1GT0C

Crystal structure of a pou/hmg/dna ternary complex
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
155
structure length
137
Chain Sequence
PSDLEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMSKLKPLLEKWLNDAENLGLSRRRKKRTSIETNIRVALEKSFLENQKPTSEEITMIADQLNMEKEVIRVWFSNRRQKEKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*TP*TP*CP*TP*TP*TP*GP*TP*TP*TP* GP*GP*AP* TP*GP*CP*TP*A
publication title Crystal Structure of a POU/Hmg/DNA Ternary Complex Suggests Differential Assembly of Oct4 and Sox2 on Two Enhancers
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 46
structure length 137
sequence length 155
ec nomenclature
pdb deposition date 2002-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00046 Homeodomain Homeodomain
C PF00157 Pou Pou domain - N-terminal to homeobox domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1gt0C02
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 1gt0C01
3I4NJ 2CJJA 2DJNA 1OJLA 5FJ8J 4I76A 3S1QJ 3BS3A 3FKIJ 5E3OA 2L8NA 1LMB3 3ZQHA 3LNQA 2NS8A 1P7JA 5M3MJ 3CQZJ 2AXVA 1T56A 3JREA 5K98B 1QP7A 3HOYJ 1ZPQA 2KT0A 2YS9A 1YSEA 1PRVA 2E19A 1DU0A 1LCDA 2JJ7A 1MBJA 4A93J 2ME0A 3RZZA 2L7ZA 4EEFG 2DA4A 4I6ZA 3BR1A 1ZAYA 2KEKA 4A3EJ 1JH9A 4JCYA 4FE4A 3OMTA 2CSFA 2L9RA 4BKXA 4Y52J 1BDIA 3HM5A 3GN5B 2X6OA 3R1FA 1ZTRA 1RKTA 4A3FJ 1B72B 1FIAA 2O4AA 1W0TA 1O4XA 4X4CA 2XGCA 4G12A 4GFBA 4A3DJ 2O8KA 2ID6A 1JTYA 2L7MP 3TW6A 3F52A 1HDDC 1RR7A 5J1UA 3HEFA 4AYBN 1RIOA 2D5VA 5IP7J 1DW9A 2FX0A 2M8GX 3PM1A 1NK2P 2TRTA 3KXAA 2K9SA 2PPXA 1PNRA 4QTRA 4Z58A 1Z77A 1QQBA 5FLVA 5EGOB 1F43A 2XB5A 2LYSA 4UUSA 1JWLA 3LSJA 1IG7A 1ZQ3P 4AUXA 5DS9A 5IP9J 1DU6A 3MVPA 4QIWN 1OSLA 3G1MA 2JA7J 2FJ1A 4PU4C 2DA2A 3JRHA 1S7EA 3RZDJ 3BTJA 1PERL 2JVLA 1Z0XA 2DMPA 3UFDA 1AKHB 5IOYA 1BDHA 4Y7NJ 5C3EJ 3IH2A 1X2MA 5F0FA 4S0HB 1ZGWA 1T33A 1FTTA 3TEDA 3BG9A 3NAUA 3G1OA 1RESA 5J3LA 2HXOA 4JP0A 3GTJJ 3HKZN 1PUFA 1IDYA 1JJ8C 4XIDA 5J1RA 3BTIA 2HQ5A 1EF4A 1MBGA 3HGYA 1CJGA 2XPVA 2B5AA 3HB9A 2LLKA 2GBYA 2R0QC 2FJRA 1ORKA 3JXBC 3G5GA 3A03A 1EFAA 2R5ZB 3ZHIA 2PUEA 4A3GJ 3BR3A 1QRYA 2NS7A 3BDNA 3OQOA 3E7LA 4M3DA 1U9NA 1LE8A 3HOWJ 5GPAA 3BD1A 1JUMA 2R1JL 2PE5A 1BW5A 2EBIA 3VK0A 3ZKCA 4X1EA 1AU7A 3S8QA 4V2GA 4D7NA 3M3YJ 1TWAJ 3FIWA 2VKVA 4X4HA 5BNGA 1JKOC 5E3MA 5A7LA 3JRAA 4D5FA 1IUFA 4CYCB 1GDTA 4BBRJ 3QF3A 2BJCA 1MSFC 2JA6J 4X4GA 2R92J 2QCOA 4X4IA 5F1JA 1YRNB 1UTXA 3RZOJ 2HXIA 5K7FA 1MBFA 3K2AA 1ZUGA 5FKKA 2XGEA 1VPWA 3B6CA 3DEWA 1W0UA 4BY1J 1RZRD 1UXCA 4YARA 3WHCA 3D1NI 4X4EA 2PUAA 4A3LJ 3SCHA 2WAQN 3S15J 3Q3SA 1APLC 4JCXA 2E1OA 3F0CA 3A02A 2ECBA 4LOCA 1JFTA 1LCCA 4B3AA 3MKLA 2EZHA 2DA3A 2CQQA 3ZQGA 1QVTA 2HI3A 5FKNA 1WH6A 2XSDC 3JRBA 5EG0A 1POGA 1FIPA 1X58A 2JWTA 5F0CA 3O8GA 4HNVA 1CQTA 2YU9J 4A3JJ 4J1WA 1IJWC 4AC0A 3FISA 2MW8A 2L0KA 2PMZN 1RZSA 3H5TA 3RKQA 3S17J 3EUSA 3JXDL 3QQ6A 4MO7A 3OQNA 4FN3A 2PUDA 1QPIA 1JFSA 2I10A 4J1XA 2GM4A 5M5WJ 2ZB9A 3FK6A 1NK3P 3PO2J 4D7MA 2PUCA 1A6IA 1HCRA 4X4FA 4IVZA 2EH3A 4RDUA 3QPSA 1B0NA 5F27A 1IC8A 1ZZCA 4V2FA 2K9QA 4A3KJ 5J1YA 3SDGA 2M2EA 4Z5HA 2CUEA 4Z5CA 4JQDA 2PUBA 2ICPA 2DMQA 2G0EA 4IA8A 2CU7A 3IH4A 3BT9A 1IGNA 1MBHA 2HYJA 3LOCA 3O8HA 5GPCA 1Y1WJ 5FKMA 2LYRA 1XG1A 3TRBA 3BTCA 2K40A 2EBYA 4GHJA 3A01B 3GTQJ 2K9NA 1TC3C 4MCTA 2AXUA 3HOZJ 2IVGA 1LFBA 2DA5A 3JRCA 1ADRA 3LFPA 2EZKA 3OP9A 3JRFA 4DYQA 2W48A 1MBKA 1U8BA 2HOAA 3GTMJ 2KPJA 2XJ3A 3G1LA 1ETKA 2R5YA 3IH3A 4Z59A 4M3GA 4RBOA 2JK3A 2VI6A 3HBLA 4XRSA 2LVSA 3CMYA 1TWHJ 1QPZA 1NTCA 1WH7A 2LYLA 4A3MJ 3DCFA 1GV5A 1D5YA 1DWKA 4DYCA 1FJLA 2LYJA 2DMTA 2XB0X 4IWRA 2GLOA 2NVTJ 1ZZBA 4X4DA 3BQZA 4ABZA 3HZIB 4MLOA 1I50J 4FTHA 2IV1A 2KDZA 1B8IA 3CECA 1K83J 1GV2A 3BR6A 2MG4A 4NDLA 3O9XA 1I6HJ 1ETOA 5F08A 5IYDJ 1NERA 1X2NA 1IDZA 2HSGA 1ZR2A 2E2JJ 2VKEA 1RPWA 4C3JJ 3BQYA 5K7HA 4DZPA 5HODA 1QP4A 4JX6A 2XCJA 2Y9YA 3BR0A 2ECCA 2CROA 3IVPA 1RETA 4UUSB 4GQMA 1QQAA 2H1KA 1ZR4A 1JTXA 1WCMJ 4X6AJ 4M3FA 5IOZA 4A3CJ 2RAEA 3JRIA 1E3OC 5E3NA 2WIUB 2TCTA 3C2BA 3S2DJ 2P81A 3H3VK 1JUSA 2LR8A 2DTZA 2IEKA 2OPTA 3ZQCA 1WH8A 4FBIA 3GTOJ 3LSGA 4MFDA 4J19A 9ANTA 1Y7YA 4Y42A 5K7ZA 1GVDA 3QQAA 3M4OJ 2MGQA 2OR1L 3ZQFA 1HLVA 3Q0VA 3OSFA 1PUFB 1MSEC 3HGGA 1ETXA 1ZZ9A 1MH4A 5FLMJ 1HF0A 3BG5A 3IV5A 2FD5A 1ENHA 2CUFA 3HOXJ 2NVXJ 4BBSJ 4A69C 5JLXA 1VFCA 1OCPA 2AHQA 2AO9A 1LFUP 2ME6A 4IHWA 2Y0SN 2KEJA 1JUPA 2NVYJ 1LE8B 2A6CA 2AUWA 1ETWA 1Y1VJ 1ZKGA 2WB1N 3LSPA 3BR2A 3S16J 1U78A 4Z5DA 2X48A 1BW6A 2Y9ZA 1ETYA 3MLFA 4X4BA 2PUGA 3MN2A 4XRMA 3SJMA 2X9DA 3B7HA 2CRGA 1PRAA 2QF7A 2MQKA 2AWIA 3TP3A 1IV6A 4YBAA 1JKRC 1OFCX 3BTLA 1K61A 3GTPJ 3TP0A 1H89C 3GN5A 2MEZA 1B72A 2CQXA 3OQMA 2M9HA 2ELKA 2LK2A 1WI3A 1JJ6C 3GTGJ 2IUOA 1JT6A 2LTPA 2LYKA 4MFEA 3VPRA 2EF8A 4PU3C 4BY7J 3JR9A 3F51A 3F6WA 2PUFA 1ZZ6A 5C4JJ 1XWRA 2EQRA 2DMNA 1AHDP 2FQ4A 4FCYA 1LLIA 5F0HA 2KEIA 2HOSA 3BG3A 5EGOA 2HINA 2LKXA 3FYMA 5EG0B 4M6VA 3Q0UA 1R9TJ 1ZZ8A 3RQIA 2GRMA 4I8TA 1R69A 5EEAA 1X2LA 3ZHMA 4MCXA 2LY9A 1BL0A 1TWGJ 4D5CA 4PU7A 3ZQLA 2JCGA 1AKHA 4C3IJ 1JGGA 3NARA 3JRDA 1P7IA 5IPAA 1SFOJ 2XIUA 1WPKA 3S1MJ 1QVUA 3OOUA 1BA5A 5IYBJ 3L1PA 3OIOA 2BNOA 5EZGA 3TW7A 2JA8J 5IYCJ 4IHXA 2EZIA 2Y30A 5EDNA 2GZUA 1I3QJ 4I6UA 2O7OA 2ICTA 2JA5J 4JX4A 2R5ZA 4C2MJ 2IAIA 4W1UA 1VF9A 4DYRA 5EF6A 2DA7A 3WHBA 4B4CA 1TWFJ 3K7AJ 1WH5A 3BR5A 1OCTC 4XK4A 3S2HJ 1ZVVA 2XRLA 3W6VA 2R93J 5F04A 1MBEA 2VUMJ 3UKGA 3U3WA 2O9LA 4I6RA 4O8BA 4XICA 2R63A 2HDDA 2Y31A 5FKOA 3S1RJ 3G7DA 1HOMA 3Q0WA 3PXPA 5M5XJ 1H8AC 2M0CA 5EYRA 5EZHA 4YG1A 4CYCA 5M3FJ 2LD5A 3GBGA 1RKWA 3S1NJ 4A3BJ 1SANA 2PIJA 3SFIA 3GTLJ 2NVQJ 1PRUA 1FEXA 3B6AA 3SCGA 1YRNA 2L7FP 2EWTA 4FISA 2R5YB 2R7ZJ 4BXXJ 1IRZA 5GP9A 1ZK8A 1HDPA 3OSGA 4JX5A 4DW6A 4F8DA 1FTZA 4QSHA 3JXCL 1ITYA 2L49A 2VPRA 5JLWA 1JKPC 2GRLA 2DMUA 1XC5A 1POUA 2XGDA 1F36A 4A3IJ 2O49A 4M3EA 1RZRA 1UG2A 3CCYA 2OF7A 1UXDA 5M5YJ 3I4MJ 1XS9A 3DNVB 2MSYA 2E2HJ 2BNMA 2B63J 1ETQA 4YG4A 2H8RA 1JKQC 2JN6A 3ZOBA 1B8IB 4OB4A 1RPEL 4C3HJ 1NEQA 3CDLA 2XPWA 3HDDA 4IHYA 1TWCJ 2HOTA 3QWGA 1ZZ7A 1WGXA 2JMWA 3H0GJ 1UMQA 5IP6A 2YUSA 2IBDA 3FK7A 1G2HA 1LQCA 2DN0A 3PO3J 3LSRA 2AW6A 3GBFA 3SCFA 1GT0C 2LFBA 4IEJA 3KZ3A 1A5JA 2DA6A 3GTKJ 1WIZA 4NDWA 4XRSG 4PU8A 4YG7B 4L5EA 2LYPA 3QYXA 3ZQIA 4UUTA 5FKLA 3JRGA 1L1MA 2Y2ZA 1JT0A 5C44J 1WETA 1Q1VA 3QPLA 2IU7A 2WV1A 3HOUJ 2COBA 1UHSA 1VNDA 2LP0A 4IHVA 2OFYA 1QP0A 1U9OA 2AXZA 2WUSR 1MH3A 2BNNA 2KZ8A 4M3BA 2LCVA 2XPUA 2LYQA 2EZLA 1H88C 4JYKA 1SQ8A 1Y9QA 5DTDA 3CLCA 2ID3A 2NOGA 3KJXA 4W97A 2XI8A 3FMYA 4DZJA 2DA1A 1X57A 3FYAA 1R63A 1ZS4A 4B1RA 3CROL 2O38A 4I6TA 1ETVA 3A01A 1VI0A 2M34A 1MNMC 3S14J 3HOVJ 5C4XJ 2IVQA 1GUUA 1BJZA 2N8GA 2E2IJ 2IVBA 3LISA 5E3LA 4FE7A 4MIMA
chains in the Genus database with same CATH superfamily
3LA2A 3I4NJ 3S1QJ 1B9MA 3WTSC 4I76A 3P5JA 2L8NA 3ZQHA 3PSIA 5EEGA 1P7JA 2KJBA 3TDUC 3ZN1A 1UELB 1VQ9I 5H6QA 3CQZJ 4AYBA 2OZUA 5E1WA 3MEJA 1QP7A 4UV9A 4L5IA 3A2KA 1ZPQA 5LRRA 2JJ7A 3ZMSA 5FB2A 4I02A 1YX3A 4EEFG 4ESBA 1IW7F 1VQ5I 3TFLA 2A6TA 3OMTA 3LWFA 4BKXA 3ZCOA 1J9IA 1BDIA 4Y3OA 3OS1A 1ZTRA 4GGGA 1FIAA 4Y15A 2O4AA 1WZ2A 3CUQA 2A3SA 2GOXB 4X4CA 3HHGA 2MC4A 2XGCA 1Z3YA 4HRIA 3K2ZA 3C7JA 3TW6A 3R09A 2A61A 1VQ7I 1RIOA 1OR7A 3HIFA 2FX0A 2J5PA 2M8GX 4RAGA 1NK2P 3G3ZA 2G7HA 5LBQA 4QPOA 4X0GA 4YIRX 3RYRA 3G73A 4UV8A 3DTIA 4HNTA 2LYSA 3OYGA 3IWFA 1RUOA 3LSHA 1JWLA 1DP7P 3FXMA 1NW3A 3MVPA 4RM3A 1ZRFA 1FBQA 1FP1D 3IHUA 2JA7J 2FJ1A 2OU2A 3QOEA 1KU2A 2ZXIA 1R5HA 2ESHA 3SXYA 1HQ1A 2Z16A 1PERL 2JVLA 1ZLKA 1UG0A 3OYKA 3I5UA 1BDHA 4EK9A 4Y7NJ 5C3EJ 2MFZA 1X2MA 4BQAA 4A12A 5JVGF 1T33A 2DPUA 2KZGA 3TEDA 3H35A 4ER3A 4P9FA 2V6CA 2F5VA 4N0BA 3M8EA 3BTIA 2HQ5A 2Z2SB 3PFYA 3NRVA 4NNJA 1IRFA 3MKZA 2XPVA 3RI4A 3HB9A 4HZFA 2GBYA 1E3HA 1BI3A 1ORKA 1MD0A 1YW7A 5GTIC 2FJRA 3G5GA 3J7AY 1R5GA 4A3GJ 3BR3A 1QRYA 1WJDA 2FOWA 4ETSA 1ZARA 2HTJA 3E7LA 4Z2YA 1IN6A 4IRHA 4J00A 2K86A 3LQQA 5L3CA 4Q5SF 1BW5A 2WAQA 3WGIA 4HF1A 3I0TA 2KL4A 2P4WA 4X1EA 4IL6C 4V2GA 1I27A 2K9LA 3OYJA 3CCEI 4X4HA 5BNGA 1T95A 3FXOA 2JSPA 2JRTA 3DLLF 3JRAA 1DP3A 2IA0A 1GDTA 4CYCB 2FNPA 2BJCA 1MSFC 2L4AA 3ZQ7A 2WA0A 3J7YJ 2YR2A 3G0TA 4X4IA 1MBFA 3C18A 5FKKA 2XGEA 4DE8A 3VWSA 1W36D 4E6KG 1BBYA 2GA2A 1LQ1A 2HYGD 2MLGA 4RA2A 2FF4A 3RSNA 4BY1J 4G6TB 3R6SA 2FSWA 2Y48A 4BNCA 3SCHA 1TNSA 1APLC 1Z1DA 5LHHA 2HDCA 3OL3A 2CW0F 1QZXA 4B3AA 2Z33A 3DF8A 4NC8A 4MTEA 3A9ZA 2F2EA 3S3MA 1J2XA 1R4NB 3GUDA 4C2UA 5HLGA 2DOAA 3LQRA 2OTLI 4NHJA 5FKNA 1T08B 2FOKA 3JRBA 5AONA 1FIPA 1Z91A 2GOMA 1VQLI 3CC7I 4AC0A 2L0KA 2PMZN 1RZSA 5B5EC 2IGMA 2WWYA 4YG2F 3WGHA 3S17J 3JXDL 4OIRF 2LC2A 3OQNA 2IVMA 3L2CA 1QPIA 2I10A 3HXLA 3C3WA 2ZB9A 3TEPA 1R23A 2PUCA 2GQQA 2E71A 1WJAA 5L3FA 2EH3A 1R71A 3V8LA 1D1CA 3PL8A 3IRQA 3PFIA 1B0NA 3GFIA 1IC8A 3F72A 1SC7A 2H94A 3SYTA 2QZ8A 4QPQA 2A05A 4ZC3A 3DXJF 2ICPA 4Z5CA 2PUBA 2DMQA 2G0EA 1S7OA 3L9FA 2W7NA 1IGNA 1MBHA 3CDHA 4II2A 4B47A 4A0YA 5J6XA 2M5WA 3F9KA 2FU4A 3TRBA 4RGXA 4M6XA 3UNGC 3GTQJ 4CCMA 5IY5H 1XGNA 3DTEA 4MCTA 1U2WA 5E20A 1YLFA 1ADRA 3LFPA 4DYQA 3BY6A 3ECHA 2JZYA 1U8BA 3HRTA 4MQVA 2STTA 2HVRA 2PI0A 5IT9K 4IO9F 2DJIA 4M3GA 1TWHJ 2K4JA 1QPZA 2K27A 4ZDPA 3RQ4A 2XB0X 3RPQA 4UB6C 2L02A 5HLIA 3WTZA 1VQ4I 4II3A 1ZAOA 4X4DA 2YPRA 4XBFA 2R7OA 5EEHA 1CGPA 1I50J 2IV1A 5CKTA 2HZTA 2KDZA 1K83J 2MG4A 2VLAA 1I6HJ 1ETOA 1MMNA 1NERA 3NWTA 2TDXA 2BHZA 3WU0A 2V7FA 2RDPA 3D0SA 4F93B 1RPWA 3BQYA 3E5UA 1QP4A 4PGHA 4ZYEA 1J7KA 1OCOH 2CROA 1R4MB 3H9GA 4UUSB 1WCMJ 4MNUA 4AU7A 3JRIA 1E3OC 1ON1A 4Z6YA 2TCTA 3C2BA 3CD6I 3H3VK 5HOOA 5DD4A 2V79A 2DTZA 2IEKA 2AXTC 4E7IA 1TW3A 3F8MA 3EUKL 3U21A 4J19A 1YE9A 2LY1A 4Y42A 1I5ZA 1I3AA 1WVRA 2LRDA 3EQLF 3M07A 4E7ZA 5HLTA 2ELHA 5J47A 2R7SA 3M4OJ 3VYRB 2H6CA 4EMSA 1PUFB 1YW9A 1R36A 1ETXA 1FOXA 2BHYA 3BG5A 1S7AA 2KZVA 2BGCA 4F55A 5JLXA 4DIQA 4MTDA 2AHQA 4EM0B 3P9IA 2A6CA 2M4HA 3ONQA 3CJNA 3E0JB 3FMSA 1UB9A 3L2UA 1Z05A 4ER6A 1OQYA 1ETWA 1MIJA 1Y1VJ 1ZKGA 3BR2A 3S16J 3QYBA 2E36A 1BW6A 4G9YA 2Y9ZA 1ETYA 2AS5F 1Y6IA 4X4BA 2PUGA 3KYDB 3MN2A 1RRJA 4XRMA 4UUVA 3SJMA 5FFZA 3CP8A 4CYDA 2MQKA 5LFAA 3TP3A 3HRMA 4XLEA 3BTLA 3GLXA 4BE0A 5D4RA 3OS0A 3GN5A 1B59A 2XC7A 3OQMA 3E6BA 2M9HA 5CVRA 1WJ5A 2ELKA 2LK2A 2HS5A 1WI3A 2I8DA 2LNBA 3RPUD 3WG9A 1JJ6C 5LD2C 2DXIA 2IUOA 2LYKA 1XGOA 2W25A 2EF8A 2MD0A 2K9MA 2MABA 3F6WA 4IJAA 2MH2A 2PUFA 2RGVA 5C4JJ 4I01A 2PG4A 2DMNA 1AHDP 4YIFA 2VXZA 4LIVA 3DU6A 2LG4A 4P5OA 1XSDA 3BG3A 4LG3A 2EFPA 