1GT0C

Crystal structure of a pou/hmg/dna ternary complex
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
155
structure length
137
Chain Sequence
PSDLEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMSKLKPLLEKWLNDAENLGLSRRRKKRTSIETNIRVALEKSFLENQKPTSEEITMIADQLNMEKEVIRVWFSNRRQKEKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a POU/Hmg/DNA Ternary Complex Suggests Differential Assembly of Oct4 and Sox2 on Two Enhancers
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords 5'-D(*TP*TP*CP*TP*TP*TP*GP*TP*TP*TP* GP*GP*AP* TP*GP*CP*TP*A
total genus 46
structure length 137
sequence length 155
ec nomenclature
pdb deposition date 2002-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00046 Homeodomain Homeodomain
C PF00157 Pou Pou domain - N-terminal to homeobox domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1gt0C02
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 1gt0C01
2XCJA 1JTYA 4IHYA 2FQ4A 5JLXA 4PU7A 3S1NJ 3TEDA 3LSGA 2WV1A 4PU3C 1VI0A 3B6AA 2TRTA 1R69A 4MO7A 2ZB9A 2FJRA 2B63J 2R63A 2ID3A 1CQTA 1I6HJ 3HKZN 2GZUA 3RZOJ 2ECCA 4JX5A 4XRSG 4C3HJ 3GTQJ 1K61A 3BR2A 4MLOA 4JX6A 1BW5A 2GRLA 1BW6A 4C3JJ 1ADRA 4M3GA 5GPCA 4X4IA 1R9TJ 4GFBA 2EBYA 3BD1A 1ZVVA 1HF0A 5DS9A 3JRCA 2JA7J 1WGXA 4A3EJ 5JLWA 3JRDA 5M5YJ 1JT6A 5EZHA 1A5JA 1LCCA 2NVYJ 5FLVA 1R63A 4C3IJ 3GN5A 1LE8A 1X58A 1ETVA 3O8HA 2H1KA 4IWRA 5A7LA 1U8BA 1ETYA 1JUPA 2L7MP 4RBOA 1OCPA 2KEIA 4V2FA 4A3IJ 3M3YJ 2XGCA 2LCVA 5IP6A 1U9OA 1MBFA 1T33A 3QQAA 1PRAA 2IV1A 4X4GA 3HB9A 3S1QJ 5E3OA 5FJ8J 5K98B 2VKVA 1ZPQA 2CU7A 2DA1A 2H8RA 2WIUB 2FJ1A 2JK3A 4XRSA 5EZGA 4MFDA 3ZHIA 4Z5CA 2PUBA 1TC3C 3JXDL 3QF3A 4UUSA 2HOTA 1BJZA 4HNVA 2XGEA 2K9NA 1IV6A 4MFEA 2AXUA 4OB4A 2HYJA 1DWKA 3JRGA 1IG7A 1EFAA 2BNNA 3LSJA 5GP9A 4I6RA 2IVQA 4JYKA 2R1JL 4Y42A 1UHSA 2DJNA 3ZQGA 2IUOA 3F52A 2CSFA 1Q1VA 3TRBA 2E2JJ 1PRVA 5EG0B 3HOWJ 3GTJJ 3ZQLA 3G5GA 4YG7B 5EDNA 1QVTA 4X4DA 2PUCA 5FKNA 2EH3A 1NK3P 1EF4A 1IUFA 2PIJA 2L8NA 1RKWA 1LMB3 2WB1N 4B3AA 4BBRJ 2EF8A 5C4JJ 1B72B 3OIOA 4AC0A 4X4HA 1TWFJ 2O7OA 4X4EA 2QCOA 4JCXA 3F51A 3SFIA 2Y0SN 5EGOA 2B5AA 1ETWA 3G1LA 3PM1A 4LOCA 3S16J 1IDZA 2MEZA 1GV5A 3RZDJ 1HDDC 3IH4A 1XWRA 1WH7A 2LKXA 3CECA 1CJGA 1DU6A 4X4CA 4A93J 3VPRA 4BKXA 3IVPA 3WHBA 1WETA 4J1XA 1PNRA 2HXIA 1WPKA 3HOUJ 4PU8A 5EEAA 4D7NA 2ME6A 2NVQJ 1NERA 1JUMA 3JRIA 1B72A 1RESA 3SJMA 1ZZ6A 2KEKA 2O4AA 2XB5A 4X4BA 2EZKA 2Y2ZA 3HEFA 4AYBN 5IPAA 2KZ8A 4D5FA 3G1OA 2JA5J 1RETA 2MW8A 1GVDA 4B1RA 3HBLA 5FKOA 4I6UA 1LLIA 4DW6A 1MBKA 3MKLA 5EYRA 3GTOJ 3JRAA 2COBA 1BDIA 4A69C 2LYSA 3NAUA 3ZOBA 2XB0X 1RZRD 2JCGA 1ORKA 5IP7J 5IYBJ 3B6CA 3LISA 4DYCA 2HOAA 2DMNA 1MBGA 2LLKA 5K7HA 4A3FJ 3S1RJ 2LYRA 1B0NA 2LP0A 2MG4A 2EBIA 2OR1L 4A3BJ 3OQMA 3OQNA 4D5CA 2HQ5A 4XIDA 1D5YA 1FJLA 4Z58A 2BNOA 3OP9A 3BS3A 1RPWA 2YUSA 4DYRA 3S2DJ 3HM5A 4J19A 2D5VA 4YARA 3BG3A 4XRMA 1YRNB 1ETXA 3RKQA 4BY1J 4A3MJ 2HINA 1JGGA 3K7AJ 1LFUP 2FX0A 2N8GA 4YBAA 1ENHA 2XPVA 2HI3A 4YG4A 1RR7A 1OSLA 1Y9QA 2R5YA 1RZSA 2CROA 3FISA 5BNGA 2R93J 1YSEA 5IP9J 2M2EA 3BT9A 2KT0A 3KXAA 2XJ3A 1Z77A 1I50J 2NVTJ 1JKRC 1ZR2A 3GTPJ 2VKEA 3FYMA 3G7DA 2PUFA 3JRBA 1ZTRA 2CUFA 5FKLA 2E2HJ 1YRNA 5J1YA 3LNQA 3S2HJ 1E3OC 3TP0A 4UUSB 5K7FA 1RPEL 2ICPA 4DYQA 5IYCJ 5GPAA 4JCYA 2L7FP 2EZHA 3QYXA 2AHQA 4C2MJ 2XRLA 3DEWA 2LK2A 5E3NA 1UTXA 5C4XJ 3TW7A 2LD5A 2Y9YA 2XGDA 3E7LA 3GBGA 3I4NJ 1IDYA 2XPUA 4BY7J 1LE8B 4Y52J 2IVGA 5F27A 1NK2P 1UXDA 1O4XA 1JH9A 4AUXA 3BG5A 1XS9A 2EZLA 4CYCA 5F0FA 2LYPA 2JMWA 2XI8A 3QPLA 4EEFG 1JJ6C 1VF9A 1ZZ8A 1AHDP 1MSFC 1F43A 4M3FA 1TWGJ 3LSRA 1MBEA 4Z59A 1TWHJ 3D1NI 4XICA 5K7ZA 1B8IB 4B4CA 4M3DA 2LR8A 4V2GA 1ZR4A 1OCTC 2GLOA 1FTZA 3GBFA 1JFTA 2PUGA 3CQZJ 1IC8A 2W48A 1TWCJ 2EWTA 2PMZN 5J1RA 4FN3A 2OF7A 1P7JA 1JJ8C 3IH2A 3W6VA 2VUMJ 4M3EA 3Q0WA 3FYAA 1OFCX 1PUFB 5E3MA 1FIAA 4XK4A 1Y1VJ 4DZJA 1H8AC 1AKHA 3HOZJ 3BTCA 3H0GJ 5FKKA 3DNVB 2DMPA 4YG1A 5F1JA 4FE7A 1OJLA 2NS7A 2DA4A 2XPWA 3OMTA 4D7MA 3H3VK 3A03A 3B7HA 3JREA 1FTTA 2R5ZB 1MBJA 2JN6A 1Y1WJ 5IOYA 3HGGA 1B8IA 1ZS4A 3FK7A 4S0HB 3IH3A 1GUUA 2VI6A 5C3EJ 4M6VA 3JR9A 2QF7A 1W0UA 2LFBA 4X4FA 3LOCA 3LFPA 2K40A 2YS9A 3I4MJ 1S7EA 1WH8A 1UG2A 1X2LA 1PUFA 3HOYJ 1NEQA 1U9NA 3PO2J 3Q0UA 4FE4A 5C44J 3SCFA 4I8TA 1ZZBA 2DTZA 3BTLA 3M4OJ 2KDZA 4G12A 2JJ7A 2DMUA 2HSGA 1NTCA 2BJCA 2A6CA 1P7IA 2X48A 3JXBC 3BR3A 3DCFA 4IEJA 2JVLA 1DW9A 2L49A 2DMTA 4J1WA 2RAEA 4I6TA 3QPSA 2K9QA 1ZZ7A 1A6IA 2R0QC 2G0EA 4QIWN 3CLCA 3C2BA 5M3MJ 1QP7A 4BBSJ 3ZHMA 1X2NA 1PERL 2LY9A 1ZZ9A 2L7ZA 2FD5A 3S8QA 2Y9ZA 2LYKA 1JKPC 2X6OA 2Y31A 1HLVA 3JRFA 1W0TA 4A3GJ 3FK6A 1SANA 3BTJA 3NARA 4RDUA 1RIOA 2K9SA 3GTLJ 3EUSA 3OQOA 1ZGWA 2CRGA 5EGOB 5F04A 2XSDC 2O38A 1I3QJ 3GTMJ 3FMYA 1IRZA 4X1EA 2VPRA 1GDTA 5DTDA 1ZK8A 1U78A 3SDGA 1X57A 1JUSA 5HODA 4FBIA 4W97A 3CDLA 1VFCA 2KEJA 3S1MJ 1POGA 1GV2A 2M8GX 1SFOJ 3SCHA 4A3JJ 1RZRA 5M5XJ 2DA3A 2ELKA 2JA8J 5F08A 1XC5A 1QRYA 3PO3J 3UKGA 5J3LA 4ABZA 2M0CA 2R5ZA 4IHXA 3UFDA 1DU0A 4FTHA 2AXVA 3HGYA 2YU9J 2DA7A 2EZIA 1QPZA 1LFBA 2JWTA 3S15J 3FKIJ 2Y30A 1AU7A 2PUAA 4MCXA 4I6ZA 2LYLA 2BNMA 2OFYA 3ZQFA 4DZPA 3BTIA 3O9XA 4JQDA 1WH5A 1GT0C 4FCYA 5J1UA 2AUWA 4Z5HA 4MCTA 4NDLA 2ICTA 3VK0A 2DMQA 3O8GA 1MH3A 2HOSA 2DA2A 3SCGA 2PE5A 2NS8A 2CJJA 3GN5B 2XIUA 3S17J 1POUA 1FIPA 2R92J 1JT0A 3JRHA 2IAIA 3TW6A 1ZKGA 4Y7NJ 3G1MA 1FEXA 2GBYA 4W1UA 3MLFA 2DA5A 2MSYA 3MN2A 2MQKA 2I10A 4CYCB 3RQIA 1BA5A 1RKTA 3BQYA 4A3KJ 4FISA 2ID6A 2CQQA 1ITYA 3OOUA 1ZZCA 2OPTA 3IV5A 1T56A 4A3DJ 5F0CA 3FIWA 1HDPA 4A3LJ 1JWLA 2R7ZJ 2LYJA 3BR6A 2X9DA 2AO9A 3HOXJ 3GTKJ 1QQBA 3BR1A 1ZQ3P 3GTGJ 1WCMJ 2E2IJ 3BR0A 4O8BA 3BQZA 1MH4A 1XG1A 5M3FJ 3U3WA 1F36A 3KZ3A 2PUEA 3OSFA 1WIZA 2ECBA 2GM4A 3HZIB 1AKHB 4NDWA 2M34A 2O8KA 5F0HA 1G2HA 4X6AJ 1HCRA 2E19A 4L5EA 1TWAJ 2LVSA 5EG0A 4IA8A 1MSEC 3K2AA 1WH6A 3CROL 2WUSR 1JKOC 4QTRA 3CCYA 1APLC 1UXCA 3MVPA 2CQXA 2WAQN 3L1PA 1QP4A 2DN0A 2L9RA 2IU7A 3A01A 1QQAA 2LYQA 4PU4C 4A3CJ 5EF6A 2O49A 3BG9A 3OSGA 4IVZA 3LSPA 2NOGA 3CMYA 2IVBA 5M5WJ 2CUEA 4M3BA 1HOMA 1Z0XA 2L0KA 1L1MA 3ZQCA 3QQ6A 1QP0A 2PUDA 3BR5A 3Q0VA 5IYDJ 5FLMJ 2HDDA 2JA6J 1QVUA 4I76A 3A02A 1ZAYA 1UMQA 4BXXJ 4GHJA 1ETKA 3HOVJ 3WHCA 1MBHA 1BDHA 4UUTA 3F0CA 4GQMA 1JKQC 2DA6A 2NVXJ 4IHVA 1BL0A 4MIMA 3R1FA 3ZKCA 2E1OA 2O9LA 3Q3SA 3ZQHA 1Y7YA 2AW6A 2EQRA 3A01B 2AWIA 2PPXA 4JP0A 2P81A 1MNMC 1ETQA 3JXCL 3KJXA 1VNDA 2LTPA 2AXZA 9ANTA 5FKMA 1JTXA 2R5YB 3S14J 2IEKA 1PRUA 4JX4A 3TP3A 1X2MA 1VPWA 2IBDA 1ETOA 3HDDA 2GRMA 1IJWC 3F6WA 1IGNA 1H89C 2ME0A 4QSHA 3ZQIA 2HXOA 2KPJA 5E3LA 1QPIA 3H5TA 3BDNA 2M9HA 5IOZA 1LQCA 1WI3A 1LCDA 4Z5DA 2TCTA 3QWGA 1ZUGA 4IHWA 2MGQA 1SQ8A 4F8DA 3PXPA 1H88C 3RZZA 1JFSA 1K83J
chains in the Genus database with same CATH superfamily
2FQ4A 2K02A 1MJ9A 4I0BA 3S1NJ 2V26A 3S93A 3B6AA 3P9CA 4MO7A 2DOEA 4E7IA 2HYGD 3LA3A 2E1NA 2WA0A 4ZYGA 3J7YJ 2B63J 2ZJPF 2R63A 2CFOA 1QO0D 1JI8A 1WJ5A 1BN5A 4UVBA 3RZOJ 2K86A 4IZZA 1XDUA 4C3HJ 1QPMA 1OCRH 4ESJA 3BR2A 4KIGA 1K61A 4A0XA 1OKRA 1ADRA 3F22A 4LK0F 4GFBA 2EBYA 3BD1A 2Z2SB 4CDGA 2M7AA 5DS9A 4KT6A 4L9JA 2ZJ2A 3JRDA 5M5YJ 3G3ZA 1JT6A 4IKFA 3K69A 3K4JA 1R63A 1I3AA 1T98A 2GIVA 2FA5A 3TO6A 4M6XA 3VYTB 4J01A 1P92A 1B9NA 3MCZA 4IX7A 2GA1A 4OOIA 2R7OA 1SFKA 4V2FA 1KGSA 3M3YJ 1A6QA 2XGCA 4LGWA 4F92B 2LF7A 2ZMEB 4XQFA 3QQAA 1FOXA 2IV1A 5K98B 2EFQA 3BCAA 1TP4A 1HW5A 2DA1A 3IKVA 2H8RA 3A0HC 4PJ0C 2OTJI 3ZHIA 4MFDA 3K70D 2HCSA 2ZFUA 1TC3C 3ZRGA 1R6RA 3VB2A 4Y17A 4CICA 2H8WA 2K9NA 3AG1H 5LFAA 4IPAA 5ILVA 3F9KA 1IV6A 5FRNA 3GZDA 4B09A 1IZ1A 2JRTA 1FBSA 3JRGA 2JRMA 2Y48A 3JW4A 3ZMZA 5LBQA 4IRIA 1OR7A 3GMEA 2XXPA 3QU3A 2ACJA 4I6RA 3KP2A 4XKWA 2VBXA 1ZRDA 3KYCB 1UHSA 2EV0A 3KEYA 4RM2A 3U2RA 2IUOA 3ZPXA 2ZO4A 2M7BA 4WK8F 2IVMA 5H2FC 2HS5A 1WJBA 2VXDA 1QVTA 1SD4A 5F6FA 5FKNA 2HQNA 2EH3A 1EF4A 4GYIA 2BYVE 1DQUA 2L7KA 3CUOA 1I1SA 1RKWA 1LMB3 2EF8A 1YQAA 4XLCA 4MQ9F 3LQXA 2P6TA 1KQ0A 3F51A 1P6RA 2XVCA 2Y0SN 2KRFA 2B5AA 3BWGA 1ETWA 2JVGA 3S16J 1FWZA 5HLHA 1BOAA 1GV5A 3RZDJ 3IH4A 3FMRA 4ZYAA 3N97A 2E36A 2BY0A 1O7FA 4MEXF 2LKXA 4HSTA 4DBQA 2ZJQF 1AA7A 4E6KG 2PJRB 3WHBA 4J1XA 3ABTA 1WPKA 1FYKA 2K3FA 2ME6A 4XLEA 3FXKA 3HUGA 2KEKA 3PFIA 2MD0A 4MNUA 1IN8A 3QYBA 4HX7A 3JSPA 3B73A 4AYBN 1ZARA 3S8PA 3JAMZ 1MNEA 3EUKL 3MZ8A 4BAYA 1YYVA 4ZZDA 2HVRA 2XAHA 1TNTA 2MW8A 3JTGA 2FUG2 2KPMA 4R8HA 4I6UA 2IJLA 3R60A 3FXLA 2ZNZA 1T95A 4IQ4A 4FX0A 2COBA 4BDZA 1OCOH 4KITB 5A2QZ 2PJRA 4OBMA 3RYRA 2M3AA 2LSOA 2QUFA 3M9AA 1E3HA 1ORKA 2KMUA 5HNFA 1TW2A 2L2OA 2HOAA 1XN7A 2D45A 4A3FJ 3QFIA 1UELB 2IA2A 3S1RJ 2DPUA 2CO5A 2LP0A 1QU3A 1R00A 2K4JA 2MG4A 4A3BJ 4QPOA 4MTEA 1EH6A 1FJLA 4WXDA 1D5YA 4LFUA 2LBFA 4PJLA 2BNOA 4Z58A 3MAJA 1IRXA 3HM5A 4J19A 4YARA 4XRMA 3RKQA 4Y3OA 4IOCF 2N8GA 4NQWA 3OYCA 4I2OA 2L9NA 4XLHA 3WODF 1D0ZA 3PJRA 2EA2A 2R5YA 3ABKH 2H6CA 4KN4X 3FM3A 3EETA 5IP9J 1AOYA 2JUGA 3BT9A 4Q5SF 2ZCWA 3G4SI 3KXAA 3R09A 1ZR2A 3GTPJ 2H94A 2K5CA 3OL4A 3KE2A 3KZYA 2CUFA 5DTRA 3O6BB 1KQ9A 1TBXA 5B3SH 3GZNB 1WFXA 4UUSB 2HQAA 3SQNA 3TOBA 3IRRA 4DYQA 3WTZA 1SMTA 2PQ8A 4XLFA 3P7NA 1ZG3A 2IPQX 2FOKA 3CDIA 2LK2A 2LY2A 4M72A 2HZDA 3TW7A 4OINF 1LQ1A 2Y9YA 2XGDA 3E7LA 2XPUA 4BY7J 2VC0A 3AAFA 1NK2P 2ZSIB 3E3VA 5F64A 1O4XA 2EZLA 4P9FA 1WZ2A 4BL0B 4UY8I 3DWLE 2RGVA 2CGPA 2PN6A 1F43A 1TWGJ 2XDVA 2V9PA 4KT5C 4CH7A 2FE3A 3GLXA 3FDYA 2ISZA 5FLXK 4M3DA 3V8KA 2GLOA 1XMKA 2W48A 5DUKA 2EWTA 5H6RA 3WTTC 4BGDA 4XBFA 2VONA 1IXRC 2VE8A 1R1TA 2IXSA 3G2BA 2UXNA 3E5UA 5E3MA 4R1HA 4HDUA 1Y1VJ 2NVUB 1W7PB 2W25A 5E20A 4RB0A 2WV0A 3BTCA 1RR8C 5FKKA 3C7JA 4CSWA 2DMPA 1Z3YA 3DU5A 1KU9A 2F48A 3NZLA 2L5QA 3OMTA 3VWSA 2AQEA 2XPWA 5DSXA 3GXOA 3B7HA 5FGMA 1P2FA 3JREA 3A9YA 1MBJA 2JN6A 3BJOA 4H4KC 3TOAA 2QSGX 1LDJA 2EA4A 1BIAA 1ZS4A 3IH3A 1GUUA 2V9KA 2R7UA 5E1ZB 2IS4A 1X3WB 2K40A 2YS9A 1S7EA 1WHUA 1YS7A 1WH8A 1G3YA 2B7EA 4EKIA 2PBIA 3ABLH 3CCRI 2MFZA 4BNCA 3HOYJ 1FX7A 1QB2A 4ZDLA 4FE4A 2ZC2A 4I8TA 4M9ZA 3SX0A 2EJRA 2BJCA 3NXHA 4OAZA 2X48A 3GZDC 2JVLA 4IEJA 5DCMA 3AL0B 3EQLF 5KNLA 1Z7LA 1I27A 1G3SA 3ZCOA 2M1BA 1V4RA 2CW0F 3CZ6A 5DTQA 5D5XB 5M3MJ 1E0EA 4RLQA 4EQQA 2FQ3A 2HVQA 2X6OA 3K70C 3CUQB 3TBIA 4RMNA 1W0TA 2DT5A 5FFZA 1YHQI 3NARA 3R6SA 1G8XA 2E60A 2K9SA 3CCUI 1U2ZA 3EUSA 3OQOA 5EGOB 3PSIA 3A9ZA 1K6YA 2XSDC 1I3QJ 3QYEA 3FMYA 2X6XA 3HSEA 4X1EA 1MMAA 2VPRA 3ONQA 1JUSA 5HODA 2RREA 2M8GX 2XC7A 1XMXA 2BBYA 3OS0A 4A3JJ 2DA3A 5F08A 2GA2A 1XC5A 1QRYA 2MH2A 3LQRA 4PSXA 1YTYA 5CPRB 