y9RA 3IAXA 3G8DA 2H7XA 1PYOA 4JS0A 4P86A 4LEIA 1S9DA 4BBJA 2J0VA 2DQ4A 4MVMA 3KQUA 4O5OA 3AFHA 5AK5A 4N4AA 2OKUA 5COQA 1S4QA 5DP1A 5B1YA 3ZDAA 1GZUA 1UQTA 3WNVA 2QPAA 2DCMA 3ZV4A 1GU0A 4IAQA 3ZN2A 1KZ1A 1BCRA 1GUFA 4WPGA 4B4OA 3PCTA 5IT9A 2UDPA 5AJXA 2HUNA 4IDDA 3KJQA 2O6HA 2BL2A 3K33A 3RF3A 5GZ1A 2L49A 1WN0A 4B84A 2H3EA 3EIQA 4QOSA 1Q0SA 2RARA 3NAQA 2VB6A 1KYTA 2C3UA 2BGIA 3PNPA 2VYVD 1QSPA 4LS3A 4RKYA 4FN5A 4ZYTA 2NPIA 3NJ8A 5E6UA 1PZFA 5AW9A 4TZTA 3H5RA 2QAGB 3ONWA 2GM4A 3RFFA 4QRDA 1U8EA 4BNYA 3AUSA 4NFSA 1JSRA 2XDQA 1X39A 5KNBA 3WP1B 4E21A 5AW3A 1VSBA 1U1GA 5LQNA 2NZ8A 3HY3A 1WZEA 2QXTA 2EKLA 4W9NA 3IHTA 1T5TA 1FVFA 3R0XA 4XPWA 2J67A 3C1OA 5HZHA 3BHNA 1JKXA 3BTVA 3VAYA 4OXYA 1TQ2A 1HDZA 5IJ0A 4RKFA 3WG7C 2B2CA 5KTOA 1I9GA 4UJ5A 1Q7EA 4YP7A 4WAUA 3R3WA 2J3DA 3KOOA 3QF4A 5JSFA 4RYLA 3AJAA 2WV9A 4MMXB 4F11A 5JDCA 5CDFE 4WXRA 5DX1A 3FKSA 4NMHA 4DMRA 4P53A 4EBKA 2ON6A 5TT1A 3K0EA 2NAFA 3I5UA 4MUEA 3PXXA 3R7WA 1QG6A 4IRXA 1A1VA 3ZBTA 4F45A 3CU5A 3ZXUB 3U3XA 1MOQA 3MCWA 2NYRA 5K8UA 3FWKA 1AKTA 1E2MA 4FHDA 3LO8A 3DNPA 2L2QA 1G21A 2YV2A 4JKOA 1SKMA 3LOUA 3KKLA 5AM2A 4WZAB 2COKA 2WZFA 1TTHA 2A0UA 4D99A 3FDJA 2AJCA 2IV3A 2H4WA 2CSFA 2DPLA 4DNQA 1PT5A 5DTMA 4HN9A 1A4XA 1I7PA 5I5EA 3MMZA 1ZISA 1ZZEA 3OMXA 4Y2XA 1DEAA 2VK2A 4A1FA 2DPXA 4FYKA 1R6TA 2GN8A 3GLQA 2WKPA 4B71A 1THMA 4EIWA 3O92A 1U04A 2IK8A 4GEGA 4WKBA 3K0BA 1L2TA 2YRWA 1Q1AA 2JKVA 4KGVA 4IGEA 3VNSA 2JK0A 3EZHA 1GUAA 2DR3A 3B3GA 2QI9C 4FOOA 1NOKA 3VR4A 5FORA 4B80A 2L0XA 1HFEL 5KOYA 4JXKA 1D4OA 2VQ6A 1N6PA 4BV9A 2HXGA 1U94A 3TTXA 4DV7B 4M1ZA 1SD5A 3O4VA 2Q6LA 5DK4A 3G2PA 3KRTA 1E2EA 3LS0A 2Q2QA 3SC3A 1DB3A 2QR3A 1J97A 3KOUA 2FR0A 3VYSB 3FRIA 4F3YA 3OETA 4PXYA 2HMSA 4N6HA 1QHXA 4GI2A 1X6VA 4QWWA 5A6VA 4HDMA 4D4IA 4PU8A 3OD5A 4Y3UA 4ZQHA 5C7OO 2XNDA 1GU1A 1CP2A 3H5VA 3WJAA 3HR4A 4RZQA 3EDYA 1FFAA 4NNJA 1E1NA 5MFPA 1C5KA 4DXHA 3BZBA 2VDLB 5BN3A 4J7CA 3ZV7A 4X20A 1ISHA 3ACBA 3V4RA 2IXTA 3LRPA 4MWTA 3JTLO 