1H9TA 4ZDLA 1ZZ8A 3RQIA 1BI2A 1FBUA 1R69A 4XKCA 4DBQA 2VT2A 4MQ9F 1FC3A 2G7UA 3AG4H 3VYUB 5LEKA 1BL0A 5BS6A 3MQ0A 2P6TA 2VOOA 4RGUA 3L2QA 1QU3A 2E60A 4EVIA 4OIOF 3AAFA 4R8HA 2XIUA 1WPKA 3ABLH 3BZCA 3S1MJ 2X6WA 2IA1A 3DV8A 3TDZC 3CCRI 4PJNA 5IYBJ 3OIOA 3U1DA 4P1WA 2JA8J 1RIOH 2H09A 2KPMA 2EZIA 4I6UA 1I3QJ 4PJJA 4L5JA 4I99C 2JA5J 4IPAA 4C2MJ 2IAIA 3TQNA 1VF9A 1ZG3A 4DYRA 3F3XA 4R79A 2VQCA 3G4SI 4B4CA 1QO0D 3BR5A 1OCTC 3GZNB 2Z9OA 2DT5A 3W3CA 3AKZA 1ODDA 1IRXA 1XMKA 2O9LA 2DOEA 3K9TA 2HTSA 5L3BA 2R63A 1W7PA 3BPXA 1GVJA 1AOYA 3UWPA 3PXPA 5GTHC 5M5XJ 2M0CA 5EYRA 4XM3A 3VYTB 4YG1A 5ICCA 3GBGA 4EV0A 2NVQJ 1D8JA 3B6AA 3H5RA 3N05A 3ABUA 2EWTA 1KU9A 2R7ZJ 5E1ZB 2WAEA 5GP9A 1IRZA 1UCRA 1ZK8A 1YQAA 1P6RA 1HDPA 3BZKA 3P9KA 4JX5A 4DW6A 1ZG5A 4L18B 2IS4A 3JXCL 4AVPA 4LJZF 4DGWB 4PDKA 5KAFC 1ZHFA 2L49A 1F36A 2FUG2 2M3AA 4XKWA 3CCMI 1UG2A 2BYVE 1IRGA 4D0PA 2MSYA 3F23A 2BNMA 2E5ZA 2E7WA 4DBRA 2MA3A 1XD7A 4OOIA 1JKQC 1B8IB 2GXAA 4XSXF 4A2UA 5ICEA 3QOWA 2XPWA 2HOTA 1WGXA 5TISC 1NG7A 4OIPF 2JMWA 3H0GJ 2L7KA 1G2HA 2KRCA 2IS2A 2V1XA 2DN0A 3PO3J 3NQOA 2AW6A 3GBFA 3SCFA 2Z99A 2ZMEA 3L2WA 1A5JA 3DU5A 2EWNA 4ASNA 3QYXA 4UHTA 1VQMI 2LYPA 2HNHA 2Y2ZA 2VJ5A 2KHMA 3A9XA 1FMWA 2COBA 1IO2A 2OFYA 5DCMB 1QP0A 1U9OA 4HLYA 4BL0B 2BNNA 3ZGKA 1F1ZA 2FE3A 4ZTFA 4UNOA 2CSOA 2F5CA 1B4AA 3SHFA 1T39A 1H88C 5TGTA 3I54A 2HFHA 1GXQA 3HOTA 3KJXA 3DWLE 4W97A 2VN2A 1PUEE 5LGUA 4FQGA 2HKOA 4U7DA 1HKSA 3MWMA 3FMYA 4NC6A 1R63A 4YELA 1LB2A 4BHPA 2PXLA 1YJWI 2O38A 3BWGA 5D4SA 1S5LC 1VI0A 2M34A 3A01A 3S14J 2N8GA 2BXZA 1XCBA 4MIMA 2QEXI 1MKMA 4XKVA 5DD8A 1PVEA 3FKIJ 5E3OA 2FMYA 1LPQA 1LMB3 4BJ6C 4CSWA 2V9KA 4CZZA 3LNQA 2H27A 5JFRA 1DUXC 4HOBA 5M3MJ 2AXVA 1T56A 2O8XA 1BIBA 1VQKI 5K98B 3CJTB 3FZVA 4BQOA 3HOYJ 5CQEA 3B02A 2E19A 1IZ1A 3FMQA 4HBLA 4OBMA 3RZZA 2IPQX 2R7UA 5K5OA 2P8TA 1PYVA 1ZAYA 1ONVA 2KEKA 4A3EJ 4FE4A 3JCUC 3I71A 1IN5A 4Y52J 2PXBA 1MFQC 4FETA 2X6OA 5B66C 2R7WA 1B72B 1QGPA 2JUGA 2P7CB 1FY7A 1YO5C 4KYWA 1EH7A 5H6RA 5CVUA 4A3DJ 2ID6A 1W36C 2L7MP 2DI3A 3QYEA 1RR7A 2DDBA 1B6AA 2XV4S 4AIDA 1ACIA 4RAZA 4J01A 1DW9A 1X19A 3PM1A 3HKZA 1BR4A 3KXAA 4XONA 2PPXA 1PNRA 4XNFA 1SD6A 4BACA 1B1BA 3T8TA 4Y17A 1F43A 1MNDA 2EINH 2NNNA 4LG0A 3LSJA 2CQNA 3E6CC 2BZTA 4AUXA 1DU6A 1OSLA 1M1EB 3G1MA 3ME5A 2M7BA 1R58A 2X1DA 3CCUI 2ZXWH 3BTJA 2P5LC 3OYBA 2C6YA 2MC3A 2H1LA 3LSIA 1Z0XA 4CCJA 4FX0A 5KCMA 2KQRA 3KEOA 1SAUA 2I5UA 2Z1DA 3I4PA 3I64A 3LMMA 5J4YA 4L9JA 3IH2A 3A1YA 5B1BH 2OCCH 4B8XA 4O3MA 5IT9Z 2PLYA 3NAUA 4JP0A 4LD5A 3BP8A 4NUBA 1YI2I 1IDYA 1MMSA 1EF4A 2XXPA 3J81Z 1XPXA 5CPRB 2B5AA 4WCGA 5JUWA 1XMXA 4IXAA 2R0QC 4IHSA 3A03A 2PUEA 2D1HA 2J7UA 3FM5A 5CVVA 3NDBB 1LE8A 3HOWJ 3W2WA 3LQXA 2CV1A 3K4JA 2QBYB 3KL4A 2E1MB 2R1JL 1U3EM 4D9JA 3FM3A 3VK0A 3S8QA 1AU7A 2BY1A 3L09A 4U7BA 1TWAJ 3U1KA 2X1EA 4UVCA 1JKOC 1IV8A 5E3MA 4XORA 1OYYA 2WC2A 3H0DA 1B9NA 2E1NA 3QF3A 1D3YA 4YEJA 2R92J 4ZDOA 5F1JA 2M45A 4H0EA 1XCVA 3NXHA 1RPEL 2HXIA 2QVOA 3ZMDA 1I6XA 2EIMH 3H9QA 4LIUA 1VPWA 3ABMH 5A2QK 3B6CA 3RPUA 4ZJZA 2EFWA 5ICGA 2HQRA 2W84A 3L00A 4BE1A 2ISZA 2HU9A 2JRMA 2KRFA 2W82A 4G6DA 4OU0A 3FBNB 3RTRA 3F0CA 3IUOA 1IN4A 4LOCA 1JFTA 1Z67A 1FLIA 1U8RA 1TNTA 2PX9A 3WG7H 1LKXA 3V8JA 2EZHA 4F52A 1SFKA 2CQQA 4XRFA 4KISA 1QVTA 4KN4X 2HI3A 4EKIA 1WH6A 2X51A 2XSDC 1ON2A 5EG0A 1X58A 3O8GA 1CQTA 1WJCA 3WU1B 2XGXA 4J1WA 1IJWC 2OQRA 4KMUX 2KISA 3CMAI 3BJAA 4GCVA 4XKBA 4I98B 3ISPA 5ILVA 3QQ6A 4FN3A 3HPHA 2ISYA 3OYIA 2HQAA 3MAJA 4EM1A 4J1XA 3U9GA 1SFEA 5M5WJ 3FK6A 1TQIA 3PO2J 4D7MA 4BHBA 3I56I 1Y8QB 3OR1C 4B3XA 1FNNA 2M4KA 2UXXA 4AIHA 3H3ZA 2PXFA 1Z6RA 4RDUA 5L3DA 1BC8C 5F27A 3V8KA 2K9QA 3FWEA 1K4TA 1K78A 3SDGA 2M2EA 1HQCA 2VBYA 3CZ6A 2CUEA 3TELA 2FQ3A 2RNJA 3I3LA 2CU7A 3V42A 4IA8A 3IH4A 1I1GA 1T98A 3LOCA 3LSKA 1Y1WJ 2E1MC 4NQWB 3K70C 2LYRA 2VASA 1ZN2A 2K02A 3CJQB 4EGZA 3RYPA 4XN3A 2K9NA 2PMHA 2L54A 2XKOA 1WQ2A 2DA5A 2NYXA 2HDWA 2EZKA 1LDKB 2G9WA 2HCSA 1U5TA 2LF7A 1QHGA 2OJED 2W48A 3ERED 1JXSA 1ZRDA 2LF8A 3A9YA 4G7OF 1XDUA 2KPJA 2ZFUA 4Y33A 1ULYA 2GWRA 2R5YA 5ICFA 3HG9A 3O2PE 3T0YA 3CMYA 1NTCA 1RNLA 3AG3H 3H5AA 3K1PA 5FROA 3WTTC 4A3MJ 1X1AA 3DCFA 1DWKA 1YW8A 2XUBA 3I59A 4KJZA 2JSCA 2DMTA 3IC7A 1RR8C 2EILH 1F4KA 2CO5A 4IWRA 1ZELA 2HKXA 1ZZBA 1W1WE 1HSJA 4MLOA 3CUQB 4AVZA 1TZLA 5FRNA 5ED4A 1QZZA 1Z9CA 3CECA 1MJ9A 5ERIA 3LFKA 2M4GA 2DU9A 2BE5F 2JQ7A 1IDZA 3D5RC 3WODF 1R49A 3W6KB 1LJ9A 1G3TA 2VKEA 3IWZA 2KP6A 5K7HA 3OV8A 3HUGA 4HSRA 4HV6A 4KIFA 4JX6A 1E0EA 2XCJA 2Y9YA 3BR0A 2ECCA 2VE8A 4GRIA 4WVLA 2DT6A 3BDDA 4X6AJ 1UHMA 4M3FA 4N4NB 3S2DJ 2P5VA 4B43A 4MEXF 4M74A 5E79C 1R5ID 4O5VA 3SEQA 2OPTA 3ZQCA 4PSXA 1K4SA 2X85A 2FFHA 1O3SA 3LSGA 9ANTA 3EUHA 2LREA 1UZCA 2L9NA 3A4CA 3IAS2 2KRHA 4LLNA 2FBIA 1HLVA 5FFXA 1REPC 1BN5A 3E3VA 1MSEC 3HGGA 1ZZ9A 1J0RA 4RLFA 5GAGi 3IV5A 3ERMA 3HSEA 1T2KA 2NVXJ 4BBSJ 1LFUP 1W5TA 1JUPA 2NVYJ 5D6EA 2DCEA 4ER0A 4B09A 3S2WA 5FD5A 1MMDA 3K0LA 2Q2EA 2WB1N 1MGTA 5F6FA 2LLWA 1V5GA 4Z5DA 3JW4A 1IXRC 3TO6A 2X48A 2UXNA 4HW0A 2QSGX 3MLFA 2BBYA 2XIGA 3QYFA 2OAZA 4WXCA 2XROA 2QF7A 2AWIA 2NNYA 1JKRC 4DE9A 3COAC 4HNUA 5H2FC 3GTPJ 3FXLA 2MEZA 2CQXA 3OYLA 2IGNA 4V19K 2JA2A 1FSHA 2ZC2A 3QOPA 4RB2C 1Z7UA 3VPRA 4F7ZA 2D1VA 2BXYA 4EJVA 4LB5A 1JHFA 5DT2A 3DPTA 1MDMA 2CS3A 1XWRA 1OR7C 3AL0B 5GAHJ 2CV2A 1YJNI 2M30A 1XX5A 4FCYA 5BOXA 1KQ0A 3MCZA 1OCRH 2E1CA 2HOSA 2XSJC 5EGOA 5CYVA 2DYRH 2HINA 2LKXA 2CH0A 3FYMA 3Q0UA 2GRMA 3WTXC 1X2LA 4U0VA 1OISA 1G6NA 3TO9A 4HF0A 2LY9A 1R22A 4JK1X 5K5QA 1VQ6I 2HYFA 1HC8A 2CWEA 4PU7A 1AKHA 2DW4A 4B48A 3CCLI 5CJ9A 1P7IA 1SFOJ 4ESFA 3QP5A 2PXUA 4GO1A 3OOUA 3L1PA 3OYEA 4GXOA 4PJMA 1SMTA 3HRSA 4PUSA 2Y30A 4UVBA 1FT9A 2DK8A 3J81K 4BHCA 4EQZA 1D1BA 2R5ZA 1F5TA 5EF6A 1XGMA 2BEOA 4KA4A 1TWFJ 3K7AJ 3RKYA 1WH5A 2LSOA 2XRLA 2R93J 5F04A 1T0FC 1MBEA 3H9JA 5J40A 1A31A 3U3WA 2H6BA 1IAWA 4O8BA 4NB5A 1P92A 4XICA 2DYSH 4BAYA 2HDDA 4ZH4F 2Y31A 3Q0WA 3MFKA 4AIJA 4XLFA 2KKOA 2Y69H 2WY8Q 5M3FJ 2F4OB 1LDDA 4P9UA 2F4MB 2LD5A 4A3BJ 3SFIA 3ZMTA 3GTLJ 3HTSB 4A0XA 2DFIA 3GW2A 3M1EA 1YRNA 1IXSB 2L7FP 4FISA 1TLHB 4FASD 4LLLA 2DFFA 2EIKH 5BPIA 3ELKA 3GZCA 2QQAA 3OSGA 1DGRM 4F8DA 1E17A 1ITYA 2VPRA 1ZYRF 2CYYA 3TGNA 2RNGA 3VEPA 2ZJQF 1SFUA 3HOSA 4YFKF 1POUA 4WXDA 4EKGA 4HQEA 2V3CC 3VYSB 3TBIA 2BVLA 3OWTA 2HPMA 2PEXA 3AL0C 2ZXHA 3CCYA 2OF7A 1UXDA 3I4MJ 4MGRA 4HV5A 1XS9A 4PJLA 3CO7C 1A6QA 2E2HJ 1LDJA 3K70D 1FOKA 1P9QC 3ZOBA 1HXDA 1X3WB 4F91B 4OB4A 4IOCF 4XLPF 3CDLA 2V1NA 5K5RA 1TWCJ 3OIPA 3JAMK 1TTYA 3CF2A 2X0LA 1Z21A 1UMQA 3KE2A 4ZZLA 3FK7A 4IF4A 1S72I 1ZGAA 2L01A 2P0WA 4ER5A 2B9SA 2A5YB 2EV5A 2VC1A 3LSRA 2FBHA 5FLXK 2P6SA 4IRIA 2HWVA 3KZ3A 3KCCA 4L9NA 2L3DA 1FBSA 2ADUA 4O6JA 3GTKJ 1CF7A 4XRSG 4PU8A 4L5EA 3F8CA 3ML6A 1L1MA 4UUTA 4UY8I 1JT0A 2VC0A 1WETA 3N4MA 1R7JA 2OCEA 3ZMVA 5LRSA 3ZN0A 2QKLB 1A04A 1EKEA 3IP4B 1QBJA 2WUSR 2KZ8A 4BUPA 4M3BA 4ENJA 2LCVA 2XDVA 2EZLA 1Y9QA 3QPTA 2ID3A 2NOGA 2XI8A 2DT7B 1ZREA 2H8WA 2FEZA 1X57A 2VJIA 3NEUA 5A2QZ 1Y8RB 1RUNA 1RI7A 5DTMA 1J5YA 2VBWA 3HJEA 1N25A 4ENMA 5TRDA 3FXUA 5C4XJ 1TQPA 1IXCA 2PJPA 1BJZA 2E2IJ 4G94A 1LNWA 3VODA 3CDIA 3WTYC 4FE7A 1LEAA 1WKMA 1YJ9I 2CJJA 2DJNA 1OJLA 2PXQA 2HGCA 5D6FA 2PN6A 1TT5B 1DULA 2EV6A 3FXRA 1S29A 3JREA 1VQPI 3OYNA 2YS9A 2XF5A 1DU0A 2LOOA 3ABTA 4A93J 1XN7A 1Z7LA 3PQJA 2L7ZA 3VWBA 3PSFA 5HS9A 2HVSA 2BW3A 2RVCA 4BEHA 1TT0A 3M8JA 2WADA 4JCYA 4K2EA 3GN5B 3CLQA 1UHWA 2BY2A 4HX7A 1IN8A 4M72A 5KHDA 2QWWA 1O4XA 4G12A 2PXVA 4N4OB 3K4CA 5D5XB 1JTYA 2RQPA 3CTAA 4M9XA 3V7RA 5LGTA 1ZG1A 1FP2A 3F52A 4AYBN 3HEFA 4IOAF 5IP7J 3CP2A 1FYLA 2TRTA 2B7EA 4ZYHA 3K1NA 4KICA 3SZGA 2K9SA 3HL2A 3PUBA 4QTRA 4Z58A 3GZ5A 1QQBA 3M1CA 5FLVA 1O7FA 2XB5A 2R7QA 3GMEA 5DS9A 3PNYA 2Q8KA 1HW5A 1S8NA 4N9IA 4PU4C 2DA2A 3JRHA 1S7EA 4XLHA 3LSMA 1TW2A 1HSTA 2WV0A 1NHAA 3HZJA 3UFDA 3W2AA 1I1SA 3H36A 2KIQA 3KZZA 4S0HB 1QPMA 1ZGWA 4ZTJA 2K7LA 1W5SA 3E5QA 3GTJJ 5BPDA 2V26A 1USSA 1SVMA 1YX5A 3PUFA 5CVIA 4G7ZF 5J8FA 2M1BA 2ZNZA 3HGYA 1OYIA 4BXFA 4EM2A 1P4WA 2LLKA 2MYSA 4DOZA 3JXBC 3KZYA 4XN0A 2LDUA 2NS7A 5B1AH 4M3DA 2VIXA 2V4JC 3VSLA 4LMYA 3DFGA 4RAYA 3IKTA 5GPAA 3BD1A 1JUMA 2KJCA 1KU7A 2JQEA 4ENKA 2KDOA 2EBIA 3ZKCA 2HQNA 4BGDA 2OC6A 4D7NA 3M3YJ 2O0YA 2X1CA 1W7PB 2RKHA 3FIWA 3HSRA 2ZFWA 3DEEA 2EIJH 4HA8A 1Y0UA 5KAIC 1IUFA 3KYCB 2JA6J 2EFNA 4B44A 2DFEA 4CO8A 1UTXA 3RZOJ 2XAFA 3GFJA 5AIPA 2PMZA 1H9GA 4FT8A 3GZ6A 2CW7A 2GA1A 5AIQA 3KEQA 3PNVA 1RZRD 2XAUA 2IA2A 3D1NI 2FRHA 4YRVA 2WAQN 3Q3SA 2DK5A 2E1OA 3CCSI 3DPUA 3ZHIA 3KP4A 1MW7A 5DRTA 2ECBA 3WU2C 3AG1H 2HFZA 1SD5A 2MH9A 3C1DA 1A36A 4OWRB 4XSZF 1MMGA 2ESNA 5F0CA 2JWTA 2YU9J 2HOEA 1XDSA 4A3JJ 2LBFA 3FISA 3KPHA 3SZTA 1ZH5A 2ZJ2A 2R7RA 3EUSA 3K6GA 4UB8C 2ZMEB 3M9AA 5LGNA 1JI8A 4MO7A 2PUDA 5HS7A 3JSPA 1JFSA 3W6JB 2XAJA 2GM4A 3KX2A 1MJBA 3H1CA 1YG2A 3EYIA 3RDIA 1A6IA 1HCRA 3ECOA 2K3PA 1KQ9A 4Q2JA 4L9TA 2J7WA 4FHTA 4RGSA 1QZYA 2MBFA 2VKDA 1LFPA 4G8XA 4OMYA 1ZZCA 4A3KJ 2XF7A 1TQMA 5B3SH 5KK1A 4AD9A 1YS6A 4Z5HA 2E5NA 1L0OC 3QP6A 3Q9SA 2W24A 2VPLA 1U6GA 2IW5A 5E17F 1S9HA 3P7NA 2BY0A 4EJUA 3ZQQA 2HCNA 4BYYA 3LAPA 3DTKA 4S05A 3LA7A 3A01B 3A0HC 2V1UA 2V6EA 5JR3A 5CQGA 1QHHD 5K1YA 1TC3C 2XAQA 3JRCA 2VQHA 2DO7A 3OP9A 3JRFA 4BS9A 3E5XA 1X1BA 2W1OA 2ZXJA 1GXPA 2BY3A 1IUYA 2P5KA 2HOAA 3IRRA 3GTMJ 5ILUA 2XJ3A 3F8BA 2KIFA 2FMLA 1ETKA 1OPCA 4KITB 2JK3A 1KONA 2VI6A 3HBLA 3KP5A 1WH7A 1O3TA 4CCLA 1GV5A 1WHUA 1FJLA 3OS2A 4CZCA 3SQNA 3L2VA 2UZKA 4LB6B 3FXQA 3DEUA 2QUFA 3QRFF 5HVQC 4ABZA 4HSTA 3GWZA 1X1CA 4ITVA 3HZIB 5DSXA 4M9ZA 2BOLA 4ENNA 2ETHA 4D1QA 4A5MA 3A0BC 2LKSA 3BR6A 4NDLA 4OIQF 3O9XA 4G7HF 5FRMA 5IYDJ 2ODRD 5GADJ 4OINF 1X2NA 1WI9A 3KP2A 4KIGA 1ZR2A 1YFHA 4AIKA 2IT0A 2YSRA 2ZMEC 4EJTA 3BPVA 4F3QA 1RETA 2PJRA 2WBMA 2QLZA 4WXHA 2H1KA 4LG0B 2QQ9A 5ILSA 3J7AO 4GQMA 2DQLA 3P9CA 5E3NA 3BG7A 2WIUB 4U0YA 3BLYA 3LAJA 4BU2A 2LR8A 5BMZA 4A0ZA 2HZDA 3EYYA 1OCZH 1VZ0A 1WH8A 3CO6C 4FBIA 4HX8A 2VKHA 2GXGA 3F8FA 2DPDA 4MFDA 2PQ8A 3IKVA 2PMUA 3SFZA 1GVDA 1V5FA 2MGQA 4C30A 2ZJRF 2OR1L 3GX4X 3Q0VA 1BR2A 1SMYF 5D5VB 5FLMJ 1X4OA 1HF0A 4QWQA 3E6DA 2L5QA 2FD5A 1ENHA 1SEUA 1LEBA 1BOAA 2CUFA 3GFLA 5DYMA 2R7TA 1VFCA 1Y39A 1OCPA 1FPQA 1YIOA 2ME6A 1LE8B 2VJ4A 4CCNA 3OYCA 1Q1HA 2VT3A 3EDPA 2AUWA 1HKQA 2MLKA 4E7SA 1NH3A 3LSPA 1WJEA 3GFMA 4XMYA 3REOA 3JAMZ 1BI1A 3KP6A 1JHHA 1KYZA 3B73A 3FXJA 2JVHA 2RN7A 3ZMUA 5FLXZ 3LSTA 4FX4A 3B7HA 1PRAA 4HF2A 2VONA 3S3NA 1DPRA 5FD6A 5GAGJ 1EH8A 3QAHA 4YBAA 2M0MA 