4X4HA

Radiation damage to the nucleoprotein complex c.esp1396i: dose (dwd) 35.7 mgy
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
76
structure length
76
Chain Sequence
ESFLLSKVSFVIKKIRLEKGMTQEDLAYKSNLDRTYISGIERNSRNLTIKSLELIMKGLEVSDVVFFEMLIKEILK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Radiation damage to nucleoprotein complexes in macromolecular crystallography.
pubmed doi rcsb
source organism Enterobacter sp. rfl1396
molecule tags Gene regulation
molecule keywords Regulatory protein
total genus 30
structure length 76
sequence length 76
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 4x4hA00
4Z58A 1RZSA 3JXBC 4F8DA 4J1XA 1CJGA 1L1MA 2XI8A 2B5AA 1NERA 1ZZ7A 1QP7A 2LYLA 4Z5HA 4FBIA 3BDNA 2MEZA 1R63A 3F52A 3FMYA 4IVZA 4IWRA 2LYSA 2GRMA 4NDWA 1E3OC 1LQCA 2EWTA 1ZZ9A 3PXPA 4YARA 4X4FA 1S7EA 2PUFA 2PIJA 2IVGA 4GHJA 1WIZA 2IVQA 1R69A 4I6UA 3TRBA 5K98B 4OB4A 2PUDA 1YSEA 3QWGA 1SQ8A 1RPEL 1POUA 2EF8A 2PPXA 3GBFA 2CSFA 2AUWA 1UTXA 1BDIA 1ZZ6A 2XSDC 4YG4A 2JCGA 2PUBA 1CQTA 1X2LA 3FYMA 4X4HA 2KEJA 1NEQA 2BNMA 4JQDA 3OP9A 2MQKA 2AW6A 3IVPA 4I6TA 1X57A 2KPJA 4FN3A 4MCXA 4X4IA 3H5TA 1JWLA 1LLIA 3FYAA 3MLFA 2WIUB 1UXDA 1AU7A 3CECA 4X4CA 3BD1A 5A7LA 1PRUA 2EBYA 1PRAA 3VK0A 3RZZA 2L49A 3BS3A 4X4GA 3OQOA 1JFSA 2GRLA 3CLCA 2XJ3A 1QP4A 1PRVA 2IU7A 1ZZ8A 1ZPQA 4X4EA 3OMTA 3U3WA 1VPWA 3SCFA 2R1JL 2JVLA 4Z5CA 1LCDA 3KJXA 4O8BA 4IA8A 2PE5A 3L1PA 3HZIB 3QYXA 2LYQA 4PU3C 2XCJA 3UFDA 1EFAA 2L8NA 1DWKA 1WH6A 3GN5A 3D1NI 3CROL 3SCHA 2HINA 4Z59A 1UXCA 1ZZBA 3G7DA 4PU7A 1OCTC 3KXAA 1ZZCA 2AWIA 2WUSR 3F6WA 1O4XA 3B7HA 4MCTA 1QP0A 2ICTA 1B0NA 1Y9QA 2XIUA 2PUEA 2A6CA 3JXDL 2OR1L 2HSGA 1JH9A 2IV1A 3KZ3A 2CROA 1XWRA 3JXCL 4Y42A 1GT0C 4X4BA 1QQAA 4J1WA 2BNOA 2BJCA 4YBAA 1RZRA 2OFYA 1HF0A 4Z5DA 3OQMA 2R63A 2KEIA 1BDHA 1ZS4A 2LYKA 2LYPA 1PERL 2D5VA 4GQMA 3ZHIA 2IVBA 3F51A 3GN5B 2KZ8A 4PU4C 3LFPA 2FJRA 1ZVVA 1LMB3 1ADRA 1OSLA 1ZAYA 2H8RA 2O49A 2IUOA 4JCXA 2LYJA 3G5GA 1Y7YA 2BNNA 1JFTA 2PUGA 4I6RA 2LYRA 4PU8A 4I8TA 3R1FA 2LCVA 2GZUA 1QQBA 3EUSA 1PNRA 1DW9A 3QQ6A 4X4DA 1LCCA 2AXUA 1WH8A 3QF3A 1IC8A 1WETA 3OQNA 1QPZA 4YG7B 2PUCA 3SCGA 1RIOA 4YG1A 3ZKCA 2AXZA 1ZUGA 2PUAA 3S8QA 2ICPA 3ZHMA 2KEKA 2AXVA 2O4AA 3O9XA 2O38A 1RZRD 4JCYA 3LISA 3DNVB
