1QZXA

Crystal structure of the complete core of archaeal srp and implications for inter-domain communication
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
432
structure length
425
Chain Sequence
MLENIRDAVRKFLTGSTPYEKAVDEFIKDLQKSLISSDVNVKLVFSLTAKIKERLNKEKPPSVLERKEWFISIVYDELSKLFGGDKEPNVNPTKLPFIIMLVGVQGSGKTTTAGKLAYFYKKRGYKVGLVAADVYRPAAYDQLLQLGNQIGVQVYGEPNNQNPIEIAKKGVDIFVKNKMDIIIVDTAGRHGYGEETKLLEEMKEMYDVLKPDDVILVIDASIGQKAYDLASRFHQASPIGSVIITKMDGTAKGGGALSAVVATGATIKFIGTGEKIDELETFNAKRFVSRILGMGDIESILEKVKGLEEYDKIQKKMEDLTLRDVYAQIIALRKMGPLSKVLQHIPGLGIMLPTPSEDQLKIGEEKIRRWLAALNSMTYKELENPNIIDKSRMRRIAEGSGLEVEEVRELLEWYNNMNRLLKMVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Signal recognition 54 kDa protein
publication title Crystal structure of the complete core of archaeal signal recognition particle and implications for interdomain communication
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Signaling protein
total genus 130
structure length 425
sequence length 432
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00448 SRP54 SRP54-type protein, GTPase domain
A PF02881 SRP54_N SRP54-type protein, helical bundle domain
A PF02978 SRP_SPB Signal peptide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.30 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) Signal recognition particle, SRP54 subunit, M-domain 1qzxA03
1.20.120.140 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 1qzxA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1qzxA02
2FWRA 1F6BA 2F1HA 4B71A 2C9CA 1NMZA 3QE0A 3QVVA 4A0HA 1KZGB 2P3SA 3ND8A 4GOKA 3EIHA 1J99A 4YONB 4F93B 1G20E 4A15A 1ZAKA 3VQTA 1CR1A 1J90A 3KUDA 4B6EA 1KMQA 4A36A 1XPRA 3AF1A 2VP2A 4LJ8A 2HUPA 4R9UC 4FMCB 4URYR 4FD2A 4BPBA 1VG1A 3KKMA 4WXPA 3TSOA 1XTKA 2DFKB 1N6NA 4RD2A 3B85A 4RFSB 4Q4HA 1KI3A 4PC3A 3UK6A 4EUNA 2RGDA 2B7BA 2VO1A 3SS8A 1AS3A 4LK2A 1KNXA 4MGZR 1J8MF 3M1IA 1CR4A 2X19A 1ZU4A 1T3HA 3GP8A 1QRAA 3MWLA 2W58A 1VECA 1A2BA 4PSAA 3U7GA 2GJAA 1WB9A 3AF3A 3QG1A 5CIWA 2HLDA 2GETA 3CW2A 3SZRA 1ZYUA 121PA 2FOLA 5KOYA 1S0UA 1ZD1A 2A5JA 1NJGA 3GCGA 4PQFA 3LBHA 3Q72A 1P9WA 2UZIR 2VL7A 4RJLA 3KDSE 3ZQ6A 2PXPA 1JALA 4MKFA 3MFYA 3QBTA 4JVNA 4B3XA 1WGWA 1X8JA 1IXSB 4Q18A 2GF0A 4UJ3A 5JWOA 5BXQC 1BOFA 3X1DA 4OL0A 2IUSA 2IYLD 1KOFA 4KFTA 5KTYA 2NQ2C 4BZPA 1F2TA 1E9DA 3U6KA 4UNRA 2CHVA 2VP9A 1PUJA 4URZR 1CEEA 4IOKA 4NHOA 4Q4JB 1OIVA 2DWOA 2AWNA 2V54A 3G0HA 1GRRA 2GA8A 2GK7A 4UJ5A 5HE9A 1YZQA 1G8PA 1UEJA 4KU4A 3TQCA 4BFZA 5GADl 3IIKA 2GCOB 3ZLJA 2VHUA 1N0WA 1MABB 1KAOA 1U99A 1DO2A 2JLQA 2FGKA 4RZUA 1RYFA 4E5UA 2J41A 3VKHA 1HV8A 3EC1A 3CRRA 3Q7PA 5EP3A 5HR5A 1LS1A 4OK3A 2J46A 3CRW1 4GMXA 2Z4SA 4TSFD 1EFHA 4A9AA 4B43A 5CITA 2EU8A 2GVDC 1T5LA 1NKTA 4MITA 3RS3A 4LYFA 2Y8EA 2QROA 4LYJA 1SXJB 2IS6A 3AGQA 4YMVA 3QKSA 2AK2A 2Z5FA 3QSYA 4KXFB 2BCGY 1F2UA 1KJZA 1R0YA 1ZM2A 2YOGA 4MRSA 3THWB 1NNEA 4K8OA 2ZS7A 2GF9A 1KAGA 4C30A 3VR5A 4MYHA 5M04A 3ETLA 2WICA 2B8TA 3P26A 3U44A 2PX0A 4IXMA 4EJSB 1RC8A 2ODEA 3UPUA 1ZU5A 1SVSA 1G8HA 2BM0A 3THXA 2QMEA 4EPYA 2IXEA 1YZKA 2YWHA 5B58C 2WJGA 2A78A 4IDOA 3T1VA 2VPPA 1TF2A 2R6AA 4A2QA 2O52A 4L16A 2D4HA 2ZE7A 4F4CA 4JJKA 3C5HA 3LH5A 3W6OA 2ZJZA 4QGGA 4GBMA 1EFRA 3I4LA 1MO4A 2FG5A 3I5YA 4Q7JB 1Z2AA 1E2MA 1R8QA 4BLQA 4OJKA 2QEQA 2ASEA 1GNPA 3OEHD 3NWJA 1Z6YA 3BGWA 5FUXA 4DLSA 2CL7X 3O47A 3PUYA 2VEDA 5CYOA 4NYJQ 2QRNA 4B44A 4DKXA 3DHWC 4O25A 3FE2A 2PT5A 1K5DA 3EPHA 3AF0A 2Q9AA 3T5DA 3TKLA 1ZIPA 2J5XA 4GFDA 1AZSC 4AYXA 2CNWD 1WQ1R 2A3RA 4JIMA 1ZMXA 4Q1DA 1AKYA 3UMSA 2GAAA 3GEIA 4B2PA 2O0KA 3NH6A 5FBLB 4HYYA 4D0GA 1XMIA 2A9KA 2ZAMA 2OG2A 4QBHA 4K81B 4F92B 3QKUA 4BLSA 1ELOA 1W46A 4LV6A 3SR0A 1TQ4A 4Q1FA 3R20A 2ODWA 3KKQA 2IEZA 4DT1B 2ZYWX 1YJ5A 3HPQA 3BBPA 4WIAA 4NMMA 5FH9A 4CW7A 4AKHA 3D31A 1IN6A 1TL7C 1KSFX 5EE1A 2P67A 2YWFA 3Q85A 4OHYA 1OFHA 1NLYA 1SXJE 1E2KA 3C15C 1NVXQ 4AYWA 1E0SA 2NZJA 2GBLC 4H1UA 2OHFA 4P4SA 4B76A 1W0JD 4B2IA 4L4UA 5SZIA 4C0BA 2ERYA 2ODBA 1KTVA 2QNRA 1MRNA 4Q9HA 3SHFA 1GM5A 2CMKA 5TMPA 3GFPA 1DTSA 4OK5A 2IL1A 4QG7A 3D8BA 2FSIA 3OEEA 1CXZA 4NCNA 1NN3A 4LBWA 2AX4A 1YR9A 5SZKB 5G41A 4CEIA 4U7DA 2XZLA 1ZUNB 2QRZA 1IAQA 3RS2A 1HE1C 2GXQA 3CF0A 4Q19A 4JLJA 1CJVC 3TVTA 1RKBA 1VDZA 3CRQA 2GCNA 1AZTA 4IDHA 1N6PA 5LB2A 1EWQA 2X2EA 4GDFA 3NDPA 1T3LA 4Q9KA 1KDOA 1YZNA 2ZRAA 2V1UA 2LWIA 3NHAA 1B0UA 1KK1A 1OXSC 4JVMA 4A6PA 4TTRA 1JQJC 1GRQA 3RVBA 1EFUA 6Q21A 3OAAA 1KSHA 1G3RA 3BE4A 4TMKA 2WAYA 4LPSA 4A8JB 2GJKA 4PANA 1HY3A 2XZPA 3E70C 2W2XA 2H5EA 3MMPA 5CB8A 1QVRA 4HLDA 2YKGA 4B75A 4D80A 2P6UA 1FZQA 2F1RA 4QC2A 2OBLA 3ND9A 2ZJAA 2OBNA 3KB2A 2VP4A 3FMIA 3ZD6A 5CK5A 1OH6A 3NEYA 2AN9A 3QEOA 3NG1A 3WBKA 1ZM3A 1G6OA 1RRGA 3WXMA 3PUXA 2QGZA 1IBRA 1XXHE 2W6JD 2C2HA 1GIAA 5ELXA 1NJFA 4QHTA 3VHLB 1VKJA 3BS4A 3I8SA 4KFRA 4V0ME 3AVTA 2ZEJA 5A4JA 1OIXA 1Z29A 1ZIOA 4PHGA 2WIBA 3ZS9A 1EFCA 1XXHA 3RS4A 2MSDB 3ZVLA 4LPKA 4QOSA 2G1KA 3HU2A 3NVAA 4V0MA 1DARA 1U90A 2BBWA 4TLDA 4I1OA 4FMDF 5DHAA 1Q1ZA 5JFGA 2XGJA 1W4CA 3WYFA 3N2IA 3UMFA 3SI7A 1DG3A 1ONBA 5JEEA 1PZNA 1ZNZA 4G5RA 1COWA 4NYIR 2CLSA 1P9RA 1CJTC 4I1VA 4I99A 1G6HA 1GDDA 1Z22A 1Z0JA 4JYCA 4Q03A 4PC1A 3W3ZB 5KPDA 1SVKA 