1GT0C

Crystal structure of a pou/hmg/dna ternary complex
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
155
structure length
137
Chain Sequence
b'PSDLEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMSKLKPLLEKWLNDAENLGLSRRRKKRTSIETNIRVALEKSFLENQKPTSEEITMIADQLNMEKEVIRVWFSNRRQKEKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*TP*TP*CP*TP*TP*TP*GP*TP*TP*TP* GP*GP*AP* TP*GP*CP*TP*A
publication title Crystal Structure of a POU/Hmg/DNA Ternary Complex Suggests Differential Assembly of Oct4 and Sox2 on Two Enhancers
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 46
structure length 137
sequence length 155
ec nomenclature
pdb deposition date 2002-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00046 Homeodomain Homeodomain
C PF00157 Pou Pou domain - N-terminal to homeobox domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1gt0C02
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 1gt0C01
1XC5A 3BG5A 5BNGA 1GDTA 1ZZ8A 4IVZA 2EZKA 3OOUA 2NVYJ 4M3FA 4MLOA 3FKIJ 2CQXA 3ZKCA 3BQYA 4GHJA 1JT6A 2L0KA 2B63J 1W0UA 2XGEA 4X4CA 1B8IB 1YRNB 2CRGA 1QVTA 2M0CA 2E2HJ 5IYBJ 3HGGA 1ZR4A 2EH3A 1JTYA 4XRSG 2R93J 1BA5A 4DYCA 1UXCA 3FYAA 1PUFA 2P81A 5J1UA 3BS3A 1B72B 2A6CA 2DA4A 3ZQHA 1R9TJ 3RZOJ 2IVQA 4J1XA 1DWKA 1WH8A 2L8NA 3F6WA 1JTXA 2VKEA 4BY7J 4B3AA 3SDGA 2CUFA 3LSRA 3QF3A 2L7FP 4Y42A 3Q0WA 2YU9J 3FYMA 1HOMA 4IA8A 3O8HA 4X4BA 3ZQFA 3LSJA 1RETA 1CQTA 1JKPC 2E19A 3QPSA 1JUMA 1X2NA 3S8QA 1NERA 1BDIA 4Z5CA 3JR9A 2DN0A 1MBGA 2BNNA 3FISA 1OFCX 3I4NJ 1MBEA 1JUSA 3RQIA 2LD5A 1F36A 2DMNA 1LQCA 2GRMA 2R92J 2M8GX 2ECBA 3W6VA 3SCFA 3JXBC 2KEJA 4OB4A 2NVTJ 1ORKA 1VF9A 2R5ZA 4BXXJ 2Y9ZA 3S1NJ 4A3MJ 3BR0A 2GBYA 4JYKA 2FJRA 4PU7A 4BBRJ 4XRMA 5FKMA 3HOWJ 1OSLA 2LTPA 1BW6A 5IYCJ 4EEFG 5HODA 4DYQA 1SFOJ 1LMB3 3IV5A 1H8AC 1LCCA 2G0EA 2OR1L 3G1LA 3F0CA 2XPUA 3S15J 3BTLA 2LKXA 2RAEA 1H89C 3QYXA 2GZUA 1MSEC 4A93J 2KT0A 4V2GA 1ETXA 3PM1A 4M3GA 1PUFB 3NARA 1IGNA 3BG9A 4UUTA 1T33A 3H5TA 2XGDA 3IVPA 2PUBA 3JRCA 4YG4A 1RZSA 3RZZA 1X57A 4F8DA 3JREA 4MIMA 1WGXA 1MBKA 1JH9A 1ZTRA 2CUEA 5E3OA 1Q1VA 4XICA 3JXDL 5E3MA 3DNVB 4M6VA 4RBOA 2E2IJ 2DMUA 4D7NA 1BDHA 5K98B 2LYRA 3UKGA 5GP9A 1IUFA 5FKOA 3SJMA 3BDNA 3BTIA 5IP7J 1ZKGA 2XGCA 2PE5A 2YS9A 3G1MA 2DMPA 1MH4A 1RESA 2ZB9A 4PU3C 3GTJJ 2XCJA 4A3KJ 1Z0XA 2COBA 2X6OA 4XK4A 3TW7A 4X1EA 2TCTA 2X48A 4DW6A 3LISA 2YUSA 2Y31A 2AO9A 2IAIA 2QCOA 1XG1A 2M34A 2NVXJ 2IVBA 2BNOA 1IDZA 2PUDA 3BTJA 1JFTA 5M3MJ 3S1RJ 1QQBA 2OF7A 1CJGA 3PO2J 1LE8A 4A3BJ 2DA2A 3JRHA 2VPRA 2OFYA 3S1QJ 4Z5DA 3A02A 2MQKA 5M5XJ 2CSFA 3HB9A 4Y7NJ 4IHVA 4Z58A 3ZQIA 1WETA 5FKLA 1JKRC 5M5WJ 4PU8A 1UG2A 1DU6A 2HSGA 4QTRA 1WI3A 2HOTA 5EG0A 1UMQA 1JJ8C 1MNMC 1GUUA 2Y9YA 5F0HA 3HOXJ 2R1JL 2M2EA 1DW9A 2L7MP 5EZGA 1D5YA 1JKOC 2XJ3A 2PUCA 3HEFA 5C4JJ 2ME0A 4A69C 1WH5A 2EWTA 3U3WA 1VPWA 1I3QJ 3HM5A 4A3CJ 1MBFA 3WHBA 2EBYA 5K7HA 4W1UA 3B6CA 3FIWA 1XS9A 1O4XA 1MSFC 2W48A 1OCPA 5FJ8J 2GRLA 5F27A 2O9LA 3LSPA 5E3NA 2IU7A 3OIOA 2E1OA 2K9NA 3A03A 2XPVA 1LFUP 3CQZJ 1UTXA 2IEKA 2LK2A 1RIOA 4B1RA 2JK3A 2XB5A 2LP0A 4V2FA 2AXZA 2JVLA 3H3VK 3S2DJ 3S16J 2HINA 3BD1A 3KJXA 5EYRA 1APLC 3HOUJ 1F43A 3CDLA 1POGA 2K9QA 1VNDA 2MSYA 4FE4A 3B7HA 3QWGA 2EZHA 1QVUA 3DCFA 4I76A 4M3DA 1U78A 4YARA 2FD5A 3IH3A 3ZHIA 1QRYA 4D5FA 1NK2P 1SQ8A 1UXDA 5F0CA 1LE8B 1RR7A 2WAQN 4BBSJ 4AC0A 1ZZ7A 2CU7A 2GM4A 2XSDC 1ENHA 2IV1A 1ZZCA 4G12A 5K7ZA 4A3FJ 5J3LA 3KZ3A 3S2HJ 2LYKA 1PRAA 1X58A 5EG0B 1QQAA 1LFBA 1K83J 1TC3C 3GTQJ 3FMYA 4I6UA 2PIJA 1WCMJ 2GLOA 3OQMA 4C3JJ 2JA8J 1GV5A 4YG7B 1RKWA 3GTPJ 2IVGA 1ETQA 1FTZA 3GTOJ 2AXUA 1ZVVA 1E3OC 4X6AJ 1WH7A 3ZQGA 5EF6A 4A3JJ 1IJWC 1Z77A 4W97A 2D5VA 1FIPA 1X2MA 3O9XA 2PMZN 4BKXA 2ID6A 4C3HJ 3PXPA 2K9SA 1WPKA 3QQAA 2O49A 3SCHA 4MFEA 1JT0A 2HQ5A 5IP6A 2MGQA 2Y30A 1QPIA 5F08A 1R63A 1AKHA 3R1FA 2JN6A 1WH6A 1ZZ6A 1L1MA 5FLMJ 3CROL 4FTHA 2EQRA 5FLVA 2O7OA 4FISA 2PUEA 2HOSA 3K7AJ 2OPTA 5JLXA 3HOYJ 1JJ6C 5JLWA 3D1NI 2EZLA 2JWTA 3S17J 2VI6A 1A6IA 5DS9A 1JKQC 4AYBN 2BJCA 2BNMA 3IH4A 2AW6A 4FE7A 4BY1J 2IBDA 2LFBA 3ZOBA 3JRAA 4I6ZA 5IOYA 3JRBA 1ZS4A 3BR5A 2KZ8A 3LFPA 3CLCA 1TWHJ 3RKQA 1AU7A 4IHXA 3GBGA 5FKKA 2CQQA 3GTGJ 3M3YJ 4JQDA 1JGGA 3OQNA 2O4AA 2EBIA 2L9RA 4C3IJ 5GPAA 3KXAA 2HXOA 3H0GJ 3Q0VA 1AHDP 2R5ZB 4MCTA 1IDYA 5IPAA 4J19A 1FEXA 4O8BA 4X4HA 4IHYA 3HOVJ 1B0NA 1HF0A 3G5GA 3ZQLA 2WUSR 2ID3A 4JP0A 2KDZA 2JCGA 5EEAA 1NK3P 1BW5A 2B5AA 2EF8A 2AXVA 1PRVA 3ZQCA 1HCRA 3CECA 3G7DA 5IP9J 3JRIA 2ICTA 3RZDJ 1P7JA 1TWCJ 2JA6J 1ZZ9A 2R63A 2PUFA 2K40A 4UUSA 3BT9A 1RPEL 1T56A 2HXIA 4QSHA 4AUXA 3OP9A 4I6TA 1OJLA 5E3LA 1I50J 4DYRA 3E7LA 4PU4C 1AKHB 2XRLA 2KEKA 1R69A 2LR8A 4JCYA 2R5YA 2KEIA 4JX4A 2Y0SN 2LYQA 2FJ1A 3GN5A 4Y52J 3HGYA 3O8GA 1ZK8A 1A5JA 3CCYA 2M9HA 3Q3SA 1ZR2A 1VI0A 3BQZA 4A3IJ 2E2JJ 4NDWA 2HOAA 2CROA 4JX6A 3L1PA 1ZAYA 1PRUA 5C3EJ 1K61A 1EF4A 3HDDA 3ZHMA 4X4DA 4A3GJ 1IRZA 2DMTA 4X4GA 4GFBA 2WIUB 4X4EA 4A3DJ 2DTZA 1ZQ3P 2LCVA 1LLIA 1TWGJ 2HYJA 3F52A 1SANA 3DEWA 3JRFA 4ABZA 1MH3A 4DZPA 4B4CA 4A3LJ 5K7FA 2CJJA 3TRBA 2Y2ZA 4NDLA 3GTKJ 3CMYA 4MFDA 1JWLA 4X4IA 1RPWA 4LOCA 3OSFA 2DA6A 2AUWA 3I4MJ 1RKTA 1POUA 2H8RA 2FQ4A 1MBHA 1Y1WJ 2LYSA 1XWRA 1Y9QA 1BL0A 1U9OA 1U8BA 3VPRA 3B6AA 