3VWBA 3A0BC 3UFDA 4LK1F 4EM2A 4XN3A 3L2CA 1M1EB 3DLLF 3CCMI 2EZIA 1LFBA 4IXAA 1MMSA 2Z9OA 1AU7A 3ZMDA 2YX4A 4LIVA 1B4AA 4XNFA 5DYMA 5A2QK 2IW5A 1S7OA 3RQ4A 3ZQFA 4YRVA 2PI0A 3BG6A 2A69F 4O6JA 4FX4A 1WH5A 4FCYA 2G7HA 3U1DA 3WTUC 2R7DA 3H9JA 1CF7A 4FHTA 1QA6A 2ICTA 2A3SA 1MH3A 2HOSA 4GDFA 2GAUA 5HOOA 1FBUA 1A04A 3NDBB 1F9NA 2QEXI 2RC4A 3S17J 1POUA 1WI9A 3CLQA 1IUYA 5B1AH 3VODA 2IAIA 3TW6A 3KEQA 1YO5C 1ZKGA 2DFFA 3J81Z 2K27A 4Y7NJ 2GBYA 2ZKZA 4W1UA 3MLFA 5B66C 5JUWA 4EJOA 1EV7A 2J5OA 2ESNA 4L5JA 2LOOA 4LB5A 1BA5A 4F91B 1WJEA 4B43A 1MNDA 2OPTA 5F0CA 1R1UA 3O3KA 1FY7A 3BR6A 3CJRB 4G8XA 5TRDA 2HU9A 2OTLI 2V9VA 2NOJB 4HSRA 4PSWA 2BGCA 1GVJA 1MH4A 2WY7Q 5EEHA 3OYDA 5M3FJ 3OL3A 1S3JA 2F5DA 4PFPA 2PUEA 3OSFA 1K7AA 2CG4A 2MA3A 4G6TB 2MYSA 1AKHB 3VEPA 3Q9SA 2R7RA 4MQVA 1HQCA 1SVMA 3GO5A 2E19A 1WWXA 1TWAJ 3FXOA 2LVSA 1RUOA 2P7VB 1MSEC 4OWRB 3TL4X 3CROL 1ACIA 3HG9A 4QTRA 3CCYA 1WJFA 1UXCA 1QP4A 3OYAA 2L9SA 4CGZA 1QQAA 4PU4C 4A3CJ 2O49A 2VJ4A 3F21A 3OSGA 2XKPA 2NOGA 2IVBA 1B1BA 2CUEA 4M3BA 2KIFA 1FOWA 3LAPA 4HQMA 3WU2C 3BR5A 5IYDJ 5FLMJ 1ONVA 4WCGA 3BZCA 4L9TA 4U7DA 3RCOA 4BJTA 1GHCA 3HOVJ 2CWEA 2A61A 3F0CA 5H20A 3BDDA 5GTHC 3LAJA 1U8RA 1WVRA 4GQMA 1BI2A 3DKYA 3OYJA 3L2UA 5CKTA 1X3UA 3ZQHA 5GADJ 2WAFA 4K2EA 3TO9A 2EIKH 2EQRA 4E7LA 2LMDA 3ML6A 4XRFA 2YSRA 4HEA2 3I64A 3JXCL 1O3SA 2LF8A 2PXTA 3EYYA 2W82A 3MKYB 3BPVA 3S14J 4U0YA 3TP3A 1PRUA 2FSWA 2HZTA 3L2RA 3HDDA 1X1AA 4HPQA 1YG2A 3ME5A 3ZQIA 2HXOA 4ZJZA 3OYKA 2OV7A 3LQQA 2X1EA 3DPTA 1TL8A 3BDNA 1LDDA 4EGZA 3QYFA 1ZUGA 4BYYA 4BUPA 3MKWB 1D0YA 2GXAA 2PXFA 3RZZA 2XCJA 1JTYA 3WTVC 3G71I 5JLXA 1VQ7I 3JTHA 4PU7A 4M9SA 3LSGA 4M9XA 4WVLA 2WV1A 4PU3C 1HW2A 3D5SC 1ZLKA 5DM7F 3FHZA 1KU7A 1VQ8I 2GZUA 1LJ9A 2ECCA 1W5SA 3F3XA 1BC7C 3WG7H 4JX6A 1BW5A 2DW4A 3DKWA 3CF2A 4DBRA 1H9TA 2GRLA 2CSOA 2P7CB 3DTKA 2GIZA 3A9XA 4EATA 2EB7A 4X4IA 5BS6A 4U88A 3CTAA 3COAC 2PXKA 2JA7J 4A3EJ 3FXUA 4I98B 5KAIC 2TDXA 2IP2A 3VSLA 3GWZA 1LCCA 2B9SA 3U9GA 1X58A 1ETVA 3IWZA 2VKHA 4XLNF 1ETYA 1JUPA 1U6GA 5HLIA 1OCPA 5ICFA 3K6GA 3TKYA 3PIPF 2OBPA 4A3IJ 2QBYA 2JVHA 1P9QC 3PNYA 5IP6A 1U9OA 3H5NA 4KFCA 3AG4H 3JCUC 1PRAA 3HB9A 4XM3A 4BQQA 2YPRA 4XKCA 1S6LA 3FXMA 2CU7A 3CC2I 2FJ1A 4ER6A 5EZGA 4Z5CA 1J9IA 5D4SA 2WWYA 4E7KA 3RIRA 2W4SA 3CCJI 2HOTA 3KP6A 4HNVA 3U1KA 2DI3A 1G59A 5CJ9A 1P4XA 2HYJA 3DF8A 1DWKA 3FM5A 2HR3A 2BW3A 3GUUA 3LSJA 1V3FA 2M30A 3S3MA 4JOMA 5GAGi 1FMVA 4Y42A 2DJNA 3F52A 2CSFA 1Q1VA 4RGSA 1FC3A 3TRBA 2E2JJ 5EG0B 4XOTA 1R71A 3KX2A 3GTJJ 3ZQLA 3MD2A 1IRGA 3ISPA 2PUCA 1IUFA 3WG9A 2FXAA 3FXQA 4LG3A 1YITI 4B3AA 4BBRJ 5C4JJ 3R0AA 1RUNA 1X1CA 4NQWB 4ASNA 4Z6YA 1YFHA 2IRFG 2VPLA 2E7WA 2JT1A 4RGRA 1IDZA 2MEZA 3ZMUA 5HDGA 1HDDC 3T0YA 4C2UA 1WH7A 1JGSA 2FOWA 2HTSA 3WU1B 2PXPA 1DU6A 1N75A 2ZMEC 1VZ0A 2PLYA 1WETA 4D0PA 2HXIA 1Z91A 3RJPA 2HWVA 2F4OB 2FEZA 2FU4A 3E1SA 5ICCA 2NVQJ 5CVVA 2KQRA 4QLCU 3SJMA 2O6GE 4HW0A 2EWNA 2JSPA 4Y13A 1V5EA 4EZIA 2PEXA 2ZBKA 3ZXSA 2Y2ZA 2LDUA 2EFPA 2KIUA 4HX4A 3HEFA 1BBYA 5K1YA 5B5EC 5IPAA 1FBQA 2KZ8A 4D5FA 3NROA 1RETA 4LLLA 1OYYA 2P5LC 4BHCA 2PXEA 5FKOA 3KP7A 4DW6A 3P5JA 1MBKA 4A0YA 3MKLA 5EYRA 4MTDA 3MEXA 2WADA 4IJAA 3H1CA 1BDIA 2Z3YA 1YI2I 1MFQC 1T38A 4L0ZB 2VQHA 2GZWA 5IP7J 1QNTA 4MEYF 5IYBJ 2BHZA 5DDGA 4CYDA 1N25A 1E2XA 2V1XA 4II2A 4DYCA 3LISA 2HNHA 2DMNA 2LLKA 4HNUA 4CCLA 2H09A 1IN6A 3PQKA 5DCMB 4GRIA 3UR3C 3F72A 4AIKA 2OR1L 2VQCA 4WXCA 1RPWA 3VSKA 5BQTA 2D5VA 4DOZA 3BG3A 1YRNB 1RNLA 3RSNA 4HG2A 4EJUA 2L9VA 2IS1A 1ENHA 4Y4RA 1ZG5A 3PUBA 1T6SA 2CW7A 5CQEA 1Y9QA 3HPHA 1TNSA 1D0XA 2R93J 3CMMA 4A5MA 2M2EA 1SFUA 2K7LA 3J80Z 3KPHA 3ASNH 1FSEA 4O3MA 3E5QA 4CA0A 1ZELA 2X51A 3N4MA 1ZTRA 5FKLA 4ENMA 3FMSA 3LA7A 1X4OA 1YRNA 1V54H 4E70A 5J1YA 1L3LA 2O61A 3LNQA 2V4JC 2P5KA 3TP0A 3EUAA 5K7FA 1RPEL 3F8BA 1O3TA 4RB2C 1OYWA 5IYCJ 3ABMH 5GPAA 3RPUA 1HC8A 2HDCA 2EZHA 3ZR8X 2E5NA 4II3A 2XRLA 3DEWA 4G9YA 4A0ZA 3CCQI 5E3NA 1W1WE 4IHSA 5C4XJ 2CS3A 3HKZA 1TZLA 3MKZA 4PJNA 1R58A 1G6NA 2V1UA 2F4MB 3GBGA 3H5AA 2QGUA 1Y8RB 3L00A 2V1NA 2XF5A 5CYVA 4IQJA 3BG5A 3M8EA 1DGRM 1XS9A 3CF5F 5GAHJ 1PUEE 2LYPA 1T8IA 3IUOA 2LY1A 4EEFG 2L4AA 5TISC 1Z67A 1VF9A 1JJ6C 4JBAA 1AHDP 5LHIA 3QOPA 2ISYA 3W3CA 3F6OA 2MC4A 4Z59A 1Z21A 2DQLA 3CC4I 1B8IB 1JFSA 3I59B 2LRDA 4BJ6C 1TWCJ 2E34A 2R7QA 2OF7A 1P7JA 2VUMJ 2XF7A 1OQYA 1X1DA 2CQKA 4EJVA 1DGWY 3Q0WA 2BOLA 3ZQQA 1D8KA 4HDVA 1Z7UA 3HTSB 5KAFC 3IHUA 2XROA 2UWMA 1AKHA 4AU7A 2DT7B 3HOZJ 5JR3A 2BW3B 3H0GJ 3E0JB 3FHNA 4EJTA 3R61A 2H6BA 3J7AO 2P8TA 1W7PD 2VOPA 1VQ4I 4F93B 2D2WA 1BI1A 4M74A 3UWPA 5IOYA 1BI0A 1B8IA 1QBJA 3FK7A 4S0HB 4M73A 2VI6A 3BP8A 3ESWB 3J81K 1W0UA 2QF7A 4X4FA 2LG4A 3MFKA 3I4MJ 1TTYA 2OJED 1DPRA 4ENNA 3EDPA 2PJPA 1ZGAA 4N0BA 1NEQA 5JVTA 2VXZA 4RAYA 3Q0UA 5C44J 3SCFA 3OYBA 2K85A 3GFMA 1ODDA 2DMUA 1XSDA 1NW3A 2HSGA 1NTCA 3TMOA 4YELA 1A36A 3FZVA 2R7SA 3HYIA 4J1WA 2FFHA 3RDIA 4BXFA 2M45A 1Z6RA 2R0QC 4QIWN 1F4KA 2LKSA 4YEJA 2VJ5A 2L54A 1PERL 2L7ZA 4RS8A 2BVMA 5DTMA 2OZ6A 1HLVA 1F1ZA 3OY9A 1J7KA 2Y75A 4M71A 5GAGJ 1Y56A 1ZGWA 3H36A 5GTIC 3FMQA 3CO6C 2W85A 3BROA 1GDTA 3I0TA 3GZ6A 2VJJA 4AIDA 4FBIA 3LFKA 5LGNA 2W84A 3ZMVA 2CW8A 2J7UA 2OU2A 3SCHA 2WY8Q 2VBZA 1RZRA 5M5XJ 4IF4A 1LNWA 3UKGA 3L7WA 2M0CA 1UHMA 2GXGA 4IHXA 1DU0A 1O3RA 4H0EA 2AXVA 3OYNA 1C0WA 4XLAA 1QPZA 1ZN2A 3FKIJ 2Y30A 1P4AA 3RPUD 1EA3A 5FFXA 1QZEA 2LYLA 1HSTA 3LSTA 3F6VA 4GGGA 2BNMA 4B44A 4N4OB 4DZPA 2JTVA 3BTIA 3M7GA 4Z2YA 2CV0A 2ODRD 3NWTA 3FBNB 4JQDA 2DFEA 1GT0C 4CO8A 1V55H 5IT3A 4IRGA 3O8GA 1XTAA 5DV5A 4OIPF 3T8TA 3QOEA 1MIJA 4I99C 1PP8F 4BEHB 2D1HA 3ZN0A 5DEQA 2R92J 1JT0A 2YBDA 3M9LA 3KFWX 4NBQA 3LSIA 4ZZLA 4OU0A 5J6XA 3G1MA 4PCQA 2OQGA 2MSYA 1QHHD 2EFNA 2LLWA 2XXQA 1TQMA 4AIJA 4UUVA 3RQIA 3BCBA 3SFZA 4YFXF 2CQQA 1ITYA 1FLIA 3OOUA 4KIBA 5D8KB 3IV5A 1JWLA 1PDNC 4UVCA 1QQBA 4FETA 2ELJA 3BR1A 5E8IA 4UNOA 3BR0A 1K4SA 3BQZA 5ICGA 4ON0A 2XAFA 1VQLI 1IRFA 1G3TA 4F55A 3HZIB 1W7PA 4NDWA 4HV5A 3OV8A 2O5RA 3H9QA 2O8KA 4XORA 5F0HA 2YX7A 1G2HA 4BHBA 2DYRH 1MJBA 3K1MA 4L5EA 4A6DA 4FQGA 4RAFA 5EG0A 3M8JA 5D6EA 1WH6A 3REOA 4B8XA 1JKOC 4DE9A 4HQEA 5ICEA 1Z9CA 1KZHA 1ON1A 1DPUA 1BIBA 2CQXA 2DODA 2ELHA 1K78A 2F5CA 4XL9A 3IWFA 4Q47A 3CO7C 3DBHB 3HPGA 1DP3A 1Z3XA 1VTNC 1ZLJA 1FYLA 3K9TA 3FBIB 1NHAA 1D3YA 3CMYA 5M5WJ 1HOMA 1Z0XA 2QKMB 1YLFA 4NC8A 4XR6A 2GOMA 4RAZA 1UG0A 2LREA 3Q0VA 2QQAA 1ZHFA 4I76A 1ZAYA 4E7JA 1UMQA 4XOPA 1ZH5A 4BXXJ 2DT6A 1BDHA 3J7ZI 2IS6A 3OYEA 1JHFA 4NUBA 2DA6A 5J40A 2EINH 2QZ8A 4IHVA 5HDKA 3QU6A 4PK4A 3ZKCA 2O9LA 2ZJRF 1FSHA 1U3EM 1U2WA 2AW6A 2AWIA 2MC3A 2PPXA 2XRNA 2V79A 4JP0A 2P81A 2CYYA 1ETQA 3F8NA 5K5QA 3GZ5A 5HS7A 4HRAA 9ANTA 5FKMA 3WTSC 1JTXA 3C2HA 2P5VA 5HLGA 2R5YB 2IEKA 1IAWA 1KA8A 2IBDA 5HVQC 1REPC 2GRMA 1XB4A 3F6WA 5E8GA 2ME0A 5ERIA 3R0JA 2EFWA 3K1PA 2EV5A 4RM3A 3H5TA 1J75A 3E5XA 1WI3A 3FWEA 4BE0A 2TCTA 1YIOA 3MZYA 3QWGA 4Z5DA 1LCDA 3E97A 2MGQA 3TELA 4F8DA 1BR1A 2BXZA 3PXPA 3I56I 4XONA 1FPQA 5GAHi 1EKEA 2F6CA 4ZDOA 3OYIA 2R7WA 3K4BA 3DBRB 4F3QA 3K4LA 2AXLA 1SD7A 2TRTA 3I3LA 3HZJA 2IA0A 4NB5A 3HRTA 3IRQA 2ID3A 1CQTA 3G0TA 4JX5A 2BHYA 3M1CA 4XRSG 4LLGF 1ZRFA 2K9LA 4M3GA 3NWSA 1R9TJ 3CCVI 1ZVVA 1HF0A 3F23A 2EPFA 4HLXA 3OYLA 3LFUA 1A5JA 2PMZA 3TDUC 5FLVA 1LPQA 3HIFA 4C3IJ 3GN5A 1LE8A 2R7FA 1HQ1A 4IWRA 5A7LA 2RNGA 3C3WA 2VL8A 2UZKA 2KEIA 5CVIA 1YX5A 1MBFA 2PFBA 1T33A 3K2ZA 4R79A 1KYWA 2W1OA 4EKGA 5E3OA 5L3EA 2A5YB 2EV6A 1W5CC 2JK3A 4XRSA 2WIUB 1WQ2A 2VBYA 3V8LA 2ZXWH 3PFYA 4LITA 3QF3A 3JAMK 1BJZA 4G6QA 3V4GA 4Q4ZF 4OB4A 2EIJH 2Q0OA 3EYIA 1S5LC 2LNMA 2OC6A 2VT2A 2DFHA 5JHUA 3DU6A 1EFAA 1R22A 5L3GA 2PXUA 1BOBA 4F7ZA 2M87A 5GP9A 1FNNA 2IVQA 2R1JL 1DDNA 2UXXA 1JE8A 3PL8A 3L2VA 3CCLI 2JZYA 4JK1X 4YG7B 1R5ID 4BH9A 4X4DA 4LLNA 4E7HA 2PIJA 2PXLA 4HAMA 4GCVA 3C1DA 2DPDA 3SEZA 2WB1N 5AIPA 1W5TA 2QLZA 1B72B 4OIOF 3WGIA 1VQKI 3A4CA 2DK5A 4AC0A 4JCXA 1TWFJ 4X4EA 2MBFA 3SFIA 4EMSA 4P1WA 5ILSA 1JHHA 4LOCA 3PM1A 2PXDA 2HCNA 3MWMA 1YS6A 3ZP5A 1RZ4A 1HW1A 1IN4A 2RKHA 5J8FA 1Y6IA 2DDAA 1CJGA 1O57A 3GW2A 3S2WA 2M0MA 1VQ9I 4AD9A 3QOXA 3TDZC 4BKXA 3EPZA 2XAJA 2CQNA 2QSFX 2Y0SA 1PNRA 5EEAA 2NRAC 1KQ8A 4D7NA 1J2XA 1NERA 1JUMA 4CCMA 3JRIA 2R7XA 6PAXA 1ZYRF 1B72A 1RESA 2HFZA 1P4WA 2BXYA 2E1MB 2XB5A 5ED4A 4LMYA 3M1EA 1IW7F 2EIMH 1PJRA 3ROUA 3I5UA 2VN2A 4BU2A 4CCNA 3G1OA 2E1MC 1GVDA 1DULA 3HBLA 3IAM2 4HF2A 2B0LA 5DUIA 3OIPA 3TO7A 2E7XA 1S8NA 2LH9A 1SEUA 4A69C 2LYSA 2JA2A 3ELKA 3ZOBA 3IL2A 2X85A 2XB0X 2A6EF 1RZRD 2JCGA 3W6KB 4C9YA 3K10A 3H3ZA 4KNYA 3MQ0A 2DLLA 4EQZA 3HHHA 1D1CA 4YIRX 1S7AA 2WAEA 1MBGA 4PFOA 5K7HA 3H3UA 2LYRA 1KYZA 1B0NA 2QKLB 4LJZF 4GXOA 3OQMA 4PUSA 2KLOA 4D5CA 2HOEA 1XDSA 3I4PA 4LIUA 3OP9A 2V7FA 4OAYA 3MZHA 2YUSA 4DYRA 3S2DJ 2A05A 1TQIA 2DK8A 3K7AJ 2FX0A 4X0GA 4YBAA 1SFEA 4EVIA 1RR7A 3BJAA 3HSFA 1YIJI 1X3ZB 4L0YB 1MMDA 2QENA 1OSLA 3I71A 1RZSA 2IGMA 3FISA 5BNGA 3K4KA 4YFNF 2CH0A 2PXBA 3LMMA 2PMHA 3KYLA 5TJJA 2NNYA 1TLHB 3OS1A 3KETA 4HF1A 1Z77A 1I50J 3K4MA 4BDYA 2VKEA 3WTXC 3FYMA 2MH9A 5FB2A 2JPCA 3SZTA 2R7VA 5D5WB 4ENKA 3GEZA 2KJBA 3D5RC 1RRJA 1USTA 2KRCA 1UAAA 4JCYA 3DKXA 3QOWA 1O7LA 3EUHC 3GF2A 3CESA 3SYTA 1R49A 2PXVA 1RC9A 3QPTA 1TW3A 3I4NJ 2IVGA 4I02A 1LE8B 1YE9A 2RN7A 1SAXA 3OR1C 4S05A 4AIHA 4ESFA 1JH9A 2JSCA 2LC2A 3QPHA 3SZGA 2QVOA 4U0WA 5F0FA 4CYCA 2VKDA 2JMWA 2XHKA 3KEOA 3LL7A 2XI8A 4ANJA 2KL4A 3OYMA 1MSFC 1MMNA 4M3FA 4F52A 1MBEA 2BVLA 1TWHJ 5KHDA 3GYHX 3E6DA 4B4CA 4V2GA 2LR8A 1FZPB 2PUGA 2VT3A 2DO7A 2D1VA 2DCEA 5LGUA 1T0FC 2OAZA 5AIQA 3TEPA 2PMZN 2VEOA 1V5FA 1JJ8C 2Y69H 1E17A 3CUQC 1ERDA 4P96A 2BY3A 1U5TB 1FIAA 3PUFA 4DZJA 3PQJA 1TT5B 2OD5A 1LEBA 1X19A 2VQLA 2FRHA 1UJ8A 2FMYA 5F1JA 2NS7A 2DA4A 1WSUA 1KONA 4D7MA 4ZYDA 3A03A 4XKVA 1FTTA 2R5ZB 4XN0A 2F5VA 4KICA 3HGGA 5ILUA 2XASA 1HKQA 3CJTB 5C3EJ 1PP7U 2JQ7A 4TV7A 3UNGC 3LOCA 3LFPA 3GFJA 4PDKA 2CFXA 1X2LA 5CVJA 1U5TA 1Y0NA 1LKXA 1XCVA 3CLOA 3VDXA 3H0DA 3V7RA 1U9NA 1R1VA 3PO2J 2UV1A 3KLOA 4KYWA 4G7OF 5E1WA 1I1GA 1Y8QB 5IT9Z 2DTZA 3M4OJ 5DRTA 5CQGA 2JJ7A 5LGTA 4B47A 3KYDB 2K9MA 2KDOA 1WJAA 2HGCA 4HOBA 5EEGA 3JXBC 4BE1A 2XAQA 1DW9A 2KFDA 5E18F 2DMTA 2L49A 2K9QA 1ZZ7A 1R4NB 1A6IA 2M4GA 5LLQA 2G0EA 3A1YA 3W2AA 3C2BA 1QP7A 3CLCA 3ZHMA 3WU0A 1X2NA 2LY9A 1ZZ9A 3RI4A 1VQPI 2Y9ZA 2LYKA 4XKBA 2X0LA 2Y31A 2FBKA 3CD6I 3T8RA 5LHHA 3ZQ7A 3BTJA 5HS8A 2MXDA 3PIOF 4UV8A 1VQ5I 3AL0C 3BZ6A 2H1LA 1RIOA 4G7HF 2BY2A 3GTLJ 1LEAA 2CRGA 5LRSA 2O38A 1I6XA 1J59A 2HKXA 1HKTA 2Z5UA 