chains in the Genus database with same CATH superfamily
3NXHA 4F8DA 1CJGA 1L1MA 1QP7A 1ZZ7A 3BDNA 2MEZA 1R63A 2LYSA 2PXDA 1ZZ9A 3QOXA 2PXQA 5K98B 2V3CC 1YSEA 4EKIA 3QWGA 1POUA 2CSFA 4DE9A 2PUBA 1CQTA 3FYMA 4OBMA 3DM5A 3KL4A 1X57A 3H5TA 1UXDA 2EBYA 1PRAA 2L49A 2HCNA 3BS3A 3CLCA 2GRLA 2J7UA 2IU7A 4X4EA 3OMTA 2R1JL 5DT2A 4EQZA 2LLVA 3QYXA 4PU3C 3GN5A 2HINA 1UXCA 1ZZBA 3G7DA 1ZZCA 3TFLA 1B0NA 2PUEA 3JXDL 1JH9A 2CROA 4X4BA 4ER6A 3ME5A 4YBAA 3ZPXA 3GZDC 3M9LA 2PXFA 1ZS4A 1PERL 3OKZA 3ZHIA 4Q2JA 1OSLA 2BNNA 3R1FA 1DW9A 4X4DA 3QF3A 1QPZA 2PUCA 1RIOA 3MEJA 2AXZA 4DE8A 4EZIA 2O4AA 1RZRD 3DNVB 4FBIA 3F52A 2PXEA 1E3OC 4ER7A 3R09A 4I6UA 3TRBA 2EF8A 2ODRD 1UTXA 2XSDC 2JCGA 1DULA 1NEQA 4JQDA 2MQKA 4FN3A 1JWLA 3MLFA 2WIUB 1AU7A 3VK0A 5JUWA 4X4GA 3OQOA 1QP4A 2PXKA 1ZZ8A 5DTQA 2JVLA 3G0TA 3L1PA 2XCJA 2L8NA 1DWKA 3D1NI 3CROL 3SCHA 3GZDA 3UWPA 4PU7A 1OCTC 2AWIA 2WUSR 1O4XA 3B7HA 2ICTA 3JXCL 3A9YA 2OFYA 1RZRA 4Z5DA 3OQMA 5DRTA 3F51A 1MFQC 2FJRA 1ZVVA 1LMB3 1ADRA 2IUOA 3G5GA 3A9ZA 1HQ1A 3EUSA 2FFHA 4YG1A 2LLWA 3S8QA 3ZHMA 3VWSA 4JCYA 2XI8A 1NERA 4IVZA 2PXBA 2GRMA 3OWQA 1LQCA 2EWTA 4YARA 4X4FA 1S7EA 2IVGA 4GHJA 2IVQA 1R69A 2PUDA 4OB4A 1SQ8A 2PPXA 2M4HA 2PXPA 2AUWA 1BDIA 1ZZ6A 4YG4A 2BNMA 3OP9A 2AW6A 3IVPA 4MCXA 5DRYA 1LLIA 3FYAA 5DTRA 3BD1A 3SX0A 5A7LA 4EKGA 3RZZA 3QOWA 1JFSA 2XJ3A 1VPWA 3KJXA 4O8BA 4IA8A 3HZIB 3UFDA 1WH6A 4Z59A 1QP0A 2XIUA 2A6CA 2PXLA 3KZ3A 1XWRA 4Y42A 1QQAA 4HRAA 2R63A 3TEPA 2KEIA 1BDHA 2LYPA 3PE5A 3A9XA 3LFPA 4ER0A 1ZAYA 2O49A 4JCXA 2LYJA 5DSXA 2HCSA 3TELA 4PU8A 4I8TA 1QQBA 3QQ6A 1LCCA 2AXUA 1IC8A 3SCGA 3ZKCA 3NROA 2ICPA 3O9XA 2JQEA 3LISA 4Z58A 1RZSA 3JXBC 4J1XA 2B5AA 2LYLA 4Z5HA 3NZLA 3GUUA 3NDBB 3FMYA 4IWRA 4NDWA 3SR4A 3PXPA 3LQXA 2PUFA 2PIJA 1WIZA 2XXPA 1RPEL 3GBFA 1NW3A 1X2LA 4X4HA 2KEJA 1QB2A 2PXVA 4I6TA 4X4IA 2KPJA 5GAGi 4ER5A 3CECA 4X4CA 2J7WA 1PRUA 1PRVA 3U3WA 1ZPQA 3SCFA 4Z5CA 