5GAHi

Rnc in complex with srp with detached ng domain
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
126
structure length
126
Chain Sequence
GFDLNDFLEQLRQMKNMGGXXXXXXXXXXXXXXXXXXXXXXDDKVLVRMEAIINSMTMKERAKPEIIKGSRKRRIAAGCGMQVQDVNRLLKQFDDMQRMMKKMKKGGXXXXXXXXXXXXXXXXXXX
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structures of the E. coli translating ribosome with SRP and its receptor and with the translocon.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords SRP 4.5S RNA
total genus 30
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2015-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
i PF00448 SRP54 SRP54-type protein, GTPase domain
i PF02881 SRP54_N SRP54-type protein, helical bundle domain
i PF02978 SRP_SPB Signal peptide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.30 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) Signal recognition particle, SRP54 subunit, M-domain 5gahi00
2PXPA 2PXQA 1QZXA 2PXVA 3DM5A 2PXTA 2V3CC 2PXKA 2XXAA 3NDBB 3KL4A 1DULA 2PXBA 1HQ1A 2PXUA 2PXFA 2PXLA 2PXDA 2PXEA 1QB2A 1MFQC 2JQEA 5GAGi 2FFHA 3LQXA 5GAHi
chains in the Genus database with same CATH superfamily
2OR1L 4Z59A 2L8NA 2PXQA 4FN3A 2KEJA 4ER0A 2KEKA 1PRAA 1RIOA 1PNRA 3ZPXA 2PXEA 4PU3C 4YG1A 4IVZA 4OB4A 2PUCA 3NZLA 4FBIA 2PUFA 2BNNA 4X4IA 2YBDA 1WH6A 2GRLA 2WIUB 3NDBB 4Z5CA 2XI8A 1WH8A 3GZDA 3U3WA 1OSLA 1UXDA 4GHJA 3GUUA 3BD1A 4ER5A 2R63A 3GN5A 4IA8A 2R1JL 1U2ZA 2IVBA 3OQOA 1E3OC 4EKIA 1UTXA 1ZAYA 3GN5B 1QPZA 1RPEL 1JWLA 1X57A 4HRAA 2PXUA 2HFZA 3FYMA 1ZUGA 4JCYA 2O4AA 1QZXA 3ZHMA 2EBYA 3UFDA 3ZHIA 4MCTA 3MLFA 5DTQA 5DTMA 5DRTA 2PUAA 2XSDC 2XJ3A 1ZZCA 1ZS4A 4F8DA 1SQ8A 2O38A 4PU8A 3FYAA 3NXHA 1L1MA 2PXTA 2ICPA 3S8QA 3QOWA 3KL4A 3CLCA 1EFAA 1VPWA 2OFYA 4JQDA 4EZIA 3H5TA 2BNMA 2PUEA 2L49A 1MFQC 2PPXA 3OKZA 4DE8A 2GZUA 2HCNA 2LYKA 4DE9A 1LCCA 2V3CC 3KJXA 3SCHA 3KZ3A 2AW6A 3O9XA 3JXDL 2B5AA 3B7HA 1PERL 2LYPA 1JFTA 1B0NA 2CROA 3SCFA 1DWKA 1PRVA 3SX0A 4X4EA 1WIZA 3BDNA 1Y7YA 1X2LA 1AU7A 1RZRA 1OCTC 2H8RA 2MEZA 2PUDA 2BJCA 1XWRA 2ODRD 3SCGA 2HINA 1ZZ9A 3OMTA 1ZZ6A 2J7UA 3FMYA 3RZZA 2XCJA 2AXVA 3JXCL 3HZIB 3DM5A 3OP9A 4J1WA 2LYLA 1WETA 3OQMA 1LMB3 2FJRA 4ER3A 3ME5A 3QYXA 2L1PA 3F52A 5A7LA 4Y42A 4I8TA 2PE5A 4OBMA 3TEPA 4YARA 5GAHi 1ZZBA 1POUA 2J7WA 2ICTA 1DW9A 2D5VA 4GQMA 2XXAA 3BS3A 2O49A 3L1PA 1Y9QA 2PXFA 3OWQA 1QP0A 2IU7A 1YSEA 3QFIA 2A6CA 3GZDC 3JXBC 1QP4A 2AXZA 3MEJA 3G5GA 2XIUA 1RZSA 1GT0C 4IWRA 3QWGA 2IUOA 3NROA 1NEQA 3GBFA 1NERA 2XXPA 3SR4A 4Z5HA 3PXPA 5DRYA 2AWIA 1NW3A 3R09A 