3BR1A 3TP0A 5F1JA 4UUSB 3MVPA 1X2LA 4J1WA 2FX0A 5FKNA 2ME6A 2LVSA 4D5CA 4FCYA 3VK0A 4S0HB 3UFDA 2MEZA 2PUAA 1FJLA 2NS8A 1QP7A 4IWRA 3GTLJ 2R5YB 4I6RA 3GN5B 4YBAA 4Z59A 2XB0X 1ETYA 5F0FA 2ICPA 3WHCA 4CYCA 5GPCA 1MBJA 3OMTA 2KPJA 4JCXA 3FK6A 1QP0A 3BR6A 1DU0A 2AHQA 4FN3A 2VUMJ 2X9DA 1HLVA 1OCTC 5J1RA 1ZUGA 2LYJA 2XPWA 3MKLA 5IYDJ 3SFIA 4M3EA 3LNQA 2WV1A 2JA5J 1TWFJ 4C2MJ 4I8TA 3BR2A 1ETKA 3MN2A 5EGOA 2DA7A 3HZIB 1NTCA 2DJNA 1ZGWA 2LYPA 1TWAJ 2I10A 1VFCA 5C4XJ 4IEJA 3K2AA 1G2HA 3NAUA 2AWIA 3EUSA 1WIZA 1RZRD 1ADRA 9ANTA 2N8GA 1ETOA 1IC8A 4X4FA 2R0QC 1GVDA 5EZHA 4IHWA 4MCXA 2JMWA 1ZPQA 1H88C 3GBFA 2XI8A 4HNVA 1JUPA 3C2BA 3A01A 2DA1A 2ECCA 5J1YA 1ETWA 1NEQA 3HOZJ 2ELKA 3S1MJ 4Z5HA 1JFSA 1IV6A 3HKZN 3MLFA 1YSEA 2NS7A 2LY9A 1UHSA 3BR3A 1BJZA 2L7ZA 1PERL 1B8IA 3HBLA 4DZJA 2DA5A 1YRNA 1EFAA 3F51A 3OQOA 4QIWN 1QP4A 3QPLA 4L5EA 2PPXA 2HI3A 3OSGA 1RZRA 5C44J 4JX5A 2H1KA 1ITYA 3QQ6A 3BTCA 2LLKA 3LSGA 3LOCA 2MW8A 5M5YJ 1B72A 1W0TA 3GTMJ 3S14J 1GT0C 1FIAA 2L49A 5DTDA 4CYCB 1Y7YA 3Q0UA 1Y1VJ 1ETVA 2DA3A 1PNRA 3TW6A 2DMQA 3IH2A 3JRGA 2PUGA 2VKVA 1IG7A 2NOGA 2O8KA 2XIUA 2WB1N 1U9NA 4M3BA 4D7MA 5IOZA 2EZIA 5F04A 5EGOB 2JA7J 2JJ7A 4RDUA 3FK7A 4XIDA 1S7EA 2LYLA 3TP3A 1FTTA 4XRSA 3PO3J 5EDNA 5M3FJ 4GQMA 1QPZA 1HDPA 1HDDC 1ZZBA 2HDDA 3SCGA 2TRTA 2QF7A 4A3EJ 3TEDA 3M4OJ 3BG3A 1I6HJ 3JXCL 3JRDA 5A7LA 2MG4A 1GV2A 2NVQJ 2IUOA 4YG1A 3G1OA 4FBIA 1LCDA 2R7ZJ 1P7IA 2O38A 3A01B 4MO7A
chains in the Genus database with same CATH superfamily
1V5GA 2QEXI 1ZZ8A 3U1DA 3RI4A 3ZKCA 1D0YA 3BQYA 2A05A 2GIVA 2WB1A 2KRFA 1KU7A 4X4CA 2A3SA 2CRGA 2ODRD 2L4MA 3HGGA 5IYBJ 1YG2A 3OYEA 3CUOA 3W2WA 2DODA 4HOBA 1FLIA 4OWRB 1UJ8A 1BA5A 3TO7A 4RM3A 1UXCA 3I0TA 3CCJI 5J1UA 1YTYA 3Q9SA 2VE9A 4EGYA 1R9TJ 1G3TA 2IVQA 3LSKA 3DBHB 3F6WA 4BY7J 4B3AA 1R49A 3M1EA 4X4BA 2DCEA 1HW5A 3O8HA 2CG4A 2FA5A 1LDJA 3KYCB 1BM9A 1JKPC 3QPSA 1W5TA 2MXDA 3MEXA 1P4AA 5D5UB 3QU6A 3JR9A 2HWVA 3ABMH 3SZTA 1I1GA 1OFCX 2G9WA 1OR7A 4U87A 5KAIC 4ER7A 2LNMA 1LQCA 5KHDA 4OIOF 2ECBA 3HYIA 3OOPA 4LLLA 4II2A 2KEJA 3PUBA 1ORKA 1VF9A 2Y9ZA 4A3MJ 3DLAA 1VZ0A 4PK4A 2GBYA 2ZFUA 1TP4A 2ZNYA 4M9SA 3GVAA 3T8RA 3HOWJ 2VC0A 1OSLA 5IYCJ 1FSHA 2L01A 2HZDA 3HG9A 3K70C 5LBQA 1H8AC 1FPQA 1ZLJA 5ILUA 2OR1L 2XPUA 4XLCA 3PFIA 4GCVA 3K1MA 1H89C 1MFQC 1MSEC 4M72A 1ETXA 3PM1A 3ZQ7A 1PUFB 3NARA 5DD8A 4UUTA 1WRJA 5L3DA 3H5TA 3JRCA 4H4KC 3E5UA 4A0XA 4AIHA 3RZZA 3KZZA 5DV5A 4F8DA 1T8IA 2VQGA 3JREA 2EFWA 2GXBA 5E3OA 3JXDL 2A69F 3E97A 2IGOA 4D7NA 1OYIA 3CCVI 3P5JA 5K5OA 2JUGA 3UKGA 5GP9A 2OCCH 1PUEE 2NXNB 4EATA 4CH7A 5IP7J 2DT6A 2PE5A 4OINF 3G1MA 2DMPA 2LDUA 2NOJB 2ZB9A 2Y75A 1LNWA 3S3MA 3ZR8X 2COBA 2CSOA 2P5LC 3MZYA 3B02A 2YUSA 2Y31A 2AO9A 1TW2A 2W57A 2M34A 5DM7F 1F9NA 2IVBA 1A04A 2EFPA 1JFTA 2PXPA 1LDKB 2YU3A 5JVTA 1JE8A 5FO5A 3TDUC 3PO2J 5DM6F 2F5CA 2PXKA 3LA7A 1OLTA 2DFFA 2XAJA 4E7ZA 3E5XA 2ZFWA 4NUBA 1IV8A 3S1QJ 4AU7A 1V4RA 2EV5A 4IHVA 3AL0C 1WETA 5FKLA 2PI0A 2BVMA 1JKRC 2ZMEA 4EQQA 1DU6A 4QTRA 5DCFA 1WI3A 2HOTA 4LB5A 2RQQA 3DKWA 1YW8A 1YIJI 3UNGC 1P4XA 4AVPA 3V7CA 3WE3A 2PXDA 3HOXJ 1XGOA 2M2EA 2VE8A 2IPQX 1QGPA 5EZGA 3HEFA 2HTSA 5EJCA 2EWTA 1U6GA 3H35A 3WHBA 3GFIA 5K7HA 2R7WA 3CCMI 3VEPA 3H3ZA 4XN0A 3DFGA 3ME5A 4IO9F 3FIWA 3DP7A 1OCPA 4EKIA 1IW7F 5F27A 2O9LA 5E3NA 4NQWB 3TMOA 3CCUI 3I3LA 3I4PA 1XB4A 5LGTA 2GXAA 3CLQA 1UTXA 1OKRA 2LK2A 4PSXA 1RIOA 4RLFA 2LP0A 3S16J 1D3YA 3HOUJ 3W6KB 2K9QA 1VNDA 1VQ5I 3KZIC 4ER5A 2LBFB 2QYOA 1U5TC 2PXFA 1PYVA 1AA7A 2IGMA 2DFIA 3JSOA 5EEHA 3CCQI 1FBSA 1UG0A 1NK2P 3C1DA 1UXDA 3DTIA 4BE1A 3I56I 3E6BA 4GGGA 2VQHA 1VQ8I 1ZZ7A 4HNTA 4IZZA 3MZ8A 1ZHFA 1ZZCA 1Z9CA 1MDMB 3FF5A 4A0YA 1DP7P 5K7ZA 4A3FJ 1WZ2A 2MD0A 1VQ4I 5B5EC 2O03A 3GYHX 2LLWA 1QQAA 1K83J 1J0RA 1O7FA 3GTQJ 2ZBKA 4RA2A 3FMYA 3H9JA 1WCMJ 2MABA 1CGPA 4ENNA 2JVGA 3K10A 3HTSB 2IVGA 3QOEA 1ETQA 1FTZA 1OPCA 3W3CA 3GTOJ 2V1NA 4C2TA 1Y8RB 1G8XA 3NWSA 4XORA 4A6DA 3WTZA 4ZYHA 4IXAA 3QYEA 2DQLA 3BG7A 2G7UA 3FXQA 4W97A 1T0FA 1GXPA 1GVJA 1QZEA 4HSTA 3D5SC 1Z21A 2ID6A 2KIMA 4I01A 5ICGA 4L0ZB 3PXPA 1R00A 3QQAA 2R3SA 2HQ5A 2R7SA 5IP6A 2HDWA 2COMA 1QPIA 5F08A 3D5LA 2H6BA 1AKHA 2HVRA 4ZYDA 3E3VA 1IAWA 2DO7A 4MEXF 3K7AJ 2OPTA 1TQIA 4ENKA 4DIQA 1FMVA 5JLWA 2EZLA 4YIRX 2F4IA 2A68F 1A6IA 4AYBN 3TL4X 2BNMA 3AFHA 3CCLI 3P9KA 1BBYA 4FE7A 1Y0UA 4BE2A 4UNOA 3DPTA 2P7CB 2BY0A 4J00A 5LLQA 3G71I 4I6ZA 4PSWA 3WG7H 2KZ8A 4Q2JA 1YIOA 1H0MA 4KFCA 4XBFA 1ZGJA 2P5VA 2PMUA 4IHXA 3RKQA 4DOZA 3GBGA 5FKKA 1S8NA 2BOLA 5FRNA 4CZZA 1NG7A 3GTGJ 3GEZA 4FQGA 5CQGA 3VOEA 2O4AA 2HXOA 4ENJA 3Q0VA 3MKYB 3DKYA 3PNVA 5IPAA 1I5ZA 1FEXA 4X4HA 2CUJA 4XKCA 1KONA 2IS2A 3IWFA 3ZQLA 2QWWA 3LSIA 5EEAA 3HJEA 1NK3P 5D4SA 2IGKA 4CSWA 1BW5A 3F72A 4RS8A 1SAUA 2M7AA 4LK0F 4AYBA 2NNYA 5IP9J 2ICTA 1TWCJ 1K7AA 2PUFA 2EINH 5DCMA 4L9VA 2NAZA 2DLLA 3F3XA 1RPEL 2V6CA 3S3OA 4KICA 1ODDA 1DPUA 2E35A 2P7VB 4I6TA 3GFLA 5E3LA 1I50J 4DYRA 3W2VA 1P92A 2FUG2 4MTDA 2DQRA 5JHUA 5LEKA 1M1EB 2IVMA 2R5YA 4A12A 3NRVA 3MEJA 3NZLA 3VB2A 2FEZA 3HUGA 4R79A 2LYQA 3GN5A 4KNYA 3OMYA 1MNDA 3H36A 1ZG1A 1KU2A 3BPVA 2M9HA 3Q3SA 3E5QA 2E2JJ 2FMLA 3QYBA 4B47A 4CUGA 1P9QC 3DTEA 5D6EA 5GAHi 5LFAA 5C3EJ 2Q2EA 3KP3A 1K61A 2KZGA 3TDZC 3HDDA 2QKLB 5D8LB 4AVZA 2JQEA 4RGRA 