2HCJB 5A0FA 1G4AE 1XEWX 4TQ9A 1QVAA 3C16C 1TQ6A 3C14C 1OLOA 4BUJA 5KUTA 4KYUA 3IBYA 1BMFD 1S9HA 1ZNWA 1YU9A 1V5WA 1QHHB 1W4AA 1XD2B 4OBEA 4DSUA 2AFHE 2XNDD 3AKYA 4PZZA 5J4LA 2VHJA 2QA5A 4ACAA 1CJKC 5EE0A 2GEUA 4XTRA 5E7IA 1R6BX 5IK2D 3A1WA 2DY1A 2PEYA 1Q1QA 1U2RA 2JDIA 2XTZA 2JLYA 2EWVA 4DBLC 3EPLA 3A37A 2B6HA 5JWRA 1EFTA 3G5UA 4P31A 3CO5A 2WJIA 1NL3A 1KI6A 5C2JB 2ZE6A 4R98A 1OJLA 4OI4A 2D7CA 3U5ZB 5FI1B 5K8UA 2ZETA 2ZS8A 1E0JA 1G1MA 4AWXA 4LOAA 3VAAA 2JQEA 2YVUA 1ODFA 2ZRFA 3THYB 3CZPA 4B32A 4DJTA 5IDVA 2XXAB 2Q3HA 5EJEA 4YDHB 3BERA 4OI1A 4WAUA 2OAP1 5FL3A 2BMEA 3DO6A 1SVIA 4KJZA 2VP5A 1E2PA 4KODA 3SJZA 1W47A 1NG1A 2B92A 2R6CA 1ANKA 1AS2A 4MKIA 4AKEA 1TPZA 1DPFA 1Q1EA 4LV8B 1S4QA 2KI5A 4MKGA 5AR1A 3QOFA 5FTNA 1UKEA 3I72A 1DOAA 2XNSA 5GVRA 4AURA 4DDWA 5KNBA 2G3YA 3SBDA 4HB3A 3SC3A 4B3CA 5KHOC 1Z2CA 2H16A 3KKOA 4LC0A 1VYTA 3PFIA 1NIJA 1OT3A 5AUQA 4DCVA 3NDBB 5DI3A 3QPWA 3TK1A 4M1TA 2C03A 3THOA 5CM8B 2ZUBA 3K9HA 4PC2A 2JLSA 1IN4A 3CWZA 1MFQC 1NP6A 1R0WA 4DUGD 4DCNA 1N6RA 4DLZA 1P60A 3AVYA 4PAMA 3U3JA 4BEJA 2DR3A 2G0NA 3TNFA 3K09A 3A1VA 4LJ6A 1GOTA 1IHUA 3AEZA 4NTZA 1JBKA 4QFMA 4PC6A 1W7AA 2IUTA 1Q57A 3A1TA 4JLNA 4B3FX 5JEDA 3QXCA 4QKQA 2O8FB 3LVRE 2WSMA 1FX0A 1Z0IA 1C1YA 1S3SA 2VH5R 1Z0KA 1I2MA 1SXJC 4XD7D 4JSYA 5CK4A 3AKEA 3IEVA 4KFUA 1W48A 3PR1A 3FFAA 5TARA 4KLNA 2IEYA 1FNNA 1OXTA 4RSGA 2QAJA 4DLYA 4BGDA 1BS1A 3RS7A 4Q7LA 2F7SA 2W0MA 5AJXA 1FQJA 1EXMA 5FPYA 3B7GA 2NZ8A 4G01B 4ARZB 4KHZA 3HR7A 1GAJA 5FOUA 5G53C 1H8EA 1IN7A 4Z1MD 2JJ8A 2JLVA 1YE8A 2B8WA 2WWXA 4DLWA 2FFAA 2RHMA 3SJCA 2BMDA 4HZIA 1ESMA 1H8HD 1NVWQ 2QE7A 2XXAA 1HA3A 1FP7A 2DHRA 1P2UA 1UADA 2GVZC 1NN0A 2EFEB 3S1AB 1EWRA 3KTAB 1BYUA 3U60B 3IIMA 4U5XA 1PLLA 4FN5A 3HJNA 3NIBA 1EX6A 3K70C 2V3CC 5IRCD 4C3ZA 1G18A 2GXSA 4E03A 8OHMA 4LHXA 2JIZD 1UM8A 2WMNB 4RCYA 2PXLA 2H17A 4W7SA 3A4NA 3SDZA 1DADA 2WAXA 1KY3A 2IW3A 4OKSA 1IN8A 5JCZA 1SVMA 2GJ9A 3KJGA 5CJPA 3SFZA 1FP6A 4TL8A 4A2PA 3VR1A 1WA5A 3EC2A 4KSCA 3NC0C 1PV4A 4IDQA 1CJMA 3IO5A 3PEVA 2D06A 4XWKA 4RZ3A 5HE8A 2MMCA 1F5NA 5FPHA 4A0FA 1ZCAA 3Q5EA 2KSQA 4C0JA 2QY9A 5DYGA 2GXUA 5C1BA 2GXAA 1DE0A 5KYKA 2FEMA 1NY5A 4EPWA 1GKYA 5FUVA 2ZRIA 3BB3A 3BXZA 3MRSA 3VU9B 2J9RA 1DBSA 4AYTA 2AR7A 4WVFA 4CT5A 1VCMA 5LDDC 4HLUA 3HYRA 2G88A 1GTVA 3BIFA 2BHRA 2YC2C 3L43A 1E1RA 3TRFA 1AJEA 2HEIA 4C0QC 1XTJA 4OHXA 2OO7A 3OHMA 4JLOA 2CCKA 1CF4A 2C77A 2HF9A 1XBTA 2ZROA 1Q0UA 5AK0A 2A30A 4TMTA 2ZU6A 4KCGA 1XB2A 2W6ID 1FFHA 3UWKA 4TYWA 3MGCA 5DN6D 3QI2A 4EQ6A 4FW9A 4URUR 4A4DA 3B5JA 3CR7A 4YMSA 4EFLA 3W9YA 4ARZA 3C41J 4V03A 3R9IA 3R9XA 2BWJA 2QQ0A 3KQNA 1Y63A 1KJWA 2A5FA 5HCIA 2P6NA 2ZUCA 4PSKA 4M1SA 3U7FB 1DEKA 2XOKA 3HDTA 4PR0A 3RHFA 1XZQA 2ZRLA 4JLPA 1J2JA 2JJ1D 4KI0A 1MKYA 5FUYA 5AWFC 1D8TA 4TLEA 1IN5A 3TVDA 1KO7A 3WMGA 4Q4AA 2ZJBA 4Q4HB 2CLDX 4BFVA 4MRNA 1CRPA 2F6RA 3NEJA 4O2RA 2UKDA 3AF2A 4DWJA 3B60A 3AVQA 3UG6A 2JATA 1Z3IX 4A8JC 2IYSA 2RKOA 1JJVA 3CNNA 4XJXA 4NH0A 1E9EA 4A6XA 5JECA 3PV0A 4V0NA 3FHOA 1RVDA 1FUKA 5GJWC 1P7CA 3AKDA 4ERNA 5DGXA 3AUXA 1D6JA 2YYZA 1Q3TA 4YMUA 1XPUA 1OH8A 1P9NA 1Z28A 4DSNA 3FMFA 2FNAA 1G41A 5FTJA 2IS1A 1X1RA 1NY6A 5BN4A 1NG9A 4M2LA 2DB3A 4DHEA 3SJAA 3T35A 2WZQA 2XAUA 1LW7A 4I81A 1E1QD 4PZYA 3GJ3A 1YKSA 4C0HA 2O8BA 1F2TB 5FFMA 2GZAA 1JXMA 4IDPA 3CH4B 1Z0AA 2ZYUX 3SHWA 2WPDA 2Z0MA 3H4MA 3TAUA 1XCGB 2AD5A 3A6PC 4G3XA 1T3SA 1NBMD 1E4VA 3VX4A 5FUWA 2WKRA 3H1TA 1NVVR 3KQKA 4QGHA 2GILA 2JLUA 5JBQA 1IONA 1WCV1 3EPJA 4HAUA 4MYUA 1YR7A 4PO8A 5FPKA 1SXJD 2VHTA 1Z5ZA 2ZRPA 2ZJ5A 4LBVA 1GL7A 3CB4A 3QKRA 2WV9A 1Q21A 4IKEA 4EKDA 4BFTA 2YHSA 1KO8A 2FPMA 2GEVA 3CUEF 4WZ6A 1P75A 3K09C 2FSHA 1E9CA 3OE7A 2QT1A 4PHTA 3SN6A 4D4LA 4CF7A 4DZZA 3DOEA 2ZVPX 1OB5A 1W2HA 4ON9A 1XTRA 3QKSB 3FKQA 2WWWA 1F2UB 5DH9A 3CZQA 1X8KA 3T34A 2OT3B 5JRJA 1XPOA 1OB2A 2JLZA 1NN5A 1XMJA 5CYPA 4HZUA 3K0SA 3U44B 3AVVA 1S2MA 1L2TA 1XEWY 3QF4A 1QG2A 3ADCA 3I62A 2QPOA 5FL7A 2ZRGA 3THXB 1PVOA 4E07A 2PJRA 5K8IA 3GLHE 2H1LA 1TADA 2H7VA 3GLFE 2IX3A 3K70D 1Z08A 4BZQA 1XJCA 4M9ZA 2TMKA 1XJQA 1Z63A 1KI1A 4C0LA 1T91A 3AB3A 1XD9A 2Q3FA 2OFWA 4QNRA 2I4IA 2JLRA 4WOPA 3U6BA 2OAQ1 3GLHA 4WBSA 2VTKA 5EXTA 3CNOA 2W2TA 3E1SA 3U7HB 4QM7A 1CRQA 1E98A 1N5IA 3GLFA 2PJZA 1II8A 1GFIA 2EFGA 3C8UA 2VF8A 2IYVA 2QMOA 3LV8A 3B1VA 1VCNA 3PUWA 4IRUB 4C0KA 5G40A 2P65A 4DLUA 1BH2A 2F43A 4ZIRA 1KNQA 4DVGA 5SZJA 4W5JA 3LX5A 4TL7A 5J4YA 1AK2A 5J4KA 4UNQA 3RRMA 2EW1A 3VR3A 1LY1A 1LS6A 3B1XA 4NBSA 1PLKA 4RD3A 4EPRA 2ZI4A 1Z6XA 2EFDB 4IEEA 2WOOA 3I32A 1VMAA 1W36C 5KDLA 3LFUA 3ZVMA 3B78A 2ZRDA 3QNUA 1R2QA 2ZRCA 2DCUA 4M1KA 3T15A 1XCPA 2IF2A 2CBZA 1YRAA 3AVOA 2JJ2A 1N6LA 5JJKA 2R65A 4LV5B 3RRNA 1XFAA 5BYKA 2KBFA 4DCSA 1H65A 2ZSDA 2OM2A 2V7QA 4NYIQ 1G3QA 2VRWA 2PXBA 1U98A 4PPFA 4CYMA 2QT0A 1BIFA 1OYWA 2LCFA 2QENA 5CM9C 5E4FA 1Z0FA 2PX3A 4RD6A 5FPSA 1HQYE 4R2HA 2CJWA 4TZ0A 3KJEA 2PXTA 4R71A 4P4SB 2C78A 1QHNA 2G0TA 1BYIA 4Q4LA 1G3IA 4UNPA 2A7QA 5JCPA 2R6FA 4NL4H 5KPJA 4AI6A 5EUMA 2OCPA 2HDNB 4QRHA 3EIQA 3QVUA 2QTFA 4JLBA 3KKNA 5JI2E 3J81k 1FTNA 2FV8A 1G5TA 5EP2A 5EXXA 2CE7A 3L0PA 3EAQA 1U94A 2FEOA 3EWSA 3EZ9A 3I73A 4JT4A 2R62A 1N5KA 3QBVA 3LLUA 2NTYC 3EZ2A 1E2GA 3IBGA 3SEAA 1OXUA 2PMKA 1EK0A 2VA8A 5LPNA 4CEIB 