1Q12A 3IESA 1A76A 4MLCA 3RAPR 1DQZA 1PR9A 4EX6A 3FAZA 3A6EA 5BR8B 2H4XA 6GPBA 2VJYA 4IYJA 3VZCA 3HYCA 5JXHA 3NNSA 2ROQA 4EX7A 3ZC4A 1AN9A 1SC6A 5HKKA 3UF0A 3CLCA 4E2FA 4WZBB 4M36A 3BS4A 4X9XA 4I19A 3N7TA 4H54A 3O94A 4N5NA 4NHOA 3GLSA 5AW2A 4ZT5A 3D0OA 5G3YA 1N4DA 4UTVA 2C2GA 1ZVVA 4DUPA 1QH1B 3EIXA 5EJAA 2QLMA 5SV2A 3EGIA 5LA6F 5IAEA 2O2GA 1YJGA 1BO6A 2DFVA 5GY7A 3V2UA 1QP7A 1PO7A 1QE0A 1QNLA 1QJCA 1GG2A 3CX3A 8ATCA 1DBIA 3UKDA 3T1TA 1ZUIA 4FGUA 4O6NA 5CVEA 3C3AA 1X8XA 2Q8QA 1EPUA 4IIJA 4EITA 4J30B 2PGDA 1SUIA 1FRNA 2X1MA 5B6IA 2HR1A 2P9ZA 5AOCA 4LVUA 2RGXA 4MYTA 1LBEA 2V7XA 5JQWA 3TZKA 4PZLA 4ND1A 3EWAA 1AU7A 4FHEA 1XEXA 1FVOA 4YJ3B 1FE8A 2V7WA 5K01A 3NB0A 2QI9F 4EDFA 4RMHA 5E6SB 3K32A 3PP8A 2J6BA 2JGDA 4KAXA 3E5HA 2CEKA 4TQGA 2AD5A 3WNBA 1SKUA 3W3AD 3BAZA 4AMBA 1VYHA 3QHPA 2BRUC 2SKDA 2Q5LA 1MC4A 4WOBA 1NKVA 3ZH2A 3EHEA 3IE0A 5BWOA 2CF6A 3AHDA 3DD1A 4MQ4A 4YDQA 4AY6A 2IU6A 4B3TB 2VRCD 2E9SA 3OT4A 1JPJA 5IDQA 4EEZA 3JQPA 2OU6A 1EBFA 3LLUA 1NR7A 2I91A 4TYQA 4HDNA 2KSQA 2E4AA 1MX3A 3UGOA 2FX2A 3LT0A 4HDKA 4ARCA 3W2VA 2XMRA 4CL0A 4EVIA 2JGJA 3UGJA 1BR1A 5EJEA 2A5LA 3PDWA 3ENNA 3TIIA 2ZWVA 4HEA6 2G76A 1MMNA 1VP3A 3C6YA 4LV5B 3ITDA 4WRRA 1VSUA 3LX4A 2F43A 3FN4A 4TMVA 1FNSA 3EGDA 3EAGA 3SZLA 1NBIA 1OAOC 3V4SA 1OLOA 5ITSA 4F3TA 4KITB 5JSLA 4KPFC 1LK0A 2CN1A 1FFEA 1Y9DA 4Q4CA 3DE3X 2EZ9A 3S2GA 4X8MA 4ND8A 5F9FA 3GJ6A 4M55A 3RU9A 2YIJA 3OCYA 3A1TA 1W5FA 2CK3A 4GKKB 1NXQA 4ESVA 1LJLA 3DBLA 1JXMA 4CG0A 4L27A 4JVSB 3MC1A 1DL5A 1JBQA 4EB0A 3HGTA 1DIGA 3BJEA 3WIDA 3QEBZ 2F48A 1T2NA 2ZI3A 4G25A 3KZCA 5ESWA 2GOYA 2PA3A 1HZJA 2ZE5A 3LK6A 3F6PA 3GWZA 1FFGA 1GRQA 3PX7A 3G6WA 5BQ3A 2CF5A 4P92A 3I4FA 2CDNA 2PGJA 1VG9B 1ADCA 2ZTSA 4I3FA 5AKEA 3V4PB 4HGNA 2PWBA 1OTYA 4CQMA 3KE8A 5EJ9A 4LHSA 1Z5OA 4PC3A 4OFZA 4MEBA 2WU3A 4E12A 4AIRA 1NVVR 2ZCUA 1P2VA 2XT0A 4HOYA 1Z34A 1ZCBA 3JWJA 5G1PA 2NUAB 1WOLA 4NE7A 2ZSJA 3A10A 1C1DA 4NEGA 3KZVA 4CKCB 2KI5A 1Y4ZA 2ZQZA 1PDOA 4L22A 