3NXHA 4X4DA 1HKTA 4X4EA 2GXGA 2PXQA 2HOEA 2X6YA 3KIOA 3LSHA 2KRHA 2VBWA 2LYCA 2JTVA 1G4DA 5JFRA 3CJNA 2VQLA 3BCAA 1MW7A 1X19A 2XAHA 4XLHA 4IOAF 2JRTA 2J7WA 2AQFA 4XLNF 2IA2A 2WA0A 1Z3YA 3MCZA 5IT3A 2PLYA 1TW3A 4X0GA 3I71A 3QFIA 3K2ZA 1RUOA 2W25A 1RPWA 2CW0F 3VYRB 4RGUA 2KDOA 3M8JA 1RKTA 2CQ7A 2E5ZA 5BQTA 1N25A 3ZGKA 3DWLE 3GWZA 2LYSA 3RTRA 4L0YB 4PJNA 4JBAA 2LOOA 2OU2A 1SD5A 3M8EA 1O3RA 4IX7A 2RN7A 1PVEA 3RDIA 5DYMA 3FXLA 2JA2A 4CCJA 1U8BA 4F7ZA 3B6AA 4XR6A 4UUSB 3WTTC 2DFHA 2LVSA 1R36A 3BZ6A 3HIFA 5FFZA 4RB1A 1UFMA 3VK0A 2MEZA 4C9YA 1XSVA 2DT5A 2ZMEC 1ON1A 4JK1X 2M8EA 3W6JB 2VOOA 2HU9A 2R7OA 4Z59A 2EWNA 4ESJA 1FYLA 3IAS2 1ETYA 3WHCA 1IN5A 2YX4A 3CJTB 2VUMJ 2X9DA 1OCTC 4P96A 4PGHA 2PJRA 1ZARA 1HKQA 1TT5B 2V6EA 3L2QA 2D1VA 3BR2A 3MN2A 2XHKA 2DA7A 1UCRA 2Q0OA 3ERMA 3BJAA 1ZGWA 1VFCA 4U0VA 3NROA 2HNHA 2EFQA 2K3PA 1P4WA 4AWXB 1HBXG 2OA4A 2BHYA 2FOWA 3FXMA 2ISYA 9ANTA 2EV6A 1RIOH 1IC8A 2L54A 1XDUA 4X4FA 3ABLH 5HOOA 1X3UA 3C18A 1T95A 1YFHA 1H88C 2ZXHA 3GBFA 2PXBA 2XI8A 2LREA 3CD6I 3C2BA 2GOMA 3OS1A 2DA1A 2ECCA 2DK5A 1REPC 3V42A 4Z5HA 2FNPA 1JFSA 2DU9A 2M3AA 3BR3A 2K9LA 1W4MA 4YELA 1BC7C 2XF6A 4B8XA 3FHNA 4KJZA 1YO5C 3KYDB 4IJAA 5FROA 5FLXZ 4ENMA 4L5EA 2PPXA 2HR3A 3OSGA 4A0ZA 1YJNI 2QM3A 3CCSI 5C44J 4GYIA 2H1KA 2HGCA 3BTCA 3LSGA 4QWQA 3CC2I 1W0TA 4HSRA 2Z3YA 2E1MC 3GZ5A 5E8IA 1IUYA 1OCRH 3DBRB 1AOYA 2FF4A 4PGGA 1Y7YA 3Q0UA 2XAGA 1ETVA 3TW6A 4BQOA 4BXFA 4E7SA 3IH2A 2HVSA 1S7OA 2ZJRF 3L2VA 3GLLA 1UB9A 4LLGF 2VKVA 5CPRB 2PUGA 2O8KA 2NOGA 3T1BA 2XIUA 5FD6A 2B0LA 5LHIA 1LEBA 3IL2A 2EZIA 3TEPA 4HAMA 3OYFA 1ZLKA 5EGOB 1QPMA 3FK7A 1D5YA 2RNJA 3G2BA 1T0FC 3GXOA 5J6XA 3TP3A 3PO3J 4GQMA 2IA1A 3QOXA 4UUVA 2VJ4A 1HDDC 2ESHA 2PXEA 2HDDA 4PJJA 4OAYA 1VQ7I 1W5SA 1S7AA 4XLPF 3QYFA 2STWA 4I7HA 4YIIA 5FGMA 3ZN1A 3JRDA 2JVHA 2EJRA 3JAMZ 1GV2A 2NVQJ 2XSJC 3P9IA 4FBIA 2R7ZJ 4S04A 2O38A 3A01B 4IHTA 1VQNI 1GDTA 4IVZA 1IRXA 2Y48A 3VYTB 2JUCA 4M3FA 4MLOA 2Y0MA 2CQXA 4GHJA 3IKVA 2DOEA 2CGPA 2B63J 5E79C 5LD2C 1B8IB 1YRNB 2M0CA 2HFZA 1NHAA 4CZCA 3FBIB 1JTYA 4Z6YA 3FYAA 2LRDA 1PUFA 4HX7A 3BS3A 2A6CA 3DU5A 5AIQA 1BR1A 4J1XA 1Z3XA 2XXPA 2YPRA 2MC3A 2L8NA 1JTXA 1EH7A 3ASNH 1QU3A 2VKEA 4CGZA 1QNTA 3LSRA 2Z33A 3Q0WA 2YU9J 4IA8A 1X4OA 1RETA 4MQVA 4UVAA 3S8QA 1FY7A 1NERA 4EKGA 3ECOA 4I02A 3QOWA 1N78A 2PXVA 3QPHA 1SVMA 3I4NJ 4HPQA 1MBEA 3RQIA 2H94A 3HUGB 2LD5A 3HOTA 1A36A 2DMNA 2JSPA 3I53A 4KYWA 2GRMA 2O0YA 2R92J 3DQVC 2M8GX 3RIRA 3FZVA 4AIKA 4ZDPA 2OV7A 3W6VA 2L9SA 4OB4A 3V4GA 3FX3A 2R5ZA 4BXXJ 2Q2EB 2ZJ2A 2KLOA 2MBFA 3TKYA 4PU7A 4IRIA 1MMSA 4UB8C 1I1SA 5FKMA 2QENA 5DSXA 2LTPA 5CLSA 4EEFG 1HSTA 3RKXA 1MJAA 3ELKA 4OAZA 4NC7A 2QQAA 4AM3A 2VASA 3F8FA 4KMUX 1HKSA 2IS4A 2HEOA 2QBYB 3S15J 2LKXA 2L02A 3MQ0A 3SR4A 4V2GA 4M3GA 1SMTA 3F22A 3BG9A 3IVPA 4Y33A 3JAMK 2XASA 3BZCA 1MD0A 2ZJQF 2NVUB 3CJRB 3DM5A 3DNVB 4XICA 4IVNA 2V26A 4UVCA 2DJIA 2DMUA 1BDHA 4NQWA 2FQ3A 3OYAA 2LYRA 4ZYAA 5CQEA 3BDNA 2K86A 3BTIA 1WVRA 4GO1A 1YLFA 3P7NA 3ZPXA 1MH4A 2ADUA 3IRRA 3R4KA 4IHSA 4DNCA 1KQ9A 2VB6A 2XCJA 1Z0XA 4XK4A 5HLHA 4CICA 2LBFA 4X1EA 1G3YA 1XG1A 2NVXJ 3SFZA 3VFZA 4BQAA 2O8XA 5BPIA 3F8NA 2OF7A 1QQBA 2EILH 3VYUB 1NW3A 3IAM2 4EJVA 2DA2A 3HRMA 3WE2A 2F4MB 2MQKA 2IP2A 4HRAA 2QQ8A 1W7PB 3HB9A 5AIPA 2O6GE 1SFXA 4YEJA 1MDMA 1BI2A 3OYKA 3R61A 2M4GA 1UG2A 3BROA 2CQNA 1BIBA 2KL4A 1XGSA 4ZC3A 3CP2A 2VONA 1X1DA 2X0LA 5F0HA 2EB7A 1LUJB 1RC9A 3HC7A 2OD5A 2L4AA 3I9V2 4Q48A 5K5RA 5C4JJ 1TLHB 2ME0A 4A69C 1IRGA 1VPWA 2ZSIB 1I3QJ 3HM5A 5DTMA 2CO5A 1FX7A 2CQKA 2V9VA 4UHTA 1Z67A 2VKHA 2J5OA 3B6CA 5FJ8J 5FFXA 3GZNB 3LSPA 1HQ1A 2ACJA 2IU7A 3QAHA 2K9NA 3CESA 3HXLA 3CQZJ 2VXZA 3CZ6A 4V2FA 5LRSA 5K1YA 3F52A 3TO6A 5EYRA 1LVKA 1KZHA 1APLC 1POGA 4FE4A 3BY6A 5E1ZB 3KYLA 3CDIA 1ZG5A 2JQ7A 5TRDA 1QVUA 2Y69H 3MKZA 4I76A 4OIQF 1I3AA 4M3DA 1U78A 3IH3A 1VQMI 1OCCH 4LIUA 2M87A 1GHCA 1SQ8A 1JHHA 1LE8B 2WAQN 1BI0A 1R6RA 5TGTA 4AC0A 3J7YJ 4ZYGA 3V7RA 2XSDC 5DUIA 5E1WA 3U21A 1J75A 5L3CA 4G12A 2DYRH 1T98A 4HW0A 3LA2A 3S2HJ 4EZIA 3A0HC 3LQXA 1X58A 5EG0B 3DTKA 1LFBA 2MLKA 5L3EA 1YHQI 3SXYA 3G6EI 2HTJA 5TISC 3F23A 1TC3C 2GLOA 3OQMA 4ZTFA 1GV5A 4F91B 1T39A 3FMQA 1D5VA 2YR2A 2D1HA 4B48A 1W1WE 4P9FA 3M1CA 1SFKA 4X6AJ 1WJBA 1XMAA 3GFMA 3GO5A 3OIQA 4XSXF 4CA0A 4UXNA 1MMGA 2W1OA 4UY8I 2XVCA 2WAQA 4LJZF 5ERIA 1G3SA 4BKXA 2VT3A 4HEA2 3L09A 4G7ZF 1KQ0A 2FXAA 2O49A 3A9YA 1QHHD 5EEGA 1G59A 1S5LC 2EV0A 1R63A 1A31A 3K4JA 3R1FA 1WH6A 1VQLI 4CCLA 3SEZA 1L1MA 2GWRA 2K02A 2NRAC 1A35A 5FLVA 2PUEA 2HOSA 4P1WA 2OQRA 3EDPA 1IN4A 5JLXA 2DPDA 4U7DA 1FWZA 2JWTA 4BS9A 3S17J 2R7UA 2WAFA 4XNFA 2GAUA 3FBNB 1JKQC 1XN7A 4HLXA 5HVQC 4QPQA 1X1AA 2B7EA 3LAPA 5KK1A 4EJUA 5IOYA 3JRBA 3BR5A 3N4MA 3BLYA 1HQCA 3GCMA 3LFPA 2RREA 3AG1H 3LSTA 1AU7A 2CQQA 4BU2A 2MA3A 2EBIA 4C3IJ 1FYKA 2FBIA 1TT0A 5GPAA 2R5ZB 3OYBA 2XUBA 3LFUA 5F6FA 4BACA 4J19A 4O8BA 1V5FA 5DRTA 1KGSA 1OMIA 1B0NA 5LGUA 1QA6A 2KDZA 1MMAA 1JGSA 3DEUA 1MNEA 3WU2C 2EA2A 3OL3A 1FOKA 2FU4A 2AXVA 3OYHA 2H8WA 3G7DA 2LY2A 3RZDJ 1NH3A 5FD5A 2K40A 4ZJZA 1XD7A 4UUSA 1X4PA 2RVCA 2OBPA 4I99C 2ZXWH 4LFUA 3RCOA 3E6CC 3OP9A 1OJLA 2FSWA 2EK5A 2P8TA 1KYZA 2LY1A 2PG4A 1DGRM 3ZMTA 2XRLA 4BGDA 3I54A 2L2OA 2YBDA 3FMRA 2KEIA 1R23A 4FX4A 2Y0SN 