2GJ8A 1FPMA 2R6GA 2G9NA 2RCNA 3FFBA 1ZUIA 4Y0VA 1CLUA 1W5SA 1OXXK 4PFSA 4CVNA 1ZM7A 4FXPA 1ZD9A 5C4MA 4DRZA 3F5FA 4OK6A 1UDWA 3AV0B 3DKPA 3CX8A 4JSTA 2CCJA 2EFCB 3B1ZA 2PZEA 2W2VA 4QJ4A 4LY6A 1NKSA 3FKSD 2BIFA 4U00A 4UKDA 3GQBA 4BFYA 1L4UA 2PXVA 4URWR 1E2HA 3L2OB 3GLIE 3QXHA 4FWTA 2J1LA 5E3HA 2Q0HA 2WHXA 3BRWD 3L8ZA 3VR2A 3P32A 3K70B 5HZKA 2GAOA 3FHTA 1XX6A 2CLCX 3RYTC 4GMDA 4PPQA 4OHZA 3GLIA 2AHOA 2IYQA 1TEVA 1G21E 2GCPA 3CM0A 4JVLA 4BLOA 1XRJA 4WW0A 3QUSA 5JS8A 3B8HA 1T8UA 2CDNA 5BYJA 3R8CA 4OQFA 2GHIA 2A2ZA 5KDOA 4GT1A 1X1SA 3QEJA 4OI2A 4M4SA 3B2EA 1U9IA 3PG5A 2A5YB 4L5BA 5KNDA 2XSZD 4FMCF 1ZM9A 1E9RA 3WBJA 4B34A 2C96A 3LA6A 2AD1A 1IY2A 4TTQA 4F4JA 4K46A 2J0QA 1XXHB 1VTKA 2ORVA 2ZRJA 4B48A 4C7OA 1HT1E 1Z0DA 2YV5A 3VFDA 4KITB 2HT6A 4US1R 5J4VA 5GJVC 5JSZA 5FTMA 3HU3A 2VSOA 1RYHA 3TJZA 3BAFA 2AXNA 3ZZ0A 1Z8FA 1G5RA 4Q21A 3VR6A 4A0RA 4KFSA 1US8A 4JKYA 4PPGA 5FOVA 1TTTA 1AN0A 2B21A 4JLVA 3ZQJA 4DXAA 4YQFA 2RGCA 4ZDWA 3W3AA 2F1JA 4GPTA 3TR5A 2HV8A 1KO5A 3BORA 2FFBA 3L0SA 5JMTA 1O87A 1N6KA 2RGEA 1T6NA 2HCBA 4KBFA 3VX3A 3ICQB 3PENA 1FTSA 3P1JA 4KAXA 1W0KA 4BQSA 2ONKA 4P32A 1E69A 1U0JA 4ASUD 4NYMR 1F3OA 1RRCA 4MA4A 4TWZA 3V00A 4GOXA 2QSYA 2VBCA 1FNMA 3REFA 2QAGA 1GUAA 3HP1A 2QE7D 5DSZA 2V4ZA 4OHWA 1KI6B 4O3MA 1UFQA 2KJQA 2ORWA 5D3MA 3ICEA 3P4XA 1LVGA 3NBXX 3WP1B 3EXAA 4AD8A 2GESA 4TT3D 2GWHA 2RAPA 2C98A 4CIDA 2BC9A 4EPTA 1LB1B 2ZRKA 2J0UA 1CS4C 2VQSA 1HE8B 1G8FA 1R5BA 1T9HA 2UZ3A 1QZXA 1G19A 2WWHA 1TU3A 4CDGA 4J0QA 4N0DA 1L4YA 3IQXA 4RD1A 2CCGA 2YZ2A 4OYHA 1YZUA 1IOZA 4HEJA 2VHQA 2R8RA 2ERXA 3ZVNA 1TX4B 1DAFA 5DE3A 1OFUX 2ZI3A 2O8DA 2NO6A 1BKDR 4KO8A 2WBLC 1UBCA 2VHCA 3FMPB 2QP3A 4LRWA 4WZAE 2B7CA 3TGPA 2V55B 4LCBA 3KXKA 3SQWA 2RB4A 5DI3B 3NC1C 1WXQA 2YJTD 3IDQA 3LQQA 2P2LA 1MO5A 4HB0A 2BDTA 2ZJYA 5DO9A 4LHYA 4TQUS 3NTUA 5IHPA 3KB1A 4Q00A 4MH0R 1E2FA 2VIIA 3OIWA 5DHFA 3CF6R 4TYNA 3FDIA 4HUQA 2ZSAA 4EFMA 1KY2A 2G6BA 4TN1A 2W0SA 2YWEA 2PL3A 4CZ2A 4G0NA 1QDEA 1ZUHA 3M6AA 1AM4D 3WNDA 1YZTA 4XWOA 2PZGA 4JL6A 1SVOA 2L0XA 2REXB 4HUTA 2N46A 3OFND 5FTLA 5A5GA 3RRZA 2GKSA 4CEHA 1E2LA 1QB2A 1FX0B 2HXYA 4RCZA 4PAQA 4QHSA 2P0EA 1JR6A 1CBUA 1IY0A 4FCTA 4JT2A 1N0UA 4LGMA 3ZZUA 2KE5A 1OH7A 1KI9A 4Q9JA 1KKMA 3KXLA 2DWQA 1G8YA 5KO2A 1JEDA 2OE2A 3EIEA 5H70A 3RLFA 3AGPA 2XOKD 4M8NE 2QTHA 1KK0A 2X2FA 1NLFA 2QN6A 5B64A 2AK3A 1XCMA 3CRVA 5JI3E 3CR8A 2Z43A 4P33A 4BFXA 4TSFA 1XTSA 2CE2X 2NMVA 1CKEA 2BBTA 1XEXA 1OKKD 2H8KA 1M34E 4HATA 3E2IA 4PHHA 4MDFA 2J7PD 2RGXA 2PH1A 1RJ9A 4UXHA 4S35A 1W4BA 4ZV4A 1SKYE 4GOJA 1P62B 4JBXA 4LZZA 3W34A 1KGDA 4P4UA 2GDJA 1GKUB 1VHTA 2WWGA 4QJ5A 2IXGA 5DI9A 3IGFA 4TYYA 3DVLA 2YOHA 2ZE5A 1SVWA 2JLWA 4LHZA 4B47A 2Q3MA 2ZXUA 1QHXA 2BEJA 3CPHA 1Z6AA 3M0EA 1XWIA 1U8AA 3RS0A 3R9WA 3K0FA 2DBYA 1G3UA 4UXJA 1TUEA 4QBFA 4QGFA 1OHHD 1GNRA 1W36B 4RFVA 4XSGA 5LB4A 2CK3D 1Q22A 2XB2A 2O8EA 3GD7A 2MSEB 2QBYA 4X8HA 1L8QA 2JAQA 3GFTA 5C46F 4HAVA 3W8NA 1NLZA 3IHLA 1HQ1A 3LBIA 1EG7A 3LO5A 3OEHA 4XSHA 4YLGA 5EUQB 1U0LA 3QPVA 4Z8YA 1JXOA 1NN1A 4MKHA 2HXSA 4MQBA 4ZKEA 3TQFA 4DCTA 1U9IC 2IA5A 1DELA 2GJSA 1M8PA 1NVVQ 2J59A 4OQXA 3RRYA 1JJ7A 5J4HA 5K8LA 3X1WA 2ONJA 4Q7KA 3I1FA 1P73A 2C8VA 4TL6A 3TH5A 4AK9A 1W4RA 4RZ2A 3GJ0A 3EZ7A 2F55A 2GRJA 3QXJA 3RABA 3VNVA 4GZLA 1DAHA 3X1YA 3JZMA 5CJ2A 1M6NA 5FTKA 4NE2A 4V0OA 2IYXA 4ZDIA 2HJVA 3PITA 2GTPA 4WZBE 3ZZTA 2DFNA 1GKIA 4KVGA 2X1VA 2PMDA 5TDHA 2QSZA 2HJGA 1M74A 3N2EA 3LAWA 4KLZA 3VTKA 3DPUA 4M53A 4Q66C 3WY9A 5B57C 3WHLA 3QF7A 2ODNA 2FF7A 3K9NA 1Q1BA 2QMHA 4HAYA 3IPYA 421PA 3PVSA 1R4AA 4NCIA 3SE0A 4PPNA 3P20A 4LI0A 1DAIA 4B73A 4EQ6B 4YXWA 1I2DA 1F60A 1VG8A 4EDHA 1W0JA 1R10A 4DSTA 1OIWA 1P6XA 3SYKA 2C5LA 1MO3A 1T8TA 4M9XA 2C04A 2V9PA 2IWHA 2HLDD 2BEKA 1TU4A 3DOFA 1LNZA 1R0ZA 2R44A 3W6PA 3NKVA 1QG4A 1ZVQA 2A5GA 1E2DA 2N1BA 4QM6A 2QAGC 1AKEA 4Q4AB 2CHQA 4EFNA 1G7CA 4PAOA 2O0HA 3MSXA 3I92A 3DM5A 1MH1A 4JL5A 1G64A 4ESHA 1DAMA 2BOVA 2H92A 2KBEA 3GEHA 5JJLA 221PA 1XF9A 1ZP6A 4F38A 1TF5A 4W5HA 4B33A 5G3YA 3F8TA 1Z47A 1VIAA 2E1RA 2EYQA 3TSZA 2BVNA 5HZHA 4OQLA 4W5WA 2AL7A 3BJIC 4C2UA 3UXMA 4RKFA 3TMKA 3REGA 4PXAA 2P5SA 2QG6A 3A36A 4TYQA 2JGNA 3RANA 4L9SA 2E87A 3QJYA 2JJ2D 3KL4A 2NOAA 1SKQA 1OSNA 1P61B 5KSYA 1JPNA 3MCAA 1RE0A 2P6RA 1M2OB 4CEJA 1LFDB 2QL6A 3AKCA 2ZM5A 2GK6A 2O8BB 2VP0A 3K0AA 3EA0A 4ITRC 2PBRA 4Q01A 4TMWA 2PCJA 4ACBA 3ZIAA 5EQTA 5TY0A 1P72A 4TMXA 4HB4A 4JL8A 1CIPA 4M9SA 3CPEA 1ZC4A 3UATA 4BFUA 1KSJA 4IXNA 3FOZA 1CTQA 1SZPA 2CEAA 3IO3A 5BWMA 2W6JA 4BECA 3QKRB 5IF9A 3ADBA 2C9OA 3MAAC 4LYAA 2BMJA 3VHXA 2REBA 3OESA 1N0VC 2E9SA 4OHVA 1QF9A 3RC8A 2ZVQX 1C4OA 1W5TA 4C4PA 2DPXA 2CL6X 4YMTA 1XDBA 1HT2E 2NPFA 2OCYC 4TYPA 3KXIA 4OI0A 4TL9A 3T61A 4HAXA 4AC9A 4C2TA 3U3KA 3NXSA 1XTQA 1XNJA 4DLTA 4E22A 4L8GA 4TQAA 1UBFA 4JLDA 2QTVB 3UMRA 3UIEA 1U8ZA 4MGYR 3HPRA 2O5VA 4HZUB 1KZ7B 3T12A 3U61B 3QF4B 3ZD7A 3KQHA 1EFRD 2D3WA 2ZRNA 3SYNA 5L3QA 4ZI3A 3FYHA 5FR1A 1II9A 3LY5A 2ZTSA 4D82A 1KMHB 1TQ2A 2FFQA 1BMFA 1WDTA 3A1SA 3X1XA 3ADKA 3BFVA 2O8CB 2ZYVX 2XNDA 1J8YF 2RGGA 4F4IA 3GLHB 3BH0A 1HTWA 3LW8A 3QXSA 5IK2A 4MDEA 3GLFB 3VMFA 1M1YE 3SJBA 1II8B 1N2CE 2LKCA 3ZH9B 3Q7QA 1NRJB 3CPJB 3WRXC 3IHWA 4G5SA 5GAHi 4RVCA 3V4FA 1G7RA 1LV7A 4UXIA 