2L9SA 2R7XA 4BE2A 3TP0A 1H89C 2EJRA 3GTGJ 3J7ZI 4MEYF 4IZZA 3TMOA 2IP2A 4PU3C 4BY7J 3JR9A 3ZR8X 3F51A 5IT3A 5EJCA 4A6EA 3WE3A 4PZJA 2FQ4A 3H3UA 3C2HA 1IF1A 3OMYA 3T8RA 1T38A 3S32A 3F21A 1T6SA 4CXFA 2R3SA 1K7AA 1G8XA 5KNLA 3PQKA 2JT1A 2KMUA 4M6VA 5EG0B 4E7JA 1R9TJ 4I8TA 1H0MA 3ZHMA 3FHNA 3HSFA 4MCXA 5DV5A 4HAMA 3X2QH 1R6RA 3CLOA 3OYMA 3ULQB 4D5CA 1VTNC 3BC8A 2CMPA 1VQ8I 3ZQLA 1BI0A 3K4LA 4M73A 2JCGA 4P55A 3CCVI 3PNTA 3JRDA 5IPAA 3ZPXA 1HKTA 4EATA 2LMDA 2QQ8A 3GZDC 3N97A 3E6MA 3ZRGA 2MXDA 3S8PA 5LHGA 1QVUA 4XOPA 1BA5A 3ASOH 2QSHX 3QU3A 4XOTA 2P7VB 2R7VA 4A6DA 3TW7A 4RGRA 2XHKA 2WAFA 3K10A 2GZUA 2DAOA 4GYGA 4EJWA 4JX4A 1K78B 1WSUA 4IX7A 4CCOA 1J75A 3M7GA 1XMAA 3D5SC 1G4DA 1ZVVA 1V5EA 4XK4A 5TJJA 4EJOA 3W6VA 2VUMJ 2ZJPF 1SVLA 5CVJA 5KVRA 5DUKA 4KIBA 3UKGA 4I6RA 2L9VA 2EK5A 3F6OA 3KYLA 3S1RJ 3M8FA 2FNAA 2OZ6A 2A6EF 4CYCA 1U5TB 1RKWA 3S1NJ 1DQUA 1SANA 2PIJA 3F22A 1FZPB 2PXPA 1FX7A 4ON0A 1PRUA 1FEXA 5E8IA 3CF5F 2A68F 5DDGA 2F4IA 2ZSHB 2W4SA 4RLQA 2X4HA 5JI6A 2M87A 2R5YB 4BXXJ 5D5WB 2Y0SA 2PXTA 1QQIA 1FTZA 5DTRA 3BOQA 3I59B 5HDGA 2NXNB 3BZ6A 4E70A 2XGDA 4H4KC 1N75A 4M3EA 1RZRA 4GDFA 3G6EI 1D5VA 1E2XA 2VEOA 3LA3A 2YBDA 3DNVB 2HEOA 3Q9VA 3K4NA 2JPBA 1ETQA 3DKWA 4YG4A 4GYIA 2JN6A 1T0FA 1WFXA 1KU3A 1V4RA 2F5EA 3QODA 5DCFA 1P2FA 4C3HJ 1YOVB 1QB2A 4EGYA 4CA0A 4HYEA 3BJOA 4JQFA 1ZZ7A 4CDGA 3QWGA 1STZA 1W7PD 1W4MA 1EV7A 2YUSA 2IBDA 4JOMA 2Z5UA 1LQCA 5E18F 3MZ8A 5D5UB 3PIPF 4Q48A 3I9V2 3DLAA 3HUGB 4BJ5C 2VOPA 2WTEA 3G2BA 1OKRA 2DA6A 1WIZA 4NDWA 4YG7B 3ZQIA 4KT6A 5C44J 1SVOA 4BDYA 2IU7A 2WV1A 2YU3A 4OAYA 2OD5A 3ZMZA 1EA3A 1UHSA 1VNDA 2R7FA 1XB4A 2VQLA 3GCMA 4IHVA 2Y75A 3KEYA 1O7LA 1MH3A 2LY2A 2K5CA 3MD2A 3D5LA 2ZCWA 3EETA 3IAM2 5L3EA 4JYKA 4AM3A 1MJAA 3FDYA 2O3FA 3CLCA 2OBPA 2VE9A 1KQ8A 1BR1A 3C2GA 4Q4ZF 3CUQC 2DA1A 2M7AA 3U2RA 1OMIA 4CH7A 4XLAA 1ZS4A 3H92A 1SD4A 4I0BA 1ETVA 3OYHA 3FBIB 1GUUA 1P4AA 2IVBA 1UFMA 2ICWG 4HRAA 3O6BB 5E3LA 2NVTJ 1C0WA 4E7LA 5FJ8J 2JTVA 2EV0A 4ZZDA 3BS3A 2ACJA 2QSFX 1U5TC 2NS8A 2W00A 2Q2EB 3CESA 3VB2A 4C9YA 3K4BA 3CJRB 4CUGA 5FGMA 3OL4A 3I53A 3VDXA 3ASNH 2KT0A 4Q47A 4UXNA 1PRVA 4RS8A 1YSEA 1G3WA 2LNMA 1LCDA 2WY7Q 4CICA 1MBJA 2ME0A 3CC4I 1YYVA 2DA4A 1LVKA 3V4GA 3BR1A 4I6ZA 4PSWA 2QA4I 1YHQI 1JH9A 1KA8A 4U0WA 3UR3C 4KMFA 4PJ0C 2L9RA 5DM6F 2CSFA 2LLVA 5LEJA 3HM5A 3R1FA 4IVNA 1RKTA 4A3FJ 4BXUA 2LKPA 4HG2A 1W0TA 1T8IA 1R1UA 2DLLA 4JBAA 2DOFA 4A5NA 3EUAA 4GFBA 2O8KA 2L2OA 4CCKA 4KFCA 1HDDC 5DUIA 1MDMB 5J1UA 1G59A 4MHGA 1YIJI 2D5VA 4LK1F 2EPFA 3E97A 1X1DA 3KP3A 3QU6A 4M6YA 4RMNA 4CGZA 1G3SA 3BG6A 4ANJA 1Z77A 3F8NA 1QA6A 2KLOA 3VOEA 5EGOB 1HW2A 4UUSA 3KLOA 3ABKH 1IG7A 3GXOA 4WWCA 5FO5A 1ZQ3P 5IP9J 2L1PA 4QIWN 3LL7A 1FOWA 3LFUA 5LLQA 3RZDJ 2O6GE 2DBBA 3OY9A 4HX4A 2DMPA 4RB0A 2DQRA 1AKHB 3K4KA 5IOYA 3RKXA 5DTQA 4HPQA 4C2TA 3EUHC 4BQNA 5F0FA 1EFAA 3DBRB 1FTTA 2KFDA 2A5WA 2UV1A 4OMZA 4KT5C 2X6YA 2XVCA 3BG9A 5HDKA 3G1OA 3GYHX 4I2OA 1RESA 2CQ7A 2HXOA 5F64A 5J3LA 2VBZA 3HKZN 1PUFA 1JJ8C 2AQFA 3V7SA 4XIDA 5J1RA 1MBGA 1YTYA 2QENA 5CLSA 3FXKA 5JHUA 2R7DA 1CJGA 4E7KA 4WF2A 1ZGJA 4U88A 1TBXA 2R5ZB 3BDNA 3OQOA 5L3GA 2LH9A 3SDBA 3T5XA 5H20A 1U9NA 3RKWA 3IL2A 1OLTA 2IXSA 3GVAA 3RJPA 1BOBA 1Y0NA 2PE5A 2CW8A 4PFOA 4ZYAA 3KETA 3S93A 3AG2H 5DEQA 1R1TA 3TO7A 2NRAC 1HA8A 2XRNA 3ESWB 2VKVA 3BCAA 1D0ZA 5A7LA 2F6CA 4D5FA 4I0AA 4BBRJ 2AQEA 3OYFA 3Q5FA 4X4GA 1O3RA 2QCOA 4KDPA 4NC7A 4YIIA 1YRNB 4HEA2 5K7FA 3CMEI 3PJRA 3K2AA 1ZUGA 3HPGA 1TL8A 1HBXG 4I09A 1XSVA 2GIVA 2X6XA 1RC9A 2JUCA 3J80K 3DEWA 1W0UA 1MMAA 1UXCA 1JE8A 4YARA 1N77A 3VSKA 3WHCA 4X4EA 2PUAA 1Z6TA 4A3LJ 4AWXB 2A07F 2A69F 2EFQA 3S15J 4JCXA 2XAGA 2PXKA 3A02A 1LCCA 1Y56A 2V9PA 3MKLA 3FMRA 2DA3A 4U87A 3TKYA 3TOBA 3ZQGA 1WJFA 1ZRCA 5BQTA 4WX9A 5GAHi 4QLCU 1POGA 2PXEA 4IRGA 1V55H 1W5CC 4HNVA 1GHCA 3WE2A 1J09A 2NVUB 1PP7U 2MW8A 3WTWC 3H5TA 5LHIA 3RKQA 2VJJA 5HS8A 2CFXA 2OV7A 3MZHA 1X1PA 4ER7A 1O57A 1CF7B 1ZLJA 1BM9A 2RQQA 4Y13A 1NK3P 4X4FA 3RCOA 4IVZA 2CUJA 1D1AA 3PIOF 3ZP5A 4CHUA 4XQFA 3QPSA 3I58A 2AXLA 3H5NA 1MZBA 5DRYA 2NOJB 1UJ8A 3DBHB 2OUMA 4V2FA 4IKFA 5J1YA 2W57A 4N9HA 2VQGA 4LITA 1F9NA 3NZLA 1G3YA 3HTUA 4JQDA 4LGWA 3BT9A 2ZO4A 2K3FA 2HYJA 3O8HA 5GPCA 5FKMA 4BH9A 1XG1A 4XLNF 3BTCA 2IGOA 2K40A 4DQ2A 4LK0F 4YFNF 2EA4A 2FXAA 2EBYA 4F92B 4GHJA 4L9VA 1LVAA 2AXUA 5D8LB 3HRUA 1LFBA 2NS0A 2DODA 1L3LA 3FX3A 3HOZJ 2OTJI 2IVGA 3MMYB 1VQNI 3DQVC 3OWQA 4IQ4A 1MNEA 4DNCA 2VL8A 2L4MA 1MBKA 1R1VA 2M8EA 2QYOA 1VQOI 3G1LA 4Z59A 3IH3A 4RBOA 4XRSA 2LVSA 1QZEA 2HPIA 4Y4RA 2UWMA 3R60A 3HHHA 4YFXF 2LYLA 2ZBKA 1GLNA 2R4GA 1D5YA 4DYCA 2LYJA 2BW3B 4BEHB 1JGSA 1V3FA 2RC4A 2GLOA 1D0YA 4M71A 2O61A 4BDZA 1S3JA 1SFXA 3BQZA 1YS7A 4RAFA 2EA2A 4LFUA 4FTHA 2PXDA 1B8IA 2XF6A 4DJAA 4IHTA 3CCQI 1GV2A 2FBKA 1S6LA 3O3KA 5F08A 3JSOA 4OAZA 2E34A 1A35A 4KUMA 4G6QA 2Y0MA 2HSGA 1AA7A 2E2JJ 4C3JJ 5HLHA 4DZPA 5HODA 2IS6A 2E35A 2EB7A 3OOPA 3FF5A 1OYWA 3IVPA 4PGGA 4RB3C 1QQAA 1I39A 1JTXA 1TP4A 1ZR4A 1QNTA 2RREA 2CGPA 5J8CA 3QFIA 5IOZA 4A3CJ 2RAEA 4E7HA 3HC7A 4I7HA 3OYDA 2P81A 5E1XA 1JUSA 5DCMA 4E4HA 4ZYGA 4KN7X 4LLGF 2CFOA 2WB1A 3MZYA 3MKYB 3GTOJ 1PJRA 3R4KA 1SD7A 2ZNYA 1Y7YA 2K4BA 2RV8A 3OKZA 4M9SA 5K7ZA 1DGWY 5E8GA 2FA5A 3OIQA 2QKMB 3QQAA 1P4XA 3BCBA 1BJAA 3ZQFA 4BQQA 3OSFA 3K69A 2ZKZA 1MH4A 2OA4A 3MKWB 1E3PA 1RZ4A 4PFPA 3HOXJ 3GO5A 4A69C 2AO9A 2ZSIB 4NBQA 4IHWA 2Y0SN 2KEJA 1BC7C 3WGGA 3NROA 1KYWA 4TV7A 4WK8F 3QWLA 3TOAA 2GXBA 2VODA 3JTGA 1U78A 2O5RA 3CCJI 1HW1A 2D2WA 3QPHA 1NG6A 1KZHA 2UUZA 2F5FA 4RM2A 3WTVC 2X9DA 4HQMA 2Q0OA 2CRGA 2V1DA 4L0YB 2OQGA 1LUJB 2EFOA 1IV6A 1OFCX 1FOYA 3M9LA 3ROUA 1OCCH 1K61A 1IN7A 3FKJA 5J4VA 3BROA 3OR2C 1B72A 2VBXA 2LYCA 1ERDA 1JT6A 2LTPA 3R0AA 4MFEA 1DPUA 1PDNC 1ZZ6A 3NWSA 1USTA 2EQRA 2KIMA 1EH6A 1WRJA 2F5DA 1LLIA 5F0HA 2KEIA 2ELJA 2PBIA 3L7WA 4HLXA 2VXDA 3OYAA 2CUZA 1J59A 1X4PA 5EEAA 2E7XA 2LBFB 2YX7A 3KFWX 1TWGJ 2NAZA 2BVMA 1X3UA 4PCQA 2O03A 3DKXA 4C3IJ 3NARA 1JGGA 3SR4A 3FHZA 3SX0A 3R61A 4BJTA 6PAXA 3F6VA 3SZPA 1Z3XA 2CG4A 1KGSA 4EQQA 2BNOA 4L0ZB 3BJ6A 1U0JA 3CMMA 5EZGA 2Z3YA 3AFHA 5IYCJ 4IHXA 5EDNA 2HR3A 2F48A 1N78A 2O7OA 2ICTA 3DP7A 2PFBA 2K85A 4HDVA 3JTHA 2YX4A 4XLCA 3ZXSA 1XTAA 4W1UA 5F1RA 2DA7A 3WHBA 3CC2I 2D45A 1K6OA 2IJLA 3S2HJ 5HNFA 3GUUA 3GF2A 2DDAA 1DDNA 2COMA 2B0LA 4XL9A 2QBYA 3SEZA 1AWCA 3TL4X 3DBLB 3CUOA 5FKOA 1V54H 2CV0A 5GAEJ 3G7DA 3KZIC 1HOMA 1H8AC 5D8KB 5EZHA 3K4MA 2QM3A 4ZYDA 2STWA 3GEZA 3GZDA 3DKYA 1FSEA 3SCGA 2JPCA 4S04A 3V7CA 3PE5A 4P96A 4R1HA 1FMVA 4QSHA 2IGKA 5JLWA 1JKPC 2GRLA 2DMUA 2GZWA 2XAHA 1XC5A 2O49A 4A3IJ 1X3ZB 2XXQA 3HYIA 1FYKA 1K6YA 5M5YJ 2QGUA 2B63J 2HVQA 2V9VA 2H8RA 3QOXA 3MEXA 1NEQA 3WTUC 3HDDA 4IHYA 2JVGA 2W85A 1O3QA 3K1MA 2A6HF 1D0XA 1UAAA 1EJ9A 5IP6A 3VFZA 5JHFA 1PP8F 3GLLA 4RB1A 3KLNA 5HNHA 3DPLC 4EZIA 1GT0C 2LFBA 4IEJA 3L2RA 1SAXA 1D8KA 3W2VA 1K79A 3EPZA 3E1SA 3T1BA 2PJRB 2IRFG 1FWZA 2J5OA 1BIAA 5FKLA 3JRGA 2BV6A 1WJBA 1Q1VA 3QPLA 4ESJA 4IQJA 3HOUJ 2DTRA 4KNYA 5DM7F 2GAUA 2LP0A 3R0JA 5JVTA 2AXZA 3DM5A 1FYMA 2IS1A 3KIOA 2XPUA 2LYQA 3G71I 2Q1ZB 2DFHA 3RIRA 1SQ8A 5DTDA 1WWXA 2XKPA 1R00A 1YITI 3KP7A 2QQBA 3I55I 2CQKA 4HDUA 4DZJA 3FYAA 1XGSA 3ZPLA 4XR6A 2XXAA 4NQWA 2XASA 3J80Z 4B1RA 1U2ZA 3CROL 4PK4A 4I6TA 1MNMC 4UVAA 5HDNA 1XSXA 2KIUA 3HOVJ 2IVQA 2VB6A 3LISA 2MD5A 3S3OA 2GIZA
chains in the Genus database with same CATH topology
3I4NJ 2CJJA 2DJNA 1OJLA 5FJ8J 4I76A 3S1QJ 3BS3A 3FKIJ 5E3OA 2L8NA 1LMB3 3ZQHA 3LNQA 2NS8A 1P7JA 5M3MJ 3CQZJ 2AXVA 1T56A 3JREA 5K98B 1QP7A 3HOYJ 1ZPQA 2KT0A 2YS9A 1YSEA 1PRVA 2E19A 1DU0A 1LCDA 2JJ7A 1MBJA 4A93J 2ME0A 3RZZA 2L7ZA 4EEFG 2DA4A 4I6ZA 3BR1A 1ZAYA 2KEKA 4A3EJ 1JH9A 4JCYA 4FE4A 3OMTA 2CSFA 2L9RA 4BKXA 4Y52J 1BDIA 3HM5A 3GN5B 2X6OA 3R1FA 1ZTRA 1RKTA 4A3FJ 1B72B 1FIAA 2O4AA 1W0TA 1O4XA 4X4CA 2XGCA 4G12A 4GFBA 4A3DJ 2O8KA 2ID6A 1JTYA 2L7MP 3TW6A 3F52A 1HDDC 1RR7A 5J1UA 3HEFA 4AYBN 1RIOA 2D5VA 5IP7J 1DW9A 2FX0A 2M8GX 3PM1A 1NK2P 2TRTA 3KXAA 2K9SA 2PPXA 1PNRA 4QTRA 4Z58A 1Z77A 1QQBA 5FLVA 5EGOB 1F43A 2XB5A 2LYSA 4UUSA 1JWLA 3LSJA 1IG7A 1ZQ3P 4AUXA 5DS9A 5IP9J 1DU6A 3MVPA 4QIWN 1OSLA 3G1MA 2JA7J 2FJ1A 4PU4C 2DA2A 3JRHA 1S7EA 3RZDJ 3BTJA 1PERL 2JVLA 1Z0XA 2DMPA 3UFDA 1AKHB 5IOYA 1BDHA 4Y7NJ 5C3EJ 3IH2A 1X2MA 5F0FA 4S0HB 1ZGWA 1T33A 1FTTA 3TEDA 3BG9A 3NAUA 3G1OA 1RESA 5J3LA 2HXOA 4JP0A 3GTJJ 3HKZN 1PUFA 1IDYA 1JJ8C 4XIDA 5J1RA 3BTIA 2HQ5A 1EF4A 1MBGA 3HGYA 1CJGA 2XPVA 2B5AA 3HB9A 2LLKA 2GBYA 2R0QC 2FJRA 1ORKA 3JXBC 3G5GA 3A03A 1EFAA 2R5ZB 3ZHIA 2PUEA 4A3GJ 3BR3A 1QRYA 2NS7A 3BDNA 3OQOA 3E7LA 4M3DA 1U9NA 1LE8A 3HOWJ 5GPAA 3BD1A 1JUMA 2R1JL 2PE5A 1BW5A 2EBIA 3VK0A 3ZKCA 4X1EA 1AU7A 3S8QA 4V2GA 4D7NA 3M3YJ 1TWAJ 3FIWA 2VKVA 4X4HA 5BNGA 1JKOC 5E3MA 5A7LA 3JRAA 4D5FA 1IUFA 4CYCB 1GDTA 4BBRJ 3QF3A 2BJCA 1MSFC 2JA6J 4X4GA 2R92J 2QCOA 4X4IA 5F1JA 1YRNB 1UTXA 3RZOJ 2HXIA 5K7FA 1MBFA 3K2AA 1ZUGA 5FKKA 2XGEA 1VPWA 3B6CA 3DEWA 1W0UA 4BY1J 1RZRD 1UXCA 4YARA 3WHCA 3D1NI 4X4EA 2PUAA 4A3LJ 3SCHA 2WAQN 3S15J 3Q3SA 1APLC 4JCXA 2E1OA 3F0CA 3A02A 2ECBA 4LOCA 1JFTA 1LCCA 4B3AA 3MKLA 2EZHA 2DA3A 2CQQA 3ZQGA 1QVTA 2HI3A 5FKNA 1WH6A 2XSDC 3JRBA 5EG0A 1POGA 1FIPA 1X58A 2JWTA 5F0CA 3O8GA 4HNVA 1CQTA 2YU9J 4A3JJ 4J1WA 1IJWC 4AC0A 3FISA 2MW8A 2L0KA 2PMZN 1RZSA 3H5TA 3RKQA 3S17J 3EUSA 3JXDL 3QQ6A 4MO7A 3OQNA 4FN3A 2PUDA 1QPIA 1JFSA 2I10A 4J1XA 2GM4A 5M5WJ 2ZB9A 3FK6A 1NK3P 3PO2J 4D7MA 2PUCA 1A6IA 1HCRA 4X4FA 4IVZA 2EH3A 4RDUA 3QPSA 1B0NA 5F27A 1IC8A 1ZZCA 4V2FA 2K9QA 4A3KJ 5J1YA 3SDGA 2M2EA 4Z5HA 2CUEA 4Z5CA 4JQDA 2PUBA 2ICPA 2DMQA 2G0EA 4IA8A 2CU7A 3IH4A 3BT9A 1IGNA 1MBHA 2HYJA 3LOCA 3O8HA 5GPCA 1Y1WJ 5FKMA 2LYRA 1XG1A 3TRBA 3BTCA 2K40A 2EBYA 4GHJA 3A01B 3GTQJ 2K9NA 1TC3C 4MCTA 2AXUA 3HOZJ 2IVGA 1LFBA 2DA5A 3JRCA 1ADRA 3LFPA 2EZKA 3OP9A 3JRFA 4DYQA 2W48A 1MBKA 1U8BA 2HOAA 3GTMJ 2KPJA 2XJ3A 3G1LA 1ETKA 2R5YA 3IH3A 4Z59A 4M3GA 4RBOA 2JK3A 2VI6A 3HBLA 4XRSA 2LVSA 3CMYA 1TWHJ 1QPZA 1NTCA 1WH7A 2LYLA 4A3MJ 3DCFA 1GV5A 1D5YA 1DWKA 4DYCA 1FJLA 2LYJA 2DMTA 2XB0X 4IWRA 2GLOA 2NVTJ 1ZZBA 4X4DA 3BQZA 4ABZA 3HZIB 4MLOA 1I50J 4FTHA 2IV1A 2KDZA 1B8IA 3CECA 1K83J 1GV2A 3BR6A 2MG4A 4NDLA 3O9XA 1I6HJ 1ETOA 5F08A 5IYDJ 1NERA 1X2NA 1IDZA 2HSGA 1ZR2A 2E2JJ 2VKEA 1RPWA 4C3JJ 3BQYA 5K7HA 4DZPA 5HODA 1QP4A 4JX6A 2XCJA 2Y9YA 3BR0A 2ECCA 2CROA 3IVPA 1RETA 4UUSB 4GQMA 1QQAA 2H1KA 1ZR4A 1JTXA 1WCMJ 4X6AJ 4M3FA 5IOZA 4A3CJ 2RAEA 3JRIA 1E3OC 5E3NA 2WIUB 2TCTA 3C2BA 3S2DJ 2P81A 