2KRCA 4E7IA 5BMZA 4Y52J 3O8GA 3CP8A 1ZK8A 3ZPLA 1BC8C 1ZR2A 3BQZA 5F64A 3GZ6A 3KL4A 2ZCWA 4XLAA 1ZAYA 3I59B 3SZGA 3JTGA 1DUXC 2DDBA 2A6TA 3KX2A 5KNLA 4A3GJ 4KIFA 4RGSA 1IRZA 3BG6A 3AG4H 4GFBA 2WIUB 2OTJI 2DTZA 1ZQ3P 2KIQA 1LLIA 1USSA 3OL4A 1BI3A 2P6TA 3WTYC 1Q1HA 1TWGJ 3PL8A 1EV7A 5CVIA 3OYGA 1Z6RA 4P5OA 2UV1A 1IZ1A 3R0AA 1T2KA 1B1BA 3MWMA 4ZDLA 5E18F 3J7AY 2NS0A 5K7FA 3ZN0A 3GZDC 1SVOA 3TRBA 2LC2A 4PDKA 3CMYA 1X3ZB 2Y0SA 4X4IA 4BQNA 3OSFA 4F3QA 1MBHA 2ZSHB 1OCOH 1IN7A 4XONA 1MMNA 5KAFC 3LFKA 3F9KA 3MVPA 3MAJA 3WODF 5BS6A 1BN5A 1X3WB 1XMXA 1I39A 4IF4A 1WI9A 5ICFA 2QQ9A 2C6YA 2NS8A 1QP7A 5J47A 3GTLJ 1DDNA 4NBQA 3TELA 3K0LA 4I6RA 1TBXA 1IF1A 3AKZA 4AD9A 4YBAA 2XB0X 4RM2A 1GLNA 5F0FA 3OMTA 3CUQB 1FOXA 2KPJA 3BR6A 1DU0A 1T38A 5GTHC 2Q1ZB 4FN3A 1BJAA 2BXZA 3RJPA 4CCMA 1ZUGA 2LYJA 3LQRA 2OC6A 3RQ4A 3LNQA 3FXOA 3I64A 1TWFJ 4C2MJ 2WWYA 4I8TA 5H20A 5LHHA 5EGOA 1SFEA 3K4LA 4EK9A 1Z7UA 1BIAA 1W36D 3KZYA 1TWAJ 2LSOA 4P55A 1HC8A 1JKOC 3NAUA 3CO6C 2AWIA 4MQ9F 2W85A 2N8GA 4KT6A 4LGWA 3HRSA 3C2GA 4GDFA 1MZBA 2R0QC 1GVDA 4MCXA 2JMWA 3HHGA 3REOA 2IRFG 3KFWX 1IXRC 2EIMH 3A01A 3OYCA 3M7GA 1ZRDA 4Q5SF 1ETWA 3HOZJ 2VODA 1FBUA 3HKZN 3O2PE 3MLFA 2LY9A 1UHSA 2IJLA 3ULQB 2R7TA 4F52A 1B8IA 4DZJA 1YRNA 2DA5A 3K4CA 5J8FA 3A9ZA 2HI3A 1OR7C 5D8KB 1Y56A 4QLCU 2LLKA 4M74A 3LOCA 3T8TA 5M5YJ 3GTMJ 2WY7Q 3S14J 1KYWA 1XGNA 4FT8A 2L49A 5CVUA 1UAAA 4CYCB 3HPGA 3U9GA 2DBBA 1PNRA 2EIKH 1EKEA 4L5JA 2DMQA 4BYYA 4HQMA 3JRGA 2M4HA 2AXLA 2BBYA 1IG7A 5CJ9A 2M45A 4IQJA 2KKOA 4BE0A 2EPFA 4G9YA 3I55I 2UWMA 4ZTJA 2K27A 4WXHA 1D1BA 3HKZA 2JA7J 2JJ7A 3KP5A 2Z9OA 2VJJA 2MD5A 3ROUA 1FTTA 3VWSA 2K4BA 5EDNA 3KETA 1PJRA 3FWEA 1HDPA 4EM1A 5B66C 2LF8A 4KUMA 4CDGA 2HKXA 2QVOA 4Q47A 1ZZBA 4GYGA 2A6HF 1TQPA 2TRTA 1WJAA 2XXAA 1R71A 2X51A 5CKTA 4A3EJ 2M5WA 1B6AA 1YS7A 2H6CA 3BG3A 3M4OJ 2A61A 3KP4A 3JXCL 3EQLF 3IHUA 5DTQA 5CYVA 2XAUA 2KMUA 3AAFA 2A5WA 1LCDA 3FMSA 3NQOA 1JGGA 3OWTA 3S32A 4AIJA 3KPHA 2NVYJ 3OOUA 1F5TA 4PZJA 3OYDA 5DTRA 1S3JA 5LHGA 1JT6A 2L0KA 2PXTA 4Z2YA 3HTUA 3ESWB 1B59A 2XGEA 2VL8A 5H6RA 4WCGA 3WTXC 2QBYA 2Z16A 2EH3A 2JZYA 2BV6A 4XRSG 3FXRA 1K4TA 2R93J 3F6OA 3F8BA 1FC3A 4WF2A 2QA4I 1R5HA 2HFHA 3BJOA 2DA4A 4NHJA 1OCZH 2DI3A 3RZOJ 2QKMB 4HX8A 1WH8A 3CMAI 2VKDA 5GTIC 1D8JA 3SDGA 1J2XA 1E3HA 3GMEA 3DEEA 3QF3A 2PN6A 2BY1A 3CO7C 4Y42A 4JCYA 1HOMA 4M9ZA 3EETA 3LSJA 1YW7A 3QPTA 1JUMA 1X2NA 3K1NA 1OYWA 3TQNA 1BDIA 3GW2A 3ZRGA 3RPQA 1MBGA 2BGCA 3DXJF 3FISA 5HNHA 4XM3A 1JUSA 4EJTA 2XKPA 2RNGA 3WTWC 1F36A 3KP2A 2KJBA 2NNNA 3PUFA 3P9CA 4QPOA 3EUAA 3SCFA 1Y39A 4ESBA 2NVTJ 2HCSA 3PQKA 3GZCA 3BDDA 3S1NJ 4WXDA 2VJIA 3HOSA 3SYTA 2FJRA 4DGWB 4XRMA 5CVVA 2ZJPF 2LKPA 1BW6A 3PIOF 1LMB3 5HODA 1W7PA 4DYQA 1ZG3A 2BXYA 3IV5A 1YX5A 1MMDA 1XMKA 2H1LA 2KIUA 4WK8F 1XCVA 1LCCA 1R1TA 3KEYA 2GQQA 1QHGA 3DPLC 3G1LA 3F0CA 3U1KA 3E6MA 3BTLA 1MJ9A 2RAEA 4HDVA 2BHZA 3QYXA 3S2WA 1H9TA 4A93J 2KT0A 3M9LA 1TZLA 3OY9A 1IGNA 2LLVA 3SDBA 2PUBA 1T33A 3BP8A 5KCMA 4HLYA 3RYPA 3L2RA 4YG4A 4HRIA 2ISZA 2K9MA 1X57A 2M7BA 3K6GA 4MIMA 1WGXA 1MBKA 4XKVA 2Q8KA 5HLIA 1ZTRA 2UZKA 1Y8QB 5E3MA 2PUCA 5GAGJ 3SJMA 5FKOA 1UHMA 4MHGA 2E5NA 1FOYA 5L3BA 1WKMA 1ZKGA 2UXNA 4XKBA 3WU0A 3K4MA 2YS9A 4IL6C 2M30A 2MH9A 5DDGA 2BY3A 3TW7A 4A3KJ 2FRHA 3ZMZA 4DW6A 3DU6A 2HPIA 1E2XA 2QCOA 3S93A 2BNOA 1IDZA 3BTJA 3S1RJ 1QB2A 5TJJA 3RSNA 1CJGA 2HQNA 3VODA 1LE8A 4A3BJ 2VPRA 4Z5DA 3A02A 5M5XJ 1QBJA 2CSFA 4Z58A 4Y7NJ 2F5FA 3ZQIA 1IN6A 5M5WJ 5ICEA 2PEXA 3AG3H 2A6EF 2JRMA 4E70A 2QSGX 3H5AA 5EG0A 1UMQA 5HS8A 1JJ8C 4OMYA 1MNMC 1LKXA 1GUUA 2Y9YA 3T5XA 3PE5A 2R1JL 1DW9A 1XSDA 2L7MP 3KCCA 4RAYA 2R7FA 1G6NA 1WH5A 4MTEA 3U3WA 1LFPA 1MBFA 5CVRA 4W1UA 5L3GA 1QZYA 1XS9A 1O4XA 2W48A 4N9HA 2GRLA 2BY2A 2KFDA 2KHMA 3UR3C 2VPLA 3OIOA 2Z99A 3OV8A 1W5CC 2IEKA 3OYMA 2JVLA 3H3VK 3BD1A 3ECHA 4A5NA 1ZH5A 1F43A 4B44A 4YFNF 2CH0A 1U8RA 2WAEA 4C2UA 1EH6A 3L9FA 5HLGA 3GLXA 3QWGA 4L18B 3F21A 2XKOA 2FD5A 3ZHIA 1QRYA 3RKYA 4BL0B 2ICWG 4LD5A 1W7PD 2R7VA 4BBSJ 1ULYA 3K4NA 1WJCA 2KPMA 3DKXA 1DGWY 2LKSA 2K85A 5HNFA 3H9QA 2PX9A 5J3LA 3EYYA 1OQYA 3KZ3A 1HXDA 2CS3A 3CJQB 4HNUA 1VTNC 4A6EA 1SMYF 5J4VA 2W4SA 2A07F 2CV2A 4C3JJ 2VBYA 1PP7U 2JA8J 4YG7B 1YS6A 2CYYA 1RKWA 1D1CA 4EJOA 5BOXA 4I2OA 2AXUA 3KP6A 1ZVVA 4M6XA 2M4KA 2EFOA 3ZQGA 2KISA 5ILSA 1IJWC 1QQIA 4KMFA 3QRFF 2D5VA 1FIPA 1YYVA 4H0EA 2V9KA 1WJDA 2XRNA 4U88A 2WADA 3FM3A 1KQ8A 2V7FA 4B43A 3SCHA 3Q5FA 4MFEA 1JT0A 1RI7A 4G94A 1SEUA 2M0MA 1P2FA 2AXTC 4HF0A 2E7XA 4FTHA 1R5ID 3CROL 4YFXF 4L9NA 1K79A 2O7OA 1WSUA 4EJWA 1FOWA 1AWCA 1JJ6C 3D1NI 3VYSB 4L9TA 3O3KA 5DS9A 4O3MA 4YIFA 2QZ8A 1YQAA 5LGNA 2BJCA 3I59A 2BW3B 3IH4A 4HV5A 4BY1J 1UZCA 1T6SA 3GUUA 3TO9A 3JRAA 2LFBA 1N75A 3NDBB 1ZS4A 2H27A 2RQPA 1RRJA 1N77A 1EH8A 3CMEI 3CLCA 2P6SA 5LRRA 5ILVA 2V4JC 2LF7A 2K4JA 1WWXA 2V1DA 3I58A 3O6BB 2L7KA 3HZJA 3L2CA 4MCTA 2DT7B 5H2FC 2QSFX 3E1SA 1LQ1A 5E20A 4IHYA 3G5GA 2IGNA 2WUSR 2ID3A 5HDKA 3H3UA 2JCGA 3LAJA 4TV7A 2E1NA 1KA8A 4XLFA 3IKTA 1FMWA 2QUFA 3H1CA 3K70D 3CC7I 2R7DA 3ZQCA 1K4SA 1U2WA 1HCRA 1JHFA 3CECA 2QLZA 1YE9A 1ZRCA 1P7JA 1PDNC 1ZZ9A 4WVLA 4U7BA 1IXSB 3BT9A 5B1AH 4FX0A 1VQ9I 2L3DA 3CF2A 5AONA 4QSHA 4AUXA 4PU4C 4LG3A 3E7LA 4G6TB 4G6QA 1TL8A 1XDSA 1R69A 4B3XA 2LR8A 