5EQFA 2LGJA 4NIMA 2BJCA 3IUYA 5JQGF 4DA4A 3EAFA 2V6GA 1F6DA 3DJUB 1ECPA 2WJ3A 2V7TA 4DLYA 4ZPXA 1EDDA 1JMWA 2VHVA 1GZ7A 4R0MA 1J9EA 3JWHA 3O39A 1MIOB 5BP7A 4QHSA 3LRXA 1AN0A 4DBLE 2BAGA 3ICPA 4PU4C 1FFWA 5FBHA 3O74A 3OKPA 5F2OA 1JHVA 1RYEA 4MK4A 1ICEA 4KQ2A 4QBIA 3FZNA 3E2PA 4TL6A 1VHLA 3JD4A 4QHYA 1X7WA 2JFQA 5A4FS 5H0IA 5LB2A 4L5JA 3IQWA 1ZJWA 2EP5A 2IPNA 1HTTA 4B81A 2KM1A 4ESOA 3EXEB 5MGNA 1PWXA 3CZ9A 4F9GA 4WECA 3UWDA 2JCGA 5LVAA 1E58A 2P6VA 4LTMA 3VR0A 3IBYA 2MSDB 2CMHA 2QP4A 1E1LA 5JRDS 1FP4B 1N5RA 2EP8A 5EG5A 3AM1A 1OD6A 4LGYA 4AJPA 3FNQA 4DZTA 3PD1A 3Q6MA 2RGWA 1QPZA 2JGFA 2VBGA 3IV6A 3ZHZA 4BWYA 4OYLA 1ENZA 1UK6A 1WVMA 1TCUA 1T6XA 1T6IA 1EDZA 4LQCA 1O08A 1GGKA 3GAFA 4Q0MA 4YJFA 4B6JA 5F3DA 3MCAA 2EG5A 2ZTHA 3ZCPA 4IA8A 4B46A 4I3MA 4OG2A 1TD9A 2LP4A 3KMIA 3KXLA 3DUFA 4H31A 5UKDA 1PEDA 3HR8A 1IHOA 3COJA 2QF7A 1ZC4A 4EG0A 2G71A 3VKWA 1XU4A 2W43A 4XRRA 5HJ5A 5A7HA 4QU0A 4YDSA 1NDHA 2VHZA 1F2UA 1N4AA 1NJ5A 2CB9A 5AGFA 1S3IA 3LI2A 5YASA 3I04A 2LTAA 5I8PA 3LX5A 3KJFA 4PC1A 2GEFA 3D6AA 3PTAA 3SXKA 4NBLA 2AWOA 2POCA 1RM3A 1Z7YA 1PT8A 4ZOQI 3TPCA 1GG8A 5H1YA 3C6QA 3ZBQA 3QQ6A 4MVQA 3PBKA 4P6IC 4ZV9A 1AOXA 5GAGi 4MARA 2O5VA 2HTEA 4UE3S 1GKUB 1U2GC 2IZ1A 4MO9A 2VZEA 3QW0A 2I65A 1KNXA 3BE4A 2KW3C 2ZCVA 1R6BX 3R5FA 1IJEA 3GJ7A 1OW3B 1SVSA 4C3EA 2FZ4A 4HR7A 1PFQA 4PCLA 4AX8A 4KRXA 4ON9A 2GPJA 3K15A 3ZIAA 2LLWA 3GRKA 3QX3A 4DABA 4NULA 3HO6A 3OM0A 3A36A 4PHGA 1O95D 4ZEXA 2EKDA 4PM4A 1Z2DA 1D1CA 3BGDA 1JE0A 1SCBA 4MW8A 3DP7A 1GFSA 1Q0MA 4H3SA 2ZS7A 2GHRA 4MS3A 3ZGOA 4B75A 1XRPA 1X9GA 4C87A 2Z2YA 4NCNA 3VGPA 4FFMA 5GVSA 1R00A 3NFYA 3BHMA 3FOEC 1IN1A 3IULA 2FPPA 4G7HF 3KFVA 1QBGA 4PHHA 4DM7A 3MLEA 4BU1A 1K7YA 3TI9A 4OK6A 1LKXA 2X58A 2B30A 2O2EA 2O9JA 3I53A 1C50A 3P0JA 3OJEA 4A9AA 3RNLA 4XEHA 4QICA 3UGTA 2GAOA 5BUCA 4E03A 5HRAA 2D8MA 4DC0A 1MB0A 4KGXA 3QIAA 2XTJA 1G55A 1H9AA 1FJ2A 1F1JA 4H08A 3TLEA 5LA6B 1LS1A 2OKCA 4KWCA 1RVDA 5LYJA 1VIVA 4DDUA 1FR0A 2VSYA 