3H3VK 1JUSA 2LR8A 2DTZA 2IEKA 2OPTA 3ZQCA 1WH8A 4FBIA 3GTOJ 3LSGA 4MFDA 4J19A 9ANTA 1Y7YA 4Y42A 5K7ZA 1GVDA 3QQAA 3M4OJ 2MGQA 2OR1L 3ZQFA 1HLVA 3Q0VA 3OSFA 1PUFB 1MSEC 3HGGA 1ETXA 1ZZ9A 1MH4A 5FLMJ 1HF0A 3BG5A 3IV5A 2FD5A 1ENHA 2CUFA 3HOXJ 2NVXJ 4BBSJ 4A69C 5JLXA 1VFCA 1OCPA 2AHQA 2AO9A 1LFUP 2ME6A 4IHWA 2Y0SN 2KEJA 1JUPA 2NVYJ 1LE8B 2A6CA 2AUWA 1ETWA 1Y1VJ 1ZKGA 2WB1N 3LSPA 3BR2A 3S16J 1U78A 4Z5DA 2X48A 1BW6A 2Y9ZA 1ETYA 3MLFA 4X4BA 2PUGA 3MN2A 4XRMA 3SJMA 2X9DA 3B7HA 2CRGA 1PRAA 2QF7A 2MQKA 2AWIA 3TP3A 1IV6A 4YBAA 1JKRC 1OFCX 3BTLA 1K61A 3GTPJ 3TP0A 1H89C 3GN5A 2MEZA 1B72A 2CQXA 3OQMA 2M9HA 2ELKA 2LK2A 1WI3A 1JJ6C 3GTGJ 2IUOA 1JT6A 2LTPA 2LYKA 4MFEA 3VPRA 2EF8A 4PU3C 4BY7J 3JR9A 3F51A 3F6WA 2PUFA 1ZZ6A 5C4JJ 1XWRA 2EQRA 2DMNA 1AHDP 2FQ4A 4FCYA 1LLIA 5F0HA 2KEIA 2HOSA 3BG3A 5EGOA 2HINA 2LKXA 3FYMA 5EG0B 4M6VA 3Q0UA 1R9TJ 1ZZ8A 3RQIA 2GRMA 4I8TA 1R69A 5EEAA 1X2LA 3ZHMA 4MCXA 2LY9A 1BL0A 1TWGJ 4D5CA 4PU7A 3ZQLA 2JCGA 1AKHA 4C3IJ 1JGGA 3NARA 3JRDA 1P7IA 5IPAA 1SFOJ 2XIUA 1WPKA 3S1MJ 1QVUA 3OOUA 1BA5A 5IYBJ 3L1PA 3OIOA 2BNOA 5EZGA 3TW7A 2JA8J 5IYCJ 4IHXA 2EZIA 2Y30A 5EDNA 2GZUA 1I3QJ 4I6UA 2O7OA 2ICTA 2JA5J 4JX4A 2R5ZA 4C2MJ 2IAIA 4W1UA 1VF9A 4DYRA 5EF6A 2DA7A 3WHBA 4B4CA 1TWFJ 3K7AJ 1WH5A 3BR5A 1OCTC 4XK4A 3S2HJ 1ZVVA 2XRLA 3W6VA 2R93J 5F04A 1MBEA 2VUMJ 3UKGA 3U3WA 2O9LA 4I6RA 4O8BA 4XICA 2R63A 2HDDA 2Y31A 5FKOA 3S1RJ 3G7DA 1HOMA 3Q0WA 3PXPA 5M5XJ 1H8AC 2M0CA 5EYRA 5EZHA 4YG1A 4CYCA 5M3FJ 2LD5A 3GBGA 1RKWA 3S1NJ 4A3BJ 1SANA 2PIJA 3SFIA 3GTLJ 2NVQJ 1PRUA 1FEXA 3B6AA 3SCGA 1YRNA 2L7FP 2EWTA 4FISA 2R5YB 2R7ZJ 4BXXJ 1IRZA 5GP9A 1ZK8A 1HDPA 3OSGA 4JX5A 4DW6A 4F8DA 1FTZA 4QSHA 3JXCL 1ITYA 2L49A 2VPRA 5JLWA 1JKPC 2GRLA 2DMUA 1XC5A 1POUA 2XGDA 1F36A 4A3IJ 2O49A 4M3EA 1RZRA 1UG2A 3CCYA 2OF7A 1UXDA 5M5YJ 3I4MJ 1XS9A 3DNVB 2MSYA 2E2HJ 2BNMA 2B63J 1ETQA 4YG4A 2H8RA 1JKQC 2JN6A 3ZOBA 1B8IB 4OB4A 1RPEL 4C3HJ 1NEQA 3CDLA 2XPWA 3HDDA 4IHYA 1TWCJ 2HOTA 3QWGA 1ZZ7A 1WGXA 2JMWA 3H0GJ 1UMQA 5IP6A 2YUSA 2IBDA 3FK7A 1G2HA 1LQCA 2DN0A 3PO3J 3LSRA 2AW6A 3GBFA 3SCFA 1GT0C 2LFBA 4IEJA 3KZ3A 1A5JA 2DA6A 3GTKJ 1WIZA 4NDWA 4XRSG 4PU8A 4YG7B 4L5EA 2LYPA 3QYXA 3ZQIA 4UUTA 5FKLA 3JRGA 1L1MA 2Y2ZA 1JT0A 5C44J 1WETA 1Q1VA 3QPLA 2IU7A 2WV1A 3HOUJ 2COBA 1UHSA 1VNDA 2LP0A 4IHVA 2OFYA 1QP0A 1U9OA 2AXZA 2WUSR 1MH3A 2BNNA 2KZ8A 4M3BA 2LCVA 2XPUA 2LYQA 2EZLA 1H88C 4JYKA 1SQ8A 1Y9QA 5DTDA 3CLCA 2ID3A 2NOGA 3KJXA 4W97A 2XI8A 3FMYA 4DZJA 2DA1A 1X57A 3FYAA 1R63A 1ZS4A 4B1RA 3CROL 2O38A 4I6TA 1ETVA 3A01A 1VI0A 2M34A 1MNMC 3S14J 3HOVJ 5C4XJ 2IVQA 1GUUA 1BJZA 2N8GA 2E2IJ 2IVBA 3LISA 5E3LA 4FE7A 4MIMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I4N J;  2CJJ A;  2DJN A;  1OJL A;  5FJ8 J;  4I76 A;  3S1Q J;  3BS3 A;  3FKI J;  5E3O A;  2L8N A;  1LMB 3;  3ZQH A;  3LNQ A;  2NS8 A;  1P7J A;  5M3M J;  3CQZ J;  2AXV A;  1T56 A;  3JRE A;  5K98 B;  1QP7 A;  3HOY J;  1ZPQ A;  2KT0 A;  2YS9 A;  1YSE A;  1PRV A;  2E19 A;  1DU0 A;  1LCD A;  2JJ7 A;  1MBJ A;  4A93 J;  2ME0 A;  3RZZ A;  2L7Z A;  4EEF G;  2DA4 A;  4I6Z A;  3BR1 A;  1ZAY A;  2KEK A;  4A3E J;  1JH9 A;  4JCY A;  4FE4 A;  3OMT A;  2CSF A;  2L9R A;  4BKX A;  4Y52 J;  1BDI A;  3HM5 A;  3GN5 B;  2X6O A;  3R1F A;  1ZTR A;  1RKT A;  4A3F J;  1B72 B;  1FIA A;  2O4A A;  1W0T A;  1O4X A;  4X4C A;  2XGC A;  4G12 A;  4GFB A;  4A3D J;  2O8K A;  2ID6 A;  1JTY A;  2L7M P;  3TW6 A;  3F52 A;  1HDD C;  1RR7 A;  5J1U A;  3HEF A;  4AYB N;  1RIO A;  2D5V A;  5IP7 J;  1DW9 A;  2FX0 A;  2M8G X;  3PM1 A;  1NK2 P;  2TRT A;  3KXA A;  2K9S A;  2PPX A;  1PNR A;  4QTR A;  4Z58 A;  1Z77 A;  1QQB A;  5FLV A;  5EGO B;  1F43 A;  2XB5 A;  2LYS A;  4UUS A;  1JWL A;  3LSJ A;  1IG7 A;  1ZQ3 P;  4AUX A;  5DS9 A;  5IP9 J;  1DU6 A;  3MVP A;  4QIW N;  1OSL A;  3G1M A;  2JA7 J;  2FJ1 A;  4PU4 C;  2DA2 A;  3JRH A;  1S7E A;  3RZD J;  3BTJ A;  1PER L;  2JVL A;  1Z0X A;  2DMP A;  3UFD A;  1AKH B;  5IOY A;  1BDH A;  4Y7N J;  5C3E J;  3IH2 A;  1X2M A;  5F0F A;  4S0H B;  1ZGW A;  1T33 A;  1FTT A;  3TED A;  3BG9 A;  3NAU A;  3G1O A;  1RES A;  5J3L A;  2HXO A;  4JP0 A;  3GTJ J;  3HKZ N;  1PUF A;  1IDY A;  1JJ8 C;  4XID A;  5J1R A;  3BTI A;  2HQ5 A;  1EF4 A;  1MBG A;  3HGY A;  1CJG A;  2XPV A;  2B5A A;  3HB9 A;  2LLK A;  2GBY A;  2R0Q C;  2FJR A;  1ORK A;  3JXB C;  3G5G A;  3A03 A;  1EFA A;  2R5Z B;  3ZHI A;  2PUE A;  4A3G J;  3BR3 A;  1QRY A;  2NS7 A;  3BDN A;  3OQO A;  3E7L A;  4M3D A;  1U9N A;  1LE8 A;  3HOW J;  5GPA A;  3BD1 A;  1JUM A;  2R1J L;  2PE5 A;  1BW5 A;  2EBI A;  3VK0 A;  3ZKC A;  4X1E A;  1AU7 A;  3S8Q A;  4V2G A;  4D7N A;  3M3Y J;  1TWA J;  3FIW A;  2VKV A;  4X4H A;  5BNG A;  1JKO C;  5E3M A;  5A7L A;  3JRA A;  4D5F A;  1IUF A;  4CYC B;  1GDT A;  4BBR J;  3QF3 A;  2BJC A;  1MSF C;  2JA6 J;  4X4G A;  2R92 J;  2QCO A;  4X4I A;  5F1J A;  1YRN B;  1UTX A;  3RZO J;  2HXI A;  5K7F A;  1MBF A;  3K2A A;  1ZUG A;  5FKK A;  2XGE A;  1VPW A;  3B6C A;  3DEW A;  1W0U A;  4BY1 J;  1RZR D;  1UXC A;  4YAR A;  3WHC A;  3D1N I;  4X4E A;  2PUA A;  4A3L J;  3SCH A;  2WAQ N;  3S15 J;  3Q3S A;  1APL C;  4JCX A;  2E1O A;  3F0C A;  3A02 A;  2ECB A;  4LOC A;  1JFT A;  1LCC A;  4B3A A;  3MKL A;  2EZH A;  2DA3 A;  2CQQ A;  3ZQG A;  1QVT A;  2HI3 A;  5FKN A;  1WH6 A;  2XSD C;  3JRB A;  5EG0 A;  1POG A;  1FIP A;  1X58 A;  2JWT A;  5F0C A;  3O8G A;  4HNV A;  1CQT A;  2YU9 J;  4A3J J;  4J1W A;  1IJW C;  4AC0 A;  3FIS A;  2MW8 A;  2L0K A;  2PMZ N;  1RZS A;  3H5T A;  3RKQ A;  3S17 J;  3EUS A;  3JXD L;  3QQ6 A;  4MO7 A;  3OQN A;  4FN3 A;  2PUD A;  1QPI A;  1JFS A;  2I10 A;  4J1X A;  2GM4 A;  5M5W J;  2ZB9 A;  3FK6 A;  1NK3 P;  3PO2 J;  4D7M A;  2PUC A;  1A6I A;  1HCR A;  4X4F A;  4IVZ A;  2EH3 A;  4RDU A;  3QPS A;  1B0N A;  5F27 A;  1IC8 A;  1ZZC A;  4V2F A;  2K9Q A;  4A3K J;  5J1Y A;  3SDG A;  2M2E A;  4Z5H A;  2CUE A;  4Z5C A;  4JQD A;  2PUB A;  2ICP A;  2DMQ A;  2G0E A;  4IA8 A;  2CU7 A;  3IH4 A;  3BT9 A;  1IGN A;  1MBH A;  2HYJ A;  3LOC A;  3O8H A;  5GPC A;  1Y1W J;  5FKM A;  2LYR A;  1XG1 A;  3TRB A;  3BTC A;  2K40 A;  2EBY A;  4GHJ A;  3A01 B;  3GTQ J;  2K9N A;  1TC3 C;  4MCT A;  2AXU A;  3HOZ J;  2IVG A;  1LFB A;  2DA5 A;  3JRC A;  1ADR A;  3LFP A;  2EZK A;  3OP9 A;  3JRF A;  4DYQ A;  2W48 A;  1MBK A;  1U8B A;  2HOA A;  3GTM J;  2KPJ A;  2XJ3 A;  3G1L A;  1ETK A;  2R5Y A;  3IH3 A;  4Z59 A;  4M3G A;  4RBO A;  2JK3 A;  2VI6 A;  3HBL A;  4XRS A;  2LVS A;  3CMY A;  1TWH J;  1QPZ A;  1NTC A;  1WH7 A;  2LYL A;  4A3M J;  3DCF A;  1GV5 A;  1D5Y A;  1DWK A;  4DYC A;  1FJL A;  2LYJ A;  2DMT A;  2XB0 X;  4IWR A;  2GLO A;  2NVT J;  1ZZB A;  4X4D A;  3BQZ A;  4ABZ A;  3HZI B;  4MLO A;  1I50 J;  4FTH A;  2IV1 A;  2KDZ A;  1B8I A;  3CEC A;  1K83 J;  1GV2 A;  3BR6 A;  2MG4 A;  4NDL A;  3O9X A;  1I6H J;  1ETO A;  5F08 A;  5IYD J;  1NER A;  1X2N A;  1IDZ A;  2HSG A;  1ZR2 A;  2E2J J;  2VKE A;  1RPW A;  4C3J J;  3BQY A;  5K7H A;  4DZP A;  5HOD A;  1QP4 A;  4JX6 A;  2XCJ A;  2Y9Y A;  3BR0 A;  2ECC A;  2CRO A;  3IVP A;  1RET A;  4UUS B;  4GQM A;  1QQA A;  2H1K A;  1ZR4 A;  1JTX A;  1WCM J;  4X6A J;  4M3F A;  5IOZ A;  4A3C J;  2RAE A;  3JRI A;  1E3O C;  5E3N A;  2WIU B;  2TCT A;  3C2B A;  3S2D J;  2P81 A;  3H3V K;  1JUS A;  2LR8 A;  2DTZ A;  2IEK A;  2OPT A;  3ZQC A;  1WH8 A;  4FBI A;  3GTO J;  3LSG A;  4MFD A;  4J19 A;  9ANT A;  1Y7Y A;  4Y42 A;  5K7Z A;  1GVD A;  3QQA A;  3M4O J;  2MGQ A;  2OR1 L;  3ZQF A;  1HLV A;  3Q0V A;  3OSF A;  1PUF B;  1MSE C;  3HGG A;  1ETX A;  1ZZ9 A;  1MH4 A;  5FLM J;  1HF0 A;  3BG5 A;  3IV5 A;  2FD5 A;  1ENH A;  2CUF A;  3HOX J;  2NVX J;  4BBS J;  4A69 C;  5JLX A;  1VFC A;  1OCP A;  2AHQ A;  2AO9 A;  1LFU P;  2ME6 A;  4IHW A;  2Y0S N;  2KEJ A;  1JUP A;  2NVY J;  1LE8 B;  2A6C A;  2AUW A;  1ETW A;  1Y1V J;  1ZKG A;  2WB1 N;  3LSP A;  3BR2 A;  3S16 J;  1U78 A;  4Z5D A;  2X48 A;  1BW6 A;  2Y9Z A;  1ETY A;  3MLF A;  4X4B A;  2PUG A;  3MN2 A;  4XRM A;  3SJM A;  2X9D A;  3B7H A;  2CRG A;  1PRA A;  2QF7 A;  2MQK A;  2AWI A;  3TP3 A;  1IV6 A;  4YBA A;  1JKR C;  1OFC X;  3BTL A;  1K61 A;  3GTP J;  3TP0 A;  1H89 C;  3GN5 A;  2MEZ A;  1B72 A;  2CQX A;  3OQM A;  2M9H A;  2ELK A;  2LK2 A;  1WI3 A;  1JJ6 C;  3GTG J;  2IUO A;  1JT6 A;  2LTP A;  2LYK A;  4MFE A;  3VPR A;  2EF8 A;  4PU3 C;  4BY7 J;  3JR9 A;  3F51 A;  3F6W A;  2PUF A;  1ZZ6 A;  5C4J J;  1XWR A;  2EQR A;  2DMN A;  1AHD P;  2FQ4 A;  4FCY A;  1LLI A;  5F0H A;  2KEI A;  2HOS A;  3BG3 A;  5EGO A;  2HIN A;  2LKX A;  3FYM A;  5EG0 B;  4M6V A;  3Q0U A;  1R9T J;  1ZZ8 A;  3RQI A;  2GRM A;  4I8T A;  1R69 A;  5EEA A;  1X2L A;  3ZHM A;  4MCX A;  2LY9 A;  1BL0 A;  1TWG J;  4D5C A;  4PU7 A;  3ZQL A;  2JCG A;  1AKH A;  4C3I J;  1JGG A;  3NAR A;  3JRD A;  1P7I A;  5IPA A;  1SFO J;  2XIU A;  1WPK A;  3S1M J;  1QVU A;  3OOU A;  1BA5 A;  5IYB J;  3L1P A;  3OIO A;  2BNO A;  5EZG A;  3TW7 A;  2JA8 J;  5IYC J;  4IHX A;  2EZI A;  2Y30 A;  5EDN A;  2GZU A;  1I3Q J;  4I6U A;  2O7O A;  2ICT A;  2JA5 J;  4JX4 A;  2R5Z A;  4C2M J;  2IAI A;  4W1U A;  1VF9 A;  4DYR A;  5EF6 A;  2DA7 A;  3WHB A;  4B4C A;  1TWF J;  3K7A J;  1WH5 A;  3BR5 A;  1OCT C;  4XK4 A;  3S2H J;  1ZVV A;  2XRL A;  3W6V A;  2R93 J;  5F04 A;  1MBE A;  2VUM J;  3UKG A;  3U3W A;  2O9L A;  4I6R A;  4O8B A;  4XIC A;  2R63 A;  2HDD A;  2Y31 A;  5FKO A;  3S1R J;  3G7D A;  1HOM A;  3Q0W A;  3PXP A;  5M5X J;  1H8A C;  2M0C A;  5EYR A;  5EZH A;  4YG1 A;  4CYC A;  5M3F J;  2LD5 A;  3GBG A;  1RKW A;  3S1N J;  4A3B J;  1SAN A;  2PIJ A;  3SFI A;  3GTL J;  2NVQ J;  1PRU A;  1FEX A;  3B6A A;  3SCG A;  1YRN A;  2L7F P;  2EWT A;  4FIS A;  2R5Y B;  2R7Z J;  4BXX J;  1IRZ A;  5GP9 A;  1ZK8 A;  1HDP A;  3OSG A;  4JX5 A;  4DW6 A;  4F8D A;  1FTZ A;  4QSH A;  3JXC L;  1ITY A;  2L49 A;  2VPR A;  5JLW A;  1JKP C;  2GRL A;  2DMU A;  1XC5 A;  1POU A;  2XGD A;  1F36 A;  4A3I J;  2O49 A;  4M3E A;  1RZR A;  1UG2 A;  3CCY A;  2OF7 A;  1UXD A;  5M5Y J;  3I4M J;  1XS9 A;  3DNV B;  2MSY A;  2E2H J;  2BNM A;  2B63 J;  1ETQ A;  4YG4 A;  2H8R A;  1JKQ C;  2JN6 A;  3ZOB A;  1B8I B;  4OB4 A;  1RPE L;  4C3H J;  1NEQ A;  3CDL A;  2XPW A;  3HDD A;  4IHY A;  1TWC J;  2HOT A;  3QWG A;  1ZZ7 A;  1WGX A;  2JMW A;  3H0G J;  1UMQ A;  5IP6 A;  2YUS A;  2IBD A;  3FK7 A;  1G2H A;  1LQC A;  2DN0 A;  3PO3 J;  3LSR A;  2AW6 A;  3GBF A;  3SCF A;  1GT0 C;  2LFB A;  4IEJ A;  3KZ3 A;  1A5J A;  2DA6 A;  3GTK J;  1WIZ A;  4NDW A;  4XRS G;  4PU8 A;  4YG7 B;  4L5E A;  2LYP A;  3QYX A;  3ZQI A;  4UUT A;  5FKL A;  3JRG A;  1L1M A;  2Y2Z A;  1JT0 A;  5C44 J;  1WET A;  1Q1V A;  3QPL A;  2IU7 A;  2WV1 A;  3HOU J;  2COB A;  1UHS A;  1VND A;  2LP0 A;  4IHV A;  2OFY A;  1QP0 A;  1U9O A;  2AXZ A;  2WUS R;  1MH3 A;  2BNN A;  2KZ8 A;  4M3B A;  2LCV A;  2XPU A;  2LYQ A;  2EZL A;  1H88 C;  4JYK A;  1SQ8 A;  1Y9Q A;  5DTD A;  3CLC A;  2ID3 A;  2NOG A;  3KJX A;  4W97 A;  2XI8 A;  3FMY A;  4DZJ A;  2DA1 A;  1X57 A;  3FYA A;  1R63 A;  1ZS4 A;  4B1R A;  3CRO L;  2O38 A;  4I6T A;  1ETV A;  3A01 A;  1VI0 A;  2M34 A;  1MNM C;  3S14 J;  3HOV J;  5C4X J;  2IVQ A;  1GUU A;  1BJZ A;  2N8G A;  2E2I J;  2IVB A;  3LIS A;  5E3L A;  4FE7 A;  4MIM A; 