4D4KA 1TUIA 1U81A 2F43B 3K8YA 4TMVA 4ZIRB 1Z6TA 2C95A 4IW3B 4KV9A 1WBBA 3BOSA 5HTKA 3D6TB 3U2QA 4ZDKA 2OCBA 1FOEB 4POAA 1Z6GA 3GMTA 2V6JA 3R7WA 2FFHA 1G17A 2BBSA 1O3YA 3K9GA 3EARA 4DEXA 1B23P 1KJYA 2G83A 4RD0A 4ZPXA 4IJMA 4O2LA 5AJVB 5JHHB 2BM1A 3L0IB 1NSFA 4QNMA 2IYYA 4PO1A 2IK8A 2WWFA 4H9GA 2O0JA 4MRVA 5AJYA 3KQUA 4IVPA 1NMXA 4YMWA 1E2NA 3MG9A 3EZ6A 2WSSA 1S96A 3WNCA 1KI4A 1E0AA 4D6PA 3E5HA 3B9QA 2ZAOA 4Q1CA 1T0JB 2CJWB 4X8LA 3NBYC 5D3QA 3CH5A 1ZM4A 1UBGA 3GJ6A 4JMPA 2VSXA 5ANRB 3OEED 2XJ4A 4LHVA 3F0TA 3AUYA 4FWIB 2XITA 4RD4A 3X2SA 1JB1A 1AGRA 5C4GB 4Q1EA 2RGAA 4DUGA 2OV2A 5E7JA 1V43A 1W49A 3Q5DA 3PEYA 1NMYA 4IHQA 4JBYA 3KFXA 4OJQA 5LD2B 5C18A 4NYMQ 1WRBA 1D9XA 2ECKA 1WP9A 521PA 2HT1A 1MRSA 1KO4A 2WJJA 4LDJA 4M21A 2NIPA 2X77A 2FZLA 5HKKA 5P21A 4US2R 1XEFA 5J5CA 3B1YA 3GLGE 2ANBA 3OAAD 4AKIA 3OZXA 2OXCA 1KMHA 2AKYA 1G7SA 4HI0E 4IVRA 4ZDJA 2X8AA 3RWOA 3PUVA 4G5GA 1UPTA 1IXRC 3NBFA 1A7JA 2VF7A 2O8CA 1AQYA 2WWYA 3LRPA 4PTLA 2ZU0C 3JZAA 4XD7A 3TBKA 5BW8A 3GLGA 3U4QA 3LDAA 3DMNA 3WNBA 2JCSA 1CJUC 1PJRA 3HU1A 3M4YA 4JJZA 3QQ5A 3A4LA 2EFHB 1JI0A 2FMXA 3GJ7A 3TR0A 1M7BA 1P4SA 2RGNA 1G8GA 2ZJOA 3IKJA 1U8YA 2FPLA 4B3BA 2ZE8A 4MRPA 2QP9X 4D81A 1OH5A 2I1QA 2OILA 4BLTA 3DZ8A 2G1JA 1KIMA 4LJ5A 1UKVY 5HPYB 3MJRA 3RDPA 3GLIB 2OEPA 1D9ZA 4Z1MA 2ATXA 4M1YA 3T5GA 4YC7A 3AM1A 3FHCB 3VR4A 3I5XA 4HDOB 4ZCIA 1I4LD 1H8HA 1E2EA 1MOZA 1FW6A 3PXGA 4RKEA 4GRAA 4P3YA 1N3BA 2IHYA 4DB4A 2Q21A 3MWKA 3LQXA 1KO1A 4Z54A 1P2VA 3RNLA 2GEDA 1E2QA 2ZYTX 3QENA 1UKYA 4FMBB 1A82A 1Z83A 2Q9CA 1COWD 2K5UA 1R7RA 2JIZA 5L3SA 1GL9B 1S9DA 2NGRA 5KSPA 4D0LB 4C7OB 2ZRHA 1GVNB 3W6NA 4M1WA 1J70A 3WYAA 3K1JA 2ZI5A 1E9FA 3WHKA 1E9SA 5JSZB 1A5TA 2ZUDA 1DAKA 2JEOA 4QJ3A 3K0CA 4HLUC 4DDUA 4AG6A 5JRZA 3V4RA 4FINA 5AUNB 2QQEA 1UEIA 1US8B 4GP7A 3B13B 3BD9A 2WOJA 2ZIAA 3L0OA 1D2NA 2DWPA 1N25A 1OYYA 2ZR9A 5JZVA 3DM9B 2JDID 2ZI7A 2QUZA 4BLPA 2MMGA 2GZDA 1E2JA 1XJ0A 5BQ5A 2AXPA 4LSGA 4ZCLA 2H57A 1KK2A 2J3EA 1KK3A 1G3MA 1S1CA 3FVQA 2BKUA 2IF0A 2J7KA 2ZSFA 4BRUA 1CR0A 3JVUA 3BH7A 2IUUA 1RFLA 1TQDA 2GNOA 1E79A 1G9XA 5FOWA 4XH9B 1CULC 3ZYCA 1R0XA 1GZSA 3EW9A 2J0VA 5CDFE 1E99A 3UWOA 2NO9A 2QAGB 5UKDA 3DKVA 2AWOA 5KDDA 2HYIC 3WP0A 2PZFA 2WIAA 1P2SA 4UNSA 3TLXA 3A58B 1AIPA 5D3MB 1NSTA 2FJUA 2D2EA 2W6IA 3IUYA 3AP3A 5CDFA 4BFSA 1JEEA 3BC1A 2IS4A 5DN6A 2IWRA 1ZW6A 1DO0A 1ZBDA 2FN4A 4RFSA 1XTIA 2F9LA 3C4JA 4LWZA 5FOXA 3ZVRA 1JPJA 4HB2A 1E9BA 3LX8A 3QIAA 4M22A 2J0UB 4V0LA 3P4YA 4QXAA 621PA 5CLLA 3ONWA 3W5IA 4FMDB 4LC1A 2BKEA 1VIYA 5EE5B 1I4DD 1JR3E 2ORIA 1DG1G 4MYTA 4Z8XA 4D4JA 3N5CA 2JJ1A 2Q6TA 4A92A 4LBZA 4D2IA 1VCOA 4IVQA 2A5DA 2ZJ2A 3D3QA 1G291 1JR3A 1AQUA 1XMSA 2VP6A 1GNQA 3BWDD 4TMZA 4UNNA 5AUPB 2O8DB 3V9PA 2CVFA 1ZCBA 5FI0B 1K5GA 4UQOA 4PQYA 3LW7A 3FPAA 5B30A 1N6OA 4R7ZA 1KI7A 1K6MA 2YWGA 1ZD8A 4ZKDA 2G77B 1RRFA 4MGKR 4BZXA 4I1UA 4X8MA 3KJIA 2R2AA 4XVUA 1OFTA 1AS0A 1D2EA 3X1ZA 2ZS9A 3GJ4A 3NBZC 4RY2A 5CB6A 4GZMA 4ABYA 3QG5A 3GPLA 4Q4JA 5FBVB 4P4TA 2OXRA 5TV2A 2ZRBA 2F3RA 1VG0B 1CR2A 3K0EA 1E1QA 2GCOA 2NO0A 3ZDQA 4AIIA 1MABA 4HUQB 4GNKA 1QBKC 1NBME 1FL9A 1HH4A 5EXPA 1N6HA 5CLQA 1QHYA 2IYWA 2QI9C 3B9PA 3G82C 4LJ7A 5JWHA 3WMEA 2C99A 4RZXA 5SZHB 2XB4A 3O8RA 3I8XA 1TNDA 2QORA 2V6IA 4NDZA 3W90A 2W83A 1G5PA 1VCIA 3OIYA 5AJWA 1NBMA 5IT5A 1II0A 4YXWD 4CEHB 1WF3A 1XZPA 1UKZA 2N42A 3A1UA 4A2WA 2BBOA 3KFVA 1KDTA 1SHZA 1L7VC 5EE9A 1SXJA 2EQBA 2ZANA 1DULA 1E94E 1RIFA 1H8ED 3ADDA 2QMUA 4JLKA 5FR2A 3BFXA 3KQLA 1F48A 2PLRA 3AP1A 3W8RA 3THWA 1SQ5A 1G4UR 3QY0A 2WJVA 4XWAA 4JKIA 2F3TA 3EX7C 2ZSBA 4NKRA 1TEXA 4L9WA 3DMDA 2WKPA 2PXDA 2BJWA 3AVUA 4Q5IA 3SU8A 1IM2A 4TLBA 4EJSA 3UANA 2OSBA 3AVWA 5BN3A 1FUUA 1XEXB 5K8TA 1RJ9B 3H86A 3TSWA 1ZNYA 3Q9LA 1XD8A 2YOFA 3T1OA 4BLRA 1XMVA 1YRBA 3I61A 1Q3HA 3I3SR 4LBYA 1M7GA 3CLVA 4C0SA 1NVUQ 1W36D 4N3NA 3CF2A 1E32A 4TLAA 1KHTA 1CP2A 5FBQB 1SKYB 2CVHA 4BEBA 1SULA 1ZNXA 1YZLA 2Z4RA 3C5CA 2AFIE 1UDXA 2UVQA 2FH5B 2RGNC 2V1XA 1QHGA 2XJ9A 4NONA 2WVJA 1UAAA 3SYLA 2F9MA 3O8BA 1S1MA 3ASYA 3K0FB 3QXXA 4GP6A 1QHSA 4HDQB 5FBWB 3IEUA 1T0HB 1ZINA 1OXVA 5DIFA 3W5JA 1OW3B 2O8EB 4BWYA 2ZRMA 2QBYB 2IBMA 5B2ZA 3ZIAD 1HEIA 2D7DA 2BJVA 4BFWA 3A8TA 1E96A 3LWNA 1LTQA 3GFOA 4PX9A 3CONA 1N6IA 4Q47A 1N5LA 3B6EA 4MUAA 1I4TD 1YZGA 4IFEA 2RMKA 2YC4C 2YNMA 5BN5A 1Q12A 1E1RD 1LF5A 3AF4A 3AQ4A 3FWYA 1QHIA 2J0SA 1MT0A 2FZ4A 1YVDA 1JECA 1N5JA 4DT1A 3SFVA 1U0HC 3GEEA 4GSYA 5EZ6B 2EVWX 1Q20A 3L82B 3TUJC 4IFBA 3T1TA 1IJEA 2Z6VA 3OF5A 4JYBA 4WXRA 2REOA 2WJYA 3ASZA 4IOMA 2IYUA 1OF1A 3K0CC 2FU5C 2R6DA 5TB5A 5JS7A 3KUCA 1S8FA 2IYRA 3QKTA 5EP1A 4PZLA 1JAHA 5HCNA 4D26A 1OPXA 5JJIA 5LD2C 3RS5A 4A82A 4WA7A 2R9VA 4FCVA 3TE6A 4U02A 1M7HA 1GSIA 3AH8A 2PLFA 4DLRA 2ZQ5A 3AVPA 1PLJA 4YDSA 3FMOB 2PCLA 5KSOA 3BK7A 4W9MC 1D2MA 1VYUA 2J45A 1JAIA 4NCKA 1X3SA 4ZO4A 4LUCA 3CX7A 2VLIA 2D62A 3SQXA 2P5TB 1D5CA 2FPKA 1X8LA 2ZITA 4V0KA 2WWIA 3TUIC 3DEFA 4HAZA 2ZJ8A 4F7WA 4LJ4A 4Q9LA 5F98A 3C7KA 3LQRA 1YQTA 4Q9IA 4PO9A 1P2TA 2BV3A 3EZFA 4ILEA 2H18A 1SGWA 2KB0A 4A8JA 3AVXA 3L8YA 4EPVA 4MUBA 2WMOB 1WE2A 4F91B 4ZI2A 2JLXA 4DCUA 4NPHA 2PT7A 4AY2A 1E2IA 1CU1A 3HWSA 3OIUA 3RWMB 4D25A 2QPAA 3O8CA 4DSOA 1DS6A 3FKSA 3LXXA 4B3GA 3IPXA 3KKPA 3O8DA 1YR8A 1P5ZB 