5DTDA 1ZK8A 4PJJA 5CVUA 1U78A 3SDGA 1X57A 2XKOA 2FNPA 3CDLA 4W97A 2P0WA 4N9IA 2KEJA 2XGXA 3S1MJ 3RPQA 1POGA 3LSKA 2XAUA 3LSHA 2JA8J 4ZYEA 4AVPA 5L3BA 3PO3J 5J3LA 4C30A 3RTRA 2QQ9A 2KIQA 3BC8A 3HGYA 4ZYHA 2HFHA 3IAS2 3CP2A 2YU9J 2DA7A 1N78A 2JWTA 5DD4A 3E6CC 2PUAA 3G73A 4KISA 1K78B 2P4WA 4I6ZA 4L9NA 5BMZA 3FXJA 3KP4A 2ETHA 3O9XA 5CVRA 5D4RA 1R5GA 3MMYB 2L01A 4Z5HA 2GWRA 4C2TA 2DMQA 2Q2EB 4NC7A 5CLSA 2QYOA 3U21A 4RAGA 2PE5A 1OCCH 3OS2A 2CJJA 3GN5B 2XIUA 2Q1ZB 3JRHA 4E7ZA 4CCJA 3FXRA 4ITVA 2MQKA 1BJAA 2I10A 4EK9A 4B48A 1RKTA 4A3KJ 2LNBA 2WTEA 2ID6A 2VIXA 4FISA 3TQNA 4A3DJ 5L3DA 1KU3A 4HNTA 3HJEA 2LLVA 1OYIA 3QP6A 1FOKA 1OMIA 2W7NA 3BZKA 4HYEA 3HOXJ 4RGXA 1FOYA 2FF4A 4O8BA 2JUCA 2FBIA 1XG1A 3V8JA 2DDBA 3H5RA 2QWWA 2ZFWA 4RLFA 2M34A 1A31A 3D0SA 3OYFA 3GX4X 2O03A 3R4KA 5FO5A 4X6AJ 3OYGA 1R5HA 1XMAA 2L3DA 4IA8A 3Q9VA 3FX3A 2F5EA 3AFHA 3DXJF 3K2AA 2Z16A 3HC7A 4DNCA 3MVPA 5L3FA 3L1PA 1X1BA 3BG7A 2RQQA 1SMYF 3A01A 2LYQA 1YJWI 2MD5A 1ZRCA 1LB2A 1K6OA 1FP2A 3BG9A 4IVZA 3LSPA 4IRHA 4MGRA 4CCOA 2QQBA 1XX5A 1MZBA 4AM3A 1L1MA 3ZQCA 1QP0A 2PUDA 1XGSA 2HDDA 3HL2A 2JA6J 1QVUA 2PG4A 1EJ9A 1J0RA 3IC7A 1XGNA 4I7HA 5FD6A 4CHUA 3ZMTA 3WHCA 1MBHA 4UUTA 1OCZH 1JKQC 1UHWA 1S72I 1BL0A 4MIMA 1A35A 1K4TA 3Q3SA 1PYVA 2QM3A 2RQPA 1Y7YA 3A01B 3KL4A 1WKMA 1MW7A 3WGHA 1MNMC 2DXIA 3QODA 4CXFA 4G7ZF 1S9HA 2DTRA 3N05A 5TGTA 2IT0A 4MHGA 3KJXA 2LTPA 3VYRB 5HNHA 2VOOA 2OCCH 1QGPA 2KZGA 4AVZA 3OR2C 4UV9A 4JX4A 1SVLA 1X2MA 4FASD 3WTYC 1IGNA 1H89C 4QSHA 4UVAA 3DP7A 3CC7I 1XGMA 3KZZA 2KPJA 3W6JB 2IA1A 4NC6A 5E3LA 1QPIA 2V3CC 3T5XA 5IOZA 1LQCA 4ZC3A 1DP7P 3SDBA 1NH3A 1LFPA 3I58A 5KVRA 2STTA 4IHWA 3VOEA 3C2GA 4KDPA 4KIFA 3V7SA 1MJAA 1H88C 3AG2H 1IV8A 2X6WA 2RV8A 4IHYA 2L4MA 3K4NA 1XCBA 3TEDA 2GXBA 4BJ5C 2DQRA 1R23A 1VI0A 1ZG1A 1R69A 3HOTA 2ZB9A 2LYCA 5KK1A 4L18B 2FJRA 1L0OC 1XSVA 2KISA 1I6HJ 3HKZN 5E79C 1YW8A 1XGOA 4Y15A 3GTQJ 4RGUA 2E5ZA 4MLOA 2JPBA 5DD8A 1BW6A 1R36A 4C3JJ 3GFLA 5GPCA 2WC2A 2DOAA 2JQEA 2O0YA 1T08B 4KMFA 2DFIA 1XSXA 3JRCA 1WGXA 4Q2JA 3DPUA 2M8EA 3ZN1A 5JLWA 1HBXG 2W57A 4D9JA 5EZHA 5HDNA 1Z05A 2NVYJ 3ZGKA 4I01A 4PGGA 3O8HA 1QHGA 2H1KA 2VJIA 1SFXA 1U8BA 1AWCA 1SAUA 2L7MP 4RBOA 4KMUX 3A2KA 2OCEA 3HTUA 1LDKB 3W2VA 4I0AA 2G7UA 2LCVA 4HF0A 1WJCA 2I8DA 2A07F 2HVSA 4E4HA 3Q5FA 3C18A 4X4GA 4G6DA 2FNAA 4HZFA 3RYPA 3S1QJ 5FJ8J 2VKVA 1ZPQA 3HRMA 3CJQB 4M6YA 2KIMA 1IN5A 1O3QA 2PUBA 4JQFA 3JXDL 1QZXA 4GO1A 4UUSA 2XGEA 5KCMA 5B1BH 3DEUA 4MFEA 2AXUA 3SR4A 3HOSA 1SVOA 4RB3C 2IGNA 4BQNA 5HLTA 2RNJA 3KLNA 1IG7A 2BNNA 1UCRA 3GVAA 4YIIA 3ULQB 4JYKA 2X4HA 4CZZA 2KP6A 2XV4S 2I5UA 3ZQGA 4NHJA 1YW7A 5DM6F 2NXNB 4B3XA 2QA4I 1FP1D 3X2QH 1PRVA 3HOWJ 2PXQA 3G5GA 4HBLA 2AXTC 5EDNA 3FKJA 4Y33A 2HEOA 1NK3P 2XXAA 2CV2A 3NRVA 4EJWA 1GLNA 1N77A 2L8NA 1GXPA 3CUQA 3HXLA 2BE5F 2OA4A 2H27A 3OIOA 5AONA 4ZDPA 4ENJA 4X4HA 1NG7A 2O7OA 2QCOA 1RIOH 5EGOA 4A12A 2X1DA 3G1LA 4A6EA 4AYBA 2ZXIA 2XSJC 4DJAA 2OUMA 3PSFA 2E35A 1XWRA 4XSXF 3CECA 3KCCA 3OWQA 2WBMA 4X4CA 4A93J 3VPRA 3TGNA 1HXDA 4KN7X 1ZGJA 4I09A 3IVPA 1VQMI 4BS9A 1FMWA 1BR2A 3P9IA 2O3FA 1MDMB 3B02A 3HOUJ 4PU8A 4KUMA 3MEJA 1U5TC 3CJNA 4AWXB 1ZZ6A 2O4AA 4X4BA 3NQOA 4PJMA 2P6SA 2EZKA 3BLYA 4A2UA 1V5GA 2E1CA 5LRRA 2JA5J 2X1CA 3DLAA 4B1RA 4ER5A 1IXSB 1LVKA 1LLIA 5IY5H 1R7JA 2HDWA 3GTOJ 2Q2EA 3JRAA 3CCSI 3QP5A 3CMEI 2NNNA 3NAUA 3RKWA 1S29A 3SHFA 1I39A 4L5IA 1U0JA 3WE3A 2G9WA 3B6CA 1QZYA 4UXNA 3G6EI 3ABUA 2J5PA 2BV6A 2EBIA 3GZCA 3NEUA 1E3PA 3OQNA 4BHPA 5JVGF 2HQ5A 4XIDA 4IO9F 3BS3A 1H9GA 2VBWA 2R7TA 4OMZA 4ER0A 4HA8A 4BY1J 1ETXA 4A3MJ 2HINA 1JGGA 5BOXA 1LFUP 3JSOA 1ZAOA 2DOFA 2ZSHB 3WE2A 4BXUA 2XPVA 2HI3A 1W36D 4YG4A 1LUJB 4UB6C 2XAGA 4HV6A 3L9FA 2HPMA 2CROA 3I9V2 3DBLB 2YR2A 5D5VB 1YSEA 2HYFA 2A6HF 4BEHA 4N9HA 3CP8A 4G94A 2ZXHA 2KT0A 3W2WA 2K3PA 3QWLA 3WTWC 3H9GA 2XJ3A 2X6YA 1ON2A 4LD5A 5E17F 2NVTJ 3DPLC 3IKTA 1JKRC 3G7DA 2PUFA 3JRBA 4EM1A 1VQ6I 2DBBA 2PMUA 3K0LA 2IGOA 5K5OA 4CUGA 2E2HJ 3FF5A 5DT2A 2VQGA 3LWFA 1X4PA 3HUGB 3S2HJ 1E3OC 4P55A 1D5VA 4HX8A 4P9UA 2ICPA 1SD5A 2MLKA 4U87A 1B6AA 5DRYA 2F2EA 2L7FP 3K1NA 3QYXA 2AHQA 3HHGA 4C2MJ 4ESBA 2ICWG 2WAQA 1K79A 2DU9A 2VLAA 1UTXA 3ZPLA 2C6YA 4DE8A 2LD5A 4MCXA 5K5RA 1G3WA 1IDYA 3O2PE 4S04A 4DQ2A 4YG2F 4N4NB 5J4VA 2Z33A 5F27A 4Y52J 1CF7B 3ASOH 1HSJA 1UXDA 1USSA 1MMGA 4AUXA 2QQ8A 2Z99A 1XPXA 1EH8A 4V19K 1IN7A 4HLYA 2NS0A 3QPLA 1YX3A 2F5FA 3OKZA 5L3CA 4E7SA 5H6QA 1ZZ8A 2STWA 2CUZA 1TT0A 2NYXA 3HRUA 3LSRA 4EGYA 3S3OA 1WRJA 3ECHA 4LG0A 3D1NI 4BACA 4XICA 5K7ZA 1OCTC 4XMYA 1TQPA 1ZR4A 1FTZA 3RKXA 3GBFA 1JFTA 3CQZJ 1IC8A 3H35A 5J1RA 3V7CA 4FN3A 4XLPF 3T1BA 1YOVB 3W6VA 3IH2A 5FRMA 2VE9A 4CZCA 4M3EA 3FYAA 1OFCX 1PUFB 4Q48A 4XK4A 2KJCA 3J7AY 1IXCA 1BM9A 1H8AC 4HRIA 1MGTA 2V6EA 2EK5A 5FROA 3IP4B 3I54A 2ADUA 3SXYA 3DNVB 1OLTA 4YG1A 4WF2A 1B59A 4FE7A 1OJLA 5BPIA 1W36C 3H3VK 2CMPA 1GXQA 2O8XA 1SD6A 2YU3A 3DTIA 1Y1WJ 1HKSA 1R4MB 3TFLA 2KHMA 1I5ZA 2A68F 5JFRA 4M6VA 1UB9A 3JR9A 2LFBA 2PX9A 4PGHA 5D8LB 4ZTJA 2VASA 1UG2A 1OISA 2V6CA 3DFGA 4RB1A 3J80K 1PUFA 3L09A 3KIOA 1UFMA 1IF1A 4O5VA 4UHTA 2W24A 3F8MA 1RI7A 3BY6A 1ZZBA 4ER3A 3BTLA 2KDZA 2LKPA 4G12A 4A5NA 1EH7A 3M8FA 3SZPA 2A6CA 3I53A 1P7IA 4ER7A 3BR3A 3DCFA 3SEQA 2GOXB 2EFOA 2RAEA 4I6TA 3QPSA 1YJ9I 3WGGA 3PNVA 3KP3A 4BBSJ 2VODA 4D1QA 1D1BA 2FD5A 3S8QA 1OPCA 1JKPC 1W4MA 1BC8C 1Y0UA 5IT9K 3JRFA 4BQAA 4A3GJ 3FK6A 1DUXC 5EJCA 1SANA 3VYSB 4GYGA 4RDUA 5BPDA 5J4YA 2EILH 5D6FA 1OR7C 5F04A 4LB6B 5D5UB 3PNTA 3GTMJ 4OIQF 1Q1HA 2MLGA 1IRZA 4WXHA 5GAEJ 3HSRA 3F8CA 1SC7A 3GUDA 1VFCA 2BEOA 1NG6A 1GV2A 1SFOJ 2W00A 3QAHA 2ELKA 4P5OA 1ULYA 3L2QA 1YJNI 4U7BA 4ABZA 2R5ZA 3LSMA 4FTHA 2BY1A 2ZMEA 5FD5A 3M07A 2IGKA 4XSZF 4L9VA 2HPIA 3DEEA 3ZMSA 2UUZA 3S15J 4ZH4F 3GCMA 3DQVC 4NNJA 1J09A 2HKOA 4KA4A 2OFYA 3CDHA 1CGPA 4CCKA 3AKZA 2COMA 1H0MA 2HQRA 5JI6A 4ETSA 2QSHX 3K4CA 5J1UA 5JHFA 2AUWA 4MCTA 2F4IA 4NDLA 4DGWB 3VK0A 3PE5A 2DA2A 3LA2A 3SCGA 2XIGA 3ERMA 5LEKA 1XD7A 2Z1DA 2NS8A 3KZIC 4EM0B 2AQFA 3P9KA 2BZTA 1FIPA 2GQQA 2RVCA 3EUHA 1ZREA 3D5LA 5J8CA 3KP5A 2HTJA 1IO2A 2DAOA 1FEXA 2R3SA 1Y39A 2QBYB 3S32A 2DA5A 1MDMA 1J5YA 3MN2A 3CCEI 2WB1A 1X1PA 2MABA 4CYCB 2KZVA 3BQYA 3BPXA 3BOQA 4FT8A 1ZZCA 2XUBA 3BJ6A 1T56A 2KKOA 1FYMA 3FIWA 1HDPA 3HRSA 1D8JA 3OOPA 2E71A 5LHGA 5LEJA 4J00A 2R7ZJ 4A3LJ 2LYJA 4IVNA 2X9DA 2CV1A 1Z1DA 2AO9A 3GTKJ 2V1DA 4OIRF 1ZQ3P 1LVAA 3GTGJ 1WCMJ 3DV8A 2XF6A 2E2IJ 4UB8C 2ZXJA 4YIFA 5J47A 3U3WA 1YW9A 2M5WA 1F5TA 4IOAF 1F36A 1VQNI 3KZ3A 2ZNYA 1WIZA 1T0FA 2ECBA 2M4KA 2GM4A 1STZA 5FLXZ 4DIQA 3V42A 3E6BA 1VQOI 3RKYA 1PVEA 1HCRA 3AG3H 2IS2A 5F1RA 2OQRA 2M4HA 2NAZA 3ERED 2OZUA 1T39A 2WUSR 1JXSA 3VYUB 2A5WA 3OWTA 1APLC 2L1PA 1B9MA 4WX9A 4EV0A 1HA8A 4IHTA 3OMYA 4BE2A 4ZTFA 2WAQN 4LG0B 2DN0A 3CMAI 2Q8KA 1BI3A 2L9RA 2VB6A 2IU7A 2AS5F 3I59A 2K4BA 5EF6A 3OYHA 4IL6C 2R4GA 5HS9A 3OIQA 4U0VA 2L0KA 1QZZA 1QQIA 3QQ6A 1G4DA 1BR4A 3A02A 4KJZA 4OMYA 2DYSH 4GHJA 1ETKA 5LD2C 3QRFF 3DM5A 3E6MA 2FBHA 2J7WA 2NVXJ 1T2KA 1FT9A 3R1FA 2E1OA 1WJDA 3F8FA 3H92A 2CUJA 1MD0A 3L2WA 1MKMA 2L02A 2DJIA 1D1AA 1VNDA 2LBFB 2AXZA 4PZJA 2KRHA 2A6TA 3I55I 2Y0MA 4QWQA 1VPWA 2ESHA 1ETOA 3DTEA 4YFKF 1IJWC 2FMLA 5E1XA 2VC1A 4BQOA 2CQ7A 2M9HA 3VFZA 4WWCA 1Z6TA 4QPQA 3GFIA 5DCFA 2RDPA 4RA2A 1SQ8A 3GLLA 1KU2A 3ECOA 1UZCA 1K83J 3S3NA
chains in the Genus database with same CATH topology
2XCJA 1JTYA 4IHYA 2FQ4A 5JLXA 4PU7A 3S1NJ 3TEDA 3LSGA 2WV1A 4PU3C 1VI0A 3B6AA 2TRTA 1R69A 4MO7A 2ZB9A 2FJRA 2B63J 2R63A 2ID3A 1CQTA 1I6HJ 3HKZN 2GZUA 3RZOJ 2ECCA 4JX5A 4XRSG 4C3HJ 3GTQJ 1K61A 3BR2A 4MLOA 4JX6A 1BW5A 2GRLA 1BW6A 4C3JJ 1ADRA 4M3GA 5GPCA 4X4IA 1R9TJ 4GFBA 2EBYA 3BD1A 1ZVVA 1HF0A 5DS9A 3JRCA 2JA7J 1WGXA 4A3EJ 5JLWA 3JRDA 5M5YJ 1JT6A 5EZHA 1A5JA 1LCCA 2NVYJ 5FLVA 1R63A 4C3IJ 3GN5A 1LE8A 1X58A 1ETVA 3O8HA 2H1KA 4IWRA 5A7LA 1U8BA 1ETYA 1JUPA 2L7MP 4RBOA 1OCPA 2KEIA 4V2FA 4A3IJ 3M3YJ 2XGCA 2LCVA 5IP6A 1U9OA 1MBFA 1T33A 3QQAA 1PRAA 2IV1A 4X4GA 3HB9A 3S1QJ 5E3OA 5FJ8J 5K98B 2VKVA 1ZPQA 2CU7A 2DA1A 2H8RA 2WIUB 2FJ1A 2JK3A 4XRSA 5EZGA 4MFDA 3ZHIA 4Z5CA 2PUBA 1TC3C 3JXDL 3QF3A 4UUSA 2HOTA 1BJZA 4HNVA 2XGEA 2K9NA 1IV6A 4MFEA 2AXUA 4OB4A 2HYJA 1DWKA 3JRGA 1IG7A 1EFAA 2BNNA 3LSJA 5GP9A 4I6RA 2IVQA 4JYKA 2R1JL 4Y42A 1UHSA 2DJNA 3ZQGA 2IUOA 3F52A 2CSFA 1Q1VA 3TRBA 2E2JJ 1PRVA 5EG0B 3HOWJ 3GTJJ 3ZQLA 3G5GA 4YG7B 5EDNA 1QVTA 4X4DA 2PUCA 5FKNA 2EH3A 1NK3P 1EF4A 1IUFA 2PIJA 2L8NA 1RKWA 1LMB3 2WB1N 4B3AA 4BBRJ 2EF8A 5C4JJ 1B72B 3OIOA 4AC0A 4X4HA 1TWFJ 2O7OA 4X4EA 2QCOA 4JCXA 3F51A 3SFIA 2Y0SN 5EGOA 2B5AA 1ETWA 3G1LA 3PM1A 4LOCA 3S16J 1IDZA 2MEZA 1GV5A 3RZDJ 1HDDC 3IH4A 1XWRA 1WH7A 2LKXA 3CECA 1CJGA 1DU6A 4X4CA 4A93J 3VPRA 4BKXA 3IVPA 3WHBA 1WETA 4J1XA 1PNRA 2HXIA 1WPKA 3HOUJ 4PU8A 5EEAA 4D7NA 2ME6A 2NVQJ 1NERA 1JUMA 3JRIA 1B72A 1RESA 3SJMA 1ZZ6A 2KEKA 2O4AA 2XB5A 4X4BA 2EZKA 2Y2ZA 3HEFA 4AYBN 5IPAA 2KZ8A 4D5FA 3G1OA 2JA5J 1RETA 2MW8A 1GVDA 4B1RA 3HBLA 5FKOA 4I6UA 1LLIA 4DW6A 1MBKA 3MKLA 5EYRA 3GTOJ 3JRAA 2COBA 1BDIA 4A69C 2LYSA 3NAUA 3ZOBA 2XB0X 1RZRD 2JCGA 1ORKA 5IP7J 5IYBJ 3B6CA 3LISA 4DYCA 2HOAA 2DMNA 1MBGA 2LLKA 5K7HA 4A3FJ 3S1RJ 2LYRA 1B0NA 2LP0A 2MG4A 2EBIA 2OR1L 4A3BJ 3OQMA 3OQNA 4D5CA 2HQ5A 4XIDA 1D5YA 1FJLA 4Z58A 2BNOA 3OP9A 3BS3A 1RPWA 2YUSA 4DYRA 3S2DJ 3HM5A 4J19A 2D5VA 4YARA 3BG3A 4XRMA 1YRNB 1ETXA 3RKQA 4BY1J 4A3MJ 2HINA 1JGGA 3K7AJ 1LFUP 2FX0A 2N8GA 4YBAA 1ENHA 2XPVA 2HI3A 4YG4A 1RR7A 1OSLA 1Y9QA 2R5YA 1RZSA 2CROA 3FISA 5BNGA 2R93J 1YSEA 5IP9J 2M2EA 3BT9A 2KT0A 3KXAA 2XJ3A 1Z77A 1I50J 2NVTJ 1JKRC 1ZR2A 3GTPJ 2VKEA 3FYMA 3G7DA 2PUFA 3JRBA 1ZTRA 2CUFA 5FKLA 2E2HJ 1YRNA 5J1YA 3LNQA 3S2HJ 1E3OC 3TP0A 4UUSB 5K7FA 1RPEL 2ICPA 4DYQA 5IYCJ 5GPAA 4JCYA 2L7FP 2EZHA 3QYXA 2AHQA 4C2MJ 2XRLA 3DEWA 2LK2A 5E3NA 1UTXA 5C4XJ 3TW7A 2LD5A 2Y9YA 2XGDA 3E7LA 3GBGA 3I4NJ 1IDYA 2XPUA 4BY7J 1LE8B 4Y52J 2IVGA 5F27A 1NK2P 1UXDA 1O4XA 1JH9A 4AUXA 3BG5A 1XS9A 2EZLA 4CYCA 5F0FA 2LYPA 2JMWA 2XI8A 3QPLA 4EEFG 1JJ6C 1VF9A 1ZZ8A 1AHDP 1MSFC 1F43A 4M3FA 1TWGJ 3LSRA 1MBEA 4Z59A 1TWHJ 3D1NI 4XICA 5K7ZA 1B8IB 4B4CA 4M3DA 2LR8A 4V2GA 1ZR4A 1OCTC 2GLOA 1FTZA 3GBFA 1JFTA 2PUGA 3CQZJ 1IC8A 2W48A 1TWCJ 2EWTA 2PMZN 5J1RA 4FN3A 2OF7A 1P7JA 1JJ8C 3IH2A 3W6VA 2VUMJ 4M3EA 3Q0WA 3FYAA 1OFCX 1PUFB 5E3MA 1FIAA 4XK4A 1Y1VJ 4DZJA 1H8AC 1AKHA 3HOZJ 3BTCA 3H0GJ 5FKKA 3DNVB 2DMPA 4YG1A 5F1JA 4FE7A 1OJLA 2NS7A 2DA4A 2XPWA 3OMTA 4D7MA 3H3VK 3A03A 3B7HA 3JREA 1FTTA 2R5ZB 1MBJA 2JN6A 