#chains in the Genus database with same CATH topology
 3LA2 A;  3I4N J;  3S1Q J;  1B9M A;  3WTS C;  4I76 A;  3P5J A;  2L8N A;  3ZQH A;  3PSI A;  5EEG A;  1P7J A;  2KJB A;  3TDU C;  3ZN1 A;  1UEL B;  1VQ9 I;  5H6Q A;  3CQZ J;  4AYB A;  2OZU A;  5E1W A;  3MEJ A;  1QP7 A;  4UV9 A;  4L5I A;  3A2K A;  1ZPQ A;  5LRR A;  2JJ7 A;  3ZMS A;  5FB2 A;  4I02 A;  1YX3 A;  4EEF G;  4ESB A;  1IW7 F;  1VQ5 I;  3TFL A;  2A6T A;  3OMT A;  3LWF A;  4BKX A;  3ZCO A;  1J9I A;  1BDI A;  4Y3O A;  3OS1 A;  1ZTR A;  4GGG A;  1FIA A;  4Y15 A;  2O4A A;  1WZ2 A;  3CUQ A;  2A3S A;  2GOX B;  4X4C A;  3HHG A;  2MC4 A;  2XGC A;  1Z3Y A;  4HRI A;  3K2Z A;  3C7J A;  3TW6 A;  3R09 A;  2A61 A;  1VQ7 I;  1RIO A;  1OR7 A;  3HIF A;  2FX0 A;  2J5P A;  2M8G X;  4RAG A;  1NK2 P;  3G3Z A;  2G7H A;  5LBQ A;  4QPO A;  4X0G A;  4YIR X;  3RYR A;  3G73 A;  4UV8 A;  3DTI A;  4HNT A;  2LYS A;  3OYG A;  3IWF A;  1RUO A;  3LSH A;  1JWL A;  1DP7 P;  3FXM A;  1NW3 A;  3MVP A;  4RM3 A;  1ZRF A;  1FBQ A;  1FP1 D;  3IHU A;  2JA7 J;  2FJ1 A;  2OU2 A;  3QOE A;  1KU2 A;  2ZXI A;  1R5H A;  2ESH A;  3SXY A;  1HQ1 A;  2Z16 A;  1PER L;  2JVL A;  1ZLK A;  1UG0 A;  3OYK A;  3I5U A;  1BDH A;  4EK9 A;  4Y7N J;  5C3E J;  2MFZ A;  1X2M A;  4BQA A;  4A12 A;  5JVG F;  1T33 A;  2DPU A;  2KZG A;  3TED A;  3H35 A;  4ER3 A;  4P9F A;  2V6C A;  2F5V A;  4N0B A;  3M8E A;  3BTI A;  2HQ5 A;  2Z2S B;  3PFY A;  3NRV A;  4NNJ A;  1IRF A;  3MKZ A;  2XPV A;  3RI4 A;  3HB9 A;  4HZF A;  2GBY A;  1E3H A;  1BI3 A;  1ORK A;  1MD0 A;  1YW7 A;  5GTI C;  2FJR A;  3G5G A;  3J7A Y;  1R5G A;  4A3G J;  3BR3 A;  1QRY A;  1WJD A;  2FOW A;  4ETS A;  1ZAR A;  2HTJ A;  3E7L A;  4Z2Y A;  1IN6 A;  4IRH A;  4J00 A;  2K86 A;  3LQQ A;  5L3C A;  4Q5S F;  1BW5 A;  2WAQ A;  3WGI A;  4HF1 A;  3I0T A;  2KL4 A;  2P4W A;  4X1E A;  4IL6 C;  4V2G A;  1I27 A;  2K9L A;  3OYJ A;  3CCE I;  4X4H A;  5BNG A;  1T95 A;  3FXO A;  2JSP A;  2JRT A;  3DLL F;  3JRA A;  1DP3 A;  2IA0 A;  1GDT A;  4CYC B;  2FNP A;  2BJC A;  1MSF C;  2L4A A;  3ZQ7 A;  2WA0 A;  3J7Y J;  2YR2 A;  3G0T A;  4X4I A;  1MBF A;  3C18 A;  5FKK A;  2XGE A;  4DE8 A;  3VWS A;  1W36 D;  4E6K G;  1BBY A;  2GA2 A;  1LQ1 A;  2HYG D;  2MLG A;  4RA2 A;  2FF4 A;  3RSN A;  4BY1 J;  4G6T B;  3R6S A;  2FSW A;  2Y48 A;  4BNC A;  3SCH A;  1TNS A;  1APL C;  1Z1D A;  5LHH A;  2HDC A;  3OL3 A;  2CW0 F;  1QZX A;  4B3A A;  2Z33 A;  3DF8 A;  4NC8 A;  4MTE A;  3A9Z A;  2F2E A;  3S3M A;  1J2X A;  1R4N B;  3GUD A;  4C2U A;  5HLG A;  2DOA A;  3LQR A;  2OTL I;  4NHJ A;  5FKN A;  1T08 B;  2FOK A;  3JRB A;  5AON A;  1FIP A;  1Z91 A;  2GOM A;  1VQL I;  3CC7 I;  4AC0 A;  2L0K A;  2PMZ N;  1RZS A;  5B5E C;  2IGM A;  2WWY A;  4YG2 F;  3WGH A;  3S17 J;  3JXD L;  4OIR F;  2LC2 A;  3OQN A;  2IVM A;  3L2C A;  1QPI A;  2I10 A;  3HXL A;  3C3W A;  2ZB9 A;  3TEP A;  1R23 A;  2PUC A;  2GQQ A;  2E71 A;  1WJA A;  5L3F A;  2EH3 A;  1R71 A;  3V8L A;  1D1C A;  3PL8 A;  3IRQ A;  3PFI A;  1B0N A;  3GFI A;  1IC8 A;  3F72 A;  1SC7 A;  2H94 A;  3SYT A;  2QZ8 A;  4QPQ A;  2A05 A;  4ZC3 A;  3DXJ F;  2ICP A;  4Z5C A;  2PUB A;  2DMQ A;  2G0E A;  1S7O A;  3L9F A;  2W7N A;  1IGN A;  1MBH A;  3CDH A;  4II2 A;  4B47 A;  4A0Y A;  5J6X A;  2M5W A;  3F9K A;  2FU4 A;  3TRB A;  4RGX A;  4M6X A;  3UNG C;  3GTQ J;  4CCM A;  5IY5 H;  1XGN A;  3DTE A;  4MCT A;  1U2W A;  5E20 A;  1YLF A;  1ADR A;  3LFP A;  4DYQ A;  3BY6 A;  3ECH A;  2JZY A;  1U8B A;  3HRT A;  4MQV A;  2STT A;  2HVR A;  2PI0 A;  5IT9 K;  4IO9 F;  2DJI A;  4M3G A;  1TWH J;  2K4J A;  1QPZ A;  2K27 A;  4ZDP A;  3RQ4 A;  2XB0 X;  3RPQ A;  4UB6 C;  2L02 A;  5HLI A;  3WTZ A;  1VQ4 I;  4II3 A;  1ZAO A;  4X4D A;  2YPR A;  4XBF A;  2R7O A;  5EEH A;  1CGP A;  1I50 J;  2IV1 A;  5CKT A;  2HZT A;  2KDZ A;  1K83 J;  2MG4 A;  2VLA A;  1I6H J;  1ETO A;  1MMN A;  1NER A;  3NWT A;  2TDX A;  2BHZ A;  3WU0 A;  2V7F A;  2RDP A;  3D0S A;  4F93 B;  1RPW A;  3BQY A;  3E5U A;  1QP4 A;  4PGH A;  4ZYE A;  1J7K A;  1OCO H;  2CRO A;  1R4M B;  3H9G A;  4UUS B;  1WCM J;  4MNU A;  4AU7 A;  3JRI A;  1E3O C;  1ON1 A;  4Z6Y A;  2TCT A;  3C2B A;  3CD6 I;  3H3V K;  5HOO A;  5DD4 A;  2V79 A;  2DTZ A;  2IEK A;  2AXT C;  4E7I A;  1TW3 A;  3F8M A;  3EUK L;  3U21 A;  4J19 A;  1YE9 A;  2LY1 A;  4Y42 A;  1I5Z A;  1I3A A;  1WVR A;  2LRD A;  3EQL F;  3M07 A;  4E7Z A;  5HLT A;  2ELH A;  5J47 A;  2R7S A;  3M4O J;  3VYR B;  2H6C A;  4EMS A;  1PUF B;  1YW9 A;  1R36 A;  1ETX A;  1FOX A;  2BHY A;  3BG5 A;  1S7A A;  2KZV A;  2BGC A;  4F55 A;  5JLX A;  4DIQ A;  4MTD A;  2AHQ A;  4EM0 B;  3P9I A;  2A6C A;  2M4H A;  3ONQ A;  3CJN A;  3E0J B;  3FMS A;  1UB9 A;  3L2U A;  1Z05 A;  4ER6 A;  1OQY A;  1ETW A;  1MIJ A;  1Y1V J;  1ZKG A;  3BR2 A;  3S16 J;  3QYB A;  2E36 A;  1BW6 A;  4G9Y A;  2Y9Z A;  1ETY A;  2AS5 F;  1Y6I A;  4X4B A;  2PUG A;  3KYD B;  3MN2 A;  1RRJ A;  4XRM A;  4UUV A;  3SJM A;  5FFZ A;  3CP8 A;  4CYD A;  2MQK A;  5LFA A;  3TP3 A;  3HRM A;  4XLE A;  3BTL A;  3GLX A;  4BE0 A;  5D4R A;  3OS0 A;  3GN5 A;  1B59 A;  2XC7 A;  3OQM A;  3E6B A;  2M9H A;  5CVR A;  1WJ5 A;  2ELK A;  2LK2 A;  2HS5 A;  1WI3 A;  2I8D A;  2LNB A;  3RPU D;  3WG9 A;  1JJ6 C;  5LD2 C;  2DXI A;  2IUO A;  2LYK A;  1XGO A;  2W25 A;  2EF8 A;  2MD0 A;  2K9M A;  2MAB A;  3F6W A;  4IJA A;  2MH2 A;  2PUF A;  2RGV A;  5C4J J;  4I01 A;  2PG4 A;  2DMN A;  1AHD P;  4YIF A;  2VXZ A;  4LIV A;  3DU6 A;  2LG4 A;  4P5O A;  1XSD A;  3BG3 A;  4LG3 A;  2EFP A;  1H9T A;  4ZDL A;  1ZZ8 A;  3RQI A;  1BI2 A;  1FBU A;  1R69 A;  4XKC A;  4DBQ A;  2VT2 A;  4MQ9 F;  1FC3 A;  2G7U A;  3AG4 H;  3VYU B;  5LEK A;  1BL0 A;  5BS6 A;  3MQ0 A;  2P6T A;  2VOO A;  4RGU A;  3L2Q A;  1QU3 A;  2E60 A;  4EVI A;  4OIO F;  3AAF A;  4R8H A;  2XIU A;  1WPK A;  3ABL H;  3BZC A;  3S1M J;  2X6W A;  2IA1 A;  3DV8 A;  3TDZ C;  3CCR I;  4PJN A;  5IYB J;  3OIO A;  3U1D A;  4P1W A;  2JA8 J;  1RIO H;  2H09 A;  2KPM A;  2EZI A;  4I6U A;  1I3Q J;  4PJJ A;  4L5J A;  4I99 C;  2JA5 J;  4IPA A;  4C2M J;  2IAI A;  3TQN A;  1VF9 A;  1ZG3 A;  4DYR A;  3F3X A;  4R79 A;  2VQC A;  3G4S I;  4B4C A;  1QO0 D;  3BR5 A;  1OCT C;  3GZN B;  2Z9O A;  2DT5 A;  3W3C A;  3AKZ A;  1ODD A;  1IRX A;  1XMK A;  2O9L A;  2DOE A;  3K9T A;  2HTS A;  5L3B A;  2R63 A;  1W7P A;  3BPX A;  1GVJ A;  1AOY A;  3UWP A;  3PXP A;  5GTH C;  5M5X J;  2M0C A;  5EYR A;  4XM3 A;  3VYT B;  4YG1 A;  5ICC A;  3GBG A;  4EV0 A;  2NVQ J;  1D8J A;  3B6A A;  3H5R A;  3N05 A;  3ABU A;  2EWT A;  1KU9 A;  2R7Z J;  5E1Z B;  2WAE A;  5GP9 A;  1IRZ A;  1UCR A;  1ZK8 A;  1YQA A;  1P6R A;  1HDP A;  3BZK A;  3P9K A;  4JX5 A;  4DW6 A;  1ZG5 A;  4L18 B;  2IS4 A;  3JXC L;  4AVP A;  4LJZ F;  4DGW B;  4PDK A;  5KAF C;  1ZHF A;  2L49 A;  1F36 A;  2FUG 2;  2M3A A;  4XKW A;  3CCM I;  1UG2 A;  2BYV E;  1IRG A;  4D0P A;  2MSY A;  3F23 A;  2BNM A;  2E5Z A;  2E7W A;  4DBR A;  2MA3 A;  1XD7 A;  4OOI A;  1JKQ C;  1B8I B;  2GXA A;  4XSX F;  4A2U A;  5ICE A;  3QOW A;  2XPW A;  2HOT A;  1WGX A;  5TIS C;  1NG7 A;  4OIP F;  2JMW A;  3H0G J;  2L7K A;  1G2H A;  2KRC A;  2IS2 A;  2V1X A;  2DN0 A;  3PO3 J;  3NQO A;  2AW6 A;  3GBF A;  3SCF A;  2Z99 A;  2ZME A;  3L2W A;  1A5J A;  3DU5 A;  2EWN A;  4ASN A;  3QYX A;  4UHT A;  1VQM I;  2LYP A;  2HNH A;  2Y2Z A;  2VJ5 A;  2KHM A;  3A9X A;  1FMW A;  2COB A;  1IO2 A;  2OFY A;  5DCM B;  1QP0 A;  1U9O A;  4HLY A;  4BL0 B;  2BNN A;  3ZGK A;  1F1Z A;  2FE3 A;  4ZTF A;  4UNO A;  2CSO A;  2F5C A;  1B4A A;  3SHF A;  1T39 A;  1H88 C;  5TGT A;  3I54 A;  2HFH A;  1GXQ A;  3HOT A;  3KJX A;  3DWL E;  4W97 A;  2VN2 A;  1PUE E;  5LGU A;  4FQG A;  2HKO A;  4U7D A;  1HKS A;  3MWM A;  3FMY A;  4NC6 A;  1R63 A;  4YEL A;  1LB2 A;  4BHP A;  2PXL A;  1YJW I;  2O38 A;  3BWG A;  5D4S A;  1S5L C;  1VI0 A;  2M34 A;  3A01 A;  3S14 J;  2N8G A;  2BXZ A;  1XCB A;  4MIM A;  2QEX I;  1MKM A;  4XKV A;  5DD8 A;  1PVE A;  3FKI J;  5E3O A;  2FMY A;  1LPQ A;  1LMB 3;  4BJ6 C;  4CSW A;  2V9K A;  4CZZ A;  3LNQ A;  2H27 A;  5JFR A;  1DUX C;  4HOB A;  5M3M J;  2AXV A;  1T56 A;  2O8X A;  1BIB A;  1VQK I;  5K98 B;  3CJT B;  3FZV A;  4BQO A;  3HOY J;  5CQE A;  3B02 A;  2E19 A;  1IZ1 A;  3FMQ A;  4HBL A;  4OBM A;  3RZZ A;  2IPQ X;  2R7U A;  5K5O A;  2P8T A;  1PYV A;  1ZAY A;  1ONV A;  2KEK A;  4A3E J;  4FE4 A;  3JCU C;  3I71 A;  1IN5 A;  4Y52 J;  2PXB A;  1MFQ C;  4FET A;  2X6O A;  5B66 C;  2R7W A;  1B72 B;  1QGP A;  2JUG A;  2P7C B;  1FY7 A;  1YO5 C;  4KYW A;  1EH7 A;  5H6R A;  5CVU A;  4A3D J;  2ID6 A;  1W36 C;  2L7M P;  2DI3 A;  3QYE A;  1RR7 A;  2DDB A;  1B6A A;  2XV4 S;  4AID A;  1ACI A;  4RAZ A;  4J01 A;  1DW9 A;  1X19 A;  3PM1 A;  3HKZ A;  1BR4 A;  3KXA A;  4XON A;  2PPX A;  1PNR A;  4XNF A;  1SD6 A;  4BAC A;  1B1B A;  3T8T A;  4Y17 A;  1F43 A;  1MND A;  2EIN H;  2NNN A;  4LG0 A;  3LSJ A;  2CQN A;  3E6C C;  2BZT A;  4AUX A;  1DU6 A;  1OSL A;  1M1E B;  3G1M A;  3ME5 A;  2M7B A;  1R58 A;  2X1D A;  3CCU I;  2ZXW H;  3BTJ A;  2P5L C;  3OYB A;  2C6Y A;  2MC3 A;  2H1L A;  3LSI A;  1Z0X A;  4CCJ A;  4FX0 A;  5KCM A;  2KQR A;  3KEO A;  1SAU A;  2I5U A;  2Z1D A;  3I4P A;  3I64 A;  3LMM A;  5J4Y A;  4L9J A;  3IH2 A;  3A1Y A;  5B1B H;  2OCC H;  4B8X A;  4O3M A;  5IT9 Z;  2PLY A;  3NAU A;  4JP0 A;  4LD5 A;  3BP8 A;  4NUB A;  1YI2 I;  1IDY A;  1MMS A;  1EF4 A;  2XXP A;  3J81 Z;  1XPX A;  5CPR B;  2B5A A;  4WCG A;  5JUW A;  1XMX A;  4IXA A;  2R0Q C;  4IHS A;  3A03 A;  2PUE A;  2D1H A;  2J7U