1LCDA 5DTMA 2PE5A 2VEOA 1EFAA 2LYQA 2HFZA 3KXAA 1QZXA 3F6WA 4WVLA 4MCTA 1U2ZA 1Y9QA 5GAHi 2LNMA 2YBDA 2OR1L 2HSGA 2IV1A 1GT0C 4J1WA 2BNOA 2BJCA 4ER3A 2XXQA 1HF0A 2LYKA 2D5VA 4GQMA 2IVBA 3GN5B 2KZ8A 4PU4C 2PXUA 2H8RA 2MXDA 1Y7YA 1JFTA 3GZCA 2PUGA 4I6RA 2PXTA 2LYRA 2LCVA 2GZUA 2L1PA 1PNRA 1WH8A 1WETA 3OQNA 4YG7B 1ZUGA 2PUAA 4EK9A 3QFIA 2KEKA 2AXVA 2O38A 2XXAA
chains in the Genus database with same CATH topology
4Z58A 1RZSA 3JXBC 4F8DA 4J1XA 1CJGA 1L1MA 2XI8A 2B5AA 1NERA 1ZZ7A 1QP7A 2LYLA 4Z5HA 4FBIA 3BDNA 2MEZA 1R63A 3F52A 3FMYA 4IVZA 4IWRA 2LYSA 2GRMA 4NDWA 1E3OC 1LQCA 2EWTA 1ZZ9A 3PXPA 4YARA 4X4FA 1S7EA 2PUFA 2PIJA 2IVGA 4GHJA 1WIZA 2IVQA 1R69A 4I6UA 3TRBA 5K98B 4OB4A 2PUDA 1YSEA 3QWGA 1SQ8A 1RPEL 1POUA 2EF8A 2PPXA 3GBFA 2CSFA 2AUWA 1UTXA 1BDIA 1ZZ6A 2XSDC 4YG4A 2JCGA 2PUBA 1CQTA 1X2LA 3FYMA 4X4HA 2KEJA 1NEQA 2BNMA 4JQDA 3OP9A 2MQKA 2AW6A 3IVPA 4I6TA 1X57A 2KPJA 4FN3A 4MCXA 4X4IA 3H5TA 1JWLA 1LLIA 3FYAA 3MLFA 2WIUB 1UXDA 1AU7A 3CECA 4X4CA 3BD1A 5A7LA 1PRUA 2EBYA 1PRAA 3VK0A 3RZZA 2L49A 3BS3A 4X4GA 3OQOA 1JFSA 2GRLA 3CLCA 2XJ3A 1QP4A 1PRVA 2IU7A 1ZZ8A 1ZPQA 4X4EA 3OMTA 3U3WA 1VPWA 3SCFA 2R1JL 2JVLA 4Z5CA 1LCDA 3KJXA 4O8BA 4IA8A 2PE5A 3L1PA 3HZIB 3QYXA 2LYQA 4PU3C 2XCJA 3UFDA 1EFAA 2L8NA 1DWKA 1WH6A 3GN5A 3D1NI 3CROL 3SCHA 2HINA 4Z59A 1UXCA 1ZZBA 3G7DA 4PU7A 1OCTC 3KXAA 1ZZCA 2AWIA 2WUSR 3F6WA 1O4XA 3B7HA 4MCTA 1QP0A 2ICTA 1B0NA 1Y9QA 2XIUA 2PUEA 2A6CA 3JXDL 2OR1L 2HSGA 1JH9A 2IV1A 3KZ3A 2CROA 1XWRA 3JXCL 4Y42A 1GT0C 4X4BA 1QQAA 4J1WA 2BNOA 2BJCA 4YBAA 1RZRA 2OFYA 1HF0A 4Z5DA 3OQMA 2R63A 2KEIA 1BDHA 1ZS4A 2LYKA 2LYPA 1PERL 2D5VA 4GQMA 3ZHIA 2IVBA 3F51A 3GN5B 2KZ8A 4PU4C 3LFPA 2FJRA 1ZVVA 1LMB3 1ADRA 1OSLA 1ZAYA 2H8RA 2O49A 2IUOA 4JCXA 2LYJA 3G5GA 1Y7YA 2BNNA 1JFTA 2PUGA 4I6RA 2LYRA 4PU8A 4I8TA 3R1FA 2LCVA 2GZUA 1QQBA 3EUSA 1PNRA 1DW9A 3QQ6A 4X4DA 1LCCA 2AXUA 1WH8A 3QF3A 1IC8A 1WETA 3OQNA 1QPZA 4YG7B 2PUCA 3SCGA 1RIOA 4YG1A 3ZKCA 2AXZA 1ZUGA 2PUAA 3S8QA 2ICPA 3ZHMA 2KEKA 2AXVA 2O4AA 3O9XA 2O38A 1RZRD 4JCYA 3LISA 3DNVB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z58 