1ZC3A 2WPDD 4BASA 4AG5A 2QM8A 2XX3A 5E7MA 4QBGB 1RRPA 3KZ1E 3ECCA 3LBNA 3EA5A 3MUFA 2FGJA 4NYJR 3TIFA 2ZR0A 4QBIA 3PUZA 1C9KA 4CEJB 4D0NA 2CHGA 2QPTA 4IOLA 2WSSD 4HLQB 3WRYC 1DAGA 3K0AB 4MYCA 2PXEA 1HUQA 3NH9A 4Q7MB 3EPKA 2CNWA 4II7A 1GWNA 2HYDA 3PCRB 4HSEA 4Q1BA 4LYHA 1OFIA 3HYTA 1KDRA 3OE7D 4KBGA 1TF7A 4TZ6A 4OQMA 1KI2A 821PA 5FOTA 2QGNA 2OUKA 4DLVA 1VYVA 3U7EB 3TW4A 2OESA 3VKGA 2ZREA 1E6CA 3MD0A 4HAWA 4M9QA 2I3BA 2FA9A 4OQNA 1E3MA 4KSBA 2W00A 2XSZA 3SBEA 2FE4A 5GAGi 4LHWA 3BH6A 2BCJQ 4LJAA 2JASA 3RSLA 4I1SA 1E4YA 1GILA 4CT4B 5HKKD 1UF9A 2EYUA 5FL7D 5LBIA 1RZ3A 4HLCA 5FBRB 3PEWA 5E95A 1GRNA 1J7KA 2IXFA 4R2IA 5L3RA 2FX3A 1EX7A 2IT1A 1K8RA 1EGAA 4JLMA 2PXFA 2CL0X 2CXXA 3DZDA 4IOJA 3SNHA 3GJ5A 3TAHA 1QHHA 1XD2A 3A4MA 4X8OA 4IDNA 4XTCS 4N0EA 1HURA 4BRWA 4NCJA 3PQCA 3D7MA 3UG7A 1X6VA 4G5QA 5EZ5A 3P27A 4QL3A 3FB4A 3T1QA 3LD9A 3JVVA 5L3QB 2PEZA 3H2YA 4JZKA 1RPZA 3FGNA 3H0KA 2QM7A 4MGIR 1AGPA 5AJZA 2DFLA 4M0LA 3SOPA 1E0KA 4EJSC 3PIRA 1GG2A 2QP4A 1Z06A 4QHYA 1RW4A 3CIOA 2SHKA 2HF8A 4ASUA 4O0MA 1P3JA 1BO6A 1SHKA 4FIDA 2FSGA 4MRRA 4US0R 2MSCB 3THYA 5H8WA 1GP2A 3RC3A 4DLXA 4URXR 1XU4A 1R5OA 3DDCA 5KSZA 4LX0A 2PXUA 4E09A 1A1VA 3MJHA 1MR3F 4EPXA 1EESA 1TMKA 3GJ8A 3NHBA 4M1OA 5TVKA 3WMFA 1YR6A 3LLMA 3ZS8A 4TT3A 5AUOB 2Z83A 3R7WB 1PUIA 1T4GA 4XVRA 5KNCA 2QZ4A 2V7QD 5H68A 1X86B 1ESNA 5L3VA 1XP8A 2D2FA 4GI7A 3BFKA 4H1VA 2J87A 4XOIA 3U3MA 4A0GA 5JHGB 4PC7A 3FTQA 1KKLA 4ESVA 4Q48A 5L8VA 2DFTA 4NCHA 2OZEA 1KYIA 1DAEA 1G16A 1Q44A 4CRWB 1W1WA 3CBQA 4I4LA 3HR8A 3TUZC 2YINC 3VKWA 4QGAA 1FMLA 4N1AA 1GL6A 3CNLA 1HQCA 1LF0A 2LKDA 4Z51A 2ZPTX 1VPLA 1IQPA 4JLAA 1UJ2A 3KJHA 4M1MA 2F1IA 1Z07A 3RSOA 4KVAA 1NIPA 1S3GA 3TW8B 1W2GA 1R5NA 5F9FA 4LJYA 3BB4A 1OE0A 2ZI6A 3N70A 4D4MA 3CX6A 3PJRA 4HDCA 1GITA 5JLJA 3U3OA 5F9HA 4CGZA 5DLQC 721PA 4DDVA 3QPUA 5FPTA 2O8FA 1E79D 5EP4A 2NPIA 2IYTA 5TXGA 2ZR7A 2AKAB 2KWIA 1W44A 4IEIA 1FMJA 1ETUA 4P0TA 2VSFA 5J47A 4LJ9A 2NO1A 2FSFA 3IILA 5EXSA 1AA9A 4G5OA 4XVQA 2PXKA 3ZJYA 4TLCA 1SVLA 2QU8A 1MV5A 3GJXC 2ZSEA 3H84A 3LXRA 3OFNA 3WYGA 4B74A 1IXZA 1DVRA 4B6FA 3KX2A 4ZCMA 2I1VB 1TAGA 5GVSA 2RH5A 3GLGB 2VYFA 2NG1A 3EASA 5DISB 3F3YA 4PSVA 3U4QB 4FCWA 4Y0AA 5GJBA 3CRMA 2XTNA 1ZJ6A 4DEYA 4JBWA 1A4RA 4L15A 1MO6A 3Q3JB 2RGBA 4C0AC 3UKDA 3R8FA 4NZYA 3U3RA 3IQWA 3K9LA 5H1YA 1NI3A 3AP2A 3MWJA 2C9YA 4PQRA 2FDCA 1JR3D 3S1AA 3KTAA 4Q02A 2EWWA 1OKKA 1R8SA 2NO7A 2GZHA 2J7PA 3LVQE 2XTMA 4BE7B 1VG9B 4URVR 3Q8XB 5F2EA 2PXQA 1OV4A 2WTUA 1JNYA 3MWYW 3BB1A 4FI3C 1T5IA 1YHNA 3EWAA 4DC9A 1FQKA 2Q9BA 2ANCA 5DNYB 5GJCA 4KYIB 3EG5A 1E9AA 3K53A 2WJHA 3OIVA 4B35A 4EAQA 1ZRHA 1G7TA 2D74A 3IIJA 4G1UC 1NF3A 5F3WB 2IC5A 4B2LA 1IJFA 2OFOA 2IS2A 2ATVA 5L3SB 4A1FA 2XZOA 3CKLA 1JQLB 4C9BA 1WMSA 4S2EA 1OHHA 4PHFA 3T06B 4GL2A 2BMFA 3DL0A 3RAPR 2CK3A 4DB2A 4EIWA 5CIQA 2RHDA 5J40A 4B3DA 1IY1A 2JA1A 3LNCA 5EE3A 4NP6A 2XEXA 4AKGA 2WM9B 2OFXA 2OLKA 3B1WA 1KI8A 3VU9A 1KSGA 1A2KC 1HYQA 1VHLA 1UBEA 2GBLA 4JS0A 4DDTA 2WKQA 4JVSB 5FOSA 2ZI9A 1W0KD 2OBMA 4DIEA 4V02A 3ZGXA 2IHBA 3VNUA 4NU0A 2DYKA 4Q1AA 2OLJA 3B82A 3CWQA 5KU1A 1Y3AA 4TTPA 4DIDA 5DYIA 4XIGS 5G3ZA 3MLEA 2OCAA 1KDPA 2IYZA 1WBDA 3PEUA 2V8OA
chains in the Genus database with same CATH superfamily
1C8LA 2P3SA 1Z38A 4YONB 2NAFA 1OSLA 3Q7GA 3FHDA 4BPBA 1JZQA 5EFZA 3EZLA 5K98B 4PC3A 2DJIA 2C7VA 1BR2A 3ETNA 3GP8A 2V7BA 1WB9A 1Y8RA 1USKA 4IHJF 3AF3A 1ODLA 5CIWA 4JWTA 3EVBA 5KOYA 2AYYA 3LBHA 4MW0A 4YBRA 1P9WA 4RJLA 1D0SA 1Y7LA 1H9AA 4FHEA 2HMSA 4QDTA 1YB6A 2ODAA 4Q4JB 3G0HA 4MVJI 4K2AA 1VKRA 3P5SA 3WJ2A 1JEJA 1MABB 3GDFA 2O50A 4KPFC 3EC1A 1LS1A 5MGBA 1S6YA 2LV8A 2XCUA 1S7GA 4DC0A 3ETEA 5JZSA 4X7MA 1SB9A 2EU8A 4MITA 2VWPA 4UUPA 3THWB 3HRIA 4K8OA 2ZS7A 4IXMA 1QH1B 3L07A 3LP5A 5T5QA 4ZEVA 4YUYA 3K0KA 4J9UE 2VJYA 3KPYA 1JTEA 1DKRA 4RVHA 1PYDA 3OEHD 5K05A 1EX9A 4IX1A 3FCOA 4NYJQ 3HNLA 2PT5A 4BZZA 4Z3OA 1GAXA 4RK6A 3IPAA 3GEIA 4DXHA 2JJMA 2O0KA 1B8VA 2ZAMA 5D00A 4QBHA 5BSEA 4K81B 2HZBA 4J0HA 3SR0A 5BN5B 2VHEA 4CS8C 2VUHB 2P69A 2Z2KA 5FH9A 1JPVA 1NLYA 4TN5A 1U80A 4HLNA 1KTVA 4E5NA 3V8QA 3SHFA 1MEEA 2QIPA 3V4VB 1IB0A 3QWAA 1DTSA 3ZCVA 5CU7A 1TE2A 5G41A 5JS1A 3LWDA 3NTOA 2ET6A 2J3DA 2JZNA 4BFCA 3M2PA 3BBLA 4Q9KA 1WVMA 1Y81A 1OXSC 2G63A 1UK6A 3AG4C 4LS3A 3I04A 2W2XA 1Z82A 1D09A 5HA5A 4KEAA 2VPZA 4HYQA 4GH5A 4B0OA 3QEOA 2LDXA 1G6OA 4DQDA 6NULA 4DR3B 5ELXA 2FN9A 3RH3A 1WU8A 2I6XA 1EFCA 3OX3A 3K4PA 1TA4A 4HFJA 1FRZA 3PRKE 3H2UA 3OCXA 4BNLA 3FCYA 1N5OX 4CM8A 1EVZA 1XVLA 3DPIA 5A0FA 3K16A 3I5PA 5KUTA 1TQ6A 4NU5A 4BUJA 3OSZA 4KOAA 4PLVA 2NXCA 3W5HA 4DQLA 1QHHB 3G4XA 4OAPA 1FUIA 3BE6A 2Y1GA 2M1XA 1Q1QA 2JDIA 1SXHA 1TUBB 3IXQA 4XX0A 2JLYA 4YMLA 3ILSA 3SKXA 3TRIA 4CG1A 1L6RA 2QRGA 2I66A 2OB1A 2CNBA 5FL3A 4W8PA 5I7WA 5ALKA 1M6TA 1XZNA 1RTKA 3ND6A 1SM4A 1NC3A 3ESCA 3EGXA 5GVRA 2IRWA 3ECSA 4HB3A 3SC3A 1NDHA 3D6NB 3PFIA 1APCA 2WAOA 2BH2A 2NXNA 3OCCA 4DV7B 1BGVA 1IN4A 2IQ5A 4WLOA 2RONA 4PAMA 5K6AC 3F6BX 3QQPA 2WDZA 4EHJA 2WR8A 5HWSA 1N33B 4V1CI 5KTMA 1SKAA 1QPBA 2WINI 3CROL 5C7YA 3EMDA 4FSHA 1Z0KA 3ABMC 4EMBA 3PFNA 1AHHA 4NQRA 4BGDA 2EZ8A 1MJ5A 2EIXA 1FR0A 3UFXA 3SDSA 5FOUA 1V3TA 4ETWA 1ZOLA 5JAIA 2JLVA 2RSEB 3SJCA 3VJLA 3I30X 2PXAA 2DHRA 3VO1A 1H1DA 