A;  3FM5 A;  5CVV A;  3NDB B;  1LE8 A;  3HOW J;  3W2W A;  3LQX A;  2CV1 A;  3K4J A;  2QBY B;  3KL4 A;  2E1M B;  2R1J L;  1U3E M;  4D9J A;  3FM3 A;  3VK0 A;  3S8Q A;  1AU7 A;  2BY1 A;  3L09 A;  4U7B A;  1TWA J;  3U1K A;  2X1E A;  4UVC A;  1JKO C;  1IV8 A;  5E3M A;  4XOR A;  1OYY A;  2WC2 A;  3H0D A;  1B9N A;  2E1N A;  3QF3 A;  1D3Y A;  4YEJ A;  2R92 J;  4ZDO A;  5F1J A;  2M45 A;  4H0E A;  1XCV A;  3NXH A;  1RPE L;  2HXI A;  2QVO A;  3ZMD A;  1I6X A;  2EIM H;  3H9Q A;  4LIU A;  1VPW A;  3ABM H;  5A2Q K;  3B6C A;  3RPU A;  4ZJZ A;  2EFW A;  5ICG A;  2HQR A;  2W84 A;  3L00 A;  4BE1 A;  2ISZ A;  2HU9 A;  2JRM A;  2KRF A;  2W82 A;  4G6D A;  4OU0 A;  3FBN B;  3RTR A;  3F0C A;  3IUO A;  1IN4 A;  4LOC A;  1JFT A;  1Z67 A;  1FLI A;  1U8R A;  1TNT A;  2PX9 A;  3WG7 H;  1LKX A;  3V8J A;  2EZH A;  4F52 A;  1SFK A;  2CQQ A;  4XRF A;  4KIS A;  1QVT A;  4KN4 X;  2HI3 A;  4EKI A;  1WH6 A;  2X51 A;  2XSD C;  1ON2 A;  5EG0 A;  1X58 A;  3O8G A;  1CQT A;  1WJC A;  3WU1 B;  2XGX A;  4J1W A;  1IJW C;  2OQR A;  4KMU X;  2KIS A;  3CMA I;  3BJA A;  4GCV A;  4XKB A;  4I98 B;  3ISP A;  5ILV A;  3QQ6 A;  4FN3 A;  3HPH A;  2ISY A;  3OYI A;  2HQA A;  3MAJ A;  4EM1 A;  4J1X A;  3U9G A;  1SFE A;  5M5W J;  3FK6 A;  1TQI A;  3PO2 J;  4D7M A;  4BHB A;  3I56 I;  1Y8Q B;  3OR1 C;  4B3X A;  1FNN A;  2M4K A;  2UXX A;  4AIH A;  3H3Z A;  2PXF A;  1Z6R A;  4RDU A;  5L3D A;  1BC8 C;  5F27 A;  3V8K A;  2K9Q A;  3FWE A;  1K4T A;  1K78 A;  3SDG A;  2M2E A;  1HQC A;  2VBY A;  3CZ6 A;  2CUE A;  3TEL A;  2FQ3 A;  2RNJ A;  3I3L A;  2CU7 A;  3V42 A;  4IA8 A;  3IH4 A;  1I1G A;  1T98 A;  3LOC A;  3LSK A;  1Y1W J;  2E1M C;  4NQW B;  3K70 C;  2LYR A;  2VAS A;  1ZN2 A;  2K02 A;  3CJQ B;  4EGZ A;  3RYP A;  4XN3 A;  2K9N A;  2PMH A;  2L54 A;  2XKO A;  1WQ2 A;  2DA5 A;  2NYX A;  2HDW A;  2EZK A;  1LDK B;  2G9W A;  2HCS A;  1U5T A;  2LF7 A;  1QHG A;  2OJE D;  2W48 A;  3ERE D;  1JXS A;  1ZRD A;  2LF8 A;  3A9Y A;  4G7O F;  1XDU A;  2KPJ A;  2ZFU A;  4Y33 A;  1ULY A;  2GWR A;  2R5Y A;  5ICF A;  3HG9 A;  3O2P E;  3T0Y A;  3CMY A;  1NTC A;  1RNL A;  3AG3 H;  3H5A A;  3K1P A;  5FRO A;  3WTT C;  4A3M J;  1X1A A;  3DCF A;  1DWK A;  1YW8 A;  2XUB A;  3I59 A;  4KJZ A;  2JSC A;  2DMT A;  3IC7 A;  1RR8 C;  2EIL H;  1F4K A;  2CO5 A;  4IWR A;  1ZEL A;  2HKX A;  1ZZB A;  1W1W E;  1HSJ A;  4MLO A;  3CUQ B;  4AVZ A;  1TZL A;  5FRN A;  5ED4 A;  1QZZ A;  1Z9C A;  3CEC A;  1MJ9 A;  5ERI A;  3LFK A;  2M4G A;  2DU9 A;  2BE5 F;  2JQ7 A;  1IDZ A;  3D5R C;  3WOD F;  1R49 A;  3W6K B;  1LJ9 A;  1G3T A;  2VKE A;  3IWZ A;  2KP6 A;  5K7H A;  3OV8 A;  3HUG A;  4HSR A;  4HV6 A;  4KIF A;  4JX6 A;  1E0E A;  2XCJ A;  2Y9Y A;  3BR0 A;  2ECC A;  2VE8 A;  4GRI A;  4WVL A;  2DT6 A;  3BDD A;  4X6A J;  1UHM A;  4M3F A;  4N4N B;  3S2D J;  2P5V A;  4B43 A;  4MEX F;  4M74 A;  5E79 C;  1R5I D;  4O5V A;  3SEQ A;  2OPT A;  3ZQC A;  4PSX A;  1K4S A;  2X85 A;  2FFH A;  1O3S A;  3LSG A;  9ANT A;  3EUH A;  2LRE A;  1UZC A;  2L9N A;  3A4C A;  3IAS 2;  2KRH A;  4LLN A;  2FBI A;  1HLV A;  5FFX A;  1REP C;  1BN5 A;  3E3V A;  1MSE C;  3HGG A;  1ZZ9 A;  1J0R A;  4RLF A;  5GAG i;  3IV5 A;  3ERM A;  3HSE A;  1T2K A;  2NVX J;  4BBS J;  1LFU P;  1W5T A;  1JUP A;  2NVY J;  5D6E A;  2DCE A;  4ER0 A;  4B09 A;  3S2W A;  5FD5 A;  1MMD A;  3K0L A;  2Q2E A;  2WB1 N;  1MGT A;  5F6F A;  2LLW A;  1V5G A;  4Z5D A;  3JW4 A;  1IXR C;  3TO6 A;  2X48 A;  2UXN A;  4HW0 A;  2QSG X;  3MLF A;  2BBY A;  2XIG A;  3QYF A;  2OAZ A;  4WXC A;  2XRO A;  2QF7 A;  2AWI A;  2NNY A;  1JKR C;  4DE9 A;  3COA C;  4HNU A;  5H2F C;  3GTP J;  3FXL A;  2MEZ A;  2CQX A;  3OYL A;  2IGN A;  4V19 K;  2JA2 A;  1FSH A;  2ZC2 A;  3QOP A;  4RB2 C;  1Z7U A;  3VPR A;  4F7Z A;  2D1V A;  2BXY A;  4EJV A;  4LB5 A;  1JHF A;  5DT2 A;  3DPT A;  1MDM A;  2CS3 A;  1XWR A;  1OR7 C;  3AL0 B;  5GAH J;  2CV2 A;  1YJN I;  2M30 A;  1XX5 A;  4FCY A;  5BOX A;  1KQ0 A;  3MCZ A;  1OCR H;  2E1C A;  2HOS A;  2XSJ C;  5EGO A;  5CYV A;  2DYR H;  2HIN A;  2LKX A;  2CH0 A;  3FYM A;  3Q0U A;  2GRM A;  3WTX C;  1X2L A;  4U0V A;  1OIS A;  1G6N A;  3TO9 A;  4HF0 A;  2LY9 A;  1R22 A;  4JK1 X;  5K5Q A;  1VQ6 I;  2HYF A;  1HC8 A;  2CWE A;  4PU7 A;  1AKH A;  2DW4 A;  4B48 A;  3CCL I;  5CJ9 A;  1P7I A;  1SFO J;  4ESF A;  3QP5 A;  2PXU A;  4GO1 A;  3OOU A;  3L1P A;  3OYE A;  4GXO A;  4PJM A;  1SMT A;  3HRS A;  4PUS A;  2Y30 A;  4UVB A;  1FT9 A;  2DK8 A;  3J81 K;  4BHC A;  4EQZ A;  1D1B A;  2R5Z A;  1F5T A;  5EF6 A;  1XGM A;  2BEO A;  4KA4 A;  1TWF J;  3K7A J;  3RKY A;  1WH5 A;  2LSO A;  2XRL A;  2R93 J;  5F04 A;  1T0F C;  1MBE A;  3H9J A;  5J40 A;  1A31 A;  3U3W A;  2H6B A;  1IAW A;  4O8B A;  4NB5 A;  1P92 A;  4XIC A;  2DYS H;  4BAY A;  2HDD A;  4ZH4 F;  2Y31 A;  3Q0W A;  3MFK A;  4AIJ A;  4XLF A;  2KKO A;  2Y69 H;  2WY8 Q;  5M3F J;  2F4O B;  1LDD A;  4P9U A;  2F4M B;  2LD5 A;  4A3B J;  3SFI A;  3ZMT A;  3GTL J;  3HTS B;  4A0X A;  2DFI A;  3GW2 A;  3M1E A;  1YRN A;  1IXS B;  2L7F P;  4FIS A;  1TLH B;  4FAS D;  4LLL A;  2DFF A;  2EIK H;  5BPI A;  3ELK A;  3GZC A;  2QQA A;  3OSG A;  1DGR M;  4F8D A;  1E17 A;  1ITY A;  2VPR A;  1ZYR F;  2CYY A;  3TGN A;  2RNG A;  3VEP A;  2ZJQ F;  1SFU A;  3HOS A;  4YFK F;  1POU A;  4WXD A;  4EKG A;  4HQE A;  2V3C C;  3VYS B;  3TBI A;  2BVL A;  3OWT A;  2HPM A;  2PEX A;  3AL0 C;  2ZXH A;  3CCY A;  2OF7 A;  1UXD A;  3I4M J;  4MGR A;  4HV5 A;  1XS9 A;  4PJL A;  3CO7 C;  1A6Q A;  2E2H J;  1LDJ A;  3K70 D;  1FOK A;  1P9Q C;  3ZOB A;  1HXD A;  1X3W B;  4F91 B;  4OB4 A;  4IOC F;  4XLP F;  3CDL A;  2V1N A;  5K5R A;  1TWC J;  3OIP A;  3JAM K;  1TTY A;  3CF2 A;  2X0L A;  1Z21 A;  1UMQ A;  3KE2 A;  4ZZL A;  3FK7 A;  4IF4 A;  1S72 I;  1ZGA A;  2L01 A;  2P0W A;  4ER5 A;  2B9S A;  2A5Y B;  2EV5 A;  2VC1 A;  3LSR A;  2FBH A;  5FLX K;  2P6S A;  4IRI A;  2HWV A;  3KZ3 A;  3KCC A;  4L9N A;  2L3D A;  1FBS A;  2ADU A;  4O6J A;  3GTK J;  1CF7 A;  4XRS G;  4PU8 A;  4L5E A;  3F8C A;  3ML6 A;  1L1M A;  4UUT A;  4UY8 I;  1JT0 A;  2VC0 A;  1WET A;  3N4M A;  1R7J A;  2OCE A;  3ZMV A;  5LRS A;  3ZN0 A;  2QKL B;  1A04 A;  1EKE A;  3IP4 B;  1QBJ A;  2WUS R;  2KZ8 A;  4BUP A;  4M3B A;  4ENJ A;  2LCV A;  2XDV A;  2EZL A;  1Y9Q A;  3QPT A;  2ID3 A;  2NOG A;  2XI8 A;  2DT7 B;  1ZRE A;  2H8W A;  2FEZ A;  1X57 A;  2VJI A;  3NEU A;  5A2Q Z;  1Y8R B;  1RUN A;  1RI7 A;  5DTM A;  1J5Y A;  2VBW A;  3HJE A;  1N25 A;  4ENM A;  5TRD A;  3FXU A;  5C4X J;  1TQP A;  1IXC A;  2PJP A;  1BJZ A;  2E2I J;  4G94 A;  1LNW A;  3VOD A;  3CDI A;  3WTY C;  4FE7 A;  1LEA A;  1WKM A;  1YJ9 I;  2CJJ A;  2DJN A;  1OJL A;  2PXQ A;  2HGC A;  5D6F A;  2PN6 A;  1TT5 B;  1DUL A;  2EV6 A;  3FXR A;  1S29 A;  3JRE A;  1VQP I;  3OYN A;  2YS9 A;  2XF5 A;  1DU0 A;  2LOO A;  3ABT A;  4A93 J;  1XN7 A;  1Z7L A;  3PQJ A;  2L7Z A;  3VWB A;  3PSF A;  5HS9 A;  2HVS A;  2BW3 A;  2RVC A;  4BEH A;  1TT0 A;  3M8J A;  2WAD A;  4JCY A;  4K2E A;  3GN5 B;  3CLQ A;  1UHW A;  2BY2 A;  4HX7 A;  1IN8 A;  4M72 A;  5KHD A;  2QWW A;  1O4X A;  4G12 A;  2PXV A;  4N4O B;  3K4C A;  5D5X B;  1JTY A;  2RQP A;  3CTA A;  4M9X A;  3V7R A;  5LGT A;  1ZG1 A;  1FP2 A;  3F52 A;  4AYB N;  3HEF A;  4IOA F;  5IP7 J;  3CP2 A;  1FYL A;  2TRT A;  2B7E A;  4ZYH A;  3K1N A;  4KIC A;  3SZG A;  2K9S A;  3HL2 A;  3PUB A;  4QTR A;  4Z58 A;  3GZ5 A;  1QQB A;  3M1C A;  5FLV A;  1O7F A;  2XB5 A;  2R7Q A;  3GME A;  5DS9 A;  3PNY A;  2Q8K A;  1HW5 A;  1S8N A;  4N9I A;  4PU4 C;  2DA2 A;  3JRH A;  1S7E A;  4XLH A;  3LSM A;  1TW2 A;  1HST A;  2WV0 A;  1NHA A;  3HZJ A;  3UFD A;  3W2A A;  1I1S A;  3H36 A;  2KIQ A;  3KZZ A;  4S0H B;  1QPM A;  1ZGW A;  4ZTJ A;  2K7L A;  1W5S A;  3E5Q A;  3GTJ J;  5BPD A;  2V26 A;  1USS A;  1SVM A;  1YX5 A;  3PUF A;  5CVI A;  4G7Z F;  5J8F A;  2M1B A;  2ZNZ A;  3HGY A;  1OYI A;  4BXF A;  4EM2 A;  1P4W A;  2LLK A;  2MYS A;  4DOZ A;  3JXB C;  3KZY A;  4XN0 A;  2LDU A;  2NS7 A;  5B1A H;  4M3D A;  2VIX A;  2V4J C;  3VSL A;  4LMY A;  3DFG A;  4RAY A;  3IKT A;  5GPA A;  3BD1 A;  1JUM A;  2KJC A;  1KU7 A;  2JQE A;  4ENK A;  2KDO A;  2EBI A;  3ZKC A;  2HQN A;  4BGD A;  2OC6 A;  4D7N A;  3M3Y J;  2O0Y A;  2X1C A;  1W7P B;  2RKH A;  3FIW A;  3HSR A;  2ZFW A;  3DEE A;  2EIJ H;  4HA8 A;  1Y0U A;  5KAI C;  1IUF A;  3KYC B;  2JA6 J;  2EFN A;  4B44 A;  2DFE A;  4CO8 A;  1UTX A;  3RZO J;  2XAF A;  3GFJ A;  5AIP A;  2PMZ A;  1H9G A;  4FT8 A;  3GZ6 A;  2CW7 A;  2GA1 A;  5AIQ A;  3KEQ A;  3PNV A;  1RZR D;  2XAU A;  2IA2 A;  3D1N I;  2FRH A;  4YRV A;  2WAQ N;  3Q3S A;  2DK5 A;  2E1O A;  3CCS I;  3DPU A;  3ZHI A;  3KP4 A;  1MW7 A;  5DRT A;  2ECB A;  3WU2 C;  3AG1 H;  2HFZ A;  1SD5 A;  2MH9 A;  3C1D A;  1A36 A;  4OWR B;  4XSZ F;  1MMG A;  2ESN A;  5F0C A;  2JWT A;  2YU9 J;  2HOE A;  1XDS A;  4A3J J;  2LBF A;  3FIS A;  3KPH A;  3SZT A;  1ZH5 A;  2ZJ2 A;  2R7R A;  3EUS A;  3K6G A;  4UB8 C;  2ZME B;  3M9A A;  5LGN A;  1JI8 A;  4MO7 A;  2PUD A;  5HS7 A;  3JSP A;  1JFS A;  3W6J B;  2XAJ A;  2GM4 A;  3KX2 A;  1MJB A;  3H1C A;  1YG2 A;  3EYI A;  3RDI A;  1A6I A;  1HCR A;  3ECO A;  2K3P A;  1KQ9 A;  4Q2J A;  4L9T A;  2J7W A;  4FHT A;  4RGS A;  1QZY A;  2MBF A;  2VKD A;  1LFP A;  4G8X A;  4OMY A;  1ZZC A;  4A3K J;  2XF7 A;  1TQM A;  5B3S H;  5KK1 A;  4AD9 A;  1YS6 A;  4Z5H A;  2E5N A;  1L0O C;  3QP6 A;  3Q9S A;  2W24 A;  2VPL A;  1U6G A;  2IW5 A;  5E17 F;  1S9H A;  3P7N A;  2BY0 A;  4EJU A;  3ZQQ A;  2HCN A;  4BYY A;  3LAP A;  3DTK A;  4S05 A;  3LA7 A;  3A01 B;  3A0H C;  2V1U A;  2V6E A;  5JR3 A;  5CQG A;  1QHH D;  5K1Y A;  1TC3 C;  2XAQ A;  3JRC A;  2VQH A;  2DO7 A;  3OP9 A;  3JRF A;  4BS9 A;  3E5X A;  1X1B A;  2W1O A;  2ZXJ A;  1GXP A;  2BY3 A;  1IUY A;  2P5K A;  2HOA A;  3IRR A;  3GTM J;  5ILU A;  2XJ3 A;  3F8B A;  2KIF A;  2FML A;  1ETK A;  1OPC A;  4KIT B;  2JK3 A;  1KON A;  2VI6 A;  3HBL A;  3KP5 A;  1WH7 A;  1O3T A;  4CCL A;  1GV5 A;  1WHU A;  1FJL A;  3OS2 A;  4CZC A;  3SQN A;  3L2V A;  2UZK A;  4LB6 B;  3FXQ A;  3DEU A;  2QUF A;  3QRF F;  5HVQ C;  4ABZ A;  4HST A;  3GWZ A;  1X1C A;  4ITV A;  3HZI B;  5DSX A;  4M9Z A;  2BOL A;  4ENN A;  2ETH A;  4D1Q A;  4A5M A;  3A0B C;  2LKS A;  3BR6 A;  4NDL A;  4OIQ F;  3O9X A;  4G7H F;  5FRM A;  5IYD J;  2ODR D;  5GAD J;  4OIN F;  1X2N A;  1WI9 A;  