4N9IA 5BPDA 4G7OF 5GAEJ 2FJ1A 3GUDA 4KITB 2F4OB 3HGYA 2HCNA 3L00A 4ON0A 1A5JA 2L5QA 1JXSA 3TGNA 3SZPA 3CUQA 4MGRA 4ZDOA 4U0WA 1BI1A 1VI0A 2HOAA 4DBQA 3SX0A 4JX6A 2STTA 3L1PA 1PRUA 2HQAA 2CV0A 1EF4A 1QZZA 3ZHMA 4UV8A 2RDPA 4PJ0C 2DMTA 4XL9A 2DOAA 1WJEA 2V79A 3A2KA 3BZKA 4KIGA 2LCVA 1VQPI 2FBKA 3CMMA 2GOXB 1XCBA 3FXKA 5D5VB 1H9GA 1F4KA 2P5KA 4HG2A 4ABZA 2PMHA 2P4WA 1SVLA 3DF8A 4B4CA 3GX4X 3BPXA 4HA8A 3HSFA 3L2UA 1X1PA 3GTKJ 2CMPA 4BAYA 4KIBA 3PQJA 2X6WA 4CO8A 4F92B 5D5WB 4LOCA 4O6JA 3KE2A 2V3CC 3I4MJ 2K5CA 3ZMDA 1FP1D 2F6CA 4GRIA 3ASOH 2FQ4A 2H8RA 1POUA 1Y1WJ 1XWRA 1BL0A 4CYDA 2HDCA 5D6FA 1Z1DA 4RLQA 5F1JA 1K78B 3E6DA 1STZA 1X2LA 5FKNA 2RC4A 3OR1C 4BQQA 1S9HA 4ETSA 2PUAA 2O5RA 1J59A 5IT9Z 2H09A 2F5VA 2QQBA 4IWRA 2OAZA 1QZXA 2XAQA 2FE3A 3IP4B 1CF7B 3Q9VA 1F1ZA 2D45A 2IXSA 3M07A 4HBLA 4Y13A 4CYCA 5GPCA 3FK6A 1QP0A 3U2RA 4ESFA 2B9SA 1Z7LA 2XXQA 4BEHA 3FHZA 2PJPA 2Z2SB 3MKLA 4WX9A 1V54H 5HDNA 4UB6C 2X1DA 4BHBA 2WV1A 2JA5J 3C7JA 5DRYA 3FDYA 3V8KA 2XROA 1ETKA 3ZCOA 4G8XA 2DPUA 2OZ6A 3HZIB 4IQ4A 2DJNA 2LYPA 1Y6IA 3QU3A 1ON2A 1FT9A 3ABUA 4IEJA 4E4HA 3PIPF 3ERED 1Z6TA 1LPQA 2K3FA 1G2HA 2GA1A 3PSFA 4XRFA 2Z5UA 1WIZA 2OQGA 1RZRD 1ETOA 4EMSA 2OZUA 4J01A 5EZHA 4IHWA 1B4AA 1TQMA 4RB3C 5FB2A 2HYFA 4HNVA 1V3FA 5B1BH 1LVAA 4G7HF 3M8FA 2EIJH 2ZXJA 4M71A 5B3SH 5J1YA 1DQUA 3R60A 1NEQA 2BEOA 2G7HA 1IV6A 1YSEA 2NS7A 1IRFA 4V19K 1D8KA 3RKWA 5JUWA 5A2QZ 3WTSC 1BJZA 5HS7A 3H0DA 3HRTA 3DV8A 4YRVA 2F5DA 1QP4A 3OQOA 1FSEA 4KDPA 3HL2A 1MJBA 5DUKA 3QQ6A 1SAXA 2I5UA 5JR3A 2MW8A 3A0BC 3FXUA 2KQRA 5DTDA 4XQFA 3MD2A 4I0BA 4DE9A 4YG2F 3AL0B 4WWCA 2DA3A 3J80Z 4IOCF 2PBIA 4BJ6C 5K5QA 1DPRA 3OYIA 4PJLA 1U9NA 4D7MA 5IOZA 3G4SI 3BJ6A 3WGHA 5F04A 2IW5A 2KJCA 2LYLA 2PQ8A 1SC7A 2VIXA 4E7HA 4XRSA 5IT9K 4ANJA 3PNYA 2R7RA 4KT5C 4K2EA 3ABKH 5GAHJ 4ER3A 2QF7A 3L7WA 3LSMA 4MNUA 3WTUC 5H6QA 2LMDA 1E17A 1KU3A 3K4BA 4YG1A 1BR4A 1RR8C 4BJ5C 1P7IA 3ML6A 5E17F 2BNNA 3W2AA 1XC5A 3BG5A 5BNGA 3ZMVA 2EZKA 3OYLA 1LJ9A 1BOBA 1R4NB 3D0SA 3FKIJ 4HF1A 1W0UA 1ZRFA 6PAXA 1U5TB 3CTAA 4BHPA 1QVTA 1Z91A 2E2HJ 3KP7A 3DLLF 3R09A 2ZC2A 1ZR4A 3F8CA 4IRGA 4OU0A 1J09A 2DFEA 4DYCA 1U2ZA 2PXUA 4C30A 2O61A 2P81A 2HPMA 2XC7A 1ZGAA 1B72B 3ZQHA 1SD7A 4DJAA 4LG0B 1DWKA 3OR2C 1A6QA 5F1RA 2CUFA 1R1VA 1V5EA 2VBZA 2L7FP 2IS6A 3FYMA 3K4KA 2W00A 3ZQFA 3OKZA 3S3NA 2IS1A 5J4YA 1CQTA 5A2QK 2E1CA 2E19A 2ELJA 2F5EA 2WY8Q 3C2HA 4Z5CA 2HQRA 1TNTA 1OISA 2DN0A 5DD4A 1XGMA 1B9MA 2F2EA 3LMMA 1YITI 2FNAA 5E1XA 3PJRA 1J9IA 1HA8A 2XV4S 3ZP5A 2VEOA 3V8LA 2W24A 2XIGA 4NC8A 4ZZLA 3GF2A 3SHFA 2X1EA 3H5RA 4IKFA 5L3FA 3JXBC 4HF2A 4UVBA 1UELB 3MMYB 4FETA 4E7LA 2R7QA 3BR0A 3J80K 4JYKA 3MZHA 3QOPA 4BBRJ 2MFZA 2YSRA 2CW8A 1SFOJ 3R6SA 3CUQC 3KEOA 2VN2A 1XTAA 2XGXA 2G0EA 4RAZA 2CWEA 1EJ9A 1UHWA 3VSKA 1T08B 2BE5F 2LNBA 4CHUA 2GZUA 2OTLI 2L9VA 3F6VA 4A5MA 4OOIA 3A1YA 1YJWI 5DEQA 1VQOI 2WBMA 2XGDA 4FHTA 1HW1A 1BOAA 3WG9A 1RZSA 1Y0NA 2DYSH 3MFKA 4KA4A 2WC2A 4EQZA 1JH9A 4ZH4F 3D5RC 2CUEA 4ZZDA 1Q1VA 1O3SA 3K9TA 4M6VA 2JPBA 4RBOA 3EUKL 3OS0A 2E2IJ 3OIPA 3TOBA 2DXIA 5K98B 1I27A 3SQNA 2R4GA 1X1CA 4E7JA 2ZKZA 1IUFA 3KEQA 1TTYA 4I98B 2R7XA 2XGCA 2VBXA 4G6DA 3CC4I 2XAFA 1RESA 4ER0A 3H9GA 4PU3C 3GTJJ 3PSIA 2X6OA 3EYIA 2TCTA 2X48A 1DULA 3BCBA 3LISA 4XOTA 2IAIA 3BOQA 3PNTA 3CCEI 3F8MA 2PUDA 5M3MJ 4BEHB 3NWTA 1D0XA 4L9JA 2XDVA 2RV8A 5HDGA 2DDAA 3JRHA 2OFYA 1IXCA 3CLOA 3HHHA 2VQCA 4FASD 3DPUA 4PU8A 2HSGA 2KP6A 2IT0A 4LITA 3N97A 1R4MB 3RYRA 4BDYA 2VJ5A 4M73A 1O3TA 1WJFA 4BNCA 3B73A 3ISPA 2XJ3A 1ONVA 2OJED 2L1PA 4PFOA 1G3WA 4MEYF 4OIRF 4BHCA 4NNJA 4HDUA 4A3CJ 2EBYA 4RAGA 1L0OC 3JCUC 3LL7A 2W82A 4B09A 1MSFC 2V1XA 2M1BA 2WTEA 1RZ4A 1XSXA 1IN8A 2QSHX 4YFKF 2O3FA 2ZXIA 2E1OA 3A03A 2XPVA 5HLTA 2W7NA 1LFUP 2IA0A 4HYEA 4UV9A 1E0EA 4HV6A 2JK3A 2XB5A 1QO0D 4B1RA 2AXZA 1FBQA 2E71A 1EA3A 3S2DJ 3ZQQA 2HINA 2PFBA 1W36C 2X1CA 3CDLA 1K6OA 2MSYA 1HW2A 1LB2A 2DAOA 3B7HA 1E3PA 2EZHA 3EUHA 3ABTA 3DCFA 4YARA 1O57A 4D5FA 2BW3A 5F0CA 1RR7A 4XOPA 3LWFA 2CV1A 1IO2A 1XPXA 2CU7A 3HRUA 2GM4A 5E8GA 2OUMA 1ENHA 2P0WA 1L3LA 2IV1A 2BYVE 2V9PA 2X85A 4I0AA 2ZMEB 4BXUA 4KISA 1K6YA 1ACIA 1J5YA 2LYKA 3BC8A 2UXXA 1PRAA 4LIVA 2CUZA 3CDHA 4D1QA 1WJ5A 4CCNA 4XKWA 5J40A 4IPAA 1GXQA 4II3A 1O3QA 4I6UA 2X4HA 2PIJA 1PP8F 1KU9A 3GTPJ 2GA2A 5FRMA 1E3OC 1TNSA 2DOFA 1WH7A 5EF6A 3ONQA 4A3JJ 1Z77A 2VLAA 1X2MA 3O9XA 2PMZN 4C3HJ 3JTHA 2K9SA 1V55H 1WPKA 3E0JB 4EM2A 2MGQA 2DTRA 2Y30A 4F93B 2JN6A 1R1UA 1ZZ6A 2E7WA 5FLMJ 4OBMA 2EQRA 1BR2A 4N4OB 4CXFA 4FISA 4EV0A 2ZNZA 3HOYJ 3G73A 2VI6A 4LMYA 2AW6A 3V7SA 2CFXA 2HZTA 4DQ2A 1X1BA 2IBDA 3ZOBA 2E60A 1R22A 2FBHA 1ZYRF 2LH9A 3CCRI 3ZXSA 3IRQA 1YX3A 2YX7A 2PMZA 1ERDA 1TWHJ 3DBLB 5HS9A 1R5GA 3M3YJ 4JQDA 2E1MB 3VDXA 3OQNA 2L9RA 3KXAA 3H0GJ 4RAFA 4HQEA 2J5PA 1AHDP 2KZVA 1IDYA 3HSRA 2NYXA 5DT2A 2RKHA 2AQEA 3HOVJ 3L2WA 1HF0A 4L5IA 4PFPA 4JP0A 3QWLA 5D4RA 4E7KA 2B5AA 3RPUA 3QP6A 2EF8A 2ZO4A 1P6RA 1PRVA 4ZYEA 3COAC 5CVJA 3JRIA 4BJTA 2JA6J 2R63A 2CW7A 1K78A 3FKJA 1C0WA 2X6XA 2I8DA 4RB0A 4OIPF 1R7JA 1T56A 2HVQA 2HXIA 3HPHA 1MIJA 1NG6A 4PCQA 1VQ6I 1AKHB 2KEKA 4RB2C 4NC6A 2MH2A 1FNNA 1CF7A 3BWGA 4JX4A 2CFOA 2UUZA 3J81Z 3CCYA 2E34A 5IY5H 2JPCA 4LB6B 4NDWA 4A3IJ 2CROA 1WFXA 4M9XA 3OWQA 3X2QH 