3DXFA 3BCSA 3TTSA 1PT7A 2V3CC 5H9VA 1IWPB 3P97A 5EZQA 4RCYA 1XAHA 5IDYA 4P7FA 3O0DA 4HDNB 4EYOA 1Q0GA 1PJLA 3SFZA 5JYBA 4QREA 5BUQA 3IKVA 4EI2A 3AUAA 4A0FA 3V8VA 4EPWA 5JSLA 3KEFA 4AYTA 2PR7A 1V2GA 2BGWA 2YC2C 4HTFA 4D3DA 1ZIDA 3R3HA 1KEUA 1JFVA 4UPVA 9ABPA 2CDRA 3CLSC 3B5JA 2YWCA 4HKTA 1VI5A 3EGVA 1KJWA 2G80A 4I4CA 1H6CA 2O2DA 2QX4A 3IIEA 3Q8KA 2BRUA 5K0LA 2W2KA 1YDEA 2JJ1D 2IELA 1KO7A 4MJ7A 4EW3A 4NPCA 2WP0A 4BBJA 1IJKA 3AEUB 3ZHSA 5DBOA 3AVQA 2XE6A 2W4BA 3FOCA 2OKCA 2WU3A 1Q3TA 4CLHA 4R2KA 5BN4A 4DVYP 4UD2A 1F2TB 4G4GA 4GX2A 4C6HA 3UMKA 3IAM6 1NBMD 4W8KA 4J0FA 1D1CA 2VQ6A 1IONA 1G0OA 4GICA 2ZRPA 2GEKA 3V4FA 2AZ4A 1B1CA 3S55A 3DOEA 1Y6DA 5BVHA 3F6SA 1QS0A 2MHCA 2YV1A 4A6EA 3MUEA 2FSVC 1KEEA 1S2MA 3ROFA 3MT0A 4MMXB 4XWJA 1T8YA 1CY4A 2H7VA 4N76A 1XKLA 4QQRA 4EYSA 1QTNA 1BCRB 5FA5A 5AHWA 5D5PA 2FPIA 2VTKA 4EKWA 3U7HB 1UMCA 3AZPA 3E35A 3JT1A 3DFKA 2PSFA 4PU4C 4KI7A 2CNDA 2QR2A 3GG9A 3H1FA 3OF2A 3ETGA 2NNWB 3HWX1 2XB8A 5FJJA 4QYXA 3T5BA 2Q0XA 1P18A 1XFAA 1AB5A 3I83A 1J8QA 3G2PA 3LGSA 4MO2A 4ANFA 3G9UA 1U1FA 1CIVA 7ABPA 2RAVA 1RCUA 4O4JB 3G0GA 4A8PA 3WRWA 5J58A 3U2LA 13PKA 1CQZA 1E2GA 1FSGA 4C07A 2GJ8A 2ERCA 4EJ0A 1E3WB 4Q7CA 5COBA 3VNBA 4GE0A 4DRZA 3U9JA 3R3ZA 5JXHA 2QXUA 5DLJA 1XQ6A 1Y80A 2AC2A 5I5GA 4K9OA 1T2CA 5DN9A 3KKZA 3MGGA 1RJWA 4PN3A 2IYQA 4OSOA 1W6UA 2WFLB 4WW0A 3RPEA 3R40A 1Y8ZA 3JY6A 3JQAD 3WWPA 3CQZA 1KFCB 5TJHA 5I7UA 4C76A 4HDAA 4G84A 1IY2A 2ZW9A 4ND6A 2VK1A 4A10A 4E0BA 1SCDA 2BFBB 4NOJA 3HKKA 2RHBA 1QLEC 2YHAA 5F5FA 2CSFA 4CL2A 4ZDWA 5THQA 2HV8A 1WKBA 3I64A 3A1FA 4WTOA 2FRVA 5BV0A 1FRNA 4CR6A 4YIHA 4U5GA 1R4MA 4GOXA 4RVNA 2D5VA 3O8NA 2YJ5A 4P80A 3LQ1A 4AKTA 4OHWA 2YIDA 3GJQA 3P4XA 1DKOA 3EXAA 4RY8A 4QOEA 1X1CA 2R7XA 1Z2PX 2VQSA 1V16A 4QOHA 3HA7A 1ORYA 5EZYA 2Q3JA 2GVNA 3ER9A 4MICA 1M8FA 1UBCA 5WRFA 4XOUA 4M0UA 3N75A 1WXQA 3MMNA 4DWVA 4TQUS 4WFJA 4C08A 3PHBE 2XVAA 1LD3A 2R2GA 2W0SA 3WNDA 4MWGA 5C3UA 2REXB 4CLRB 3KZVA 2GKSA 2L82A 3X3HA 1N0UA 3N6XA 4CV1A 1KFBB 4MUNA 2BF7A 1MTOA 3LX6A 3ZUPA 1VM6A 1QRTA 1R4TA 5IJ0B 1M34E 9ATCA 2VJOA 5MN4A 1K0UA 4FDAA 2F3PA 4KX3A 3CINA 4YL0A 2ZE5A 2FUNB 2XRHA 1R69A 4EJMA 1OHHD 4YJ3A 1SA0B 1W36B 1MB2A 3AETB 2YV3A 3N59A 3GRVA 1DGQA 5BRNA 1WBJB 1RCFA 2HXSA 3N0RA 2J08A 1USVA 4WOKA 4RBNA 4Z6KA 3U40A 4UEOA 2HSBA 4EI8A 5TF4A 1KEWA 4J03A 2ZK7A 4BCCA 2QMHA 4MW3A 4TS9A 1R4AA 3IUSA 5CX1A 4PPNA 4WQMA 5CH8A 4LYYA 2G5PA 1LKZA 1I2DA 3OQ6A 4EF5A 1YRHA 4G85A 4QDXA 4UHFA 1P6XA 5JUAA 1MO3A 1QYWA 4UW9A 2HWXA 3M6IA 2A5GA 1AKEA 3T7DA 4ZVQA 1RU3A 1U1IA 2P2NA 4CIPA 1UMKA 4GQMA 3V8BA 4O02B 2BM8A 3NNSA 3GJTA 1JZSA 1JT9A 1T13A 3TSZA 3DZGA 3ZNOA 3TMKA 4PXAA 2QG6A 1WEKA 2JJ2D 1SKQA 4FYJA 1NX6A 2O8BB 2INGX 3NTRA 1D0IA 3VSCA 4HB4A 1ZC4A 4E6EA 5I7EA 4DNQA 3HJFA 5A3SA 3VHXA 2A67A 2R9RB 3G5AA 2NSLA 4Y2PA 3X44A 3MB5A 2QTVB 2BFEB 2O6LA 2F67A 2O5VA 4UAGA 2HWWA 1PDWA 4Y18A 5C1DA 4WXYB 2GYUA 4XCVA 1TO1E 3S7ZA 2VF4X 2GTHA 2WC1A 4WERA 5A4KA 4RPHA 3WB2A 2F43B 1M1YA 2Y92A 4IW3B 2DYRC 1BZ4A 4DYDA 5EJ7A 3S8MA 4DLAA 2XCIA 4ZEMA 3A3PA 4JAVC 1B23P 3ONEA 2DPHA 2OVBA 3RRJA 4MRVA 1KY4A 4E1BA 1ISJA 1AXGA 4QFCA 2H6EA 1L7MA 1OCEA 4WLNA 1QE0A 3VGJA 1F1MA 2WUVA 4Q37A 1MMFB 2QKYA 5ITZB 5KQPA 1PU2A 521PA 4YK5A 4US2R 2VOEA 3KKBA 2ANBA 1MMNA 3ZV5A 4ECEA 1NNLA 3BEOA 1UK7A 4PTLA 4U2GA 4KN9S 2HH9A 5LQKA 5CDTA 5JALA 2XI8A 1QYIA 1M2FA 2EOAA 4BLTA 2TMGA 3MJRA 1GL3A 1DIRA 1NZEA 1MUUA 2WWRA 2Q0QA 5JO9A 3I5XA 4DLKA 2GEJA 4N3AA 2PX4A 3MMXA 4X6UA 1N3BA 4YCSA 3JQGA 1EBFA 3PWKA 1TC1A 5C80A 4IXTA 3PQ3A 5K2MA 2FYTA 1TO2E 3FLMA 4R5HA 2GN6A 2SKEA 2ZI5A 2VDKB 2FP4B 1DOWA 5L6LB 2JEOA 3UOGA 3RKOF 3L8MA 1JEQA 3L0OA 1GT6A 2MMGA 1W85B 4Y2TA 1N7JA 1OTXA 2O20A 2C4UA 3ZBPA 4P5EA 3PNOA 5GQSA 3O1HB 4HDKB 2IOFA 5CDFE 1R15A 2HYIC 1LBSA 3FYDA 3N0WA 4F4HA 4QO8A 2Z09A 3CSDA 1JEEA 4E30A 5HRCA 1Q1NA 4H18A 4QIHA 1JPJA 4HB2A 4NESA 1P1BA 3UUFA 1Q0KA 3BCRA 4L6IA 4ZVUA 3GDGA 3TJRA 4LBZA 1ZESA 4CMJA 1ZVKA 2C61A 2W6QA 4INAA 4RHFA 4WL0A 5T3YA 2HSWA 3GBVA 2AZMA 4KQMA 3GDOA 4BO1A 3EOBI 1D2EA 2WK1A 4PNPA 2EPOA 2BGJA 4OXNA 2QLMA 1U4OA 3GM2A 2GCOA 1CT9A 1PVVA 2IOFK 1FLAA 3ANTA 4WD3A 2RG1A 2YUTA 3ORHA 1CQPA 2W83A 4H1WA 3A9XA 2BBOA 1UJ5A 5FR2A 3AHJA 4JQSA 1A8HA 5D85A 3DZCA 2JGJA 5DW0A 3SU8A 2VUSA 1O5IA 1WZUA 2V6BA 3H86A 4RF4A 3NMIA 4O4LF 2YOFA 3I61A 1M7GA 1O03A 3VSAA 2HQOA 3FCSB 2AFIE 3WC4A 2Q6VA 4D8XA 3ONNA 1JX6A 2EBYA 2YKZA 1V6CA 4JDUA 4CMCA 2XS8A 2DE0X 1C50A 3T9FA 1TGYA 4K6GA 1HEIA 4N7BA 2VEOA 4GOLD 5HIMA 2PXXA 3BWMA 1UL1X 2YNMA 2OZLB 4BN0A 2YL0A 3PGKA 2OKGA 4L3VA 1ORRA 3QPAA 2NM0A 3A2KA 4U9IS 1ABFA 3IXMA 1F0YA 1Q20A 2NSGA 2REOA 2EGHA 1EP9A 5BUOA 3M6MD 3QKTA 4LDKA 2R8BA 2O4AA 3MGKA 3HCWA 1IIBA 3ASNC 2BSAA 3ZIBA 4RMJA 4PS1A 3CX7A 4BEVA 4UAUA 4PW0A 3JQBA 2ZT8A 1X8LA 1JVNA 1QGUB 1C3OB 3FR8A 5KSWB 4HP8A 3TUIC 1T15A 4EW2A 1GQ2A 3AUKA 1N5RA 2BONA 3FF1A 1P2TA 5CTAA 4ILEA 4A8JA 4BB6A 1VA4A 2NU8B 3O8CA 1DS6A 4YJ2F 2FB9A 5LNK6 4CKXA 4BASA 3FCCA 5AIBA 2B1GA 5ALXA 2ZR0A 2JK0A 4D0NA 2CHGA 2X14A 3DFIA 3IURA 3U3ZA 3ZZMA 4MVWA 4CMKA 4RKQA 1KDRA 1URPA 2OSVA 4LAFA 2QGNA 3FGPA 1A9OA 2I5PO 3MD0A 4FOOA 4M9QA 3JR7A 1NV8A 2ABWA 1C1DB 1M1NA 2M98A 3OTGA 3JARA 3S84A 5FL7D 5IDQA 4N0EA 4DPLA 2ESRA 3I12A 1R0KA 3W8IA 3H2YA 3N53A 