1Y1WJ 5IOYA 3HGGA 1B8IA 1ZS4A 3FK7A 4S0HB 3IH3A 1GUUA 2VI6A 5C3EJ 4M6VA 3JR9A 2QF7A 1W0UA 2LFBA 4X4FA 3LOCA 3LFPA 2K40A 2YS9A 3I4MJ 1S7EA 1WH8A 1UG2A 1X2LA 1PUFA 3HOYJ 1NEQA 1U9NA 3PO2J 3Q0UA 4FE4A 5C44J 3SCFA 4I8TA 1ZZBA 2DTZA 3BTLA 3M4OJ 2KDZA 4G12A 2JJ7A 2DMUA 2HSGA 1NTCA 2BJCA 2A6CA 1P7IA 2X48A 3JXBC 3BR3A 3DCFA 4IEJA 2JVLA 1DW9A 2L49A 2DMTA 4J1WA 2RAEA 4I6TA 3QPSA 2K9QA 1ZZ7A 1A6IA 2R0QC 2G0EA 4QIWN 3CLCA 3C2BA 5M3MJ 1QP7A 4BBSJ 3ZHMA 1X2NA 1PERL 2LY9A 1ZZ9A 2L7ZA 2FD5A 3S8QA 2Y9ZA 2LYKA 1JKPC 2X6OA 2Y31A 1HLVA 3JRFA 1W0TA 4A3GJ 3FK6A 1SANA 3BTJA 3NARA 4RDUA 1RIOA 2K9SA 3GTLJ 3EUSA 3OQOA 1ZGWA 2CRGA 5EGOB 5F04A 2XSDC 2O38A 1I3QJ 3GTMJ 3FMYA 1IRZA 4X1EA 2VPRA 1GDTA 5DTDA 1ZK8A 1U78A 3SDGA 1X57A 1JUSA 5HODA 4FBIA 4W97A 3CDLA 1VFCA 2KEJA 3S1MJ 1POGA 1GV2A 2M8GX 1SFOJ 3SCHA 4A3JJ 1RZRA 5M5XJ 2DA3A 2ELKA 2JA8J 5F08A 1XC5A 1QRYA 3PO3J 3UKGA 5J3LA 4ABZA 2M0CA 2R5ZA 4IHXA 3UFDA 1DU0A 4FTHA 2AXVA 3HGYA 2YU9J 2DA7A 2EZIA 1QPZA 1LFBA 2JWTA 3S15J 3FKIJ 2Y30A 1AU7A 2PUAA 4MCXA 4I6ZA 2LYLA 2BNMA 2OFYA 3ZQFA 4DZPA 3BTIA 3O9XA 4JQDA 1WH5A 1GT0C 4FCYA 5J1UA 2AUWA 4Z5HA 4MCTA 4NDLA 2ICTA 3VK0A 2DMQA 3O8GA 1MH3A 2HOSA 2DA2A 3SCGA 2PE5A 2NS8A 2CJJA 3GN5B 2XIUA 3S17J 1POUA 1FIPA 2R92J 1JT0A 3JRHA 2IAIA 3TW6A 1ZKGA 4Y7NJ 3G1MA 1FEXA 2GBYA 4W1UA 3MLFA 2DA5A 2MSYA 3MN2A 2MQKA 2I10A 4CYCB 3RQIA 1BA5A 1RKTA 3BQYA 4A3KJ 4FISA 2ID6A 2CQQA 1ITYA 3OOUA 1ZZCA 2OPTA 3IV5A 1T56A 4A3DJ 5F0CA 3FIWA 1HDPA 4A3LJ 1JWLA 2R7ZJ 2LYJA 3BR6A 2X9DA 2AO9A 3HOXJ 3GTKJ 1QQBA 3BR1A 1ZQ3P 3GTGJ 1WCMJ 2E2IJ 3BR0A 4O8BA 3BQZA 1MH4A 1XG1A 5M3FJ 3U3WA 1F36A 3KZ3A 2PUEA 3OSFA 1WIZA 2ECBA 2GM4A 3HZIB 1AKHB 4NDWA 2M34A 2O8KA 5F0HA 1G2HA 4X6AJ 1HCRA 2E19A 4L5EA 1TWAJ 2LVSA 5EG0A 4IA8A 1MSEC 3K2AA 1WH6A 3CROL 2WUSR 1JKOC 4QTRA 3CCYA 1APLC 1UXCA 3MVPA 2CQXA 2WAQN 3L1PA 1QP4A 2DN0A 2L9RA 2IU7A 3A01A 1QQAA 2LYQA 4PU4C 4A3CJ 5EF6A 2O49A 3BG9A 3OSGA 4IVZA 3LSPA 2NOGA 3CMYA 2IVBA 5M5WJ 2CUEA 4M3BA 1HOMA 1Z0XA 2L0KA 1L1MA 3ZQCA 3QQ6A 1QP0A 2PUDA 3BR5A 3Q0VA 5IYDJ 5FLMJ 2HDDA 2JA6J 1QVUA 4I76A 3A02A 1ZAYA 1UMQA 4BXXJ 4GHJA 1ETKA 3HOVJ 3WHCA 1MBHA 1BDHA 4UUTA 3F0CA 4GQMA 1JKQC 2DA6A 2NVXJ 4IHVA 1BL0A 4MIMA 3R1FA 3ZKCA 2E1OA 2O9LA 3Q3SA 3ZQHA 1Y7YA 2AW6A 2EQRA 3A01B 2AWIA 2PPXA 4JP0A 2P81A 1MNMC 1ETQA 3JXCL 3KJXA 1VNDA 2LTPA 2AXZA 9ANTA 5FKMA 1JTXA 2R5YB 3S14J 2IEKA 1PRUA 4JX4A 3TP3A 1X2MA 1VPWA 2IBDA 1ETOA 3HDDA 2GRMA 1IJWC 3F6WA 1IGNA 1H89C 2ME0A 4QSHA 3ZQIA 2HXOA 2KPJA 5E3LA 1QPIA 3H5TA 3BDNA 2M9HA 5IOZA 1LQCA 1WI3A 1LCDA 4Z5DA 2TCTA 3QWGA 1ZUGA 4IHWA 2MGQA 1SQ8A 4F8DA 3PXPA 1H88C 3RZZA 1JFSA 1K83J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XCJ A;  1JTY A;  4IHY A;  2FQ4 A;  5JLX A;  4PU7 A;  3S1N J;  3TED A;  3LSG A;  2WV1 A;  4PU3 C;  1VI0 A;  3B6A A;  2TRT A;  1R69 A;  4MO7 A;  2ZB9 A;  2FJR A;  2B63 J;  2R63 A;  2ID3 A;  1CQT A;  1I6H J;  3HKZ N;  2GZU A;  3RZO J;  2ECC A;  4JX5 A;  4XRS G;  4C3H J;  3GTQ J;  1K61 A;  3BR2 A;  4MLO A;  4JX6 A;  1BW5 A;  2GRL A;  1BW6 A;  4C3J J;  1ADR A;  4M3G A;  5GPC A;  4X4I A;  1R9T J;  4GFB A;  2EBY A;  3BD1 A;  1ZVV A;  1HF0 A;  5DS9 A;  3JRC A;  2JA7 J;  1WGX A;  4A3E J;  5JLW A;  3JRD A;  5M5Y J;  1JT6 A;  5EZH A;  1A5J A;  1LCC A;  2NVY J;  5FLV A;  1R63 A;  4C3I J;  3GN5 A;  1LE8 A;  1X58 A;  1ETV A;  3O8H A;  2H1K A;  4IWR A;  5A7L A;  1U8B A;  1ETY A;  1JUP A;  2L7M P;  4RBO A;  1OCP A;  2KEI A;  4V2F A;  4A3I J;  3M3Y J;  2XGC A;  2LCV A;  5IP6 A;  1U9O A;  1MBF A;  1T33 A;  3QQA A;  1PRA A;  2IV1 A;  4X4G A;  3HB9 A;  3S1Q J;  5E3O A;  5FJ8 J;  5K98 B;  2VKV A;  1ZPQ A;  2CU7 A;  2DA1 A;  2H8R A;  2WIU B;  2FJ1 A;  2JK3 A;  4XRS A;  5EZG A;  4MFD A;  3ZHI A;  4Z5C A;  2PUB A;  1TC3 C;  3JXD L;  3QF3 A;  4UUS A;  2HOT A;  1BJZ A;  4HNV A;  2XGE A;  2K9N A;  1IV6 A;  4MFE A;  2AXU A;  4OB4 A;  2HYJ A;  1DWK A;  3JRG A;  1IG7 A;  1EFA A;  2BNN A;  3LSJ A;  5GP9 A;  4I6R A;  2IVQ A;  4JYK A;  2R1J L;  4Y42 A;  1UHS A;  2DJN A;  3ZQG A;  2IUO A;  3F52 A;  2CSF A;  1Q1V A;  3TRB A;  2E2J J;  1PRV A;  5EG0 B;  3HOW J;  3GTJ J;  3ZQL A;  3G5G A;  4YG7 B;  5EDN A;  1QVT A;  4X4D A;  2PUC A;  5FKN A;  2EH3 A;  1NK3 P;  1EF4 A;  1IUF A;  2PIJ A;  2L8N A;  1RKW A;  1LMB 3;  2WB1 N;  4B3A A;  4BBR J;  2EF8 A;  5C4J J;  1B72 B;  3OIO A;  4AC0 A;  4X4H A;  1TWF J;  2O7O A;  4X4E A;  2QCO A;  4JCX A;  3F51 A;  3SFI A;  2Y0S N;  5EGO A;  2B5A A;  1ETW A;  3G1L A;  3PM1 A;  4LOC A;  3S16 J;  1IDZ A;  2MEZ A;  1GV5 A;  3RZD J;  1HDD C;  3IH4 A;  1XWR A;  1WH7 A;  2LKX A;  3CEC A;  1CJG A;  1DU6 A;  4X4C A;  4A93 J;  3VPR A;  4BKX A;  3IVP A;  3WHB A;  1WET A;  4J1X A;  1PNR A;  2HXI A;  1WPK A;  3HOU J;  4PU8 A;  5EEA A;  4D7N A;  2ME6 A;  2NVQ J;  1NER A;  1JUM A;  3JRI A;  1B72 A;  1RES A;  3SJM A;  1ZZ6 A;  2KEK A;  2O4A A;  2XB5 A;  4X4B A;  2EZK A;  2Y2Z A;  3HEF A;  4AYB N;  5IPA A;  2KZ8 A;  4D5F A;  3G1O A;  2JA5 J;  1RET A;  2MW8 A;  1GVD A;  4B1R A;  3HBL A;  5FKO A;  4I6U A;  1LLI A;  4DW6 A;  1MBK A;  3MKL A;  5EYR A;  3GTO J;  3JRA A;  2COB A;  1BDI A;  4A69 C;  2LYS A;  3NAU A;  3ZOB A;  2XB0 X;  1RZR D;  2JCG A;  1ORK A;  5IP7 J;  5IYB J;  3B6C A;  3LIS A;  4DYC A;  2HOA A;  2DMN A;  1MBG A;  2LLK A;  5K7H A;  4A3F J;  3S1R J;  2LYR A;  1B0N A;  2LP0 A;  2MG4 A;  2EBI A;  2OR1 L;  4A3B J;  3OQM A;  3OQN A;  4D5C A;  2HQ5 A;  4XID A;  1D5Y A;  1FJL A;  4Z58 A;  2BNO A;  3OP9 A;  3BS3 A;  1RPW A;  2YUS A;  4DYR A;  3S2D J;  3HM5 A;  4J19 A;  2D5V A;  4YAR A;  3BG3 A;  4XRM A;  1YRN B;  1ETX A;  3RKQ A;  4BY1 J;  4A3M J;  2HIN A;  1JGG A;  3K7A J;  1LFU P;  2FX0 A;  2N8G A;  4YBA A;  1ENH A;  2XPV A;  2HI3 A;  4YG4 A;  1RR7 A;  1OSL A;  1Y9Q A;  2R5Y A;  1RZS A;  2CRO A;  3FIS A;  5BNG A;  2R93 J;  1YSE A;  5IP9 J;  2M2E A;  3BT9 A;  2KT0 A;  3KXA A;  2XJ3 A;  1Z77 A;  1I50 J;  2NVT J;  1JKR C;  1ZR2 A;  3GTP J;  2VKE A;  3FYM A;  3G7D A;  2PUF A;  3JRB A;  1ZTR A;  2CUF A;  5FKL A;  2E2H J;  1YRN A;  5J1Y A;  3LNQ A;  3S2H J;  1E3O C;  3TP0 A;  4UUS B;  5K7F A;  1RPE L;  2ICP A;  4DYQ A;  5IYC J;  5GPA A;  4JCY A;  2L7F P;  2EZH A;  3QYX A;  2AHQ A;  4C2M J;  2XRL A;  3DEW A;  2LK2 A;  5E3N A;  1UTX A;  5C4X J;  3TW7 A;  2LD5 A;  2Y9Y A;  2XGD A;  3E7L A;  3GBG A;  3I4N J;  1IDY A;  2XPU A;  4BY7 J;  1LE8 B;  4Y52 J;  2IVG A;  5F27 A;  1NK2 P;  1UXD A;  1O4X A;  1JH9 A;  4AUX A;  3BG5 A;  1XS9 A;  2EZL A;  4CYC A;  5F0F A;  2LYP A;  2JMW A;  2XI8 A;  3QPL A;  4EEF G;  1JJ6 C;  1VF9 A;  1ZZ8 A;  1AHD P;  1MSF C;  1F43 A;  4M3F A;  1TWG J;  3LSR A;  1MBE A;  4Z59 A;  1TWH J;  3D1N I;  4XIC A;  5K7Z A;  1B8I B;  4B4C A;  4M3D A;  2LR8 A;  4V2G A;  1ZR4 A;  1OCT C;  2GLO A;  1FTZ A;  3GBF A;  1JFT A;  2PUG A;  3CQZ J;  1IC8 A;  2W48 A;  1TWC J;  2EWT A;  2PMZ N;  5J1R A;  4FN3 A;  2OF7 A;  1P7J A;  1JJ8 C;  3IH2 A;  3W6V A;  2VUM J;  4M3E A;  3Q0W A;  3FYA A;  1OFC X;  1PUF B;  5E3M A;  1FIA A;  4XK4 A;  1Y1V J;  4DZJ A;  1H8A C;  1AKH A;  3HOZ J;  3BTC A;  3H0G J;  5FKK A;  3DNV B;  2DMP A;  4YG1 A;  5F1J A;  4FE7 A;  1OJL A;  2NS7 A;  2DA4 A;  2XPW A;  3OMT A;  4D7M A;  3H3V K;  3A03 A;  3B7H A;  3JRE A;  1FTT A;  2R5Z B;  1MBJ A;  2JN6 A;  1Y1W J;  5IOY A;  3HGG A;  1B8I A;  1ZS4 A;  3FK7 A;  4S0H B;  3IH3 A;  1GUU A;  2VI6 A;  5C3E J;  4M6V A;  3JR9 A;  2QF7 A;  1W0U A;  2LFB A;  4X4F A;  3LOC A;  3LFP A;  2K40 A;  2YS9 A;  3I4M J;  1S7E A;  1WH8 A;  1UG2 A;  1X2L A;  1PUF A;  3HOY J;  1NEQ A;  1U9N A;  3PO2 J;  3Q0U A;  4FE4 A;  5C44 J;  3SCF A;  4I8T A;  1ZZB A;  2DTZ A;  3BTL A;  3M4O J;  2KDZ A;  4G12 A;  2JJ7 A;  2DMU A;  2HSG A;  1NTC A;  2BJC A;  2A6C A;  1P7I A;  2X48 A;  3JXB C;  3BR3 A;  3DCF A;  4IEJ A;  2JVL A;  1DW9 A;  2L49 A;  2DMT A;  4J1W A;  2RAE A;  4I6T A;  3QPS A;  2K9Q A;  1ZZ7 A;  1A6I A;  2R0Q C;  2G0E A;  4QIW N;  3CLC A;  3C2B A;  5M3M J;  1QP7 A;  4BBS J;  3ZHM A;  1X2N A;  1PER L;  2LY9 A;  1ZZ9 A;  2L7Z A;  2FD5 A;  3S8Q A;  2Y9Z A;  2LYK A;  1JKP C;  2X6O A;  2Y31 A;  1HLV A;  3JRF A;  1W0T A;  4A3G J;  3FK6 A;  1SAN A;  3BTJ A;  3NAR A;  4RDU A;  1RIO A;  2K9S A;  3GTL J;  3EUS A;  3OQO A;  1ZGW A;  2CRG A;  5EGO B;  5F04 A;  2XSD C;  2O38 A;  1I3Q J;  3GTM J;  3FMY A;  1IRZ A;  4X1E A;  2VPR A;  1GDT A;  5DTD A;  1ZK8 A;  1U78 A;  3SDG A;  1X57 A;  1JUS A;  5HOD A;  4FBI A;  4W97 A;  3CDL A;  1VFC A;  2KEJ A;  3S1M J;  1POG A;  1GV2 A;  2M8G X;  1SFO J;  3SCH A;  4A3J J;  1RZR A;  5M5X J;  2DA3 A;  2ELK A;  2JA8 J;  5F08 A;  1XC5 A;  1QRY A;  3PO3 J;  3UKG A;  5J3L A;  4ABZ A;  2M0C A;  2R5Z A;  4IHX A;  3UFD A;  1DU0 A;  4FTH A;  2AXV A;  3HGY A;  2YU9 J;  2DA7 A;  2EZI A;  1QPZ A;  1LFB A;  2JWT A;  3S15 J;  3FKI J;  2Y30 A;  1AU7 A;  2PUA A;  4MCX A;  4I6Z A;  2LYL A;  2BNM A;  2OFY A;  3ZQF A;  4DZP A;  3BTI A;  3O9X A;  4JQD A;  1WH5 A;  1GT0 C;  4FCY A;  5J1U A;  2AUW A;  4Z5H A;  4MCT A;  4NDL A;  2ICT A;  3VK0 A;  2DMQ A;  3O8G A;  1MH3 A;  2HOS A;  2DA2 A;  3SCG A;  2PE5 A;  2NS8 A;  2CJJ A;  3GN5 B;  2XIU A;  3S17 J;  1POU A;  1FIP A;  2R92 J;  1JT0 A;  3JRH A;  2IAI A;  3TW6 A;  1ZKG A;  4Y7N J;  3G1M A;  1FEX A;  2GBY A;  4W1U A;  3MLF A;  2DA5 A;  2MSY A;  3MN2 A;  2MQK A;  2I10 A;  4CYC B;  3RQI A;  1BA5 A;  1RKT A;  3BQY A;  4A3K J;  4FIS A;  2ID6 A;  2CQQ A;  1ITY A;  3OOU A;  1ZZC A;  2OPT A;  3IV5 A;  1T56 A;  4A3D J;  5F0C A;  3FIW A;  1HDP A;  4A3L J;  1JWL A;  2R7Z J;  2LYJ A;  3BR6 A;  2X9D A;  2AO9 A;  3HOX J;  3GTK J;  1QQB A;  3BR1 A;  1ZQ3 P;  3GTG J;  1WCM J;  2E2I J;  3BR0 A;  4O8B A;  3BQZ A;  1MH4 A;  1XG1 A;  5M3F J;  3U3W A;  1F36 A;  3KZ3 A;  2PUE A;  3OSF A;  1WIZ A;  2ECB A;  2GM4 A;  3HZI B;  1AKH B;  4NDW A;  2M34 A;  2O8K A;  5F0H A;  1G2H A;  4X6A J;  1HCR A;  2E19 A;  4L5E A;  1TWA J;  2LVS A;  5EG0 A;  4IA8 A;  1MSE C;  3K2A A;  1WH6 A;  3CRO L;  2WUS R;  1JKO C;  4QTR A;  3CCY A;  1APL C;  1UXC A;  3MVP A;  2CQX A;  2WAQ N;  3L1P A;  1QP4 A;  2DN0 A;  2L9R A;  2IU7 A;  3A01 A;  1QQA A;  2LYQ A;  4PU4 C;  4A3C J;  5EF6 A;  2O49 A;  3BG9 A;  3OSG A;  4IVZ A;  3LSP A;  2NOG A;  3CMY A;  2IVB A;  5M5W J;  2CUE A;  4M3B A;  1HOM A;  1Z0X A;  2L0K A;  1L1M A;  3ZQC A;  3QQ6 A;  1QP0 A;  2PUD A;  3BR5 A;  3Q0V A;  5IYD J;  5FLM J;  2HDD A;  2JA6 J;  1QVU A;  4I76 A;  3A02 A;  1ZAY A;  1UMQ A;  4BXX J;  4GHJ A;  1ETK A;  3HOV J;  3WHC A;  1MBH A;  1BDH A;  4UUT A;  3F0C A;  4GQM A;  1JKQ C;  2DA6 A;  2NVX J;  4IHV A;  1BL0 A;  4MIM A;  3R1F A;  3ZKC A;  2E1O A;  2O9L A;  3Q3S A;  3ZQH A;  1Y7Y A;  2AW6 A;  2EQR A;  3A01 B;  2AWI A;  2PPX A;  4JP0 A;  2P81 A;  1MNM C;  1ETQ A;  3JXC L;  3KJX A;  1VND A;  2LTP A;  2AXZ A;  9ANT A;  5FKM A;  1JTX A;  2R5Y B;  3S14 J;  2IEK A;  1PRU A;  4JX4 A;  3TP3 A;  1X2M A;  1VPW A;  2IBD A;  1ETO A;  3HDD A;  2GRM A;  1IJW C;  3F6W A;  1IGN A;  1H89 C;  2ME0 A;  4QSH A;  3ZQI A;  2HXO A;  2KPJ A;  5E3L A;  1QPI A;  3H5T A;  3BDN A;  2M9H A;  5IOZ A;  1LQC A;  1WI3 A;  1LCD A;  4Z5D A;  2TCT A;  3QWG A;  1ZUG A;  4IHW A;  2MGQ A;  1SQ8 A;  4F8D A;  3PXP A;  1H88 C;  3RZZ A;  1JFS A;  1K83 J; 