1R58A 1FZPB 1S29A 4Y3OA 5JI6A 4R8HA 3WGGA 2EFNA 4XN3A 4X4GA 4N4NB 4Y17A 4A3DJ 4BH9A 2MLGA 3UWPA 2GZWA 2HYGD 1MKMA 4D0PA 2HS5A 4EVIA 3R0JA 1SD6A 2D2WA 2L9NA 3TOAA 4AIDA 2F48A 2HYJA 2WV0A 2JSCA 4CCOA 2XF7A 1SANA 2BZTA 3DEWA 3NEUA 3JRFA 1S6LA 2V1UA 1MH3A 2TDXA 4DZPA 4A3LJ 5J8CA 2CJJA 4RMNA 4E6KG 1MGTA 3OYNA 2Y2ZA 4I09A 3A9XA 5LEJA 1YW9A 4NDLA 4ER6A 3T0YA 4MFDA 1VQKI 2K7LA 1JWLA 1FYMA 2DA6A 2AUWA 2XF5A 2DW4A 4RGXA 2VC1A 2LG4A 1Y9QA 3G0TA 1U9OA 1Z05A 5ED4A 3VPRA 2QGUA 3BR1A 5DCMB 3TP0A 2MYSA 4J1WA 2FX0A 4XLEA 2ME6A 4D5CA 3EPZA 3MKWB 4FCYA 4BDZA 1RUNA 3G3ZA 4O5VA 5JVGF 1YOVB 4S0HB 5GADJ 4Q4ZF 1B9NA 3UFDA 1FJLA 3GFJA 1USTA 2VT2A 3VSLA 3KLNA 2FMYA 4PUSA 5FLXK 2R5YB 2EA4A 3OYJA 3ZMSA 3LA3A 3GN5B 4HZFA 1S72I 4A2UA 1XX5A 4XMYA 3J7ZI 1LEAA 2A5YB 3QP5A 2ICPA 1MBJA 2ELHA 4PJMA 4JCXA 2AHQA 2FOKA 3V8JA 1HLVA 1YI2I 4JOMA 5J1RA 2XPWA 3SEQA 4DE8A 5IYDJ 3SFIA 4M3EA 2DK8A 3J7AO 1U3EM 4KN7X 2HKOA 4OMZA 1ZELA 4ITVA 2FFHA 4WXCA 4DBRA 3JW4A 1NTCA 4CCKA 4M6YA 4LK1F 2I10A 5C4XJ 3WGIA 3QODA 2JT1A 2VXDA 3K2AA 3M9AA 4R1HA 1ZN2A 3HSEA 3OS2A 3VWBA 3EUSA 1ADRA 2MC4A 2PXLA 3TBIA 3J81K 3RPUD 1ZPQA 2J7UA 1FP2A 1JUPA 4LLNA 1SD4A 2ESNA 4EM0B 3EUHC 2RGVA 5ICCA 3LQQA 4HX4A 3TFLA 2ELKA 3S1MJ 2W84A 2ETHA 2BVLA 1OYYA 4U0YA 4XSZF 3IUOA 2L7ZA 1YJ9I 3AG2H 4IRHA 4F55A 1PERL 1U5TA 3HBLA 4EGZA 1EFAA 1RNLA 4P9UA 3F51A 4QIWN 1WHUA 3QPLA 1RZRA 4JX5A 1ITYA 3GZDA 3WTVC 1B72A 3H92A 3IC7A 1U0JA 1SFUA 5GAGi 1GT0C 1FIAA 2OCEA 4Y15A 4LG0A 3FXJA 4N0BA 4NB5A 4KN4X 3CF5F 1Y1VJ 3K69A 4S05A 4D9JA 5KVRA 1WQ2A 4Y4RA 5JHFA 3WU1B 2WB1N 2PJRB 3A4CA 2GIZA 3I5UA 4M3BA 4ASNA 1LDDA 1J7KA 1HSJA 4RDUA 2E36A 1DP3A 4XIDA 1S7EA 2VOPA 1D0ZA 1ZAOA 2KIFA 3C3WA 3IWZA 1O7LA 3N05A 3PFYA 5M3FJ 1QPZA 1I6XA 4GXOA 4JQFA 3KLOA 3SCGA 3ZMUA 3TEDA 3JSPA 1I6HJ 2Z1DA 4BUPA 5A7LA 2MG4A 3FM5A 2IUOA 1D1AA 5D5XB 3H5NA 3K1PA 2AS5F 3S8PA 3G1OA 1JI8A 3KJXA 1ZREA 4MO7A
chains in the Genus database with same CATH topology
1XC5A 3BG5A 5BNGA 1GDTA 1ZZ8A 4IVZA 2EZKA 3OOUA 2NVYJ 4M3FA 4MLOA 3FKIJ 2CQXA 3ZKCA 3BQYA 4GHJA 1JT6A 2L0KA 2B63J 1W0UA 2XGEA 4X4CA 1B8IB 1YRNB 2CRGA 1QVTA 2M0CA 2E2HJ 5IYBJ 3HGGA 1ZR4A 2EH3A 1JTYA 4XRSG 2R93J 1BA5A 4DYCA 1UXCA 3FYAA 1PUFA 2P81A 5J1UA 3BS3A 1B72B 2A6CA 2DA4A 3ZQHA 1R9TJ 3RZOJ 2IVQA 4J1XA 1DWKA 1WH8A 2L8NA 3F6WA 1JTXA 2VKEA 4BY7J 4B3AA 3SDGA 2CUFA 3LSRA 3QF3A 2L7FP 4Y42A 3Q0WA 2YU9J 3FYMA 1HOMA 4IA8A 3O8HA 4X4BA 3ZQFA 3LSJA 1RETA 1CQTA 1JKPC 2E19A 3QPSA 1JUMA 1X2NA 3S8QA 1NERA 1BDIA 4Z5CA 3JR9A 2DN0A 1MBGA 2BNNA 3FISA 1OFCX 3I4NJ 1MBEA 1JUSA 3RQIA 2LD5A 1F36A 2DMNA 1LQCA 2GRMA 2R92J 2M8GX 2ECBA 3W6VA 3SCFA 3JXBC 2KEJA 4OB4A 2NVTJ 1ORKA 1VF9A 2R5ZA 4BXXJ 2Y9ZA 3S1NJ 4A3MJ 3BR0A 2GBYA 4JYKA 2FJRA 4PU7A 4BBRJ 4XRMA 5FKMA 3HOWJ 1OSLA 2LTPA 1BW6A 5IYCJ 4EEFG 5HODA 4DYQA 1SFOJ 1LMB3 3IV5A 1H8AC 1LCCA 2G0EA 2OR1L 3G1LA 3F0CA 2XPUA 3S15J 3BTLA 2LKXA 2RAEA 1H89C 3QYXA 2GZUA 1MSEC 4A93J 2KT0A 4V2GA 1ETXA 3PM1A 4M3GA 1PUFB 3NARA 1IGNA 3BG9A 4UUTA 1T33A 3H5TA 2XGDA 3IVPA 2PUBA 3JRCA 4YG4A 1RZSA 3RZZA 1X57A 4F8DA 3JREA 4MIMA 1WGXA 1MBKA 1JH9A 1ZTRA 2CUEA 5E3OA 1Q1VA 4XICA 3JXDL 5E3MA 3DNVB 4M6VA 4RBOA 2E2IJ 2DMUA 4D7NA 1BDHA 5K98B 2LYRA 3UKGA 5GP9A 1IUFA 5FKOA 3SJMA 3BDNA 3BTIA 5IP7J 1ZKGA 2XGCA 2PE5A 2YS9A 3G1MA 2DMPA 1MH4A 1RESA 2ZB9A 4PU3C 3GTJJ 2XCJA 4A3KJ 1Z0XA 2COBA 2X6OA 4XK4A 3TW7A 4X1EA 2TCTA 2X48A 4DW6A 3LISA 2YUSA 2Y31A 2AO9A 2IAIA 2QCOA 1XG1A 2M34A 2NVXJ 2IVBA 2BNOA 1IDZA 2PUDA 3BTJA 1JFTA 5M3MJ 3S1RJ 1QQBA 2OF7A 1CJGA 3PO2J 1LE8A 4A3BJ 2DA2A 3JRHA 2VPRA 2OFYA 3S1QJ 4Z5DA 3A02A 2MQKA 5M5XJ 2CSFA 3HB9A 4Y7NJ 4IHVA 4Z58A 3ZQIA 1WETA 5FKLA 1JKRC 5M5WJ 4PU8A 1UG2A 1DU6A 2HSGA 4QTRA 1WI3A 2HOTA 5EG0A 1UMQA 1JJ8C 1MNMC 1GUUA 2Y9YA 5F0HA 3HOXJ 2R1JL 2M2EA 1DW9A 2L7MP 5EZGA 1D5YA 1JKOC 2XJ3A 2PUCA 3HEFA 5C4JJ 2ME0A 4A69C 1WH5A 2EWTA 3U3WA 1VPWA 1I3QJ 3HM5A 4A3CJ 1MBFA 3WHBA 2EBYA 5K7HA 4W1UA 3B6CA 3FIWA 1XS9A 1O4XA 1MSFC 2W48A 1OCPA 5FJ8J 2GRLA 5F27A 2O9LA 3LSPA 5E3NA 2IU7A 3OIOA 2E1OA 2K9NA 3A03A 2XPVA 1LFUP 3CQZJ 1UTXA 2IEKA 2LK2A 1RIOA 4B1RA 2JK3A 2XB5A 2LP0A 4V2FA 2AXZA 2JVLA 3H3VK 3S2DJ 3S16J 2HINA 3BD1A 3KJXA 5EYRA 1APLC 3HOUJ 1F43A 3CDLA 1POGA 2K9QA 1VNDA 2MSYA 4FE4A 3B7HA 3QWGA 2EZHA 1QVUA 3DCFA 4I76A 4M3DA 1U78A 4YARA 2FD5A 3IH3A 3ZHIA 1QRYA 4D5FA 1NK2P 1SQ8A 1UXDA 5F0CA 1LE8B 1RR7A 2WAQN 4BBSJ 4AC0A 1ZZ7A 2CU7A 2GM4A 2XSDC 1ENHA 2IV1A 1ZZCA 4G12A 5K7ZA 4A3FJ 5J3LA 3KZ3A 3S2HJ 2LYKA 1PRAA 1X58A 5EG0B 1QQAA 1LFBA 1K83J 1TC3C 3GTQJ 3FMYA 4I6UA 2PIJA 1WCMJ 2GLOA 3OQMA 4C3JJ 2JA8J 1GV5A 4YG7B 1RKWA 3GTPJ 2IVGA 1ETQA 1FTZA 3GTOJ 2AXUA 1ZVVA 1E3OC 4X6AJ 1WH7A 3ZQGA 5EF6A 4A3JJ 1IJWC 1Z77A 4W97A 2D5VA 1FIPA 1X2MA 3O9XA 2PMZN 4BKXA 2ID6A 4C3HJ 3PXPA 2K9SA 1WPKA 3QQAA 2O49A 3SCHA 4MFEA 1JT0A 2HQ5A 5IP6A 2MGQA 2Y30A 1QPIA 5F08A 1R63A 1AKHA 3R1FA 2JN6A 1WH6A 1ZZ6A 1L1MA 5FLMJ 3CROL 4FTHA 2EQRA 5FLVA 2O7OA 4FISA 2PUEA 2HOSA 3K7AJ 2OPTA 5JLXA 3HOYJ 1JJ6C 5JLWA 3D1NI 2EZLA 2JWTA 3S17J 2VI6A 1A6IA 5DS9A 1JKQC 4AYBN 2BJCA 2BNMA 3IH4A 2AW6A 4FE7A 4BY1J 2IBDA 2LFBA 3ZOBA 3JRAA 4I6ZA 5IOYA 3JRBA 1ZS4A 3BR5A 2KZ8A 3LFPA 3CLCA 1TWHJ 3RKQA 1AU7A 4IHXA 3GBGA 5FKKA 2CQQA 3GTGJ 3M3YJ 4JQDA 1JGGA 3OQNA 2O4AA 2EBIA 2L9RA 4C3IJ 5GPAA 