3KP2 A;  4KIG A;  1ZR2 A;  1YFH A;  4AIK A;  2IT0 A;  2YSR A;  2ZME C;  4EJT A;  3BPV A;  4F3Q A;  1RET A;  2PJR A;  2WBM A;  2QLZ A;  4WXH A;  2H1K A;  4LG0 B;  2QQ9 A;  5ILS A;  3J7A O;  4GQM A;  2DQL A;  3P9C A;  5E3N A;  3BG7 A;  2WIU B;  4U0Y A;  3BLY A;  3LAJ A;  4BU2 A;  2LR8 A;  5BMZ A;  4A0Z A;  2HZD A;  3EYY A;  1OCZ H;  1VZ0 A;  1WH8 A;  3CO6 C;  4FBI A;  4HX8 A;  2VKH A;  2GXG A;  3F8F A;  2DPD A;  4MFD A;  2PQ8 A;  3IKV A;  2PMU A;  3SFZ A;  1GVD A;  1V5F A;  2MGQ A;  4C30 A;  2ZJR F;  2OR1 L;  3GX4 X;  3Q0V A;  1BR2 A;  1SMY F;  5D5V B;  5FLM J;  1X4O A;  1HF0 A;  4QWQ A;  3E6D A;  2L5Q A;  2FD5 A;  1ENH A;  1SEU A;  1LEB A;  1BOA A;  2CUF A;  3GFL A;  5DYM A;  2R7T A;  1VFC A;  1Y39 A;  1OCP A;  1FPQ A;  1YIO A;  2ME6 A;  1LE8 B;  2VJ4 A;  4CCN A;  3OYC A;  1Q1H A;  2VT3 A;  3EDP A;  2AUW A;  1HKQ A;  2MLK A;  4E7S A;  1NH3 A;  3LSP A;  1WJE A;  3GFM A;  4XMY A;  3REO A;  3JAM Z;  1BI1 A;  3KP6 A;  1JHH A;  1KYZ A;  3B73 A;  3FXJ A;  2JVH A;  2RN7 A;  3ZMU A;  5FLX Z;  3LST A;  4FX4 A;  3B7H A;  1PRA A;  4HF2 A;  2VON A;  3S3N A;  1DPR A;  5FD6 A;  5GAG J;  1EH8 A;  3QAH A;  4YBA A;  2M0M A;  2L9S A;  2R7X A;  4BE2 A;  3TP0 A;  1H89 C;  2EJR A;  3GTG J;  3J7Z I;  4MEY F;  4IZZ A;  3TMO A;  2IP2 A;  4PU3 C;  4BY7 J;  3JR9 A;  3ZR8 X;  3F51 A;  5IT3 A;  5EJC A;  4A6E A;  3WE3 A;  4PZJ A;  2FQ4 A;  3H3U A;  3C2H A;  1IF1 A;  3OMY A;  3T8R A;  1T38 A;  3S32 A;  3F21 A;  1T6S A;  4CXF A;  2R3S A;  1K7A A;  1G8X A;  5KNL A;  3PQK A;  2JT1 A;  2KMU A;  4M6V A;  5EG0 B;  4E7J A;  1R9T J;  4I8T A;  1H0M A;  3ZHM A;  3FHN A;  3HSF A;  4MCX A;  5DV5 A;  4HAM A;  3X2Q H;  1R6R A;  3CLO A;  3OYM A;  3ULQ B;  4D5C A;  1VTN C;  3BC8 A;  2CMP A;  1VQ8 I;  3ZQL A;  1BI0 A;  3K4L A;  4M73 A;  2JCG A;  4P55 A;  3CCV I;  3PNT A;  3JRD A;  5IPA A;  3ZPX A;  1HKT A;  4EAT A;  2LMD A;  2QQ8 A;  3GZD C;  3N97 A;  3E6M A;  3ZRG A;  2MXD A;  3S8P A;  5LHG A;  1QVU A;  4XOP A;  1BA5 A;  3ASO H;  2QSH X;  3QU3 A;  4XOT A;  2P7V B;  2R7V A;  4A6D A;  3TW7 A;  4RGR A;  2XHK A;  2WAF A;  3K10 A;  2GZU A;  2DAO A;  4GYG A;  4EJW A;  4JX4 A;  1K78 B;  1WSU A;  4IX7 A;  4CCO A;  1J75 A;  3M7G A;  1XMA A;  3D5S C;  1G4D A;  1ZVV A;  1V5E A;  4XK4 A;  5TJJ A;  4EJO A;  3W6V A;  2VUM J;  2ZJP F;  1SVL A;  5CVJ A;  5KVR A;  5DUK A;  4KIB A;  3UKG A;  4I6R A;  2L9V A;  2EK5 A;  3F6O A;  3KYL A;  3S1R J;  3M8F A;  2FNA A;  2OZ6 A;  2A6E F;  4CYC A;  1U5T B;  1RKW A;  3S1N J;  1DQU A;  1SAN A;  2PIJ A;  3F22 A;  1FZP B;  2PXP A;  1FX7 A;  4ON0 A;  1PRU A;  1FEX A;  5E8I A;  3CF5 F;  2A68 F;  5DDG A;  2F4I A;  2ZSH B;  2W4S A;  4RLQ A;  2X4H A;  5JI6 A;  2M87 A;  2R5Y B;  4BXX J;  5D5W B;  2Y0S A;  2PXT A;  1QQI A;  1FTZ A;  5DTR A;  3BOQ A;  3I59 B;  5HDG A;  2NXN B;  3BZ6 A;  4E70 A;  2XGD A;  4H4K C;  1N75 A;  4M3E A;  1RZR A;  4GDF A;  3G6E I;  1D5V A;  1E2X A;  2VEO A;  3LA3 A;  2YBD A;  3DNV B;  2HEO A;  3Q9V A;  3K4N A;  2JPB A;  1ETQ A;  3DKW A;  4YG4 A;  4GYI A;  2JN6 A;  1T0F A;  1WFX A;  1KU3 A;  1V4R A;  2F5E A;  3QOD A;  5DCF A;  1P2F A;  4C3H J;  1YOV B;  1QB2 A;  4EGY A;  4CA0 A;  4HYE A;  3BJO A;  4JQF A;  1ZZ7 A;  4CDG A;  3QWG A;  1STZ A;  1W7P D;  1W4M A;  1EV7 A;  2YUS A;  2IBD A;  4JOM A;  2Z5U A;  1LQC A;  5E18 F;  3MZ8 A;  5D5U B;  3PIP F;  4Q48 A;  3I9V 2;  3DLA A;  3HUG B;  4BJ5 C;  2VOP A;  2WTE A;  3G2B A;  1OKR A;  2DA6 A;  1WIZ A;  4NDW A;  4YG7 B;  3ZQI A;  4KT6 A;  5C44 J;  1SVO A;  4BDY A;  2IU7 A;  2WV1 A;  2YU3 A;  4OAY A;  2OD5 A;  3ZMZ A;  1EA3 A;  1UHS A;  1VND A;  2R7F A;  1XB4 A;  2VQL A;  3GCM A;  4IHV A;  2Y75 A;  3KEY A;  1O7L A;  1MH3 A;  2LY2 A;  2K5C A;  3MD2 A;  3D5L A;  2ZCW A;  3EET A;  3IAM 2;  5L3E A;  4JYK A;  4AM3 A;  1MJA A;  3FDY A;  2O3F A;  3CLC A;  2OBP A;  2VE9 A;  1KQ8 A;  1BR1 A;  3C2G A;  4Q4Z F;  3CUQ C;  2DA1 A;  2M7A A;  3U2R A;  1OMI A;  4CH7 A;  4XLA A;  1ZS4 A;  3H92 A;  1SD4 A;  4I0B A;  1ETV A;  3OYH A;  3FBI B;  1GUU A;  1P4A A;  2IVB A;  1UFM A;  2ICW G;  4HRA A;  3O6B B;  5E3L A;  2NVT J;  1C0W A;  4E7L A;  5FJ8 J;  2JTV A;  2EV0 A;  4ZZD A;  3BS3 A;  2ACJ A;  2QSF X;  1U5T C;  2NS8 A;  2W00 A;  2Q2E B;  3CES A;  3VB2 A;  4C9Y A;  3K4B A;  3CJR B;  4CUG A;  5FGM A;  3OL4 A;  3I53 A;  3VDX A;  3ASN H;  2KT0 A;  4Q47 A;  4UXN A;  1PRV A;  4RS8 A;  1YSE A;  1G3W A;  2LNM A;  1LCD A;  2WY7 Q;  4CIC A;  1MBJ A;  2ME0 A;  3CC4 I;  1YYV A;  2DA4 A;  1LVK A;  3V4G A;  3BR1 A;  4I6Z A;  4PSW A;  2QA4 I;  1YHQ I;  1JH9 A;  1KA8 A;  4U0W A;  3UR3 C;  4KMF A;  4PJ0 C;  2L9R A;  5DM6 F;  2CSF A;  2LLV A;  5LEJ A;  3HM5 A;  3R1F A;  4IVN A;  1RKT A;  4A3F J;  4BXU A;  2LKP A;  4HG2 A;  1W0T A;  1T8I A;  1R1U A;  2DLL A;  4JBA A;  2DOF A;  4A5N A;  3EUA A;  4GFB A;  2O8K A;  2L2O A;  4CCK A;  4KFC A;  1HDD C;  5DUI A;  1MDM B;  5J1U A;  1G59 A;  4MHG A;  1YIJ I;  2D5V A;  4LK1 F;  2EPF A;  3E97 A;  1X1D A;  3KP3 A;  3QU6 A;  4M6Y A;  4RMN A;  4CGZ A;  1G3S A;  3BG6 A;  4ANJ A;  1Z77 A;  3F8N A;  1QA6 A;  2KLO A;  3VOE A;  5EGO B;  1HW2 A;  4UUS A;  3KLO A;  3ABK H;  1IG7 A;  3GXO A;  4WWC A;  5FO5 A;  1ZQ3 P;  5IP9 J;  2L1P A;  4QIW N;  3LL7 A;  1FOW A;  3LFU A;  5LLQ A;  3RZD J;  2O6G E;  2DBB A;  3OY9 A;  4HX4 A;  2DMP A;  4RB0 A;  2DQR A;  1AKH B;  3K4K A;  5IOY A;  3RKX A;  5DTQ A;  4HPQ A;  4C2T A;  3EUH C;  4BQN A;  5F0F A;  1EFA A;  3DBR B;  1FTT A;  2KFD A;  2A5W A;  2UV1 A;  4OMZ A;  4KT5 C;  2X6Y A;  2XVC A;  3BG9 A;  5HDK A;  3G1O A;  3GYH X;  4I2O A;  1RES A;  2CQ7 A;  2HXO A;  5F64 A;  5J3L A;  2VBZ A;  3HKZ N;  1PUF A;  1JJ8 C;  2AQF A;  3V7S A;  4XID A;  5J1R A;  1MBG A;  1YTY A;  2QEN A;  5CLS A;  3FXK A;  5JHU A;  2R7D A;  1CJG A;  4E7K A;  4WF2 A;  1ZGJ A;  4U88 A;  1TBX A;  2R5Z B;  3BDN A;  3OQO A;  5L3G A;  2LH9 A;  3SDB A;  3T5X A;  5H20 A;  1U9N A;  3RKW A;  3IL2 A;  1OLT A;  2IXS A;  3GVA A;  3RJP A;  1BOB A;  1Y0N A;  2PE5 A;  2CW8 A;  4PFO A;  4ZYA A;  3KET A;  3S93 A;  3AG2 H;  5DEQ A;  1R1T A;  3TO7 A;  2NRA C;  1HA8 A;  2XRN A;  3ESW B;  2VKV A;  3BCA A;  1D0Z A;  5A7L A;  2F6C A;  4D5F A;  4I0A A;  4BBR J;  2AQE A;  3OYF A;  3Q5F A;  4X4G A;  1O3R A;  2QCO A;  4KDP A;  4NC7 A;  4YII A;  1YRN B;  4HEA 2;  5K7F A;  3CME I;  3PJR A;  3K2A A;  1ZUG A;  3HPG A;  1TL8 A;  1HBX G;  4I09 A;  1XSV A;  2GIV A;  2X6X A;  1RC9 A;  2JUC A;  3J80 K;  3DEW A;  1W0U A;  1MMA A;  1UXC A;  1JE8 A;  4YAR A;  1N77 A;  3VSK A;  3WHC A;  4X4E A;  2PUA A;  1Z6T A;  4A3L J;  4AWX B;  2A07 F;  2A69 F;  2EFQ A;  3S15 J;  4JCX A;  2XAG A;  2PXK A;  3A02 A;  1LCC A;  1Y56 A;  2V9P A;  3MKL A;  3FMR A;  2DA3 A;  4U87 A;  3TKY A;  3TOB A;  3ZQG A;  1WJF A;  1ZRC A;  5BQT A;  4WX9 A;  5GAH i;  4QLC U;  1POG A;  2PXE A;  4IRG A;  1V55 H;  1W5C C;  4HNV A;  1GHC A;  3WE2 A;  1J09 A;  2NVU B;  1PP7 U;  2MW8 A;  3WTW C;  3H5T A;  5LHI A;  3RKQ A;  2VJJ A;  5HS8 A;  2CFX A;  2OV7 A;  3MZH A;  1X1P A;  4ER7 A;  1O57 A;  1CF7 B;  1ZLJ A;  1BM9 A;  2RQQ A;  4Y13 A;  1NK3 P;  4X4F A;  3RCO A;  4IVZ A;  2CUJ A;  1D1A A;  3PIO F;  3ZP5 A;  4CHU A;  4XQF A;  3QPS A;  3I58 A;  2AXL A;  3H5N A;  1MZB A;  5DRY A;  2NOJ B;  1UJ8 A;  3DBH B;  2OUM A;  4V2F A;  4IKF A;  5J1Y A;  2W57 A;  4N9H A;  2VQG A;  4LIT A;  1F9N A;  3NZL A;  1G3Y A;  3HTU A;  4JQD A;  4LGW A;  3BT9 A;  2ZO4 A;  2K3F A;  2HYJ A;  3O8H A;  5GPC A;  5FKM A;  4BH9 A;  1XG1 A;  4XLN F;  3BTC A;  2IGO A;  2K40 A;  4DQ2 A;  4LK0 F;  4YFN F;  2EA4 A;  2FXA A;  2EBY A;  4F92 B;  4GHJ A;  4L9V A;  1LVA A;  2AXU A;  5D8L B;  3HRU A;  1LFB A;  2NS0 A;  2DOD A;  1L3L A;  3FX3 A;  3HOZ J;  2OTJ I;  2IVG A;  3MMY B;  1VQN I;  3DQV C;  3OWQ A;  4IQ4 A;  1MNE A;  4DNC A;  2VL8 A;  2L4M A;  1MBK A;  1R1V A;  2M8E A;  2QYO A;  1VQO I;  3G1L A;  4Z59 A;  3IH3 A;  4RBO A;  4XRS A;  2LVS A;  1QZE A;  2HPI A;  4Y4R A;  2UWM A;  3R60 A;  3HHH A;  4YFX F;  2LYL A;  2ZBK A;  1GLN A;  2R4G A;  1D5Y A;  4DYC A;  2LYJ A;  2BW3 B;  4BEH B;  1JGS A;  1V3F A;  2RC4 A;  2GLO A;  1D0Y A;  4M71 A;  2O61 A;  4BDZ A;  1S3J A;  1SFX A;  3BQZ A;  1YS7 A;  4RAF A;  2EA2 A;  4LFU A;  4FTH A;  2PXD A;  1B8I A;  2XF6 A;  4DJA A;  4IHT A;  3CCQ I;  1GV2 A;  2FBK A;  1S6L A;  3O3K A;  5F08 A;  3JSO A;  4OAZ A;  2E34 A;  1A35 A;  4KUM A;  4G6Q A;  2Y0M A;  2HSG A;  1AA7 A;  2E2J J;  4C3J J;  5HLH A;  4DZP A;  5HOD A;  2IS6 A;  2E35 A;  2EB7 A;  3OOP A;  3FF5 A;  1OYW A;  3IVP A;  4PGG A;  4RB3 C;  1QQA A;  1I39 A;  1JTX A;  1TP4 A;  1ZR4 A;  1QNT A;  2RRE A;  2CGP A;  5J8C A;  3QFI A;  5IOZ A;  4A3C J;  2RAE A;  4E7H A;  3HC7 A;  4I7H A;  3OYD A;  2P81 A;  5E1X A;  1JUS A;  5DCM A;  4E4H A;  4ZYG A;  4KN7 X;  4LLG F;  2CFO A;  2WB1 A;  3MZY A;  3MKY B;  3GTO J;  1PJR A;  3R4K A;  1SD7 A;  2ZNY A;  1Y7Y A;  2K4B A;  2RV8 A;  3OKZ A;  4M9S A;  5K7Z A;  1DGW Y;  5E8G A;  2FA5 A;  3OIQ A;  2QKM B;  3QQA A;  1P4X A;  3BCB A;  1BJA A;  3ZQF A;  4BQQ A;  3OSF A;  3K69 A;  2ZKZ A;  1MH4 A;  2OA4 A;  3MKW B;  1E3P A;  1RZ4 A;  4PFP A;  3HOX J;  3GO5 A;  4A69 C;  2AO9 A;  2ZSI B;  4NBQ A;  4IHW A;  2Y0S N;  2KEJ A;  1BC7 C;  3WGG A;  3NRO A;  1KYW A;  4TV7 A;  4WK8 F;  3QWL A;  3TOA A;  2GXB A;  2VOD A;  3JTG A;  1U78 A;  2O5R A;  3CCJ I;  1HW1 A;  2D2W A;  3QPH A;  1NG6 A;  1KZH A;  2UUZ A;  2F5F A;  4RM2 A;  3WTV C;  2X9D A;  4HQM A;  2Q0O A;  2CRG A;  2V1D A;  4L0Y B;  2OQG A;  1LUJ B;  2EFO A;  1IV6 A;  1OFC X;  1FOY A;  3M9L A;  3ROU A;  1OCC H;  1K61 A;  1IN7 A;  3FKJ A;  5J4V A;  3BRO A;  3OR2 C;  1B72 A;  2VBX A;  2LYC A;  1ERD A;  1JT6 A;  2LTP A;  3R0A A;  4MFE A;  1DPU A;  1PDN C;  1ZZ6 A;  3NWS A;  1UST A;  2EQR A;  2KIM A;  1EH6 A;  1WRJ A;  2F5D A;  1LLI A;  5F0H A;  2KEI A;  2ELJ A;  2PBI A;  3L7W A;  4HLX A;  2VXD A;  3OYA A;  2CUZ A;  1J59 A;  1X4P A;  5EEA A;  2E7X A;  2LBF B;  2YX7 A;  3KFW X;  1TWG J;  2NAZ A;  2BVM A;  1X3U A;  4PCQ A;  2O03 A;  3DKX A;  4C3I J;  3NAR A;  1JGG A;  3SR4 A;  3FHZ A;  3SX0 A;  3R61 A;  4BJT A;  6PAX A;  3F6V A;  3SZP A;  1Z3X A;  2CG4 A;  1KGS A;  4EQQ A;  2BNO A;  4L0Z B;  3BJ6 A;  1U0J A;  3CMM A;  5EZG A;  2Z3Y A;  3AFH A;  5IYC J;  4IHX A;  5EDN A;  2HR3 A;  2F48 A;  1N78 A;  2O7O A;  2ICT A;  3DP7 A;  2PFB A;  2K85 A;  