A;  1RZS A;  3JXB C;  4F8D A;  4J1X A;  1CJG A;  1L1M A;  2XI8 A;  2B5A A;  1NER A;  1ZZ7 A;  1QP7 A;  2LYL A;  4Z5H A;  4FBI A;  3BDN A;  2MEZ A;  1R63 A;  3F52 A;  3FMY A;  4IVZ A;  4IWR A;  2LYS A;  2GRM A;  4NDW A;  1E3O C;  1LQC A;  2EWT A;  1ZZ9 A;  3PXP A;  4YAR A;  4X4F A;  1S7E A;  2PUF A;  2PIJ A;  2IVG A;  4GHJ A;  1WIZ A;  2IVQ A;  1R69 A;  4I6U A;  3TRB A;  5K98 B;  4OB4 A;  2PUD A;  1YSE A;  3QWG A;  1SQ8 A;  1RPE L;  1POU A;  2EF8 A;  2PPX A;  3GBF A;  2CSF A;  2AUW A;  1UTX A;  1BDI A;  1ZZ6 A;  2XSD C;  4YG4 A;  2JCG A;  2PUB A;  1CQT A;  1X2L A;  3FYM A;  4X4H A;  2KEJ A;  1NEQ A;  2BNM A;  4JQD A;  3OP9 A;  2MQK A;  2AW6 A;  3IVP A;  4I6T A;  1X57 A;  2KPJ A;  4FN3 A;  4MCX A;  4X4I A;  3H5T A;  1JWL A;  1LLI A;  3FYA A;  3MLF A;  2WIU B;  1UXD A;  1AU7 A;  3CEC A;  4X4C A;  3BD1 A;  5A7L A;  1PRU A;  2EBY A;  1PRA A;  3VK0 A;  3RZZ A;  2L49 A;  3BS3 A;  4X4G A;  3OQO A;  1JFS A;  2GRL A;  3CLC A;  2XJ3 A;  1QP4 A;  1PRV A;  2IU7 A;  1ZZ8 A;  1ZPQ A;  4X4E A;  3OMT A;  3U3W A;  1VPW A;  3SCF A;  2R1J L;  2JVL A;  4Z5C A;  1LCD A;  3KJX A;  4O8B A;  4IA8 A;  2PE5 A;  3L1P A;  3HZI B;  3QYX A;  2LYQ A;  4PU3 C;  2XCJ A;  3UFD A;  1EFA A;  2L8N A;  1DWK A;  1WH6 A;  3GN5 A;  3D1N I;  3CRO L;  3SCH A;  2HIN A;  4Z59 A;  1UXC A;  1ZZB A;  3G7D A;  4PU7 A;  1OCT C;  3KXA A;  1ZZC A;  2AWI A;  2WUS R;  3F6W A;  1O4X A;  3B7H A;  4MCT A;  1QP0 A;  2ICT A;  1B0N A;  1Y9Q A;  2XIU A;  2PUE A;  2A6C A;  3JXD L;  2OR1 L;  2HSG A;  1JH9 A;  2IV1 A;  3KZ3 A;  2CRO A;  1XWR A;  3JXC L;  4Y42 A;  1GT0 C;  4X4B A;  1QQA A;  4J1W A;  2BNO A;  2BJC A;  4YBA A;  1RZR A;  2OFY A;  1HF0 A;  4Z5D A;  3OQM A;  2R63 A;  2KEI A;  1BDH A;  1ZS4 A;  2LYK A;  2LYP A;  1PER L;  2D5V A;  4GQM A;  3ZHI A;  2IVB A;  3F51 A;  3GN5 B;  2KZ8 A;  4PU4 C;  3LFP A;  2FJR A;  1ZVV A;  1LMB 3;  1ADR A;  1OSL A;  1ZAY A;  2H8R A;  2O49 A;  2IUO A;  4JCX A;  2LYJ A;  3G5G A;  1Y7Y A;  2BNN A;  1JFT A;  2PUG A;  4I6R A;  2LYR A;  4PU8 A;  4I8T A;  3R1F A;  2LCV A;  