#chains in the Genus database with same CATH topology
 2FQ4 A;  2K02 A;  1MJ9 A;  4I0B A;  3S1N J;  2V26 A;  3S93 A;  3B6A A;  3P9C A;  4MO7 A;  2DOE A;  4E7I A;  2HYG D;  3LA3 A;  2E1N A;  2WA0 A;  4ZYG A;  3J7Y J;  2B63 J;  2ZJP F;  2R63 A;  2CFO A;  1QO0 D;  1JI8 A;  1WJ5 A;  1BN5 A;  4UVB A;  3RZO J;  2K86 A;  4IZZ A;  1XDU A;  4C3H J;  1QPM A;  1OCR H;  4ESJ A;  3BR2 A;  4KIG A;  1K61 A;  4A0X A;  1OKR A;  1ADR A;  3F22 A;  4LK0 F;  4GFB A;  2EBY A;  3BD1 A;  2Z2S B;  4CDG A;  2M7A A;  5DS9 A;  4KT6 A;  4L9J A;  2ZJ2 A;  3JRD A;  5M5Y J;  3G3Z A;  1JT6 A;  4IKF A;  3K69 A;  3K4J A;  1R63 A;  1I3A A;  1T98 A;  2GIV A;  2FA5 A;  3TO6 A;  4M6X A;  3VYT B;  4J01 A;  1P92 A;  1B9N A;  3MCZ A;  4IX7 A;  2GA1 A;  4OOI A;  2R7O A;  1SFK A;  4V2F A;  1KGS A;  3M3Y J;  1A6Q A;  2XGC A;  4LGW A;  4F92 B;  2LF7 A;  2ZME B;  4XQF A;  3QQA A;  1FOX A;  2IV1 A;  5K98 B;  2EFQ A;  3BCA A;  1TP4 A;  1HW5 A;  2DA1 A;  3IKV A;  2H8R A;  3A0H C;  4PJ0 C;  2OTJ I;  3ZHI A;  4MFD A;  3K70 D;  2HCS A;  2ZFU A;  1TC3 C;  3ZRG A;  1R6R A;  3VB2 A;  4Y17 A;  4CIC A;  2H8W A;  2K9N A;  3AG1 H;  5LFA A;  4IPA A;  5ILV A;  3F9K A;  1IV6 A;  5FRN A;  3GZD A;  4B09 A;  1IZ1 A;  2JRT A;  1FBS A;  3JRG A;  2JRM A;  2Y48 A;  3JW4 A;  3ZMZ A;  5LBQ A;  4IRI A;  1OR7 A;  3GME A;  2XXP A;  3QU3 A;  2ACJ A;  4I6R A;  3KP2 A;  4XKW A;  2VBX A;  1ZRD A;  3KYC B;  1UHS A;  2EV0 A;  3KEY A;  4RM2 A;  3U2R A;  2IUO A;  3ZPX A;  2ZO4 A;  2M7B A;  4WK8 F;  2IVM A;  5H2F C;  2HS5 A;  1WJB A;  2VXD A;  1QVT A;  1SD4 A;  5F6F A;  5FKN A;  2HQN A;  2EH3 A;  1EF4 A;  4GYI A;  2BYV E;  1DQU A;  2L7K A;  3CUO A;  1I1S A;  1RKW A;  1LMB 3;  2EF8 A;  1YQA A;  4XLC A;  4MQ9 F;  3LQX A;  2P6T A;  1KQ0 A;  3F51 A;  1P6R A;  2XVC A;  2Y0S N;  2KRF A;  2B5A A;  3BWG A;  1ETW A;  2JVG A;  3S16 J;  1FWZ A;  5HLH A;  1BOA A;  1GV5 A;  3RZD J;  3IH4 A;  3FMR A;  4ZYA A;  3N97 A;  2E36 A;  2BY0 A;  1O7F A;  4MEX F;  2LKX A;  4HST A;  4DBQ A;  2ZJQ F;  1AA7 A;  4E6K G;  2PJR B;  3WHB A;  4J1X A;  3ABT A;  1WPK A;  1FYK A;  2K3F A;  2ME6 A;  4XLE A;  3FXK A;  3HUG A;  2KEK A;  3PFI A;  2MD0 A;  4MNU A;  1IN8 A;  3QYB A;  4HX7 A;  3JSP A;  3B73 A;  4AYB N;  1ZAR A;  3S8P A;  3JAM Z;  1MNE A;  3EUK L;  3MZ8 A;  4BAY A;  1YYV A;  4ZZD A;  2HVR A;  2XAH A;  1TNT A;  2MW8 A;  3JTG A;  2FUG 2;  2KPM A;  4R8H A;  4I6U A;  2IJL A;  3R60 A;  3FXL A;  2ZNZ A;  1T95 A;  4IQ4 A;  4FX0 A;  2COB A;  4BDZ A;  1OCO H;  4KIT B;  5A2Q Z;  2PJR A;  4OBM A;  3RYR A;  2M3A A;  2LSO A;  2QUF A;  3M9A A;  1E3H A;  1ORK A;  2KMU A;  5HNF A;  1TW2 A;  2L2O A;  2HOA A;  1XN7 A;  2D45 A;  4A3F J;  3QFI A;  1UEL B;  2IA2 A;  3S1R J;  2DPU A;  2CO5 A;  2LP0 A;  1QU3 A;  1R00 A;  2K4J A;  2MG4 A;  4A3B J;  4QPO A;  4MTE A;  1EH6 A;  1FJL A;  4WXD A;  1D5Y A;  4LFU A;  2LBF A;  4PJL A;  2BNO A;  4Z58 A;  3MAJ A;  1IRX A;  3HM5 A;  4J19 A;  4YAR A;  4XRM A;  3RKQ A;  4Y3O A;  4IOC F;  2N8G A;  4NQW A;  3OYC A;  4I2O A;  2L9N A;  4XLH A;  3WOD F;  1D0Z A;  3PJR A;  2EA2 A;  2R5Y A;  3ABK H;  2H6C A;  4KN4 X;  3FM3 A;  3EET A;  5IP9 J;  1AOY A;  2JUG A;  3BT9 A;  4Q5S F;  2ZCW A;  3G4S I;  3KXA A;  3R09 A;  1ZR2 A;  3GTP J;  2H94 A;  2K5C A;  3OL4 A;  3KE2 A;  3KZY A;  2CUF A;  5DTR A;  3O6B B;  1KQ9 A;  1TBX A;  5B3S H;  3GZN B;  1WFX A;  4UUS B;  2HQA A;  3SQN A;  3TOB A;  3IRR A;  4DYQ A;  3WTZ A;  1SMT A;  2PQ8 A;  4XLF A;  3P7N A;  1ZG3 A;  2IPQ X;  2FOK A;  3CDI A;  2LK2 A;  2LY2 A;  4M72 A;  2HZD A;  3TW7 A;  4OIN F;  1LQ1 A;  2Y9Y A;  2XGD A;  3E7L A;  2XPU A;  4BY7 J;  2VC0 A;  3AAF A;  1NK2 P;  2ZSI B;  3E3V A;  5F64 A;  1O4X A;  2EZL A;  4P9F A;  1WZ2 A;  4BL0 B;  4UY8 I;  3DWL E;  2RGV A;  2CGP A;  2PN6 A;  1F43 A;  1TWG J;  2XDV A;  2V9P A;  4KT5 C;  4CH7 A;  2FE3 A;  3GLX A;  3FDY A;  2ISZ A;  5FLX K;  4M3D A;  3V8K A;  2GLO A;  1XMK A;  2W48 A;  5DUK A;  2EWT A;  5H6R A;  3WTT C;  4BGD A;  4XBF A;  2VON A;  1IXR C;  2VE8 A;  1R1T A;  2IXS A;  3G2B A;  2UXN A;  3E5U A;  5E3M A;  4R1H A;  4HDU A;  1Y1V J;  2NVU B;  1W7P B;  2W25 A;  5E20 A;  4RB0 A;  2WV0 A;  3BTC A;  1RR8 C;  5FKK A;  3C7J A;  4CSW A;  2DMP A;  1Z3Y A;  3DU5 A;  1KU9 A;  2F48 A;  3NZL A;  2L5Q A;  3OMT A;  3VWS A;  2AQE A;  2XPW A;  5DSX A;  3GXO A;  3B7H A;  5FGM A;  1P2F A;  3JRE A;  3A9Y A;  1MBJ A;  2JN6 A;  3BJO A;  4H4K C;  3TOA A;  2QSG X;  1LDJ A;  2EA4 A;  1BIA A;  1ZS4 A;  3IH3 A;  1GUU A;  2V9K A;  2R7U A;  5E1Z B;  2IS4 A;  1X3W B;  2K40 A;  2YS9 A;  1S7E A;  1WHU A;  1YS7 A;  1WH8 A;  1G3Y A;  2B7E A;  4EKI A;  2PBI A;  3ABL H;  3CCR I;  2MFZ A;  4BNC A;  3HOY J;  1FX7 A;  1QB2 A;  4ZDL A;  4FE4 A;  2ZC2 A;  4I8T A;  4M9Z A;  3SX0 A;  2EJR A;  2BJC A;  3NXH A;  4OAZ A;  2X48 A;  3GZD C;  2JVL A;  4IEJ A;  5DCM A;  3AL0 B;  3EQL F;  5KNL A;  1Z7L A;  1I27 A;  1G3S A;  3ZCO A;  2M1B A;  1V4R A;  2CW0 F;  3CZ6 A;  5DTQ A;  5D5X B;  5M3M J;  1E0E A;  4RLQ A;  4EQQ A;  2FQ3 A;  2HVQ A;  2X6O A;  3K70 C;  3CUQ B;  3TBI A;  4RMN A;  1W0T A;  2DT5 A;  5FFZ A;  1YHQ I;  3NAR A;  3R6S A;  1G8X A;  2E60 A;  2K9S A;  3CCU I;  1U2Z A;  3EUS A;  3OQO A;  5EGO B;  3PSI A;  3A9Z A;  1K6Y A;  2XSD C;  1I3Q J;  3QYE A;  3FMY A;  2X6X A;  3HSE A;  4X1E A;  1MMA A;  2VPR A;  3ONQ A;  1JUS A;  5HOD A;  2RRE A;  2M8G X;  2XC7 A;  1XMX A;  2BBY A;  3OS0 A;  4A3J J;  2DA3 A;  5F08 A;  2GA2 A;  1XC5 A;  1QRY A;  2MH2 A;  3LQR A;  4PSX A;  1YTY A;  5CPR B;  3VWB A;  3A0B C;  3UFD A;  4LK1 F;  4EM2 A;  4XN3 A;  3L2C A;  1M1E B;  3DLL F;  3CCM I;  2EZI A;  1LFB A;  4IXA A;  1MMS A;  2Z9O A;  1AU7 A;  3ZMD A;  2YX4 A;  4LIV A;  1B4A A;  4XNF A;  5DYM A;  5A2Q K;  2IW5 A;  1S7O A;  3RQ4 A;  3ZQF A;  4YRV A;  2PI0 A;  3BG6 A;  2A69 F;  4O6J A;  4FX4 A;  1WH5 A;  4FCY A;  2G7H A;  3U1D A;  3WTU C;  2R7D A;  3H9J A;  1CF7 A;  4FHT A;  1QA6 A;  2ICT A;  2A3S A;  1MH3 A;  2HOS A;  4GDF A;  2GAU A;  5HOO A;  1FBU A;  1A04 A;  3NDB B;  1F9N A;  2QEX I;  2RC4 A;  3S17 J;  1POU A;  1WI9 A;  3CLQ A;  1IUY A;  5B1A H;  3VOD A;  2IAI A;  3TW6 A;  3KEQ A;  1YO5 C;  1ZKG A;  2DFF A;  3J81 Z;  2K27 A;  4Y7N J;  2GBY A;  2ZKZ A;  4W1U A;  3MLF A;  5B66 C;  5JUW A;  4EJO A;  1EV7 A;  2J5O A;  2ESN A;  4L5J A;  2LOO A;  4LB5 A;  1BA5 A;  4F91 B;  1WJE A;  4B43 A;  1MND A;  2OPT A;  5F0C A;  1R1U A;  3O3K A;  1FY7 A;  3BR6 A;  3CJR B;  4G8X A;  5TRD A;  2HU9 A;  2OTL I;  2V9V A;  2NOJ B;  4HSR A;  4PSW A;  2BGC A;  1GVJ A;  1MH4 A;  2WY7 Q;  5EEH A;  3OYD A;  5M3F J;  3OL3 A;  1S3J A;  2F5D A;  4PFP A;  2PUE A;  3OSF A;  1K7A A;  2CG4 A;  2MA3 A;  4G6T B;  2MYS A;  1AKH B;  3VEP A;  3Q9S A;  2R7R A;  4MQV A;  1HQC A;  1SVM A;  3GO5 A;  2E19 A;  1WWX A;  1TWA J;  3FXO A;  2LVS A;  1RUO A;  2P7V B;  1MSE C;  4OWR B;  3TL4 X;  3CRO L;  1ACI A;  3HG9 A;  4QTR A;  3CCY A;  1WJF A;  1UXC A;  1QP4 A;  3OYA A;  2L9S A;  4CGZ A;  1QQA A;  4PU4 C;  4A3C J;  2O49 A;  2VJ4 A;  3F21 A;  3OSG A;  2XKP A;  2NOG A;  2IVB A;  1B1B A;  2CUE A;  4M3B A;  2KIF A;  1FOW A;  3LAP A;  4HQM A;  3WU2 C;  3BR5 A;  5IYD J;  5FLM J;  1ONV A;  4WCG A;  3BZC A;  4L9T A;  4U7D A;  3RCO A;  4BJT A;  1GHC A;  3HOV J;  2CWE A;  2A61 A;  3F0C A;  5H20 A;  3BDD A;  5GTH C;  3LAJ A;  1U8R A;  1WVR A;  4GQM A;  1BI2 A;  3DKY A;  3OYJ A;  3L2U A;  5CKT A;  1X3U A;  3ZQH A;  5GAD J;  2WAF A;  4K2E A;  3TO9 A;  2EIK H;  2EQR A;  4E7L A;  2LMD A;  3ML6 A;  4XRF A;  2YSR A;  4HEA 2;  3I64 A;  3JXC L;  1O3S A;  2LF8 A;  2PXT A;  3EYY A;  2W82 A;  3MKY B;  3BPV A;  3S14 J;  4U0Y A;  3TP3 A;  1PRU A;  2FSW A;  2HZT A;  3L2R A;  3HDD A;  1X1A A;  4HPQ A;  1YG2 A;  3ME5 A;  3ZQI A;  2HXO A;  4ZJZ A;  3OYK A;  2OV7 A;  3LQQ A;  2X1E A;  3DPT A;  1TL8 A;  3BDN A;  1LDD A;  4EGZ A;  3QYF A;  1ZUG A;  4BYY A;  4BUP A;  3MKW B;  1D0Y A;  2GXA A;  2PXF A;  3RZZ A;  2XCJ A;  1JTY A;  3WTV C;  3G71 I;  5JLX A;  1VQ7 I;  3JTH A;  4PU7 A;  4M9S A;  3LSG A;  4M9X A;  4WVL A;  2WV1 A;  4PU3 C;  1HW2 A;  3D5S C;  1ZLK A;  5DM7 F;  3FHZ A;  1KU7 A;  1VQ8 I;  2GZU A;  1LJ9 A;  2ECC A;  1W5S A;  3F3X A;  1BC7 C;  3WG7 H;  4JX6 A;  1BW5 A;  2DW4 A;  3DKW A;  3CF2 A;  4DBR A;  1H9T A;  2GRL A;  2CSO A;  2P7C B;  3DTK A;  2GIZ A;  3A9X A;  4EAT A;  2EB7 A;  4X4I A;  5BS6 A;  4U88 A;  3CTA A;  3COA C;  2PXK A;  2JA7 J;  4A3E J;  3FXU A;  4I98 B;  5KAI C;  2TDX A;  2IP2 A;  3VSL A;  3GWZ A;  1LCC A;  2B9S A;  3U9G A;  1X58 A;  1ETV A;  3IWZ A;  2VKH A;  4XLN F;  1ETY A;  1JUP A;  1U6G A;  5HLI A;  1OCP A;  5ICF A;  3K6G A;  3TKY A;  3PIP F;  2OBP A;  4A3I J;  2QBY A;  2JVH A;  1P9Q C;  3PNY A;  5IP6 A;  1U9O A;  3H5N A;  4KFC A;  3AG4 H;  3JCU C;  1PRA A;  3HB9 A;  4XM3 A;  4BQQ A;  2YPR A;  4XKC A;  1S6L A;  3FXM A;  2CU7 A;  3CC2 I;  2FJ1 A;  4ER6 A;  5EZG A;  4Z5C A;  1J9I A;  5D4S A;  2WWY A;  4E7K A;  3RIR A;  2W4S A;  3CCJ I;  2HOT A;  3KP6 A;  4HNV A;  3U1K A;  2DI3 A;  1G59 A;  5CJ9 A;  1P4X A;  2HYJ A;  3DF8 A;  1DWK A;  3FM5 A;  2HR3 A;  2BW3 A;  3GUU A;  3LSJ A;  1V3F A;  2M30 A;  3S3M A;  4JOM A;  5GAG i;  1FMV A;  4Y42 A;  2DJN A;  3F52 A;  2CSF A;  1Q1V A;  4RGS A;  1FC3 A;  3TRB A;  2E2J J;  5EG0 B;  4XOT A;  1R71 A;  3KX2 A;  3GTJ J;  3ZQL A;  3MD2 A;  1IRG A;  3ISP A;  2PUC A;  1IUF A;  3WG9 A;  2FXA A;  3FXQ A;  4LG3 A;  1YIT I;  4B3A A;  4BBR J;  5C4J J;  3R0A A;  1RUN A;  1X1C A;  4NQW B;  4ASN A;  4Z6Y A;  