5DT2A 3DNVB 3TRBA 2PXDA 2AUWA 2WUSR 2FFHA 3CECA 1LLIA 2EWTA 1UXCA 3G0TA 3R1FA 2IVGA 4YBAA 3VWSA 1LQCA 2XXQA 2LYJA 4EKGA 3QQ6A 4ER7A 1BDIA 2AXUA 1QQAA 4I6TA 2LYSA 2BNOA 2MXDA 3PE5A 5JUWA 2JQEA 3LQXA 2LLWA 3GZCA 3OQNA 2HCSA 2MQKA 1ZZ8A 4O8BA 4J1XA 1JFSA 4PU7A 2LYQA 3ZKCA 2PXVA 3QF3A 1CQTA 2M4HA 4EK9A 2PXBA 5DTRA 2PXLA 2VEOA 4X4FA 5K98B 1QQBA 2KPJA 2LCVA 1ZVVA 1RZRD 2CSFA 2LNMA 4Z5DA 3G7DA 2PXKA 4PU4C 3A9XA 4EQZA 2LYRA 3F6WA 4X4DA 1HQ1A 1ADRA 2PUBA 4ER6A 2JCGA 2IVQA 1QB2A 1S7EA 3LFPA 3LISA 4WVLA 1CJGA 4X4CA 4X4HA 4YG4A 1PRUA 2IV1A 1BDHA 4X4BA 2LLVA 3CROL 1ZZ7A 4X4GA 1ZPQA 4YG7B 2PUGA 4Z58A 3EUSA 3QOXA 1QP7A 1IC8A 3F51A 4I6RA 2PIJA 1JH9A 1LCDA 3A9ZA 2KZ8A 4JCXA 3TELA 1R69A 5GAGi 2HSGA 1R63A 4NDWA 2JVLA 2EF8A 1O4XA 2GRMA 2PXPA 3KXAA 4I6UA 3VK0A 3IVPA 5DSXA 4Q2JA 3TFLA 1DULA 3A9YA 1HF0A 4MCXA 2KEIA 3UWPA 3M9LA 3D1NI
chains in the Genus database with same CATH topology
2PXPA 2PXQA 1QZXA 2PXVA 3DM5A 2PXTA 2V3CC 2PXKA 2XXAA 3NDBB 3KL4A 1DULA 2PXBA 1HQ1A 2PXUA 2PXFA 2PXLA 2PXDA 2PXEA 1QB2A 1MFQC 2JQEA 5GAGi 2FFHA 3LQXA 5GAHi
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PXP A;  2PXQ A;  1QZX A;  2PXV A;  3DM5 A;  2PXT A;  2V3C C;  2PXK A;  2XXA A;  3NDB B;  3KL4 A;  1DUL A;  2PXB A;  1HQ1 A;  2PXU A;  2PXF A;  2PXL A;  2PXD A;  2PXE A;  1QB2 A;  1MFQ C;  2JQE A;  5GAG i;  2FFH A;  3LQX A;  5GAH i; 
#chains in the Genus database with same CATH topology
 2OR1 L;  4Z59 A;  2L8N A;  2PXQ A;  4FN3 A;  2KEJ A;  4ER0 A;  2KEK A;  1PRA A;  1RIO A;  1PNR A;  3ZPX A;  2PXE A;  4PU3 C;  4YG1 A;  4IVZ A;  4OB4 A;  2PUC A;  3NZL A;  4FBI A;  2PUF A;  2BNN A;  4X4I A;  2YBD A;  1WH6 A;  2GRL A;  2WIU B;  3NDB B;  4Z5C A;  2XI8 A;  1WH8 A;  3GZD A;  3U3W A;  1OSL A;  1UXD A;  4GHJ A;  3GUU A;  3BD1 A;  4ER5 A;  2R63 A;  3GN5 A;  4IA8 A;  2R1J L;  1U2Z A;  2IVB A;  3OQO A;  1E3O C;  4EKI A;  1UTX A;  1ZAY A;  3GN5 B;  1QPZ A;  1RPE L;  1JWL A;  1X57 A;  4HRA A;  2PXU A;  2HFZ A;  3FYM A;  1ZUG A;  4JCY A;  2O4A A;  1QZX A;  3ZHM A;  2EBY A;  3UFD A;  3ZHI A;  4MCT A;  3MLF A;  5DTQ A;  5DTM A;  5DRT A;  2PUA A;  2XSD C;  2XJ3 A;  1ZZC A;  1ZS4 A;  4F8D A;  1SQ8 A;  2O38 A;  4PU8 A;  3FYA A;  3NXH A;  1L1M A;  2PXT A;  2ICP A;  3S8Q A;  3QOW A;  3KL4 A;  3CLC A;  1EFA A;  1VPW A;  2OFY A;  4JQD A;  4EZI A;  3H5T A;  2BNM A;  2PUE A;  2L49 A;  1MFQ C;  2PPX A;  3OKZ A;  4DE8 A;  2GZU A;  2HCN A;  2LYK A;  4DE9 A;  1LCC A;  2V3C C;  3KJX A;  3SCH A;  3KZ3 A;  2AW6 A;  3O9X A;  3JXD L;  2B5A A;  3B7H A;  1PER L;  2LYP A;  1JFT