3KXAA 2HXOA 3H0GJ 3Q0VA 1AHDP 2R5ZB 4MCTA 1IDYA 5IPAA 4J19A 1FEXA 4O8BA 4X4HA 4IHYA 3HOVJ 1B0NA 1HF0A 3G5GA 3ZQLA 2WUSR 2ID3A 4JP0A 2KDZA 2JCGA 5EEAA 1NK3P 1BW5A 2B5AA 2EF8A 2AXVA 1PRVA 3ZQCA 1HCRA 3CECA 3G7DA 5IP9J 3JRIA 2ICTA 3RZDJ 1P7JA 1TWCJ 2JA6J 1ZZ9A 2R63A 2PUFA 2K40A 4UUSA 3BT9A 1RPEL 1T56A 2HXIA 4QSHA 4AUXA 3OP9A 4I6TA 1OJLA 5E3LA 1I50J 4DYRA 3E7LA 4PU4C 1AKHB 2XRLA 2KEKA 1R69A 2LR8A 4JCYA 2R5YA 2KEIA 4JX4A 2Y0SN 2LYQA 2FJ1A 3GN5A 4Y52J 3HGYA 3O8GA 1ZK8A 1A5JA 3CCYA 2M9HA 3Q3SA 1ZR2A 1VI0A 3BQZA 4A3IJ 2E2JJ 4NDWA 2HOAA 2CROA 4JX6A 3L1PA 1ZAYA 1PRUA 5C3EJ 1K61A 1EF4A 3HDDA 3ZHMA 4X4DA 4A3GJ 1IRZA 2DMTA 4X4GA 4GFBA 2WIUB 4X4EA 4A3DJ 2DTZA 1ZQ3P 2LCVA 1LLIA 1TWGJ 2HYJA 3F52A 1SANA 3DEWA 3JRFA 4ABZA 1MH3A 4DZPA 4B4CA 4A3LJ 5K7FA 2CJJA 3TRBA 2Y2ZA 4NDLA 3GTKJ 3CMYA 4MFDA 1JWLA 4X4IA 1RPWA 4LOCA 3OSFA 2DA6A 2AUWA 3I4MJ 1RKTA 1POUA 2H8RA 2FQ4A 1MBHA 1Y1WJ 2LYSA 1XWRA 1Y9QA 1BL0A 1U9OA 1U8BA 3VPRA 3B6AA 3BR1A 3TP0A 5F1JA 4UUSB 3MVPA 1X2LA 4J1WA 2FX0A 5FKNA 2ME6A 2LVSA 4D5CA 4FCYA 3VK0A 4S0HB 3UFDA 2MEZA 2PUAA 1FJLA 2NS8A 1QP7A 4IWRA 3GTLJ 2R5YB 4I6RA 3GN5B 4YBAA 4Z59A 2XB0X 1ETYA 5F0FA 2ICPA 3WHCA 4CYCA 5GPCA 1MBJA 3OMTA 2KPJA 4JCXA 3FK6A 1QP0A 3BR6A 1DU0A 2AHQA 4FN3A 2VUMJ 2X9DA 1HLVA 1OCTC 5J1RA 1ZUGA 2LYJA 2XPWA 3MKLA 5IYDJ 3SFIA 4M3EA 3LNQA 2WV1A 2JA5J 1TWFJ 4C2MJ 4I8TA 3BR2A 1ETKA 3MN2A 5EGOA 2DA7A 3HZIB 1NTCA 2DJNA 1ZGWA 2LYPA 1TWAJ 2I10A 1VFCA 5C4XJ 4IEJA 3K2AA 1G2HA 3NAUA 2AWIA 3EUSA 1WIZA 1RZRD 1ADRA 9ANTA 2N8GA 1ETOA 1IC8A 4X4FA 2R0QC 1GVDA 5EZHA 4IHWA 4MCXA 2JMWA 1ZPQA 1H88C 3GBFA 2XI8A 4HNVA 1JUPA 3C2BA 3A01A 2DA1A 2ECCA 5J1YA 1ETWA 1NEQA 3HOZJ 2ELKA 3S1MJ 4Z5HA 1JFSA 1IV6A 3HKZN 3MLFA 1YSEA 2NS7A 2LY9A 1UHSA 3BR3A 1BJZA 2L7ZA 1PERL 1B8IA 3HBLA 4DZJA 2DA5A 1YRNA 1EFAA 3F51A 3OQOA 4QIWN 1QP4A 3QPLA 4L5EA 2PPXA 2HI3A 3OSGA 1RZRA 5C44J 4JX5A 2H1KA 1ITYA 3QQ6A 3BTCA 2LLKA 3LSGA 3LOCA 2MW8A 5M5YJ 1B72A 1W0TA 3GTMJ 3S14J 1GT0C 1FIAA 2L49A 5DTDA 4CYCB 1Y7YA 3Q0UA 1Y1VJ 1ETVA 2DA3A 1PNRA 3TW6A 2DMQA 3IH2A 3JRGA 2PUGA 2VKVA 1IG7A 2NOGA 2O8KA 2XIUA 2WB1N 1U9NA 4M3BA 4D7MA 5IOZA 2EZIA 5F04A 5EGOB 2JA7J 2JJ7A 4RDUA 3FK7A 4XIDA 1S7EA 2LYLA 3TP3A 1FTTA 4XRSA 3PO3J 5EDNA 5M3FJ 4GQMA 1QPZA 1HDPA 1HDDC 1ZZBA 2HDDA 3SCGA 2TRTA 2QF7A 4A3EJ 3TEDA 3M4OJ 3BG3A 1I6HJ 3JXCL 3JRDA 5A7LA 2MG4A 1GV2A 2NVQJ 2IUOA 4YG1A 3G1OA 4FBIA 1LCDA 2R7ZJ 1P7IA 2O38A 3A01B 4MO7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XC5 A;  3BG5 A;  5BNG A;  1GDT A;  1ZZ8 A;  4IVZ A;  2EZK A;  3OOU A;  2NVY J;  4M3F A;  4MLO A;  3FKI J;  2CQX A;  3ZKC A;  3BQY A;  4GHJ A;  1JT6 A;  2L0K A;  2B63 J;  1W0U A;  2XGE A;  4X4C A;  1B8I B;  1YRN B;  2CRG A;  1QVT A;  2M0C A;  2E2H J;  5IYB J;  3HGG A;  1ZR4 A;  2EH3 A;  1JTY A;  4XRS G;  2R93 J;  1BA5 A;  4DYC A;  1UXC A;  3FYA A;  1PUF A;  2P81 A;  5J1U A;  3BS3 A;  1B72 B;  2A6C A;  2DA4 A;  3ZQH A;  1R9T J;  3RZO J;  2IVQ A;  4J1X A;  1DWK A;  1WH8 A;  2L8N A;  3F6W A;  1JTX A;  2VKE A;  4BY7 J;  4B3A A;  3SDG A;  2CUF A;  3LSR A;  3QF3 A;  2L7F P;  4Y42 A;  3Q0W A;  2YU9 J;  3FYM A;  1HOM A;  4IA8 A;  3O8H A;  4X4B A;  3ZQF A;  3LSJ A;  1RET A;  1CQT A;  1JKP C;  2E19 A;  3QPS A;  1JUM A;  1X2N A;  3S8Q A;  1NER A;  1BDI A;  4Z5C A;  3JR9 A;  2DN0 A;  1MBG A;  2BNN A;  3FIS A;  1OFC X;  3I4N J;  1MBE A;  1JUS A;  3RQI A;  2LD5 A;  1F36 A;  2DMN A;  1LQC A;  2GRM A;  2R92 J;  2M8G X;  2ECB A;  3W6V A;  3SCF A;  3JXB C;  2KEJ A;  4OB4 A;  2NVT J;  1ORK A;  1VF9 A;  2R5Z A;  4BXX J;  2Y9Z A;  3S1N J;  4A3M J;  3BR0 A;  2GBY A;  4JYK A;  2FJR A;  4PU7 A;  4BBR J;  4XRM A;  5FKM A;  3HOW J;  1OSL A;  2LTP A;  1BW6 A;  5IYC J;  4EEF G;  5HOD A;  4DYQ A;  1SFO J;  1LMB 3;  3IV5 A;  1H8A C;  1LCC A;  2G0E A;  2OR1 L;  3G1L A;  3F0C A;  2XPU A;  3S15 J;  3BTL A;  2LKX A;  2RAE A;  1H89 C;  3QYX A;  2GZU A;  1MSE C;  4A93 J;  2KT0 A;  4V2G A;  1ETX A;  3PM1 A;  4M3G A;  1PUF B;  3NAR A;  1IGN A;  3BG9 A;  4UUT A;  1T33 A;  3H5T A;  2XGD A;  3IVP A;  2PUB A;  3JRC A;  4YG4 A;  1RZS A;  3RZZ A;  1X57 A;  4F8D A;  3JRE A;  4MIM A;  1WGX A;  1MBK A;  1JH9 A;  1ZTR A;  2CUE A;  5E3O A;  1Q1V A;  4XIC A;  3JXD L;  5E3M A;  3DNV B;  4M6V A;  4RBO A;  2E2I J;  2DMU A;  4D7N A;  1BDH A;  5K98 B;  2LYR A;  3UKG A;  5GP9 A;  1IUF A;  5FKO A;  3SJM A;  3BDN A;  3BTI A;  5IP7 J;  1ZKG A;  2XGC A;  2PE5 A;  2YS9 A;  3G1M A;  2DMP A;  1MH4 A;  1RES A;  2ZB9 A;  4PU3 C;  3GTJ J;  2XCJ A;  4A3K J;  1Z0X A;  2COB A;  2X6O A;  4XK4 A;  3TW7 A;  4X1E A;  2TCT A;  2X48 A;  4DW6 A;  3LIS A;  2YUS A;  2Y31 A;  2AO9 A;  2IAI A;  2QCO A;  1XG1 A;  2M34 A;  2NVX J;  2IVB A;  2BNO A;  1IDZ A;  2PUD A;  3BTJ A;  1JFT A;  5M3M J;  3S1R J;  1QQB A;  2OF7 A;  1CJG A;  3PO2 J;  1LE8 A;  4A3B J;  2DA2 A;  3JRH A;  2VPR A;  2OFY A;  3S1Q J;  4Z5D A;  3A02 A;  2MQK A;  5M5X J;  2CSF A;  3HB9 A;  4Y7N J;  4IHV A;  4Z58 A;  3ZQI A;  1WET A;  5FKL A;  1JKR C;  5M5W J;  4PU8 A;  1UG2 A;  1DU6 A;  2HSG A;  4QTR A;  1WI3 A;  2HOT A;  5EG0 A;  1UMQ A;  1JJ8 C;  1MNM C;  1GUU A;  2Y9Y A;  5F0H A;  3HOX J;  2R1J L;  2M2E A;  1DW9 A;  2L7M P;  5EZG A;  1D5Y A;  1JKO C;  2XJ3 