1YFH A;  2IRF G;  2VPL A;  2E7W A;  2JT1 A;  4RGR A;  1IDZ A;  2MEZ A;  3ZMU A;  5HDG A;  1HDD C;  3T0Y A;  4C2U A;  1WH7 A;  1JGS A;  2FOW A;  2HTS A;  3WU1 B;  2PXP A;  1DU6 A;  1N75 A;  2ZME C;  1VZ0 A;  2PLY A;  1WET A;  4D0P A;  2HXI A;  1Z91 A;  3RJP A;  2HWV A;  2F4O B;  2FEZ A;  2FU4 A;  3E1S A;  5ICC A;  2NVQ J;  5CVV A;  2KQR A;  4QLC U;  3SJM A;  2O6G E;  4HW0 A;  2EWN A;  2JSP A;  4Y13 A;  1V5E A;  4EZI A;  2PEX A;  2ZBK A;  3ZXS A;  2Y2Z A;  2LDU A;  2EFP A;  2KIU A;  4HX4 A;  3HEF A;  1BBY A;  5K1Y A;  5B5E C;  5IPA A;  1FBQ A;  2KZ8 A;  4D5F A;  3NRO A;  1RET A;  4LLL A;  1OYY A;  2P5L C;  4BHC A;  2PXE A;  5FKO A;  3KP7 A;  4DW6 A;  3P5J A;  1MBK A;  4A0Y A;  3MKL A;  5EYR A;  4MTD A;  3MEX A;  2WAD A;  4IJA A;  3H1C A;  1BDI A;  2Z3Y A;  1YI2 I;  1MFQ C;  1T38 A;  4L0Z B;  2VQH A;  2GZW A;  5IP7 J;  1QNT A;  4MEY F;  5IYB J;  2BHZ A;  5DDG A;  4CYD A;  1N25 A;  1E2X A;  2V1X A;  4II2 A;  4DYC A;  3LIS A;  2HNH A;  2DMN A;  2LLK A;  4HNU A;  4CCL A;  2H09 A;  1IN6 A;  3PQK A;  5DCM B;  4GRI A;  3UR3 C;  3F72 A;  4AIK A;  2OR1 L;  2VQC A;  4WXC A;  1RPW A;  3VSK A;  5BQT A;  2D5V A;  4DOZ A;  3BG3 A;  1YRN B;  1RNL A;  3RSN A;  4HG2 A;  4EJU A;  2L9V A;  2IS1 A;  1ENH A;  4Y4R A;  1ZG5 A;  3PUB A;  1T6S A;  2CW7 A;  5CQE A;  1Y9Q A;  3HPH A;  1TNS A;  1D0X A;  2R93 J;  3CMM A;  4A5M A;  2M2E A;  1SFU A;  2K7L A;  3J80 Z;  3KPH A;  3ASN H;  1FSE A;  4O3M A;  3E5Q A;  4CA0 A;  1ZEL A;  2X51 A;  3N4M A;  1ZTR A;  5FKL A;  4ENM A;  3FMS A;  3LA7 A;  1X4O A;  1YRN A;  1V54 H;  4E70 A;  5J1Y A;  1L3L A;  2O61 A;  3LNQ A;  2V4J C;  2P5K A;  3TP0 A;  3EUA A;  5K7F A;  1RPE L;  3F8B A;  1O3T A;  4RB2 C;  1OYW A;  5IYC J;  3ABM H;  5GPA A;  3RPU A;  1HC8 A;  2HDC A;  2EZH A;  3ZR8 X;  2E5N A;  4II3 A;  2XRL A;  3DEW A;  4G9Y A;  4A0Z A;  3CCQ I;  5E3N A;  1W1W E;  4IHS A;  5C4X J;  2CS3 A;  3HKZ A;  1TZL A;  3MKZ A;  4PJN A;  1R58 A;  1G6N A;  2V1U A;  2F4M B;  3GBG A;  3H5A A;  2QGU A;  1Y8R B;  3L00 A;  2V1N A;  2XF5 A;  5CYV A;  4IQJ A;  3BG5 A;  3M8E A;  1DGR M;  1XS9 A;  3CF5 F;  5GAH J;  1PUE E;  2LYP A;  1T8I A;  3IUO A;  2LY1 A;  4EEF G;  2L4A A;  5TIS C;  1Z67 A;  1VF9 A;  1JJ6 C;  4JBA A;  1AHD P;  5LHI A;  3QOP A;  2ISY A;  3W3C A;  3F6O A;  2MC4 A;  4Z59 A;  1Z21 A;  2DQL A;  3CC4 I;  1B8I B;  1JFS A;  3I59 B;  2LRD A;  4BJ6 C;  1TWC J;  2E34 A;  2R7Q A;  2OF7 A;  1P7J A;  2VUM J;  2XF7 A;  1OQY A;  1X1D A;  2CQK A;  4EJV A;  1DGW Y;  3Q0W A;  2BOL A;  3ZQQ A;  1D8K A;  4HDV A;  1Z7U A;  3HTS B;  5KAF C;  3IHU A;  2XRO A;  2UWM A;  1AKH A;  4AU7 A;  2DT7 B;  3HOZ J;  5JR3 A;  2BW3 B;  3H0G J;  3E0J B;  3FHN A;  4EJT A;  3R61 A;  2H6B A;  3J7A O;  2P8T A;  1W7P D;  2VOP A;  1VQ4 I;  4F93 B;  2D2W A;  1BI1 A;  4M74 A;  3UWP A;  5IOY A;  1BI0 A;  1B8I A;  1QBJ A;  3FK7 A;  4S0H B;  4M73 A;  2VI6 A;  3BP8 A;  3ESW B;  3J81 K;  1W0U A;  2QF7 A;  4X4F A;  2LG4 A;  3MFK A;  3I4M J;  1TTY A;  2OJE D;  1DPR A;  4ENN A;  3EDP A;  2PJP A;  1ZGA A;  4N0B A;  1NEQ A;  5JVT A;  2VXZ A;  4RAY A;  3Q0U A;  5C44 J;  3SCF A;  3OYB A;  2K85 A;  3GFM A;  1ODD A;  2DMU A;  1XSD A;  1NW3 A;  2HSG A;  1NTC A;  3TMO A;  4YEL A;  1A36 A;  3FZV A;  2R7S A;  3HYI A;  4J1W A;  2FFH A;  3RDI A;  4BXF A;  2M45 A;  1Z6R A;  2R0Q C;  4QIW N;  1F4K A;  2LKS A;  4YEJ A;  2VJ5 A;  2L54 A;  1PER L;  2L7Z A;  4RS8 A;  2BVM A;  5DTM A;  2OZ6 A;  1HLV A;  1F1Z A;  3OY9 A;  1J7K A;  2Y75 A;  4M71 A;  5GAG J;  1Y56 A;  1ZGW A;  3H36 A;  5GTI C;  3FMQ A;  3CO6 C;  2W85 A;  3BRO A;  1GDT A;  3I0T A;  3GZ6 A;  2VJJ A;  4AID A;  4FBI A;  3LFK A;  5LGN A;  2W84 A;  3ZMV A;  2CW8 A;  2J7U A;  2OU2 A;  3SCH A;  2WY8 Q;  2VBZ A;  1RZR A;  5M5X J;  4IF4 A;  1LNW A;  3UKG A;  3L7W A;  2M0C A;  1UHM A;  2GXG A;  4IHX A;  1DU0 A;  1O3R A;  4H0E A;  2AXV A;  3OYN A;  1C0W A;  4XLA A;  1QPZ A;  1ZN2 A;  3FKI J;  2Y30 A;  1P4A A;  3RPU D;  1EA3 A;  5FFX A;  1QZE A;  2LYL A;  1HST A;  3LST A;  3F6V A;  4GGG A;  2BNM A;  4B44 A;  4N4O B;  4DZP A;  2JTV A;  3BTI A;  3M7G A;  4Z2Y A;  2CV0 A;  2ODR D;  3NWT A;  3FBN B;  4JQD A;  2DFE A;  1GT0 C;  4CO8 A;  1V55 H;  5IT3 A;  4IRG A;  3O8G A;  1XTA A;  5DV5 A;  4OIP F;  3T8T A;  3QOE A;  1MIJ A;  4I99 C;  1PP8 F;  4BEH B;  2D1H A;  3ZN0 A;  5DEQ A;  2R92 J;  1JT0 A;  2YBD A;  3M9L A;  3KFW X;  4NBQ A;  3LSI A;  4ZZL A;  4OU0 A;  5J6X A;  3G1M A;  4PCQ A;  2OQG A;  2MSY A;  1QHH D;  2EFN A;  2LLW A;  2XXQ A;  1TQM A;  4AIJ A;  4UUV A;  3RQI A;  3BCB A;  3SFZ A;  4YFX F;  2CQQ A;  1ITY A;  1FLI A;  3OOU A;  4KIB A;  5D8K B;  3IV5 A;  1JWL A;  1PDN C;  4UVC A;  1QQB A;  4FET A;  2ELJ A;  3BR1 A;  5E8I A;  4UNO A;  3BR0 A;  1K4S A;  3BQZ A;  5ICG A;  4ON0 A;  2XAF A;  1VQL I;  1IRF A;  1G3T A;  4F55 A;  3HZI B;  1W7P A;  4NDW A;  4HV5 A;  3OV8 A;  2O5R A;  3H9Q A;  2O8K A;  4XOR A;  5F0H A;  2YX7 A;  1G2H A;  4BHB A;  2DYR H;  1MJB A;  3K1M A;  4L5E A;  4A6D A;  4FQG A;  4RAF A;  5EG0 A;  3M8J A;  5D6E A;  1WH6 A;  3REO A;  4B8X A;  1JKO C;  4DE9 A;  4HQE A;  5ICE A;  1Z9C A;  1KZH A;  1ON1 A;  1DPU A;  1BIB A;  2CQX A;  2DOD A;  2ELH A;  1K78 A;  2F5C A;  4XL9 A;  3IWF A;  4Q47 A;  3CO7 C;  3DBH B;  3HPG A;  1DP3 A;  1Z3X A;  1VTN C;  1ZLJ A;  1FYL A;  3K9T A;  3FBI B;  1NHA A;  1D3Y A;  3CMY A;  5M5W J;  1HOM A;  1Z0X A;  2QKM B;  1YLF A;  4NC8 A;  4XR6 A;  2GOM A;  4RAZ A;  1UG0 A;  2LRE A;  3Q0V A;  2QQA A;  1ZHF A;  4I76 A;  1ZAY A;  4E7J A;  1UMQ A;  4XOP A;  1ZH5 A;  4BXX J;  2DT6 A;  1BDH A;  3J7Z I;  2IS6 A;  3OYE A;  1JHF A;  4NUB A;  2DA6 A;  5J40 A;  2EIN H;  2QZ8 A;  4IHV A;  5HDK A;  3QU6 A;  4PK4 A;  3ZKC A;  2O9L A;  2ZJR F;  1FSH A;  1U3E M;  1U2W A;  2AW6 A;  2AWI A;  2MC3 A;  2PPX A;  2XRN A;  2V79 A;  4JP0 A;  2P81 A;  2CYY A;  1ETQ A;  3F8N A;  5K5Q A;  3GZ5 A;  5HS7 A;  4HRA A;  9ANT A;  5FKM A;  3WTS C;  1JTX A;  3C2H A;  2P5V A;  5HLG A;  2R5Y B;  2IEK A;  1IAW A;  1KA8 A;  2IBD A;  5HVQ C;  1REP C;  2GRM A;  1XB4 A;  3F6W A;  5E8G A;  2ME0 A;  5ERI A;  3R0J A;  2EFW A;  3K1P A;  2EV5 A;  4RM3 A;  3H5T A;  1J75 A;  3E5X A;  1WI3 A;  3FWE A;  4BE0 A;  2TCT A;  1YIO A;  3MZY A;  3QWG A;  4Z5D A;  1LCD A;  3E97 A;  2MGQ A;  3TEL A;  4F8D A;  1BR1 A;  2BXZ A;  3PXP A;  3I56 I;  4XON A;  1FPQ A;  5GAH i;  1EKE A;  2F6C A;  4ZDO A;  3OYI A;  2R7W A;  3K4B A;  3DBR B;  4F3Q A;  3K4L A;  2AXL A;  1SD7 A;  2TRT A;  3I3L A;  3HZJ A;  2IA0 A;  4NB5 A;  3HRT A;  3IRQ A;  2ID3 A;  1CQT A;  3G0T A;  4JX5 A;  2BHY A;  3M1C A;  4XRS G;  4LLG F;  1ZRF A;  2K9L A;  4M3G A;  3NWS A;  1R9T J;  3CCV I;  1ZVV A;  1HF0 A;  3F23 A;  2EPF A;  4HLX A;  3OYL A;  3LFU A;  1A5J A;  2PMZ A;  3TDU C;  5FLV A;  1LPQ A;  3HIF A;  4C3I J;  3GN5 A;  1LE8 A;  2R7F A;  1HQ1 A;  4IWR A;  5A7L A;  2RNG A;  3C3W A;  2VL8 A;  2UZK A;  2KEI A;  5CVI A;  1YX5 A;  1MBF A;  2PFB A;  1T33 A;  3K2Z A;  4R79 A;  1KYW A;  2W1O A;  4EKG A;  5E3O A;  5L3E A;  2A5Y B;  2EV6 A;  1W5C C;  2JK3 A;  4XRS A;  2WIU B;  1WQ2 A;  2VBY A;  3V8L A;  2ZXW H;  3PFY A;  4LIT A;  3QF3 A;  3JAM K;  1BJZ A;  4G6Q A;  3V4G A;  4Q4Z F;  4OB4 A;  2EIJ H;  2Q0O A;  3EYI A;  1S5L C;  2LNM A;  2OC6 A;  2VT2 A;  2DFH A;  5JHU A;  3DU6 A;  1EFA A;  1R22 A;  5L3G A;  2PXU A;  1BOB A;  4F7Z A;  2M87 A;  5GP9 A;  1FNN A;  2IVQ A;  2R1J L;  1DDN A;  2UXX A;  1JE8 A;  3PL8 A;  3L2V A;  3CCL I;  2JZY A;  4JK1 X;  4YG7 B;  1R5I D;  4BH9 A;  4X4D A;  4LLN A;  4E7H A;  2PIJ A;  2PXL A;  4HAM A;  4GCV A;  3C1D A;  2DPD A;  3SEZ A;  2WB1 N;  5AIP A;  1W5T A;  2QLZ A;  1B72 B;  4OIO F;  3WGI A;  1VQK I;  3A4C A;  2DK5 A;  4AC0 A;  4JCX A;  1TWF J;  4X4E A;  2MBF A;  3SFI A;  4EMS A;  4P1W A;  5ILS A;  1JHH A;  4LOC A;  3PM1 A;  2PXD A;  2HCN A;  3MWM A;  1YS6 A;  3ZP5 A;  1RZ4 A;  1HW1 A;  1IN4 A;  2RKH A;  5J8F A;  1Y6I A;  2DDA A;  1CJG A;  1O57 A;  3GW2 A;  3S2W A;  2M0M A;  1VQ9 I;  4AD9 A;  3QOX A;  3TDZ C;  4BKX A;  3EPZ A;  2XAJ A;  2CQN A;  2QSF X;  2Y0S A;  1PNR A;  5EEA A;  2NRA C;  1KQ8 A;  4D7N A;  1J2X A;  1NER A;  1JUM A;  4CCM A;  3JRI A;  2R7X A;  6PAX A;  1ZYR F;  1B72 A;  1RES A;  2HFZ A;  1P4W A;  2BXY A;  2E1M B;  2XB5 A;  5ED4 A;  4LMY A;  3M1E A;  1IW7 F;  2EIM H;  1PJR A;  3ROU A;  3I5U A;  2VN2 A;  4BU2 A;  4CCN A;  3G1O A;  2E1M C;  1GVD A;  1DUL A;  3HBL A;  3IAM 2;  4HF2 A;  2B0L A;  5DUI A;  3OIP A;  3TO7 A;  2E7X A;  1S8N A;  2LH9 A;  1SEU A;  4A69 C;  2LYS A;  2JA2 A;  3ELK A;  3ZOB A;  3IL2 A;  2X85 A;  2XB0 X;  2A6E F;  1RZR D;  2JCG A;  3W6K B;  4C9Y A;  3K10 A;  3H3Z A;  4KNY A;  3MQ0 A;  2DLL A;  4EQZ A;  3HHH A;  1D1C A;  4YIR X;  1S7A A;  2WAE A;  1MBG A;  4PFO A;  5K7H A;  3H3U A;  2LYR A;  1KYZ A;  1B0N A;  2QKL B;  4LJZ F;  4GXO A;  3OQM A;  4PUS A;  2KLO A;  4D5C A;  2HOE A;  1XDS A;  3I4P A;  4LIU A;  3OP9 A;  2V7F A;  4OAY A;  3MZH A;  2YUS A;  4DYR A;  3S2D J;  2A05 A;  1TQI A;  2DK8 A;  3K7A J;  2FX0 A;  4X0G A;  4YBA A;  1SFE A;  4EVI A;  1RR7 A;  3BJA A;  3HSF A;  1YIJ I;  1X3Z B;  4L0Y B;  1MMD A;  2QEN A;  1OSL A;  3I71 A;  1RZS A;  2IGM A;  3FIS A;  5BNG A;  3K4K A;  4YFN F;  2CH0 A;  2PXB A;  3LMM A;  2PMH A;  3KYL A;  5TJJ A;  2NNY A;  1TLH B;  3OS1 A;  3KET A;  4HF1 A;  1Z77 A;  1I50 J;  3K4M A;  4BDY A;  2VKE A;  3WTX C;  3FYM A;  2MH9 A;  5FB2 A;  2JPC A;  3SZT A;  2R7V A;  5D5W B;  4ENK A;  3GEZ A;  2KJB A;  3D5R C;  1RRJ A;  1UST A;  2KRC A;  1UAA A;  4JCY A;  3DKX A;  3QOW A;  1O7L A;  3EUH C;  3GF2 A;  3CES A;  3SYT A;  1R49 A;  2PXV A;  1RC9 A;  3QPT A;  1TW3 A;  3I4N J;  2IVG A;  4I02 A;  1LE8 B;  1YE9 A;  2RN7 A;  1SAX A;  3OR1 C;  4S05 A;  4AIH A;  4ESF A;  1JH9 A;  2JSC A;  2LC2 A;  3QPH A;  3SZG A;  2QVO A;  4U0W A;  5F0F A;  4CYC A;  2VKD A;  2JMW A;  2XHK A;  3KEO A;  3LL7 A;  2XI8 A;  4ANJ A;  2KL4 A;  3OYM A;  1MSF C;  1MMN A;  4M3F A;  4F52 A;  1MBE A;  2BVL A;  1TWH J;  5KHD A;  3GYH X;  3E6D A;  4B4C A;  4V2G A;  2LR8 A;  1FZP B;  2PUG A;  2VT3 A;  2DO7 A;  2D1V A;  2DCE A;  5LGU A;  1T0F C;  2OAZ A;  5AIQ A;  3TEP A;  2PMZ N;  2VEO A;  1V5F A;  1JJ8 C;  2Y69 H;  1E17 A;  3CUQ C;  1ERD A;  4P96 A;  2BY3 A;  1U5T B;  1FIA A;  3PUF A;  4DZJ A;  3PQJ A;  1TT5 B;  2OD5 A;  1LEB A;  1X19 A;  2VQL