A;  1B0N A;  2CRO A;  3SCF A;  1DWK A;  1PRV A;  3SX0 A;  4X4E A;  1WIZ A;  3BDN A;  1Y7Y A;  1X2L A;  1AU7 A;  1RZR A;  1OCT C;  2H8R A;  2MEZ A;  2PUD A;  2BJC A;  1XWR A;  2ODR D;  3SCG A;  2HIN A;  1ZZ9 A;  3OMT A;  1ZZ6 A;  2J7U A;  3FMY A;  3RZZ A;  2XCJ A;  2AXV A;  3JXC L;  3HZI B;  3DM5 A;  3OP9 A;  4J1W A;  2LYL A;  1WET A;  3OQM A;  1LMB 3;  2FJR A;  4ER3 A;  3ME5 A;  3QYX A;  2L1P A;  3F52 A;  5A7L A;  4Y42 A;  4I8T A;  2PE5 A;  4OBM A;  3TEP A;  4YAR A;  5GAH i;  1ZZB A;  1POU A;  2J7W A;  2ICT A;  1DW9 A;  2D5V A;  4GQM A;  2XXA A;  3BS3 A;  2O49 A;  3L1P A;  1Y9Q A;  2PXF A;  3OWQ A;  1QP0 A;  2IU7 A;  1YSE A;  3QFI A;  2A6C A;  3GZD C;  3JXB C;  1QP4 A;  2AXZ A;  3MEJ A;  3G5G A;  2XIU A;  1RZS A;  1GT0 C;  4IWR A;  3QWG A;  2IUO A;  3NRO A;  1NEQ A;  3GBF A;  1NER A;  2XXP A;  3SR4 A;  4Z5H A;  3PXP A;  5DRY A;  2AWI A;  1NW3 A;  3R09 A;  5DT2 A;  3DNV B;  3TRB A;  2PXD A;  2AUW A;  2WUS R;  2FFH A;  3CEC A;  1LLI A;  2EWT A;  1UXC A;  3G0T A;  3R1F A;  2IVG A;  4YBA A;  3VWS A;  1LQC A;  2XXQ A;  2LYJ A;  4EKG A;  3QQ6 A;  4ER7 A;  1BDI A;  2AXU A;  1QQA A;  4I6T A;  2LYS A;  2BNO A;  2MXD A;  3PE5 A;  5JUW A;  2JQE A;  3LQX A;  2LLW A;  3GZC A;  3OQN A;  2HCS A;  2MQK A;  1ZZ8 A;  4O8B A;  4J1X A;  1JFS A;  4PU7 A;  2LYQ A;  3ZKC A;  2PXV A;  3QF3 A;  1CQT A;  2M4H A;  4EK9 A;  2PXB A;  5DTR A;  2PXL A;  2VEO A;  4X4F A;  5K98 B;  1QQB A;  2KPJ A;  2LCV A;  1ZVV A;  1RZR D;  2CSF A;  2LNM A;  4Z5D A;  3G7D A;  2PXK A;  4PU4 C;  3A9X A;  4EQZ A;  2LYR A;  3F6W A;  4X4D A;  1HQ1 A;  1ADR A;  2PUB A;  4ER6 A;  2JCG A;  2IVQ A;  1QB2 A;  1S7E A;  3LFP A;  3LIS A;  4WVL A;  1CJG A;  4X4C A;  4X4H A;  4YG4 A;  1PRU A;  2IV1 A;  1BDH A;  4X4B A;  2LLV A;  3CRO L;  1ZZ7 A;  4X4G A;  1ZPQ A;  4YG7 B;  2PUG A;  4Z58 A;  3EUS A;  3QOX A;  1QP7 A;  1IC8 A;  3F51 A;  4I6R A;  2PIJ A;  1JH9 A;  1LCD A;  3A9Z A;  2KZ8 A;  4JCX A;  3TEL A;  1R69 A;  5GAG i;  2HSG A;  1R63 A;  4NDW A;  2JVL A;  2EF8 A;  1O4X A;  2GRM A;  2PXP A;  3KXA A;  4I6U A;  3VK0 A;  3IVP A;  5DSX A;  4Q2J A;  3TFL A;  1DUL A;  3A9Y A;  1HF0 A;  4MCX A;  2KEI A;  3UWP A;  3M9L A;  3D1N I; 
#chains in the Genus database with same CATH homology
 2PXP A;  2PXQ A;  1QZX A;  2PXV A;  3DM5 A;  2PXT A;  2V3C C;  2PXK A;  2XXA A;  3NDB B;  3KL4 A;  1DUL A;  2PXB A;  1HQ1 A;  2PXU A;  2PXF A;  2PXL A;  2PXD A;  2PXE A;  1QB2 A;  1MFQ C;  2JQE A;  5GAG i;  2FFH A;  3LQX A;  5GAH i; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...