4HDV A;  3JTH A;  2YX4 A;  4XLC A;  3ZXS A;  1XTA A;  4W1U A;  5F1R A;  2DA7 A;  3WHB A;  3CC2 I;  2D45 A;  1K6O A;  2IJL A;  3S2H J;  5HNF A;  3GUU A;  3GF2 A;  2DDA A;  1DDN A;  2COM A;  2B0L A;  4XL9 A;  2QBY A;  3SEZ A;  1AWC A;  3TL4 X;  3DBL B;  3CUO A;  5FKO A;  1V54 H;  2CV0 A;  5GAE J;  3G7D A;  3KZI C;  1HOM A;  1H8A C;  5D8K B;  5EZH A;  3K4M A;  2QM3 A;  4ZYD A;  2STW A;  3GEZ A;  3GZD A;  3DKY A;  1FSE A;  3SCG A;  2JPC A;  4S04 A;  3V7C A;  3PE5 A;  4P96 A;  4R1H A;  1FMV A;  4QSH A;  2IGK A;  5JLW A;  1JKP C;  2GRL A;  2DMU A;  2GZW A;  2XAH A;  1XC5 A;  2O49 A;  4A3I J;  1X3Z B;  2XXQ A;  3HYI A;  1FYK A;  1K6Y A;  5M5Y J;  2QGU A;  2B63 J;  2HVQ A;  2V9V A;  2H8R A;  3QOX A;  3MEX A;  1NEQ A;  3WTU C;  3HDD A;  4IHY A;  2JVG A;  2W85 A;  1O3Q A;  3K1M A;  2A6H F;  1D0X A;  1UAA A;  1EJ9 A;  5IP6 A;  3VFZ A;  5JHF A;  1PP8 F;  3GLL A;  4RB1 A;  3KLN A;  5HNH A;  3DPL C;  4EZI A;  1GT0 C;  2LFB A;  4IEJ A;  3L2R A;  1SAX A;  1D8K A;  3W2V A;  1K79 A;  3EPZ A;  3E1S A;  3T1B A;  2PJR B;  2IRF G;  1FWZ A;  2J5O A;  1BIA A;  5FKL A;  3JRG A;  2BV6 A;  1WJB A;  1Q1V A;  3QPL A;  4ESJ A;  4IQJ A;  3HOU J;  2DTR A;  4KNY A;  5DM7 F;  2GAU A;  2LP0 A;  3R0J A;  5JVT A;  2AXZ A;  3DM5 A;  1FYM A;  2IS1 A;  3KIO A;  2XPU A;  2LYQ A;  3G71 I;  2Q1Z B;  2DFH A;  3RIR A;  1SQ8 A;  5DTD A;  1WWX A;  2XKP A;  1R00 A;  1YIT I;  3KP7 A;  2QQB A;  3I55 I;  2CQK A;  4HDU A;  4DZJ A;  3FYA A;  1XGS A;  3ZPL A;  4XR6 A;  2XXA A;  4NQW A;  2XAS A;  3J80 Z;  4B1R A;  1U2Z A;  3CRO L;  4PK4 A;  4I6T A;  1MNM C;  4UVA A;  5HDN A;  1XSX A;  2KIU A;  3HOV J;  2IVQ A;  2VB6 A;  3LIS A;  2MD5 A;  3S3O A;  2GIZ A; 
#chains in the Genus database with same CATH homology
 3I4N J;  2CJJ A;  2DJN A;  1OJL A;  5FJ8 J;  4I76 A;  3S1Q J;  3BS3 A;  3FKI J;  5E3O A;  2L8N A;  1LMB 3;  3ZQH A;  3LNQ A;  2NS8 A;  1P7J A;  5M3M J;  3CQZ J;  2AXV A;  1T56 A;  3JRE A;  5K98 B;  1QP7 A;  3HOY J;  1ZPQ A;  2KT0 A;  2YS9 A;  1YSE A;  1PRV A;  2E19 A;  1DU0 A;  1LCD A;  2JJ7 A;  1MBJ A;  4A93 J;  2ME0 A;  3RZZ A;  2L7Z A;  4EEF G;  2DA4 A;  4I6Z A;  3BR1 A;  1ZAY A;  2KEK A;  4A3E J;  1JH9 A;  4JCY A;  4FE4 A;  3OMT A;  2CSF A;  2L9R A;  4BKX A;  4Y52 J;  1BDI A;  3HM5 A;  3GN5 B;  2X6O A;  3R1F A;  1ZTR A;  1RKT A;  4A3F J;  1B72 B;  1FIA A;  2O4A A;  1W0T A;  1O4X A;  4X4C A;  2XGC A;  4G12 A;  4GFB A;  4A3D J;  2O8K A;  2ID6 A;  1JTY A;  2L7M P;  3TW6 A;  3F52 A;  1HDD C;  1RR7 A;  5J1U A;  3HEF A;  4AYB N;  1RIO A;  2D5V A;  5IP7 J;  1DW9 A;  2FX0 A;  2M8G X;  3PM1 A;  1NK2 P;  2TRT A;  3KXA A;  2K9S A;  2PPX A;  1PNR A;  4QTR A;  4Z58 A;  1Z77 A;  1QQB A;  5FLV A;  5EGO B;  1F43 A;  2XB5 A;  2LYS A;  4UUS A;  1JWL A;  3LSJ A;  1IG7 A;  1ZQ3 P;  4AUX A;  5DS9 A;  5IP9 J;  1DU6 A;  3MVP A;  4QIW N;  1OSL A;  3G1M A;  2JA7 J;  2FJ1 A;  4PU4 C;  2DA2 A;  3JRH A;  1S7E A;  3RZD J;  3BTJ A;  1PER L;  2JVL A;  1Z0X A;  2DMP A;  3UFD A;  1AKH B;  5IOY A;  1BDH A;  4Y7N J;  5C3E J;  3IH2 A;  1X2M A;  5F0F A;  4S0H B;  1ZGW A;  1T33 A;  1FTT A;  3TED A;  3BG9 A;  3NAU A;  3G1O A;  1RES A;  5J3L A;  2HXO A;  4JP0 A;  3GTJ J;  3HKZ N;  1PUF A;  1IDY A;  1JJ8 C;  4XID A;  5J1R A;  3BTI A;  2HQ5 A;  1EF4 A;  1MBG A;  3HGY A;  1CJG A;  2XPV A;  2B5A A;  3HB9 A;  2LLK A;  2GBY A;  2R0Q C;  2FJR A;  1ORK A;  3JXB C;  3G5G A;  3A03 A;  1EFA A;  2R5Z B;  3ZHI A;  2PUE A;  4A3G J;  3BR3 A;  1QRY A;  2NS7 A;  3BDN A;  3OQO A;  3E7L A;  4M3D A;  1U9N A;  1LE8 A;  3HOW J;  5GPA A;  3BD1 A;  1JUM A;  2R1J L;  2PE5 A;  1BW5 A;  2EBI A;  3VK0 A;  3ZKC A;  4X1E A;  1AU7 A;  3S8Q A;  4V2G A;  4D7N A;  3M3Y J;  1TWA J;  3FIW A;  2VKV A;  4X4H A;  5BNG A;  1JKO C;  5E3M A;  5A7L A;  3JRA A;  4D5F A;  1IUF A;  4CYC B;  1GDT A;  4BBR J;  3QF3 A;  2BJC A;  1MSF C;  2JA6 J;  4X4G A;  2R92 J;  2QCO A;  4X4I A;  5F1J A;  1YRN B;  1UTX A;  3RZO J;  2HXI A;  5K7F A;  1MBF A;  3K2A A;  1ZUG A;  5FKK A;  2XGE A;  1VPW A;  3B6C A;  3DEW A;  1W0U A;  4BY1 J;  1RZR D;  1UXC A;  4YAR A;  3WHC A;  3D1N I;  4X4E A;  2PUA A;  4A3L J;  3SCH A;  2WAQ N;  3S15 J;  3Q3S A;  1APL C;  4JCX A;  2E1O A;  3F0C A;  3A02 A;  2ECB A;  4LOC A;  1JFT A;  1LCC A;  4B3A A;  3MKL A;  2EZH A;  2DA3 A;  2CQQ A;  3ZQG A;  1QVT A;  2HI3 A;  5FKN A;  1WH6 A;  2XSD C;  3JRB A;  5EG0 A;  1POG A;  1FIP A;  1X58 A;  2JWT A;  5F0C A;  3O8G A;  4HNV A;  1CQT A;  2YU9 J;  4A3J J;  4J1W A;  1IJW C;  4AC0 A;  3FIS A;  2MW8 A;  2L0K A;  2PMZ N;  1RZS A;  3H5T A;  3RKQ A;  3S17 J;  3EUS A;  3JXD L;  3QQ6 A;  4MO7 A;  3OQN A;  4FN3 A;  2PUD A;  1QPI A;  1JFS A;  2I10 A;  4J1X A;  2GM4 A;  5M5W J;  2ZB9 A;  3FK6 A;  1NK3 P;  3PO2 J;  4D7M A;  2PUC A;  1A6I A;  1HCR A;  4X4F A;  4IVZ A;  2EH3 A;  4RDU A;  3QPS A;  1B0N A;  5F27 A;  1IC8 A;  1ZZC A;  4V2F A;  2K9Q A;  4A3K J;  5J1Y A;  3SDG A;  2M2E A;  4Z5H A;  2CUE A;  4Z5C A;  4JQD A;  2PUB A;  2ICP A;  2DMQ A;  2G0E A;  4IA8 A;  2CU7 A;  3IH4 A;  3BT9 A;  1IGN A;  1MBH A;  2HYJ A;  3LOC A;  3O8H A;  5GPC A;  1Y1W J;  5FKM A;  2LYR A;  1XG1 A;  3TRB A;  3BTC A;  2K40 A;  2EBY A;  4GHJ A;  3A01 B;  3GTQ J;  2K9N A;  1TC3 C;  4MCT A;  2AXU A;  3HOZ J;  2IVG A;  1LFB A;  2DA5 A;  3JRC A;  1ADR A;  3LFP A;  2EZK A;  3OP9 A;  3JRF A;  4DYQ A;  2W48 A;  1MBK A;  1U8B A;  2HOA A;  3GTM J;  2KPJ A;  2XJ3 A;  3G1L A;  1ETK A;  2R5Y A;  3IH3 A;  4Z59 A;  4M3G A;  4RBO A;  2JK3 A;  2VI6 A;  3HBL A;  4XRS A;  2LVS A;  3CMY A;  1TWH J;  1QPZ A;  1NTC A;  1WH7 A;  2LYL A;  4A3M J;  3DCF A;  1GV5 A;  1D5Y A;  1DWK A;  4DYC A;  1FJL A;  2LYJ A;  2DMT A;  2XB0 X;  4IWR A;  2GLO A;  2NVT J;  1ZZB A;  4X4D A;  3BQZ A;  4ABZ A;  3HZI B;  4MLO A;  1I50 J;  4FTH A;  2IV1 A;  2KDZ A;  1B8I A;  3CEC A;  1K83 J;  1GV2 A;  3BR6 A;  2MG4 A;  4NDL A;  3O9X A;  1I6H J;  1ETO A;  5F08 A;  5IYD J;  1NER A;  1X2N A;  1IDZ A;  2HSG A;  1ZR2 A;  2E2J J;  2VKE A;  1RPW A;  4C3J J;  3BQY A;  5K7H A;  4DZP A;  5HOD A;  1QP4 A;  4JX6 A;  2XCJ A;  2Y9Y A;  3BR0 A;  2ECC A;  2CRO A;  3IVP A;  1RET A;  4UUS B;  4GQM A;  1QQA A;  2H1K A;  1ZR4 A;  1JTX A;  1WCM J;  4X6A J;  4M3F A;  5IOZ A;  4A3C J;  2RAE A;  3JRI A;  1E3O C;  5E3N A;  2WIU B;  2TCT A;  3C2B A;  3S2D J;  2P81 A;  3H3V K;  1JUS A;  2LR8 A;  2DTZ A;  2IEK A;  2OPT A;  3ZQC A;  1WH8 A;  4FBI A;  3GTO J;  3LSG A;  4MFD A;  4J19 A;  9ANT A;  1Y7Y A;  4Y42 A;  5K7Z A;  1GVD A;  3QQA A;  3M4O J;  2MGQ A;  2OR1 L;  3ZQF A;  1HLV A;  3Q0V A;  3OSF A;  1PUF B;  1MSE C;  3HGG A;  1ETX A;  1ZZ9 A;  1MH4 A;  5FLM J;  1HF0 A;  3BG5 A;  3IV5 A;  2FD5 A;  1ENH A;  2CUF A;  3HOX J;  2NVX J;  4BBS J;  4A69 C;  5JLX A;  1VFC A;  1OCP A;  2AHQ A;  2AO9 A;  1LFU P;  2ME6 A;  4IHW A;  2Y0S N;  2KEJ A;  1JUP A;  2NVY J;  1LE8 B;  2A6C A;  2AUW A;  1ETW A;  1Y1V J;  1ZKG A;  2WB1 N;  3LSP A;  3BR2 A;  3S16 J;  1U78 A;  4Z5D A;  2X48 A;  1BW6 A;  2Y9Z A;  1ETY A;  3MLF A;  4X4B A;  2PUG A;  3MN2 A;  4XRM A;  3SJM A;  2X9D A;  3B7H A;  2CRG A;  1PRA A;  2QF7 A;  2MQK A;  2AWI A;  3TP3 A;  1IV6 A;  4YBA A;  1JKR C;  1OFC X;  3BTL A;  1K61 A;  3GTP J;  3TP0 A;  1H89 C;  3GN5 A;  2MEZ A;  1B72 A;  2CQX A;  3OQM A;  2M9H A;  2ELK A;  2LK2 A;  1WI3 A;  1JJ6 C;  3GTG J;  2IUO A;  1JT6 A;  2LTP A;  2LYK A;  4MFE A;  3VPR A;  2EF8 A;  4PU3 C;  4BY7 J;  3JR9 A;  3F51 A;  3F6W A;  2PUF A;  1ZZ6 A;  5C4J J;  1XWR A;  2EQR A;  2DMN A;  1AHD P;  2FQ4 A;  4FCY A;  1LLI A;  5F0H A;  2KEI A;  2HOS A;  3BG3 A;  5EGO A;  2HIN A;  2LKX A;  3FYM A;  5EG0 B;  4M6V A;  3Q0U A;  1R9T J;  1ZZ8 A;  3RQI A;  2GRM A;  4I8T A;  1R69 A;  5EEA A;  1X2L A;  3ZHM A;  4MCX A;  2LY9 A;  1BL0 A;  1TWG J;  4D5C A;  4PU7 A;  3ZQL A;  2JCG A;  1AKH A;  4C3I J;  1JGG A;  3NAR A;  3JRD A;  1P7I A;  5IPA A;  1SFO J;  2XIU A;  1WPK A;  3S1M J;  1QVU A;  3OOU A;  1BA5 A;  5IYB J;  3L1P A;  3OIO A;  2BNO A;  5EZG A;  3TW7 A;  2JA8 J;  5IYC J;  4IHX A;  2EZI A;  2Y30 A;  5EDN A;  2GZU A;  1I3Q J;  4I6U A;  2O7O A;  2ICT A;  2JA5 J;  4JX4 A;  2R5Z A;  4C2M J;  2IAI A;  4W1U A;  1VF9 A;  4DYR A;  5EF6 A;  2DA7 A;  3WHB A;  4B4C A;  1TWF J;  3K7A J;  1WH5 A;  3BR5 A;  1OCT C;  4XK4 A;  3S2H J;  1ZVV A;  2XRL A;  3W6V A;  2R93 J;  5F04 A;  1MBE A;  2VUM J;  3UKG A;  3U3W A;  2O9L A;  4I6R A;  4O8B A;  4XIC A;  2R63 A;  2HDD A;  2Y31 A;  5FKO A;  3S1R J;  3G7D A;  1HOM A;  3Q0W A;  3PXP A;  5M5X J;  1H8A C;  2M0C A;  5EYR A;  5EZH A;  4YG1 A;  4CYC A;  5M3F J;  2LD5 A;  3GBG A;  1RKW A;  3S1N J;  4A3B J;  1SAN A;  2PIJ A;  3SFI A;  3GTL J;  2NVQ J;  1PRU A;  1FEX A;  3B6A A;  3SCG A;  1YRN A;  2L7F P;  2EWT A;  4FIS A;  2R5Y B;  2R7Z J;  4BXX J;  1IRZ A;  5GP9 A;  1ZK8 A;  1HDP A;  3OSG A;  4JX5 A;  4DW6 A;  4F8D A;  1FTZ A;  4QSH A;  3JXC L;  1ITY A;  2L49 A;  2VPR A;  5JLW A;  1JKP C;  2GRL A;  2DMU A;  1XC5 A;  1POU A;  2XGD A;  1F36 A;  4A3I J;  2O49 A;  4M3E A;  1RZR A;  1UG2 A;  3CCY A;  2OF7 A;  1UXD A;  5M5Y J;  3I4M J;  1XS9 A;  3DNV B;  2MSY A;  2E2H J;  2BNM A;  2B63 J;  1ETQ A;  4YG4 A;  2H8R A;  1JKQ C;  2JN6 A;  3ZOB A;  1B8I B;  4OB4 A;  1RPE L;  4C3H J;  1NEQ A;  3CDL A;  2XPW A;  3HDD A;  4IHY A;  1TWC J;  2HOT A;  3QWG A;  1ZZ7 A;  1WGX A;  2JMW A;  3H0G J;  1UMQ A;  5IP6 A;  2YUS A;  2IBD A;  3FK7 A;  1G2H A;  1LQC A;  2DN0 A;  3PO3 J;  3LSR A;  2AW6 A;  3GBF A;  3SCF A;  1GT0 C;  2LFB A;  4IEJ A;  3KZ3 A;  1A5J A;  2DA6 A;  3GTK J;  1WIZ A;  4NDW A;  4XRS G;  4PU8 A;  4YG7 B;  4L5E A;  2LYP A;  3QYX A;  3ZQI A;  4UUT A;  5FKL A;  3JRG A;  1L1M A;  2Y2Z A;  1JT0 A;  5C44 J;  1WET A;  1Q1V A;  3QPL A;  2IU7 A;  2WV1 A;  3HOU J;  2COB A;  1UHS A;  1VND A;  2LP0 A;  4IHV A;  2OFY A;  1QP0 A;  1U9O A;  2AXZ A;  2WUS R;  1MH3 A;  2BNN A;  2KZ8 A;  4M3B A;  2LCV A;  2XPU A;  2LYQ A;  2EZL A;  1H88 C;  4JYK A;  1SQ8 A;  1Y9Q A;  5DTD A;  3CLC A;  2ID3 A;  2NOG A;  3KJX A;  4W97 A;  2XI8 A;  3FMY A;  4DZJ A;  2DA1 A;  1X57 A;  3FYA A;  1R63 A;  1ZS4 A;  4B1R A;  3CRO L;  2O38 A;  4I6T A;  1ETV A;  3A01 A;  1VI0 A;  2M34 A;  1MNM C;  3S14 J;  3HOV J;  5C4X J;  2IVQ A;  1GUU A;  1BJZ A;  2N8G A;  2E2I J;  2IVB A;  3LIS A;  5E3L A;  4FE7 A;  4MIM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...