3I28A 3RJ5A 5DGCA 5JROA 5G0UA 1R5JA 4CEIA 3RJMA 3NHWA 3QXJA 5HF5A 4ARAA 2IOYA 3TFLA 2P1RA 3LAWA 3TQHA 1Z5GA 1CUHA 4P54A 2QR5A 2PCLA 3UJHA 1AU9A 3NHSA 3LDHA 8LDHA 2B8EA 2Q7DA 5E9WA 3EVEA 3X1YA 4JZYA 3DL7A 2EERA 4EYOA 3B9BA 1EEXB 4NZZA 1ATIA 3AEZA 1X94A 4DMFA 5CP8A 3VVLA 1UM8A 2ZYDA 2FPIB 2P61A 4P4UA 2GBLC 1ZMOA 5DM4A 1OX6A 2J0EA 1UPAA 5D3ZA 2DB4A 2XRZA 2WFZA 4HEHA 4HX5A 4DNOA 2HCJB 3A3OA 3WLIA 5CGZA 3SQXA 1VHWA 4DIMA 3AQ4A 1YMUA 5LFAA 4JBYA 3D31A 5KOHB 1OX4B 5TEWA 4FJ2A 1H0KA 1WO8A 2WHYA 5K4AA 1I24A 3NHUA 4R69A 2QSZA 1K40A 5ICMA 4DG5A 3JTEA 1Z08A 4OLBA 3KZOA 1J99A 4MUNA 4MVWA 1R4NA 5CVVA 5DNVA 2XF8A 5FWXA 3GJZA 3HABA 4IIEA 4N6OA 4PF1A 1GS9A 1RYBA 3LUPA 1NJSA 1PL0A 2YWAA 4QBFA 5BSFA 1DKRA 1PR0A 4AZWA 2C1XA 2YYSA 4JMLA 2O4UX 3BWDD 3LCJA 4ZYLA 1OTHA 4G5GA 1RWXA 2KC3A 2CUZA 1IK6A 2P9GA 4HLUC 2G6BA 4KC9A 5L51A 3MJRA 3UB2A 5EZSA 5ITZA 2IZ0A 5F9MA 4XLPF 1GFIA 4KI2A 3B3JA 2D1QA 3SXJA 4EWCA 4MQ6A 3T7KA 1XD2A 1IBRA 4OLAA 2WJ6A 3ZY5A 2GVZC 4P4GA 5AP9A 2EIKC 2CJWA 3IFSA 1UFBA 2BFAA 4M98A 4EGJA 4BQSA 2MYSA 1HRDA 4W5OA 4X66B 4DV6B 1M5UA 1NA5A 1LU9A 1UXKA 4YCLA 2FEWB 2FAXA 2ZXPA 4GLJA 1VJDA 4FGSA 2C5EA 1HKHA 2I1VB 3C0KA 3GN2A 3BZUA 1W6UA 2VQDA 5ARCA 4QG3A 4DQXA 2YY6A 4BNIA 1KVSA 4QL3A 3AI1A 4U5EE 3CWZA 3QU4A 3PTLA 1FW8A 1OXVA 4BGEA 3WIOA 2C4NA 4RIFA 2GZSA 4GOLD 2JAUA 1ORHA 4RS3A 1E4EB 2W2MA 4ZC1A 2P35A 5DIFA 1MT3A 2VNJA 4DPMA 4ZYVA 3R24A 1SQ6A 1MRSA 3N53A 2VWHA 1YZNA 3CWCA 1JDUA 2RG7A 1Z4KA 1B0AA 2JA2A 1DX9A 2QJFA 1EXMA 3KQLA 1N3BA 3GH3A 4NEHB 4WXYB 1E2KA 3E3AA 1G1AA 1BQ4A 3CTPA 1YRAA 3O2SB 3NVAA 3AVOA 4M9RA 2E48A 3U4QB 2YWHA 5JQGB 4DLWA 2O6LA 1E7QA 1E9VA 1FJGB 2Y77A 2WD8A 4C4PA 4UEKA 1W2HA 3T3EA 3GIDA 4TSFD 1PS8A 2GXUA 1KEUA 2PWPA 3GDFA 4B4VA 3UVEA 5BMVF 4XPYA 3QLVC 1X15A 3IQIX 4G9EA 2WB2A 2XLMA 4KXWA 5DVZA 4JZAA 3ZV3A 3P9QA 3FCEA 3KPJA 4QDJA 3F73A 3OLWA 1RKQA 4Z0NA 3I39X 1HDOA 4LJRA 3UMKA 4L8FA 3L7IA 4LSMA 1V9SA 2ZSDA 4JI4B 5IP5A 3IP9A 3CCFA 4RFSB 4ZWNA 3Q3HA 4MPPA