3TEPA 3OT5A 2HSDA 5AJZA 4TX1A 4CKBB 4DABA 4LQCA 1RQNA 3OY2A 3N8HA 1JEYA 4IQ4A 1R5OA 4BO5A 4OOFA 3X1KA 1F7VA 1VHDA 1TMKA 3GFFA 3GJ8A 3H6GA 4M1OA 4EBFA 5CIVA 5HFJA 1PUIA 1XTPA 4XVRA 1SKUA 5IULC 2WFAA 3JALA 3ABZA 1XP8A 2Q7RA 1KKLA 1SBQA 1O9HA 4GWLA 4L2IA 2QNIA 5TIIA 3CBQA 2B2NA 3BGOS 1K3UB 2KYHA 5IM4F 4HNHA 4BUCA 3MJDA 4IPTA 5CDSA 1FS4A 1DEAA 2F1IA 4QBKA 2JIPA 3ZY4A 4QI2A 3GQVA 3CX6A 4M1QA 1FNCA 4NI5A 5F9HA 4OB8A 1WUIS 3QPUA 3PQ7A 4IEIA 1TZJA 2YZGA 1ETUA 4HUJA 4DMFA 3HXMA 1MV5A 1VE5A 1F9AA 4UM7A 4DIOA 5EJ4A 4CL3A 4ZN6A 4FCWA 3F8WA 4EGCB 3IEEA 4C0AC 4CTOA 1GVHA 2DHQA 3LS0A 3AP2A 5AM0A 3HJAA 3S1AA 2R8OA 2VJDA 1R8SA 4URVR 3OP1A 4XASA 1JJIA 3PGXA 2P9JA 2WTUA 3BB1A 1DFHA 4ZU6X 2VNHA 5GJCA 2QW0X 1JFRA 1NNSA 3PE3A 2LTAA 2FDRA 4B2LA 2OCKA 2XD9A 4XARA 2CK3A 4JVSB 4X95A 4CIHA 3WIDA 2DYKA 2V96A 5EIBD 1VLZA 5F52A 4KPUA 1KBQA 1HE1A 2C9CA 4E2WA 1G20E 4JI5B 4HWOA 3ZHIA 2JI4A 3AESB 4R9UC 4K9PA 4HE8D 1T36A 5A03A 3MXTA 5ICSA 4UDNA 1N4AA 1WASA 3C8MA 3M1IA 5FTWA 2I2CA 2GFQA 1UZUA 1OXMA 121PA 3NTQA 1PR6A 1U3DA 1T5DX 2HI0A 3QBTA 5DP1A 1IXSB 2PWBA 1H6AA 4UHHA 2XKAA 4XW2A 2C2GA 4F3TA 4OIFA 4MV6A 2KPJA 2NQ2C 2ZB8A 2VP9A 2DWOA 1V74B 3EZNA 5ECGC 1EXNA 4HX5A 4EHBA 2VNAA 2HPVA 3UAGA 1HE2A 2J46A 4A9AA 2WPNA 2CLMB 4QODA 2QROA 3QKSA 3FSGA 4MRSA 4BLWA 1P4HA 3EXEB 1K7CA 3FIJA 4HH4A 4WBXC 1NQUA 2Q6LA 3T1VA 1TF2A 1CZLA 1PYOA 4BQIA 2R6HA 4MDYA 3G0DA 3I5YA 2HTEA 2A92A 3R76A 3BGWA 1WPGA 2UAGA 1IYZA 2YJGA 4MA5A 3ONDA 5KU7A 2GAAA 2PX6A 4Q93A 1NRIA 1OLSB 3SHVA 1TQ4A 4R84A 5IJAA 4BS9A 1D0ZA 3RBXA 4FE7A 2JF0A 3BWBA 2R1ZA 3Q85A 2VPIA 4H1UA 3W2VA 2GBLC 4N5HX 4C0BA 3T3MB 2EKBA 1V3UA 3P2EA 3E1KA 1X2BA 3QWBA 5SZKB 4CM3A 3U1BA 2O19A 3V1UA 4J1WA 3CJQA 4L74A 2BLLA 2HD4A 1ID1A 4QUKA 1HZZC 3VYRB 2EHJA 2ZRAA 4G4IA 3A6JA 1EFUA 1QAMA 4AZ0A 3UMJA 1VP3A 1WXWA 3M1YA 4G5XA 1HG1A 1AH2A 3HVJA 3FR7A 1FZQA 2I78A 5IVIA 1Z12A 5TMBA 4L4RA 2PUHA 2H7XA 2QGZA 3W2EA 2KEKA 2ZEJA 4FYPA 1USUA 5DGHA 1GAWA 1T34A 1I8TA 3HL0A 4XCXA 1NT2A 2OGUA 4R05A 4FYIA 4LA4A 1Q1ZA 3WYFA 2P75A 4O5OA 1ONBA 1ZBQA 1HE3A 1LFAA 4G5RA 3D3KA 1D7AA 2OZKA 5KTOA 1TA0A 2OA0A 4INOA 3T5AA 5JC8A 2B4RO 4Y2GA 3AI3A 2YN2A 5E6UB 2YL3A 2Y05A 3E5RA 3LC7O 5HKBA 5H7XA 3DBLA 5JANA 1G2QA 4L4ZA 5T7BA 2OHVA 2ZE6A 5L7YA 1I3LA 3ZQUA 3U5ZB 2ETSA 2DBVO 5JE8A 2BY4A 2FW9A 1A04A 3RO7A 1U6KA 1WX1A 3DO6A 1O2DA 2XNHA 1PR0A 3QOFA 4IDDA 4GL4A 3DO8A 1OI7A 3TCKA 1YB5A 1PTJA 2C5HA 4EBJA 3KFLA 2PF4E 3THOA 2NYRA 3ZHTA 2VN8A 4B4WA 1POWA 1VE7A 1FFGA 1R0WA 5DU2A 1OBFO 4HJXA 4YRRA 2JKZA 1TECE 4OHPA 2JGDA 1I2ZA 2XKJE 4WX2B 1P7VA 3PF9A 2ZBFA 1YHZA 4OIMA 2WSMA 4FHZA 5FNVA 1W48A 4C29A 4RSGA 2A9RA 4PXYA 1BS1A 5GOZA 4Q7LA 5B4UA 1QANA 2B6NA 1J9EA 3HY6A 2RH8A 5ESWA 3S2UA 5DHSA 2JHFA 2FPOA 1CS0B 3M3PA 3QX7A 2IIVA 1BYUA 5A3QA 3TLJA 4ZQIA 3JAKB 2Y0BA 4LDZA 4I50B 2ZJ4A 1DKLA 1VLMA 2DWCA 2ISQA 2YQZA 5FEMA 1U2EA 4FQ7A 2XLOA 1A7UA 3PEVA 1TYAE 1V71A 2Q1TA 1IC8A 4CTNA 2GXAA 2YVLA 3N07A 3ELBA 3BXZA 3UMHA 5A7HA 4HCJA 5AC5A 5AM2A 3HKCB 3BE8A 1EH5A 4X6LA 3MB8A 4NBTA 1M5RA 1XBTA 2HZ7A 1JEOA 3G6WA 1QBGA 3NHWA 4DMLA 1YBFA 2H08A 1UG7A 3DVQX 1SC1A 5IASA 4BFVA 3AXSA 3L7LA 4MEBA 4Y9TA 4G56A 3ZDAA 5HG0A 3EQZA 4JYZA 3CNNA 4A6XA 1Z7GA 5ECYA 3DV0B 3UAWA 2UXBB 3I45A 1P2BA 1V8PA 1Y6JA 4M7WA 3OT4A 4I4TF 4HG2A 4JQDA 2DB3A 1JFFA 4I81A 1T2AA 5E7QA 3GJ3A 4IUBS 3DZFA 1U1EA 3QTBA 2R3SA 2X5OA 4XGKA 3H1TA 1UM9B 1WCV1 2VYQA 4QGBA 1U8TA 2D00A 3QKRA 4IKEA 4PQGA 4RW0A 1YARO 4DZZA 2CJPA 1ZZ9A 1LCCA 2WIJA 2EKDA 4GLJA 2Q2QA 1XZJA 1SBTA 2QU7A 2JGLA 2ID9A 3R3YA 1FDSA 4JCOA 4IXWA 1XJQA 2I4IA 3U6BA 3ZHMA 3U3DA 5MFPA 4IJJA 1Z7YA 3T6KA 4IJQA 3RFXA 2C94A 3JYYA 2OORA 2EW1A 3K4HA 3CSKA 1LY1A 2GN4A 2GGSA 3B78A 1UMDB 1R2QA 5K0GA 1YU6A 1YRAA 4LV5B 1T6YA 1Y5RA 4ALNA 4KR7A 4PG4A 2VHWA 4NYIQ 2ZBEA 2AXVA 1A9TA 1BIFA 1Z0FA 5FPSA 4E7PA 3K8OE 3T5CA 1AHNA 2WHQA 2WSBA 4NL4H 4RVSA 3V1MA 3ILXA 1FTNA 4KH0A 3EZ9A 2II6A 1Z8HA 5ULLA 3O90A 4YCBA 3KE8A 4I8IA 4UU7A 3I0NA 1ZD9A 2Z5LA 3Q8MA 4P53A 1DLIA 1KQOA 2CCJA 4XIIA 2O3RA 3ZUGA 1G5FA 4FEEA 1D1TA 5GZ1A 2J1LA 5E3HA 4CQJA 3VR2A 2EHDA 3AOEA 3C1UA 3RNOA 4J0JA 5EHIA 3P0RA 3VZPA 5JR3A 1GSOA 3PEEA 2YXEA 3L8GA 1X1SA 3QEJA 4M83A 1VBFA 1RXWA 3K1IA 4N9WA 1G4WR 2A0WA 4NOKA 2YMLA 4PG6A 1VTKA 2ZRJA 4YHHB 4PFKA 5EMHA 1PWHA 3PCVA 3CW8X 3CX4A 4B0PA 4Q21A 2C3OA 4S04A 5ECDA 5EERA 2WU8A 1M10A 3DAOA 2RGEA 4MVZA 3R3WA 4O8ZA 5A0VA 5K20A 1FTSA 4BQSA 3FAPB 1U0JA 5BYBA 2VK8A 3L0CA 3P0IA 2XADA 2GO1A 5TEVA 4IQFA 4DPKA 2GESA 2GPAA 2R7RA 2J0UA 3CXUA 5K0ZA 4MEJA 3DMPA 5IZCC 2WB2A 1W5FA 4KC0A 2B99A 1N1GA 3RC1A 2RK3A 4A23A 3UMVA 1T4MA 1JR8A 4R2XA 1T8WA 3ELUA 2RB4A 1ECLA 1FRVA 2YJTD 2OV6A 3TLBA 3H4TA 1SCUB 5G1NA 2ZJYA 1T9GR 1MVLA 3ZU2A 3KB1A 5H0IA 4PZDA 1T8RA 1NUQA 4YR9A 2HGZA 2MHRA 4WEQA 2PL3A 2CYDA 1TQGA 1T4BA 2EJUA 1DHRA 5A6SA 1E2LA 4RCZA 1QTQA 1CBUA 1YF3A 1OMOA 1KI9A 4CMBA 4WZBB 4P1ZA 4M8NE 3RHTA 4UBIA 2LYKA 3H19A 4LNUA 1DAOA 3ML1A 5BR4A 1YBVA 4H59A 4Z9AA 5CI9A 5KX5B 3KLNA 2D5BA 2GX6A 2XEDA 4L5IA 3NOXA 2LP4A 3BRJA 1HL3A 4UHEA 1GNRA 1NWHA 1JA1A 1K2WA 2QY6A 2IU0A 4Z8YA 2HNKA 4O2BA 1RWOA 1RVV1 1DELA 4PX2A 4ZV9A 3I1FA 2C8VA 2FR0A 3H2KA 3V1YA 3IV6A 5F64A 1VRVA 2J07A 1B0NA 4R31A 1E3DA 3I2YX 4KVGA 3EFBA 2HJGA 3T3PB 2NUPB 3IMGA 3AR7A 1S05A 