2GZU A;  1QQB A;  3EUS A;  1PNR A;  1DW9 A;  3QQ6 A;  4X4D A;  1LCC A;  2AXU A;  1WH8 A;  3QF3 A;  1IC8 A;  1WET A;  3OQN A;  1QPZ A;  4YG7 B;  2PUC A;  3SCG A;  1RIO A;  4YG1 A;  3ZKC A;  2AXZ A;  1ZUG A;  2PUA A;  3S8Q A;  2ICP A;  3ZHM A;  2KEK A;  2AXV A;  2O4A A;  3O9X A;  2O38 A;  1RZR D;  4JCY A;  3LIS A;  3DNV B; 
#chains in the Genus database with same CATH topology
 3NXH A;  4F8D A;  1CJG A;  1L1M A;  1QP7 A;  1ZZ7 A;  3BDN A;  2MEZ A;  1R63 A;  2LYS A;  2PXD A;  1ZZ9 A;  3QOX A;  2PXQ A;  5K98 B;  2V3C C;  1YSE A;  4EKI A;  3QWG A;  1POU A;  2CSF A;  4DE9 A;  2PUB A;  1CQT A;  3FYM A;  4OBM A;  3DM5 A;  3KL4 A;  1X57 A;  3H5T A;  1UXD A;  2EBY A;  1PRA A;  2L49 A;  2HCN A;  3BS3 A;  3CLC A;  2GRL A;  2J7U A;  2IU7 A;  4X4E A;  3OMT A;  2R1J L;  5DT2 A;  4EQZ A;  2LLV A;  3QYX A;  4PU3 C;  3GN5 A;  2HIN A;  1UXC A;  1ZZB A;  3G7D A;  1ZZC A;  3TFL A;  1B0N A;  2PUE A;  3JXD L;  1JH9 A;  2CRO A;  4X4B A;  4ER6 A;  3ME5 A;  4YBA A;  3ZPX A;  3GZD C;  3M9L A;  2PXF A;  1ZS4 A;  1PER L;  3OKZ A;  3ZHI A;  4Q2J A;  1OSL A;  2BNN A;  3R1F A;  1DW9 A;  4X4D A;  3QF3 A;  1QPZ A;  2PUC A;  1RIO A;  3MEJ A;  2AXZ A;  4DE8 A;  4EZI A;  2O4A A;  1RZR D;  3DNV B;  4FBI A;  3F52 A;  2PXE A;  1E3O C;  4ER7 A;  3R09 A;  4I6U A;  3TRB A;  2EF8 A;  2ODR D;  1UTX A;  2XSD C;  2JCG A;  1DUL A;  1NEQ A;  4JQD A;  2MQK A;  4FN3 A;  1JWL A;  3MLF A;  2WIU B;  1AU7 A;  3VK0 A;  5JUW A;  4X4G A;  3OQO A;  1QP4 A;  2PXK A;  1ZZ8 A;  5DTQ A;  2JVL A;  3G0T A;  3L1P A;  2XCJ A;  2L8N A;  1DWK A;  3D1N I;  3CRO L;  3SCH A;  3GZD A;  3UWP A;  4PU7 A;  1OCT C;  2AWI A;  2WUS R;  1O4X A;  3B7H A;  2ICT A;  3JXC L;  3A9Y A;  2OFY A;  1RZR A;  4Z5D A;  3OQM A;  5DRT A;  3F51 A;  1MFQ C;  2FJR A;  1ZVV A;  1LMB 3;  1ADR A;  2IUO A;  3G5G A;  3A9Z A;  1HQ1 A;  3EUS A;  2FFH A;  4YG1 A;  2LLW A;  3S8Q A;  3ZHM A;  3VWS A;  4JCY A;  2XI8 A;  1NER A;  4IVZ A;  2PXB A;  2GRM A;  3OWQ A;  1LQC A;  2EWT A;  4YAR A;  4X4F A;  1S7E A;  2IVG A;  4GHJ A;  2IVQ A;  1R69 A;  2PUD A;  4OB4 A;  