A;  2FRH A;  1UJ8 A;  2FMY A;  5F1J A;  2NS7 A;  2DA4 A;  1WSU A;  1KON A;  4D7M A;  4ZYD A;  3A03 A;  4XKV A;  1FTT A;  2R5Z B;  4XN0 A;  2F5V A;  4KIC A;  3HGG A;  5ILU A;  2XAS A;  1HKQ A;  3CJT B;  5C3E J;  1PP7 U;  2JQ7 A;  4TV7 A;  3UNG C;  3LOC A;  3LFP A;  3GFJ A;  4PDK A;  2CFX A;  1X2L A;  5CVJ A;  1U5T A;  1Y0N A;  1LKX A;  1XCV A;  3CLO A;  3VDX A;  3H0D A;  3V7R A;  1U9N A;  1R1V A;  3PO2 J;  2UV1 A;  3KLO A;  4KYW A;  4G7O F;  5E1W A;  1I1G A;  1Y8Q B;  5IT9 Z;  2DTZ A;  3M4O J;  5DRT A;  5CQG A;  2JJ7 A;  5LGT A;  4B47 A;  3KYD B;  2K9M A;  2KDO A;  1WJA A;  2HGC A;  4HOB A;  5EEG A;  3JXB C;  4BE1 A;  2XAQ A;  1DW9 A;  2KFD A;  5E18 F;  2DMT A;  2L49 A;  2K9Q A;  1ZZ7 A;  1R4N B;  1A6I A;  2M4G A;  5LLQ A;  2G0E A;  3A1Y A;  3W2A A;  3C2B A;  1QP7 A;  3CLC A;  3ZHM A;  3WU0 A;  1X2N A;  2LY9 A;  1ZZ9 A;  3RI4 A;  1VQP I;  2Y9Z A;  2LYK A;  4XKB A;  2X0L A;  2Y31 A;  2FBK A;  3CD6 I;  3T8R A;  5LHH A;  3ZQ7 A;  3BTJ A;  5HS8 A;  2MXD A;  3PIO F;  4UV8 A;  1VQ5 I;  3AL0 C;  3BZ6 A;  2H1L A;  1RIO A;  4G7H F;  2BY2 A;  3GTL J;  1LEA A;  2CRG A;  5LRS A;  2O38 A;  1I6X A;  1J59 A;  2HKX A;  1HKT A;  2Z5U A;  5DTD A;  1ZK8 A;  4PJJ A;  5CVU A;  1U78 A;  3SDG A;  1X57 A;  2XKO A;  2FNP A;  3CDL A;  4W97 A;  2P0W A;  4N9I A;  2KEJ A;  2XGX A;  3S1M J;  3RPQ A;  1POG A;  3LSK A;  2XAU A;  3LSH A;  2JA8 J;  4ZYE A;  4AVP A;  5L3B A;  3PO3 J;  5J3L A;  4C30 A;  3RTR A;  2QQ9 A;  2KIQ A;  3BC8 A;  3HGY A;  4ZYH A;  2HFH A;  3IAS 2;  3CP2 A;  2YU9 J;  2DA7 A;  1N78 A;  2JWT A;  5DD4 A;  3E6C C;  2PUA A;  3G73 A;  4KIS A;  1K78 B;  2P4W A;  4I6Z A;  4L9N A;  5BMZ A;  3FXJ A;  3KP4 A;  2ETH A;  3O9X A;  5CVR A;  5D4R A;  1R5G A;  3MMY B;  2L01 A;  4Z5H A;  2GWR A;  4C2T A;  2DMQ A;  2Q2E B;  4NC7 A;  5CLS A;  2QYO A;  3U21 A;  4RAG A;  2PE5 A;  1OCC H;  3OS2 A;  2CJJ A;  3GN5 B;  2XIU A;  2Q1Z B;  3JRH A;  4E7Z A;  4CCJ A;  3FXR A;  4ITV A;  2MQK A;  1BJA A;  2I10 A;  4EK9 A;  4B48 A;  1RKT A;  4A3K J;  2LNB A;  2WTE A;  2ID6 A;  2VIX A;  4FIS A;  3TQN A;  4A3D J;  5L3D A;  1KU3 A;  4HNT A;  3HJE A;  2LLV A;  1OYI A;  3QP6 A;  1FOK A;  1OMI A;  2W7N A;  3BZK A;  4HYE A;  3HOX J;  4RGX A;  1FOY A;  2FF4 A;  4O8B A;  2JUC A;  2FBI A;  1XG1 A;  3V8J A;  2DDB A;  3H5R A;  2QWW A;  2ZFW A;  4RLF A;  2M34 A;  1A31 A;  3D0S A;  3OYF A;  3GX4 X;  2O03 A;  3R4K A;  5FO5 A;  4X6A J;  3OYG A;  1R5H A;  1XMA A;  2L3D A;  4IA8 A;  3Q9V A;  3FX3 A;  2F5E A;  3AFH A;  3DXJ F;  3K2A A;  2Z16 A;  3HC7 A;  4DNC A;  3MVP A;  5L3F A;  3L1P A;  1X1B A;  3BG7 A;  2RQQ A;  1SMY F;  3A01 A;  2LYQ A;  1YJW I;  2MD5 A;  1ZRC A;  1LB2 A;  1K6O A;  1FP2 A;  3BG9 A;  4IVZ A;  3LSP A;  4IRH A;  4MGR A;  4CCO A;  2QQB A;  1XX5 A;  1MZB A;  4AM3 A;  1L1M A;  3ZQC A;  1QP0 A;  2PUD A;  1XGS A;  2HDD A;  3HL2 A;  2JA6 J;  1QVU A;  2PG4 A;  1EJ9 A;  1J0R A;  3IC7 A;  1XGN A;  4I7H A;  5FD6 A;  4CHU A;  3ZMT A;  3WHC A;  1MBH A;  4UUT A;  1OCZ H;  1JKQ C;  1UHW A;  1S72 I;  1BL0 A;  4MIM A;  1A35 A;  1K4T A;  3Q3S A;  1PYV A;  2QM3 A;  2RQP A;  1Y7Y A;  3A01 B;  3KL4 A;  1WKM A;  1MW7 A;  3WGH A;  1MNM C;  2DXI A;  3QOD A;  4CXF A;  4G7Z F;  1S9H A;  2DTR A;  3N05 A;  5TGT A;  2IT0 A;  4MHG A;  3KJX A;  2LTP A;  3VYR B;  5HNH A;  2VOO A;  2OCC H;  1QGP A;  2KZG A;  4AVZ A;  3OR2 C;  4UV9 A;  4JX4 A;  1SVL A;  1X2M A;  4FAS D;  3WTY C;  1IGN A;  1H89 C;  4QSH A;  4UVA A;  3DP7 A;  3CC7 I;  1XGM A;  3KZZ A;  2KPJ A;  3W6J B;  2IA1 A;  4NC6 A;  5E3L A;  1QPI A;  2V3C C;  3T5X A;  5IOZ A;  1LQC A;  4ZC3 A;  1DP7 P;  3SDB A;  1NH3 A;  1LFP A;  3I58 A;  5KVR A;  2STT A;  4IHW A;  3VOE A;  3C2G A;  4KDP A;  4KIF A;  3V7S A;  1MJA A;  1H88 C;  3AG2 H;  1IV8 A;  2X6W A;  2RV8 A;  4IHY A;  2L4M A;  3K4N A;  1XCB A;  3TED A;  2GXB A;  4BJ5 C;  2DQR A;  1R23 A;  1VI0 A;  1ZG1 A;  1R69 A;  3HOT A;  2ZB9 A;  2LYC A;  5KK1 A;  4L18 B;  2FJR A;  1L0O C;  1XSV A;  2KIS A;  1I6H J;  3HKZ N;  5E79 C;  1YW8 A;  1XGO A;  4Y15 A;  3GTQ J;  4RGU A;  2E5Z A;  4MLO A;  2JPB A;  5DD8 A;  1BW6 A;  1R36 A;  4C3J J;  3GFL A;  5GPC A;  2WC2 A;  2DOA A;  2JQE A;  2O0Y A;  1T08 B;  4KMF A;  2DFI A;  1XSX A;  3JRC A;  1WGX A;  4Q2J A;  3DPU A;  2M8E A;  3ZN1 A;  5JLW A;  1HBX G;  2W57 A;  4D9J A;  5EZH A;  5HDN A;  1Z05 A;  2NVY J;  3ZGK A;  4I01 A;  4PGG A;  3O8H A;  1QHG A;  2H1K A;  2VJI A;  1SFX A;  1U8B A;  1AWC A;  1SAU A;  2L7M P;  4RBO A;  4KMU X;  3A2K A;  2OCE A;  3HTU A;  1LDK B;  3W2V A;  4I0A A;  2G7U A;  2LCV A;  4HF0 A;  1WJC A;  2I8D A;  2A07 F;  2HVS A;  4E4H A;  3Q5F A;  3C18 A;  4X4G A;  4G6D A;  2FNA A;  4HZF A;  3RYP A;  3S1Q J;  5FJ8 J;  2VKV A;  1ZPQ A;  3HRM A;  3CJQ B;  4M6Y A;  2KIM A;  1IN5 A;  1O3Q A;  2PUB A;  4JQF A;  3JXD L;  1QZX A;  4GO1 A;  4UUS A;  2XGE A;  5KCM A;  5B1B H;  3DEU A;  4MFE A;  2AXU A;  3SR4 A;  3HOS A;  1SVO A;  4RB3 C;  2IGN A;  4BQN A;  5HLT A;  2RNJ A;  3KLN A;  1IG7 A;  2BNN A;  1UCR A;  3GVA A;  4YII A;  3ULQ B;  4JYK A;  2X4H A;  4CZZ A;  2KP6 A;  2XV4 S;  2I5U A;  3ZQG A;  4NHJ A;  1YW7 A;  5DM6 F;  2NXN B;  4B3X A;  2QA4 I;  1FP1 D;  3X2Q H;  1PRV A;  3HOW J;  2PXQ A;  3G5G A;  4HBL A;  2AXT C;  5EDN A;  3FKJ A;  4Y33 A;  2HEO A;  1NK3 P;  2XXA A;  2CV2 A;  3NRV A;  4EJW A;  1GLN A;  1N77 A;  2L8N A;  1GXP A;  3CUQ A;  3HXL A;  2BE5 F;  2OA4 A;  2H27 A;  3OIO A;  5AON A;  4ZDP A;  4ENJ A;  4X4H A;  1NG7 A;  2O7O A;  2QCO A;  1RIO H;  5EGO A;  4A12 A;  2X1D A;  3G1L A;  4A6E A;  4AYB A;  2ZXI A;  2XSJ C;  4DJA A;  2OUM A;  3PSF A;  2E35 A;  1XWR A;  4XSX F;  3CEC A;  3KCC A;  3OWQ A;  2WBM A;  4X4C A;  4A93 J;  3VPR A;  3TGN A;  1HXD A;  4KN7 X;  1ZGJ A;  4I09 A;  3IVP A;  1VQM I;  4BS9 A;  1FMW A;  1BR2 A;  3P9I A;  2O3F A;  1MDM B;  3B02 A;  3HOU J;  4PU8 A;  4KUM A;  3MEJ A;  1U5T C;  3CJN A;  4AWX B;  1ZZ6 A;  2O4A A;  4X4B A;  3NQO A;  4PJM A;  2P6S A;  2EZK A;  3BLY A;  4A2U A;  1V5G A;  2E1C A;  5LRR A;  2JA5 J;  2X1C A;  3DLA A;  4B1R A;  4ER5 A;  1IXS B;  1LVK A;  1LLI A;  5IY5 H;  1R7J A;  2HDW A;  3GTO J;  2Q2E A;  3JRA A;  3CCS I;  3QP5 A;  3CME I;  2NNN A;  3NAU A;  3RKW A;  1S29 A;  3SHF A;  1I39 A;  4L5I A;  1U0J A;  3WE3 A;  2G9W A;  3B6C A;  1QZY A;  4UXN A;  3G6E I;  3ABU A;  2J5P A;  2BV6 A;  2EBI A;  3GZC A;  3NEU A;  1E3P A;  3OQN A;  4BHP A;  5JVG F;  2HQ5 A;  4XID A;  4IO9 F;  3BS3 A;  1H9G A;  2VBW A;  2R7T A;  4OMZ A;  4ER0 A;  4HA8 A;  4BY1 J;  1ETX A;  4A3M J;  2HIN A;  1JGG A;  5BOX A;  1LFU P;  3JSO A;  1ZAO A;  2DOF A;  2ZSH B;  3WE2 A;  4BXU A;  2XPV A;  2HI3 A;  1W36 D;  4YG4 A;  1LUJ B;  4UB6 C;  2XAG A;  4HV6 A;  3L9F A;  2HPM A;  2CRO A;  3I9V 2;  3DBL B;  2YR2 A;  5D5V B;  1YSE A;  2HYF A;  2A6H F;  4BEH A;  4N9H A;  3CP8 A;  4G94 A;  2ZXH A;  2KT0 A;  3W2W A;  2K3P A;  3QWL A;  3WTW C;  3H9G A;  2XJ3 A;  2X6Y A;  1ON2 A;  4LD5 A;  5E17 F;  2NVT J;  3DPL C;  3IKT A;  1JKR C;  3G7D A;  2PUF A;  3JRB A;  4EM1 A;  1VQ6 I;  2DBB A;  2PMU A;  3K0L A;  2IGO A;  5K5O A;  4CUG A;  2E2H J;  3FF5 A;  5DT2 A;  2VQG A;  3LWF A;  1X4P A;  3HUG B;  3S2H J;  1E3O C;  4P55 A;  1D5V A;  4HX8 A;  4P9U A;  2ICP A;  1SD5 A;  2MLK A;  4U87 A;  1B6A A;  5DRY A;  2F2E A;  2L7F P;  3K1N A;  3QYX A;  2AHQ A;  3HHG A;  4C2M J;  4ESB A;  2ICW G;  2WAQ A;  1K79 A;  2DU9 A;  2VLA A;  1UTX A;  3ZPL A;  2C6Y A;  4DE8 A;  2LD5 A;  4MCX A;  5K5R A;  1G3W A;  1IDY A;  3O2P E;  4S04 A;  4DQ2 A;  4YG2 F;  4N4N B;  5J4V A;  2Z33 A;  5F27 A;  4Y52 J;  1CF7 B;  3ASO H;  1HSJ A;  1UXD A;  1USS A;  1MMG A;  4AUX A;  2QQ8 A;  2Z99 A;  1XPX A;  1EH8 A;  4V19 K;  1IN7 A;  4HLY A;  2NS0 A;  3QPL A;  1YX3 A;  2F5F A;  3OKZ A;  5L3C A;  4E7S A;  5H6Q A;  1ZZ8 A;  2STW A;  2CUZ A;  1TT0 A;  2NYX A;  3HRU A;  3LSR A;  4EGY A;  3S3O A;  1WRJ A;  3ECH A;  4LG0 A;  3D1N I;  4BAC A;  4XIC A;  5K7Z A;  1OCT C;  4XMY A;  1TQP A;  1ZR4 A;  1FTZ A;  3RKX A;  3GBF A;  1JFT A;  3CQZ J;  1IC8 A;  3H35 A;  5J1R A;  3V7C A;  4FN3 A;  4XLP F;  3T1B A;  1YOV B;  3W6V A;  3IH2 A;  5FRM A;  2VE9 A;  4CZC A;  4M3E A;  3FYA A;  1OFC X;  1PUF B;  4Q48 A;  4XK4 A;  2KJC A;  3J7A Y;  1IXC A;  1BM9 A;  1H8A C;  4HRI A;  1MGT A;  2V6E A;  2EK5 A;  5FRO A;  3IP4 B;  3I54 A;  2ADU A;  3SXY A;  3DNV B;  1OLT A;  4YG1 A;  4WF2 A;  1B59 A;  4FE7 A;  1OJL A;  5BPI A;  1W36 C;  3H3V K;  2CMP A;  1GXQ A;  2O8X A;  1SD6 A;  2YU3 A;  3DTI A;  1Y1W J;  1HKS A;  1R4M B;  3TFL A;  2KHM A;  1I5Z A;  2A68 F;  5JFR A;  4M6V A;  1UB9 A;  3JR9 A;  2LFB A;  2PX9 A;  4PGH A;  5D8L B;  4ZTJ A;  2VAS A;  1UG2 A;  1OIS A;  2V6C A;  3DFG A;  4RB1 A;  3J80 K;  1PUF A;  3L09 A;  3KIO A;  1UFM A;  1IF1 A;  4O5V A;  4UHT A;  2W24 A;  3F8M A;  1RI7 A;  3BY6 A;  1ZZB A;  4ER3 A;  3BTL A;  2KDZ A;  2LKP A;  4G12 A;  4A5N A;  1EH7 A;  3M8F A;  3SZP A;  2A6C A;  3I53 A;  1P7I A;  4ER7 A;  3BR3 A;  3DCF A;  3SEQ A;  2GOX B;  2EFO A;  2RAE A;  4I6T A;  3QPS A;  1YJ9 I;  3WGG A;  3PNV A;  3KP3 A;  4BBS J;  2VOD A;  4D1Q A;  1D1B A;  2FD5 A;  3S8Q A;  1OPC A;  1JKP C;  1W4M A;  1BC8 C;  1Y0U A;  5IT9 K;  3JRF A;  4BQA A;  4A3G J;  3FK6 A;  1DUX C;  5EJC A;  1SAN A;  3VYS B;  4GYG A;  4RDU A;  5BPD A;  5J4Y A;  2EIL H;  5D6F A;  1OR7 C;  5F04 A;  4LB6 B;  5D5U B;  3PNT A;  3GTM J;  4OIQ F;  1Q1H A;  2MLG A;  1IRZ A;  4WXH A;  5GAE J;  3HSR A;  3F8C A;  1SC7 A;  3GUD A;  1VFC A;  2BEO A;  1NG6 A;  1GV2 A;  1SFO J;  2W00 A;  3QAH A;  2ELK A;  4P5O A;  1ULY A;  3L2Q A;  1YJN I;  4U7B A;  4ABZ A;  2R5Z A;  3LSM A;  4FTH A;  2BY1 A;  2ZME A;  5FD5 A;  3M07 A;  2IGK A;  4XSZ F;  4L9V A;  2HPI A;  3DEE A;  3ZMS A;  2UUZ A;  3S15 J;  4ZH4 F;  3GCM A;  3DQV C;  4NNJ A;  1J09 A;  2HKO A;  4KA4 A;  2OFY A;  3CDH A;  1CGP A;  4CCK A;  3AKZ A;  2COM A;  1H0M A;  2HQR A;  5JI6 A;  4ETS A;  2QSH X;  3K4C A;  5J1U A;  5JHF A;  2AUW A;  4MCT A;  2F4I A;  4NDL A;  4DGW B;  3VK0 A;  3PE5 A;  2DA2 A;  3LA2 A;  3SCG A;  2XIG A;  3ERM A;  5LEK A;  1XD7 A;  2Z1D A;  2NS8 A;  3KZI C;  4EM0 B;  2AQF A;  3P9K A;  2BZT A;  1FIP A;  2GQQ A;  2RVC A;  3EUH A;  1ZRE A;  3D5L A;  5J8C A;  3KP5 A;  2HTJ A;  1IO2 A;  2DAO A;  1FEX A;  2R3S A;  1Y39 A;  2QBY B;  3S32 A;  2DA5 A;  1MDM A;  1J5Y A;  3MN2 A;  3CCE I;  2WB1 