5BQ3A 3LI2A 3MBOA 4NV1A 3JTMA 5LA6F 4BJ6C 2CLFB 4PXSA 2M4HA 3KT3A 3DOFA 5IY5C 4HDMA 1CZHA 2I3ZA 2R44A 3AX6A 1E2DA 5EIBC 3KJQA 4PAOA 5TS2A 4DNOA 4JL5A 1RHMA 3GT7A 4R1PA 2QF7A 5A0TA 2A9QA 2C07A 4OGWA 4YI3A 2JHGA 4C2UA 5HZHA 1HSOA 2DM6A 4P3OA 4H7JA 4K6CA 3KSUA 2B1RA 4F2GA 3CG4A 4NJOA 1P61B 3BREA 4RABA 3QTHA 3JASA 2GO7A 4E4YA 1T5HX 1FDIA 3A3YA 3JWIA 4J1TA 2GCEA 4CBVA 2AYZA 1ATIA 1TEHA 3W06A 2X42A 4LF8B 4YCAA 4HAXA 1XTQA 5JJBA 2VWHA 1YGPA 4NXNB 1YKFA 4UQPA 4NBLA 4MGYR 1GNLA 1II9A 1FJXA 5C8YF 5I9SA 1WDTA 1OZAA 3GCWA 3FZEA 1AGYA 3GLHB 1HORA 1CGOA 3S5UA 4EFKA 1ZHFA 2CKDA 1U81A 1N2CA 4AUMA 5BMVB 5DJ5A 2FFHA 2A57A 1RQ2A 4C21A 3B71A 1RXEA 2LVBA 1T8PA 1KYXA 3C2QA 3Q0EA 5ALEA 4U2DA 1A9YA 2HFKA 4IVPA 1S96A 1E0AA 1PE0A 3B9QA 4X8LA 1UBGA 1O5TA 2VSXA 3WK7A 6ABPA 3H42B 3TBFA 5ICEA 4YWHA 2JIRA 4QJIA 4NSNA 3T4XA 1WRBA 4CIVA 3RUEA 2R751 4ILKA 2WJJA 5CGZA 1XEFA 4PBSA 1GGFA 5KIAA 3OZXA 1PN3A 4G5GA 4Y6QA 3GLGA 3U4QA 3DEYX 3W8DA 4W6ZA 3A6LA 2RGNA 3IKJA 1KORA 2ZYDA 3RTDA 3DZ8A 3D8RA 3ZKWB 4BIMA 4JI7B 1QFZA 1AGNA 5BQOA 1X15A 3LNRA 4EZIA 3FOPA 2IE8A 2JL1A 2IHYA 4DB4A 3M82A 4I4IA 3A70A 2QVBA 1MB3A 2YLDA 1V11B 2JIZA 4LECA 4IGIA 3IOBA 2VC9A 1A5ZA 3K1JA 3C3YA 3K20A 3B6JA 3QWHA 4XM0A 4F9FA 4LDNA 3ZWPA 1P5HA 3VPAA 2I15A 5L0IA 4MTGA 4G1EB 4X60A 1YI0A 2IF0A 2AOWA 2ZT7A 1V8DA 4FS3A 4FGLA 2XCSB 4DBLE 1E79A 1G9XA 5FOWA 4FJ0A 4AJPA 2PSSA 2PZFA 3QNMA 4C22A 3HH8A 3BC1A 5FI3A 4YMGA 1D4FA 4OXRA 2FN4A 3ZVRA 2VLBA 2G7ZA 2Y9PB 5B1HA 1XT6A 2OP0A 3C87A 1UWKA 4PQYA 1KI7A 2OCDA 4OJYA 3KSBC 5CT4A 4G89A 5GONF 2EPKX 4RY2A 5CB6A 2OXIA 1EA7A 4GLOA 2E7ZA 5ILGA 4HUQB 5SY4A 1LDGA 4XR9A 3RK1A 5SZHB 3CBGA 4GC9A 4N82A 4WZZA 1TT5B 3IAS6 1KDTA 5E9AA 2OR1L 3QPCA 5EE9A 1SXJA 4OOEA 3ADDA 2R7OA 2G09A 2B9EA 3LLCA 3CN7A 4IDEA 5DNAA 4UM5A 3CE9A 3DMDA 5AQEA 5DBFA 1IM2A 3D5TA 1SKBA 3C24A 4PGFA 5K0NA 4BTLA 3HB7A 3DR3A 3I3SR 1UPAA 4N3NA 2ENWA 2ZYAA 1IK6A 1V7CA 1XDDA 1A7DA 3SYLA 4FZVA 4E14A 2KNHA 2YRXA 3CG0A 2O8EB 2IBMA 2ECOA 1YDHA 4BFWA 3NYWA 2XLHA 2H2GA 3IV9A 4P84A 3CONA 3VZRA 1WB4A 1QK4A 1DJOA 1USGA 1YZGA 4WFKA 4BN4A 1Q12A 1E1RD 2XV1A 1JHDA 3ELDA 4YRZA 1NYQA 3WKCA 1G8KA 2IITA 3N2YA 2BGIA 5DWQA 3L82B 3RVRA 3TUJC 4WMLA 2IYUA 4D0RA 1GFSA 4F06A 4GG1A 1NOIA 1JLKA 3MBKA 1ISSA 1IZ9A 5HCNA 5JZOA 3E9RA 4AW9A 3QOXA 1ZUNA 4BMYA 4A73A 4H3VA 1UFVA 4LJ4A 4Q9LA 1QR2A 5KYYA 4XQGA 1U7OA 2QPAA 1OFVA 4YO7A 3K15A 1ZNQO 1JAXA 3H5NA 2O57A 1JQ3A 3BRWA 3AEYA 1C9KA 5K6TA 4CEJB 4IOLA 1GWNA 3R6DA 4R1UA 4Q1BA 4LYHA 3TZQA 2Z5GA 1NJ6A 4OQMA 5FOTA 5A69A 2XQJA 2W00A 3LISA 2PJUA 4BJ5A 1DC6A 4KNWA 1GILA 1OCOC 2YXBA 3DHNA 1PBNA 4EHNA 4QO7A 5ADUS 2GAIA 3T1QA 1H42A 5L3QB 1ZMOA 3NM6B 2ZT5A 3DB2A 2XUFA 4WJKB 1P3JA 1DJQA 3OZ7A 1PFYA 2AZTA 1U0RA 4UUOA 1A1VA 3CECA 4YRPA 2O38A 3OQIA 5IC4A 3ZS8A 2PLAA 2V7QD 3LECA 4F60A 5EJ6A 4PZUA 2ZXOA 1VZ3A 4LYEA 1C9JA 2ADFA 4DA0A 2ZSIA 3TUZC 3T9CA 5GM1A 2JHAA 1Z73A 4JLAA 1NE2A 1NIPA 2PL9A 5JLJA 1KEVA 2O8FA 2UYQA 5FLYA 2NZWA 1RI2A 2QU8A 3GJXC 4RENA 3SJ7A 1U9CA 1CZOA 2PGXA 3DEZA 1DVRA 4DG9A 4Z9HA 2CXSA 1OFUA 1WIZA 1ZJ6A 3TD9A 2AEJA 5LU8A 2E5WA 2Q0SA 5BW5A 1JR3D 3I34X 3KTAA 4Q02A 3Q5GA 1KDVA 5KNDD 4QXRA 3HWWA 3ZVKA 1CNMA 4OUKX 4NATA 2OFFA 3E7XA 4HBGA 4Z49A 1GY8A 4B35A 3TOMA 3DZIA 1R6VA 4PRKA 1W34A 2IUOA 5L0DA 2QX9A 3MFNA 2PRSA 4DRYA 3LNCA 3ZJ4A 4NP6A 5GM2A 2HHCA 1VHLA 5KYNA 1GAQA 4IH1A 4IMRA 1VI2A 1RPNA 4PCUA 4JXKA 1DV2A 1MOPA 3B6MA 3N2NA 1IG3A 1E20A 4WXMA 3MLEA 3GROA 5DW3A 5CB4A 1KJ9A 1VXRA 4CDAA 2LYLA 4MR9B 1R16A 1KZGB 2QTRA 3ND8A 4JI3B 4BCDA 2A8YA 2OYSA 1ZAKA 1IBKB 1HY5A 1DOZA 4TMFA 1JS1X 2F3SA 3WL8A 2IXMA 2B7BA 4GM0A 4I6TA 1ZU4A 1F8YA 1A2BA 4X6YA 1YAJA 3IEKA 4HWTA 3ZQ6A 5H3LA 1LQCA 2UZ4A 3MFYA 4Q18A 2CHFA 4MVQA 2AXZA 4HZGA 3UJDA 3URKA 2PX8A 1U3GA 4X7BA 3N39C 3P9NA 2OZVA 3C6YA 1XQ9A 1IDN1 3WGGA 4Y2QA 1AQ6A 2VZLA 3I2HA 2AUMA 1ONOA 4LZJA 3NASA 2HRDA 1NW4A 1XQVA 2H2WA 3K6BA 1CJBA 1UUFA 3AGQA 2WYHA 2OV3A 1KJZA 1XF1A 2QLAA 3VR5A 2VQFB 1I01A 1YXMA 4D42A 2B8TA 2PX0A 4JGIA 1ZU5A 1SVSA 1Z2NX 4XLNF 2CV1A 1ST3A 4L16A 1VC2A 3QLTA 3LBYA 4M9CA 1MO4A 1Y4UA 2R1TB 2FVXA 1LMB3 2F62A 2O3UA 3NWJA 3ZI4A 1Z6YA 4NG4A 1E5VA 4XIJA 5CYOA 3GGCA 4B44A 3OZAA 4JEUA 4PJNA 5BWBA 3OZVA 2QK4A 1L1FA 4GW3A 4B6OA 1SF8A 3ZH2A 1ESCA 3U13A 3ET4A 5HIJA 1NPTO 1ZN9A 3K30A 1A5BB 1EJ0A 2MT9A 1DSSG 3PNKA 1TL7C 1KSFX 2YWFA 2VNSA 1SXJE 3A9WA 1AVTA 1UC8A 1FDUA 4L4UA 4KGVA 3DMGA 3TDMA 1Q0SA 3ZGVA 2IV1A 4TWBA 1Z8DA 3RVLA 5ITSA 4D4XA 3D8BA 5E9QA 3JYLA 1E2BA 3ESYA 2QRZA 1U2PA 3O03A 4U1RA 1SY7A 3EOZA 5EC8A 3U7QA 2LPMA 1IY8A 4JR1A 5K0FA 2VAXA 5LN1A 2HK9A 4G41A 3OAAA 4XAQA 2VJCA 4BG0A 1WMBA 3ICOA 1ZHTA 3MWDB 2JIBA 2VP4A 3NEYA 3PUKA 5CT8A 4UBNA 2YZKA 1MA3A 4UHDA 4JXZA 4FBMA 4PHGA 3ZS9A 1IRIA 3GBFA 3PKZA 4QX6A 5JFGA 2AW5A 4ALKA 1HF0A 5AH0A 1L5KA 3EG9B 3K5PA 2IH2A 2C8KA 2IFTA 4M0MA 4PFJA 1QVAA 2J9YB 1LE4A 4KUHA 3RFFA 2FRDA 3I2FA 1ZNWA 4NZOA 1W4AA 5J4LA 4ZYWA 2VHJA 2V8BA 2Y3HA 1LPNA 2PEYA 2PMFA 1QH0A 5CT5A 2EWVA 4PK4A 3TIIA 1AV6A 3L7OA 1G1MA 5IANA 3O4RA 1ODFA 4RF2A 2ZRFA 3TX6A 4DJTA 5IDVA 3NV9A 4YDHB 2JGFA 4DAEA 1S4QA 2B94A 3EF3A 3EA4A 4QUAA 4R1TA 4Q3KA 5TNXA 1VYTA 3OLCX 3LLSA 5B2FA 5DI3A 5C5IA 3MYRA 4LLEA 1N6RA 3T7EA 1GGVA 3KYIA 4WT7A 4AVYA 4E32A 1Y37A 1Q7TA 3ZGNA 3TNFA