1SQ8 A;  2PPX A;  2M4H A;  2PXP A;  2AUW A;  1BDI A;  1ZZ6 A;  4YG4 A;  2BNM A;  3OP9 A;  2AW6 A;  3IVP A;  4MCX A;  5DRY A;  1LLI A;  3FYA A;  5DTR A;  3BD1 A;  3SX0 A;  5A7L A;  4EKG A;  3RZZ A;  3QOW A;  1JFS A;  2XJ3 A;  1VPW A;  3KJX A;  4O8B A;  4IA8 A;  3HZI B;  3UFD A;  1WH6 A;  4Z59 A;  1QP0 A;  2XIU A;  2A6C A;  2PXL A;  3KZ3 A;  1XWR A;  4Y42 A;  1QQA A;  4HRA A;  2R63 A;  3TEP A;  2KEI A;  1BDH A;  2LYP A;  3PE5 A;  3A9X A;  3LFP A;  4ER0 A;  1ZAY A;  2O49 A;  4JCX A;  2LYJ A;  5DSX A;  2HCS A;  3TEL A;  4PU8 A;  4I8T A;  1QQB A;  3QQ6 A;  1LCC A;  2AXU A;  1IC8 A;  3SCG A;  3ZKC A;  3NRO A;  2ICP A;  3O9X A;  2JQE A;  3LIS A;  4Z58 A;  1RZS A;  3JXB C;  4J1X A;  2B5A A;  2LYL A;  4Z5H A;  3NZL A;  3GUU A;  3NDB B;  3FMY A;  4IWR A;  4NDW A;  3SR4 A;  3PXP A;  3LQX A;  2PUF A;  2PIJ A;  1WIZ A;  2XXP A;  1RPE L;  3GBF A;  1NW3 A;  1X2L A;  4X4H A;  2KEJ A;  1QB2 A;  2PXV A;  4I6T A;  4X4I A;  2KPJ A;  5GAG i;  4ER5 A;  3CEC A;  4X4C A;  2J7W A;  1PRU A;  1PRV A;  3U3W A;  1ZPQ A;  3SCF A;  4Z5C A;  1LCD A;  5DTM A;  2PE5 A;  2VEO A;  1EFA A;  2LYQ A;  2HFZ A;  3KXA A;  1QZX A;  3F6W A;  4WVL A;  4MCT A;  1U2Z A;  1Y9Q A;  5GAH i;  2LNM A;  2YBD A;  2OR1 L;  2HSG A;  2IV1 A;  1GT0 C;  4J1W A;  2BNO A;  2BJC A;  4ER3 A;  2XXQ A;  1HF0 A;  2LYK A;  2D5V A;  4GQM A;  2IVB A;  3GN5 B;  2KZ8 A;  4PU4 C;  2PXU A;  2H8R A;  2MXD A;  1Y7Y A;  1JFT A;  3GZC A;  2PUG A;  4I6R A;  2PXT A;  2LYR A;  2LCV A;  2GZU A;  2L1P A;  1PNR A;  1WH8 A;  1WET A;  3OQN A;  4YG7 B;  1ZUG A;  2PUA A;  4EK9 A;  3QFI A;  2KEK A;  2AXV A;  2O38 A;  2XXA A; 
#chains in the Genus database with same CATH homology
 4Z58 A;  1RZS A;  3JXB C;  4F8D A;  4J1X A;  1CJG A;  1L1M A;  2XI8 A;  2B5A A;  1NER A;  1ZZ7 A;  1QP7 A;  2LYL A;  4Z5H A;  4FBI A;  3BDN A;  2MEZ A;  1R63 A;  3F52 A;  3FMY A;  4IVZ A;  4IWR A;  2LYS A;  2GRM A;  4NDW A;  1E3O C;  1LQC A;  2EWT A;  1ZZ9 A;  3PXP A;  4YAR A;  4X4F A;  1S7E A;  2PUF A;  2PIJ A;  2IVG A;  4GHJ A;  1WIZ A;  2IVQ A;  1R69 A;  4I6U A;  