A;  1X1P A;  2MAB A;  4CYC B;  2KZV A;  3BQY A;  3BPX A;  3BOQ A;  4FT8 A;  1ZZC A;  2XUB A;  3BJ6 A;  1T56 A;  2KKO A;  1FYM A;  3FIW A;  1HDP A;  3HRS A;  1D8J A;  3OOP A;  2E71 A;  5LHG A;  5LEJ A;  4J00 A;  2R7Z J;  4A3L J;  2LYJ A;  4IVN A;  2X9D A;  2CV1 A;  1Z1D A;  2AO9 A;  3GTK J;  2V1D A;  4OIR F;  1ZQ3 P;  1LVA A;  3GTG J;  1WCM J;  3DV8 A;  2XF6 A;  2E2I J;  4UB8 C;  2ZXJ A;  4YIF A;  5J47 A;  3U3W A;  1YW9 A;  2M5W A;  1F5T A;  4IOA F;  1F36 A;  1VQN I;  3KZ3 A;  2ZNY A;  1WIZ A;  1T0F A;  2ECB A;  2M4K A;  2GM4 A;  1STZ A;  5FLX Z;  4DIQ A;  3V42 A;  3E6B A;  1VQO I;  3RKY A;  1PVE A;  1HCR A;  3AG3 H;  2IS2 A;  5F1R A;  2OQR A;  2M4H A;  2NAZ A;  3ERE D;  2OZU A;  1T39 A;  2WUS R;  1JXS A;  3VYU B;  2A5W A;  3OWT A;  1APL C;  2L1P A;  1B9M A;  4WX9 A;  4EV0 A;  1HA8 A;  4IHT A;  3OMY A;  4BE2 A;  4ZTF A;  2WAQ N;  4LG0 B;  2DN0 A;  3CMA I;  2Q8K A;  1BI3 A;  2L9R A;  2VB6 A;  2IU7 A;  2AS5 F;  3I59 A;  2K4B A;  5EF6 A;  3OYH A;  4IL6 C;  2R4G A;  5HS9 A;  3OIQ A;  4U0V A;  2L0K A;  1QZZ A;  1QQI A;  3QQ6 A;  1G4D A;  1BR4 A;  3A02 A;  4KJZ A;  4OMY A;  2DYS H;  4GHJ A;  1ETK A;  5LD2 C;  3QRF F;  3DM5 A;  3E6M A;  2FBH A;  2J7W A;  2NVX J;  1T2K A;  1FT9 A;  3R1F A;  2E1O A;  1WJD A;  3F8F A;  3H92 A;  2CUJ A;  1MD0 A;  3L2W A;  1MKM A;  2L02 A;  2DJI A;  1D1A A;  1VND A;  2LBF B;  2AXZ A;  4PZJ A;  2KRH A;  2A6T A;  3I55 I;  2Y0M A;  4QWQ A;  1VPW A;  2ESH A;  1ETO A;  3DTE A;  4YFK F;  1IJW C;  2FML A;  5E1X A;  2VC1 A;  4BQO A;  2CQ7 A;  2M9H A;  3VFZ A;  4WWC A;  1Z6T A;  4QPQ A;  3GFI A;  5DCF A;  2RDP A;  4RA2 A;  1SQ8 A;  3GLL A;  1KU2 A;  3ECO A;  1UZC A;  1K83 J;  3S3N A; 
#chains in the Genus database with same CATH homology
 2XCJ A;  1JTY A;  4IHY A;  2FQ4 A;  5JLX A;  4PU7 A;  3S1N J;  3TED A;  3LSG A;  2WV1 A;  4PU3 C;  1VI0 A;  3B6A A;  2TRT A;  1R69 A;  4MO7 A;  2ZB9 A;  2FJR A;  2B63 J;  2R63 A;  2ID3 A;  1CQT A;  1I6H J;  3HKZ N;  2GZU A;  3RZO J;  2ECC A;  4JX5 A;  4XRS G;  4C3H J;  3GTQ J;  1K61 A;  3BR2 A;  4MLO A;  4JX6 A;  1BW5 A;  2GRL A;  1BW6 A;  4C3J J;  1ADR A;  4M3G A;  5GPC A;  4X4I A;  1R9T J;  4GFB A;  2EBY A;  3BD1 A;  1ZVV A;  1HF0 A;  5DS9 A;  3JRC A;  2JA7 J;  1WGX A;  4A3E J;  5JLW A;  3JRD A;  5M5Y J;  1JT6 A;  5EZH A;  1A5J A;  1LCC A;  2NVY J;  5FLV A;  1R63 A;  4C3I J;  3GN5 A;  1LE8 A;  1X58 A;  1ETV A;  3O8H A;  2H1K A;  4IWR A;  5A7L A;  1U8B A;  1ETY A;  1JUP A;  2L7M P;  4RBO A;  1OCP A;  2KEI A;  4V2F A;  4A3I J;  3M3Y J;  2XGC A;  2LCV A;  5IP6 A;  1U9O A;  1MBF A;  1T33 A;  3QQA A;  1PRA A;  2IV1 A;  4X4G A;  3HB9 A;  3S1Q J;  5E3O A;  5FJ8 J;  5K98 B;  2VKV A;  1ZPQ A;  2CU7 A;  2DA1 A;  2H8R A;  2WIU B;  2FJ1 A;  2JK3 A;  4XRS A;  5EZG A;  4MFD A;  3ZHI A;  4Z5C A;  2PUB A;  1TC3 C;  3JXD L;  3QF3 A;  4UUS A;  2HOT A;  1BJZ A;  4HNV A;  2XGE A;  2K9N A;  1IV6 A;  4MFE A;  2AXU A;  4OB4 A;  2HYJ A;  1DWK A;  3JRG A;  1IG7 A;  1EFA A;  2BNN A;  3LSJ A;  5GP9 A;  4I6R A;  2IVQ A;  4JYK A;  2R1J L;  4Y42 A;  1UHS A;  2DJN A;  3ZQG A;  2IUO A;  3F52 A;  2CSF A;  1Q1V A;  3TRB A;  2E2J J;  1PRV A;  5EG0 B;  3HOW J;  3GTJ J;  3ZQL A;  3G5G A;  4YG7 B;  5EDN A;  1QVT A;  4X4D A;  2PUC A;  5FKN A;  2EH3 A;  1NK3 P;  1EF4 A;  1IUF A;  2PIJ A;  2L8N A;  1RKW A;  1LMB 3;  2WB1 N;  4B3A A;  4BBR J;  2EF8 A;  5C4J J;  1B72 B;  3OIO A;  4AC0 A;  4X4H A;  1TWF J;  2O7O A;  4X4E A;  2QCO A;  4JCX A;  3F51 A;  3SFI A;  2Y0S N;  5EGO A;  2B5A A;  1ETW A;  3G1L A;  3PM1 A;  4LOC A;  3S16 J;  1IDZ A;  2MEZ A;  1GV5 A;  3RZD J;  1HDD C;  3IH4 A;  1XWR A;  1WH7 A;  2LKX A;  3CEC A;  1CJG A;  1DU6 A;  4X4C A;  4A93 J;  3VPR A;  4BKX A;  3IVP A;  3WHB A;  1WET A;  4J1X A;  1PNR A;  2HXI A;  1WPK A;  3HOU J;  4PU8 A;  5EEA A;  4D7N A;  2ME6 A;  2NVQ J;  1NER A;  1JUM A;  3JRI A;  1B72 A;  1RES A;  3SJM A;  1ZZ6 A;  2KEK A;  2O4A A;  2XB5 A;  4X4B A;  2EZK A;  2Y2Z A;  3HEF A;  4AYB N;  5IPA A;  2KZ8 A;  4D5F A;  3G1O A;  2JA5 J;  1RET A;  2MW8 A;  1GVD A;  4B1R A;  3HBL A;  5FKO A;  4I6U A;  1LLI A;  4DW6 A;  1MBK A;  3MKL A;  5EYR A;  3GTO J;  3JRA A;  2COB A;  1BDI A;  4A69 C;  2LYS A;  3NAU A;  3ZOB A;  2XB0 X;  1RZR D;  2JCG A;  1ORK A;  5IP7 J;  5IYB J;  3B6C A;  3LIS A;  4DYC A;  2HOA A;  2DMN A;  1MBG A;  2LLK A;  5K7H A;  4A3F J;  3S1R J;  2LYR A;  1B0N A;  2LP0 A;  2MG4 A;  2EBI A;  2OR1 L;  4A3B J;  3OQM A;  3OQN A;  4D5C A;  2HQ5 A;  4XID A;  1D5Y A;  1FJL A;  4Z58 A;  2BNO A;  3OP9 A;  3BS3 A;  1RPW A;  2YUS A;  4DYR A;  3S2D J;  3HM5 A;  4J19 A;  2D5V A;  4YAR A;  3BG3 A;  4XRM A;  1YRN B;  1ETX A;  3RKQ A;  4BY1 J;  4A3M J;  2HIN A;  1JGG A;  3K7A J;  1LFU P;  2FX0 A;  2N8G A;  4YBA A;  1ENH A;  2XPV A;  2HI3 A;  4YG4 A;  1RR7 A;  1OSL A;  1Y9Q A;  2R5Y A;  1RZS A;  2CRO A;  3FIS A;  5BNG A;  2R93 J;  1YSE A;  5IP9 J;  2M2E A;  3BT9 A;  2KT0 A;  3KXA A;  2XJ3 A;  1Z77 A;  1I50 J;  2NVT J;  1JKR C;  1ZR2 A;  3GTP J;  2VKE A;  3FYM A;  3G7D A;  2PUF A;  3JRB A;  1ZTR A;  2CUF A;  5FKL A;  2E2H J;  1YRN A;  5J1Y A;  3LNQ A;  3S2H J;  1E3O C;  3TP0 A;  4UUS B;  5K7F A;  1RPE L;  2ICP A;  4DYQ A;  5IYC J;  5GPA A;  4JCY A;  2L7F P;  2EZH A;  3QYX A;  2AHQ A;  4C2M J;  2XRL A;  3DEW A;  2LK2 A;  5E3N A;  1UTX A;  5C4X J;  3TW7 A;  2LD5 A;  2Y9Y A;  2XGD A;  3E7L A;  3GBG A;  3I4N J;  1IDY A;  2XPU A;  4BY7 J;  1LE8 B;  4Y52 J;  2IVG A;  5F27 A;  1NK2 P;  1UXD A;  1O4X A;  1JH9 A;  4AUX A;  3BG5 A;  1XS9 A;  2EZL A;  4CYC A;  5F0F A;  2LYP A;  2JMW A;  2XI8 A;  3QPL A;  4EEF G;  1JJ6 C;  1VF9 A;  1ZZ8 A;  1AHD P;  1MSF C;  1F43 A;  4M3F A;  1TWG J;  3LSR A;  1MBE A;  4Z59 A;  1TWH J;  3D1N I;  4XIC A;  5K7Z A;  1B8I B;  4B4C A;  4M3D A;  2LR8 A;  4V2G A;  1ZR4 A;  1OCT C;  2GLO A;  1FTZ A;  3GBF A;  1JFT A;  2PUG A;  3CQZ J;  1IC8 A;  2W48 A;  1TWC J;  2EWT A;  2PMZ N;  5J1R A;  4FN3 A;  2OF7 A;  1P7J A;  1JJ8 C;  3IH2 A;  3W6V A;  2VUM J;  4M3E A;  3Q0W A;  3FYA A;  1OFC X;  1PUF B;  5E3M A;  1FIA A;  4XK4 A;  1Y1V J;  4DZJ A;  1H8A C;  1AKH A;  3HOZ J;  3BTC A;  3H0G J;  5FKK A;  3DNV B;  2DMP A;  4YG1 A;  5F1J A;  4FE7 A;  1OJL A;  2NS7 A;  2DA4 A;  2XPW A;  3OMT A;  4D7M A;  3H3V K;  3A03 A;  3B7H A;  3JRE A;  1FTT A;  2R5Z B;  1MBJ A;  2JN6 A;  1Y1W J;  5IOY A;  3HGG A;  1B8I A;  1ZS4 A;  3FK7 A;  4S0H B;  3IH3 A;  1GUU A;  2VI6 A;  5C3E J;  4M6V A;  3JR9 A;  2QF7 A;  1W0U A;  2LFB A;  4X4F A;  3LOC A;  3LFP A;  2K40 A;  2YS9 A;  3I4M J;  1S7E A;  1WH8 A;  1UG2 A;  1X2L A;  1PUF A;  3HOY J;  1NEQ A;  1U9N A;  3PO2 J;  3Q0U A;  4FE4 A;  5C44 J;  3SCF A;  4I8T A;  1ZZB A;  2DTZ A;  3BTL A;  3M4O J;  2KDZ A;  4G12 A;  2JJ7 A;  2DMU A;  2HSG A;  1NTC A;  2BJC A;  2A6C A;  1P7I A;  2X48 A;  3JXB C;  3BR3 A;  3DCF A;  4IEJ A;  2JVL A;  1DW9 A;  2L49 A;  2DMT A;  4J1W A;  2RAE A;  4I6T A;  3QPS A;  2K9Q A;  1ZZ7 A;  1A6I A;  2R0Q C;  2G0E A;  4QIW N;  3CLC A;  3C2B A;  5M3M J;  1QP7 A;  4BBS J;  3ZHM A;  1X2N A;  1PER L;  2LY9 A;  1ZZ9 A;  2L7Z A;  2FD5 A;  3S8Q A;  2Y9Z A;  2LYK A;  1JKP C;  2X6O A;  2Y31 A;  1HLV A;  3JRF A;  1W0T A;  4A3G J;  3FK6 A;  1SAN A;  3BTJ A;  3NAR A;  4RDU A;  1RIO A;  2K9S A;  3GTL J;  3EUS A;  3OQO A;  1ZGW A;  2CRG A;  5EGO B;  5F04 A;  2XSD C;  2O38 A;  1I3Q J;  3GTM J;  3FMY A;  1IRZ A;  4X1E A;  2VPR A;  1GDT A;  5DTD A;  1ZK8 A;  1U78 A;  3SDG A;  1X57 A;  1JUS A;  5HOD A;  4FBI A;  4W97 A;  3CDL A;  1VFC A;  2KEJ A;  3S1M J;  1POG A;  1GV2 A;  2M8G X;  1SFO J;  3SCH A;  4A3J J;  1RZR A;  5M5X J;  2DA3 A;  2ELK A;  2JA8 J;  5F08 A;  1XC5 A;  1QRY A;  3PO3 J;  3UKG A;  5J3L A;  4ABZ A;  2M0C A;  2R5Z A;  4IHX A;  3UFD A;  1DU0 A;  4FTH A;  2AXV A;  3HGY A;  2YU9 J;  2DA7 A;  2EZI A;  1QPZ A;  1LFB A;  2JWT A;  3S15 J;  3FKI J;  2Y30 A;  1AU7 A;  2PUA A;  4MCX A;  4I6Z A;  2LYL A;  2BNM A;  2OFY A;  3ZQF A;  4DZP A;  3BTI A;  3O9X A;  4JQD A;  1WH5 A;  1GT0 C;  4FCY A;  5J1U A;  2AUW A;  4Z5H A;  4MCT A;  4NDL A;  2ICT A;  3VK0 A;  2DMQ A;  3O8G A;  1MH3 A;  2HOS A;  2DA2 A;  3SCG A;  2PE5 A;  2NS8 A;  2CJJ A;  3GN5 B;  2XIU A;  3S17 J;  1POU A;  1FIP A;  2R92 J;  1JT0 A;  3JRH A;  2IAI A;  3TW6 A;  1ZKG A;  4Y7N J;  3G1M A;  1FEX A;  2GBY A;  4W1U A;  3MLF A;  2DA5 A;  2MSY A;  3MN2 A;  2MQK A;  2I10 A;  4CYC B;  3RQI A;  1BA5 A;  1RKT A;  3BQY A;  4A3K J;  4FIS A;  2ID6 A;  2CQQ A;  1ITY A;  3OOU A;  1ZZC A;  2OPT A;  3IV5 A;  1T56 A;  4A3D J;  5F0C A;  3FIW A;  1HDP A;  4A3L J;  1JWL A;  2R7Z J;  2LYJ A;  3BR6 A;  2X9D A;  2AO9 A;  3HOX J;  3GTK J;  1QQB A;  3BR1 A;  1ZQ3 P;  3GTG J;  1WCM J;  2E2I J;  3BR0 A;  4O8B A;  3BQZ A;  1MH4 A;  1XG1 A;  5M3F J;  3U3W A;  1F36 A;  3KZ3 A;  2PUE A;  3OSF A;  1WIZ A;  2ECB A;  2GM4 A;  3HZI B;  1AKH B;  4NDW A;  2M34 A;  2O8K A;  5F0H A;  1G2H A;  4X6A J;  1HCR A;  2E19 A;  4L5E A;  1TWA J;  2LVS A;  5EG0 A;  4IA8 A;  1MSE C;  3K2A A;  1WH6 A;  3CRO L;  2WUS R;  1JKO C;  4QTR A;  3CCY A;  1APL C;  1UXC A;  3MVP A;  2CQX A;  2WAQ N;  3L1P A;  1QP4 A;  2DN0 A;  2L9R A;  2IU7 A;  3A01 A;  1QQA A;  2LYQ A;  4PU4 C;  4A3C J;  5EF6 A;  2O49 A;  3BG9 A;  3OSG A;  4IVZ A;  3LSP A;  2NOG A;  3CMY A;  2IVB A;  5M5W J;  2CUE A;  4M3B A;  1HOM A;  1Z0X A;  2L0K A;  1L1M A;  3ZQC A;  3QQ6 A;  1QP0 A;  2PUD A;  3BR5 A;  3Q0V A;  5IYD J;  5FLM J;  2HDD A;  2JA6 J;  1QVU A;  4I76 A;  3A02 A;  1ZAY A;  1UMQ A;  4BXX J;  4GHJ A;  1ETK A;  3HOV J;  3WHC A;  1MBH A;  1BDH A;  4UUT A;  3F0C A;  4GQM A;  1JKQ C;  2DA6 A;  2NVX J;  4IHV A;  1BL0 A;  4MIM A;  3R1F A;  3ZKC A;  2E1O A;  2O9L A;  3Q3S A;  3ZQH A;  1Y7Y A;  2AW6 A;  2EQR A;  3A01 B;  2AWI A;  2PPX A;  4JP0 A;  2P81 A;  1MNM C;  1ETQ A;  3JXC L;  3KJX A;  1VND A;  2LTP A;  2AXZ A;  9ANT A;  5FKM A;  1JTX A;  2R5Y B;  3S14 J;  2IEK A;  1PRU A;  4JX4 A;  3TP3 A;  1X2M A;  1VPW A;  2IBD A;  1ETO A;  3HDD A;  2GRM A;  1IJW C;  3F6W A;  1IGN A;  1H89 C;  2ME0 A;  4QSH A;  3ZQI A;  2HXO A;  2KPJ A;  5E3L A;  1QPI A;  3H5T A;  3BDN A;  2M9H A;  5IOZ A;  1LQC A;  1WI3 A;  1LCD A;  4Z5D A;  2TCT A;  3QWG A;  1ZUG A;  4IHW A;  2MGQ A;  1SQ8 A;  4F8D A;  3PXP A;  1H88 C;  3RZZ A;  1JFS A;  1K83 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...