3TRB A;  5K98 B;  4OB4 A;  2PUD A;  1YSE A;  3QWG A;  1SQ8 A;  1RPE L;  1POU A;  2EF8 A;  2PPX A;  3GBF A;  2CSF A;  2AUW A;  1UTX A;  1BDI A;  1ZZ6 A;  2XSD C;  4YG4 A;  2JCG A;  2PUB A;  1CQT A;  1X2L A;  3FYM A;  4X4H A;  2KEJ A;  1NEQ A;  2BNM A;  4JQD A;  3OP9 A;  2MQK A;  2AW6 A;  3IVP A;  4I6T A;  1X57 A;  2KPJ A;  4FN3 A;  4MCX A;  4X4I A;  3H5T A;  1JWL A;  1LLI A;  3FYA A;  3MLF A;  2WIU B;  1UXD A;  1AU7 A;  3CEC A;  4X4C A;  3BD1 A;  5A7L A;  1PRU A;  2EBY A;  1PRA A;  3VK0 A;  3RZZ A;  2L49 A;  3BS3 A;  4X4G A;  3OQO A;  1JFS A;  2GRL A;  3CLC A;  2XJ3 A;  1QP4 A;  1PRV A;  2IU7 A;  1ZZ8 A;  1ZPQ A;  4X4E A;  3OMT A;  3U3W A;  1VPW A;  3SCF A;  2R1J L;  2JVL A;  4Z5C A;  1LCD A;  3KJX A;  4O8B A;  4IA8 A;  2PE5 A;  3L1P A;  3HZI B;  3QYX A;  2LYQ A;  4PU3 C;  2XCJ A;  3UFD A;  1EFA A;  2L8N A;  1DWK A;  1WH6 A;  3GN5 A;  3D1N I;  3CRO L;  3SCH A;  2HIN A;  4Z59 A;  1UXC A;  1ZZB A;  3G7D A;  4PU7 A;  1OCT C;  3KXA A;  1ZZC A;  2AWI A;  2WUS R;  3F6W A;  1O4X A;  3B7H A;  4MCT A;  1QP0 A;  2ICT A;  1B0N A;  1Y9Q A;  2XIU A;  2PUE A;  2A6C A;  3JXD L;  2OR1 L;  2HSG A;  1JH9 A;  2IV1 A;  3KZ3 A;  2CRO A;  1XWR A;  3JXC L;  4Y42 A;  1GT0 C;  4X4B A;  1QQA A;  4J1W A;  2BNO A;  2BJC A;  4YBA A;  1RZR A;  2OFY A;  1HF0 A;  4Z5D A;  3OQM A;  2R63 A;  2KEI A;  1BDH A;  1ZS4 A;  2LYK A;  2LYP A;  1PER L;  2D5V A;  4GQM A;  3ZHI A;  2IVB A;  3F51 A;  3GN5 B;  2KZ8 A;  4PU4 C;  3LFP A;  2FJR A;  1ZVV A;  1LMB 3;  1ADR A;  1OSL A;  1ZAY A;  2H8R A;  2O49 A;  2IUO A;  4JCX A;  2LYJ A;  3G5G A;  1Y7Y A;  2BNN A;  1JFT A;  2PUG A;  4I6R A;  2LYR A;  4PU8 A;  4I8T A;  3R1F A;  2LCV A;  2GZU A;  1QQB A;  3EUS A;  1PNR A;  1DW9 A;  3QQ6 A;  4X4D A;  1LCC A;  2AXU A;  1WH8 A;  3QF3 A;  1IC8 A;  1WET A;  3OQN A;  1QPZ A;  4YG7 B;  2PUC A;  3SCG A;  1RIO A;  4YG1 A;  3ZKC A;  2AXZ A;  1ZUG A;  2PUA A;  3S8Q A;  2ICP A;  3ZHM A;  2KEK A;  2AXV A;  2O4A A;  3O9X A;  2O38 A;  1RZR D;  4JCY A;  3LIS A;  3DNV B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...