A;  2PUC A;  3HEF A;  5C4J J;  2ME0 A;  4A69 C;  1WH5 A;  2EWT A;  3U3W A;  1VPW A;  1I3Q J;  3HM5 A;  4A3C J;  1MBF A;  3WHB A;  2EBY A;  5K7H A;  4W1U A;  3B6C A;  3FIW A;  1XS9 A;  1O4X A;  1MSF C;  2W48 A;  1OCP A;  5FJ8 J;  2GRL A;  5F27 A;  2O9L A;  3LSP A;  5E3N A;  2IU7 A;  3OIO A;  2E1O A;  2K9N A;  3A03 A;  2XPV A;  1LFU P;  3CQZ J;  1UTX A;  2IEK A;  2LK2 A;  1RIO A;  4B1R A;  2JK3 A;  2XB5 A;  2LP0 A;  4V2F A;  2AXZ A;  2JVL A;  3H3V K;  3S2D J;  3S16 J;  2HIN A;  3BD1 A;  3KJX A;  5EYR A;  1APL C;  3HOU J;  1F43 A;  3CDL A;  1POG A;  2K9Q A;  1VND A;  2MSY A;  4FE4 A;  3B7H A;  3QWG A;  2EZH A;  1QVU A;  3DCF A;  4I76 A;  4M3D A;  1U78 A;  4YAR A;  2FD5 A;  3IH3 A;  3ZHI A;  1QRY A;  4D5F A;  1NK2 P;  1SQ8 A;  1UXD A;  5F0C A;  1LE8 B;  1RR7 A;  2WAQ N;  4BBS J;  4AC0 A;  1ZZ7 A;  2CU7 A;  2GM4 A;  2XSD C;  1ENH A;  2IV1 A;  1ZZC A;  4G12 A;  5K7Z A;  4A3F J;  5J3L A;  3KZ3 A;  3S2H J;  2LYK A;  1PRA A;  1X58 A;  5EG0 B;  1QQA A;  1LFB A;  1K83 J;  1TC3 C;  3GTQ J;  3FMY A;  4I6U A;  2PIJ A;  1WCM J;  2GLO A;  3OQM A;  4C3J J;  2JA8 J;  1GV5 A;  4YG7 B;  1RKW A;  3GTP J;  2IVG A;  1ETQ A;  1FTZ A;  3GTO J;  2AXU A;  1ZVV A;  1E3O C;  4X6A J;  1WH7 A;  3ZQG A;  5EF6 A;  4A3J J;  1IJW C;  1Z77 A;  4W97 A;  2D5V A;  1FIP A;  1X2M A;  3O9X A;  2PMZ N;  4BKX A;  2ID6 A;  4C3H J;  3PXP A;  2K9S A;  1WPK A;  3QQA A;  2O49 A;  3SCH A;  4MFE A;  1JT0 A;  2HQ5 A;  5IP6 A;  2MGQ A;  2Y30 A;  1QPI A;  5F08 A;  1R63 A;  1AKH A;  3R1F A;  2JN6 A;  1WH6 A;  1ZZ6 A;  1L1M A;  5FLM J;  3CRO L;  4FTH A;  2EQR A;  5FLV A;  2O7O A;  4FIS A;  2PUE A;  2HOS A;  3K7A J;  2OPT A;  5JLX A;  3HOY J;  1JJ6 C;  5JLW A;  3D1N I;  2EZL A;  2JWT A;  3S17 J;  2VI6 A;  1A6I A;  5DS9 A;  1JKQ C;  4AYB N;  2BJC A;  2BNM A;  3IH4 A;  2AW6 A;  4FE7 A;  4BY1 J;  2IBD A;  2LFB A;  3ZOB A;  3JRA A;  4I6Z A;  5IOY A;  3JRB A;  1ZS4 A;  3BR5 A;  2KZ8 A;  3LFP A;  3CLC A;  1TWH J;  3RKQ A;  1AU7 A;  4IHX A;  3GBG A;  5FKK A;  2CQQ A;  3GTG J;  3M3Y J;  4JQD A;  1JGG A;  3OQN A;  2O4A A;  2EBI A;  2L9R A;  4C3I J;  5GPA A;  3KXA A;  2HXO A;  3H0G J;  3Q0V A;  1AHD P;  2R5Z B;  4MCT A;  1IDY A;  5IPA A;  4J19 A;  1FEX A;  4O8B A;  4X4H A;  4IHY A;  3HOV J;  1B0N A;  1HF0 A;  3G5G A;  3ZQL A;  2WUS R;  2ID3 A;  4JP0 A;  2KDZ A;  2JCG A;  5EEA A;  1NK3 P;  1BW5 A;  2B5A A;  2EF8 A;  2AXV A;  1PRV A;  3ZQC A;  1HCR A;  3CEC A;  3G7D A;  5IP9 J;  3JRI A;  2ICT A;  3RZD J;  1P7J A;  1TWC J;  2JA6 J;  1ZZ9 A;  2R63 A;  2PUF A;  2K40 A;  4UUS A;  3BT9 A;  1RPE L;  1T56 A;  2HXI A;  4QSH A;  4AUX A;  3OP9 A;  4I6T A;  1OJL A;  5E3L A;  1I50 J;  4DYR A;  3E7L A;  4PU4 C;  1AKH B;  2XRL A;  2KEK A;  1R69 A;  2LR8 A;  4JCY A;  2R5Y A;  2KEI A;  4JX4 A;  2Y0S N;  2LYQ A;  2FJ1 A;  3GN5 A;  4Y52 J;  3HGY A;  3O8G A;  1ZK8 A;  1A5J A;  3CCY A;  2M9H A;  3Q3S A;  1ZR2 A;  1VI0 A;  3BQZ A;  4A3I J;  2E2J J;  4NDW A;  2HOA A;  2CRO A;  4JX6 A;  3L1P A;  1ZAY A;  1PRU A;  5C3E J;  1K61 A;  1EF4 A;  3HDD A;  3ZHM A;  4X4D A;  4A3G J;  1IRZ A;  2DMT A;  4X4G A;  4GFB A;  2WIU B;  4X4E A;  4A3D J;  2DTZ A;  1ZQ3 P;  2LCV A;  1LLI A;  1TWG J;  2HYJ A;  3F52 A;  1SAN A;  3DEW A;  3JRF A;  4ABZ A;  1MH3 A;  4DZP A;  4B4C A;  4A3L J;  5K7F A;  2CJJ A;  3TRB A;  2Y2Z A;  4NDL A;  3GTK J;  3CMY A;  4MFD A;  1JWL A;  4X4I A;  1RPW A;  4LOC A;  3OSF A;  2DA6 A;  2AUW A;  3I4M J;  1RKT A;  1POU A;  2H8R A;  2FQ4 A;  1MBH A;  1Y1W J;  2LYS A;  1XWR A;  1Y9Q A;  1BL0 A;  1U9O A;  1U8B A;  3VPR A;  3B6A A;  3BR1 A;  3TP0 A;  5F1J A;  4UUS B;  3MVP A;  1X2L A;  4J1W A;  2FX0 A;  5FKN A;  2ME6 A;  2LVS A;  4D5C A;  4FCY A;  3VK0 A;  4S0H B;  3UFD A;  2MEZ A;  2PUA A;  1FJL A;  2NS8 A;  1QP7 A;  4IWR A;  3GTL J;  2R5Y B;  4I6R A;  3GN5 B;  4YBA A;  4Z59 A;  2XB0 X;  1ETY A;  5F0F A;  2ICP A;  3WHC A;  4CYC A;  5GPC A;  1MBJ A;  3OMT A;  2KPJ A;  4JCX A;  3FK6 A;  1QP0 A;  3BR6 A;  1DU0 A;  2AHQ A;  4FN3 A;  2VUM J;  2X9D A;  1HLV A;  1OCT C;  5J1R A;  1ZUG A;  2LYJ A;  2XPW A;  3MKL A;  5IYD J;  3SFI A;  4M3E A;  3LNQ A;  2WV1 A;  2JA5 J;  1TWF J;  4C2M J;  4I8T A;  3BR2 A;  1ETK A;  3MN2 A;  5EGO A;  2DA7 A;  3HZI B;  1NTC A;  2DJN A;  1ZGW A;  2LYP A;  1TWA J;  2I10 A;  1VFC A;  5C4X J;  4IEJ A;  3K2A A;  1G2H A;  3NAU A;  2AWI A;  3EUS A;  1WIZ A;  1RZR D;  1ADR A;  9ANT A;  2N8G A;  1ETO A;  1IC8 A;  4X4F A;  2R0Q C;  1GVD A;  5EZH A;  4IHW A;  4MCX A;  2JMW A;  1ZPQ A;  1H88 C;  3GBF A;  2XI8 A;  4HNV A;  1JUP A;  3C2B A;  3A01 A;  2DA1 A;  2ECC A;  5J1Y A;  1ETW A;  1NEQ A;  3HOZ J;  2ELK A;  3S1M J;  4Z5H A;  1JFS A;  1IV6 A;  3HKZ N;  3MLF A;  1YSE A;  2NS7 A;  2LY9 A;  1UHS A;  3BR3 A;  1BJZ A;  2L7Z A;  1PER L;  1B8I A;  3HBL A;  4DZJ A;  2DA5 A;  1YRN A;  1EFA A;  3F51 A;  3OQO A;  4QIW N;  1QP4 A;  3QPL A;  4L5E A;  2PPX A;  2HI3 A;  3OSG A;  1RZR A;  5C44 J;  4JX5 A;  2H1K A;  1ITY A;  3QQ6 A;  3BTC A;  2LLK A;  3LSG A;  3LOC A;  2MW8 A;  5M5Y J;  1B72 A;  1W0T A;  3GTM J;  3S14 J;  1GT0 C;  1FIA A;  2L49 A;  5DTD A;  4CYC B;  1Y7Y A;  3Q0U A;  1Y1V J;  1ETV A;  2DA3 A;  1PNR A;  3TW6 A;  2DMQ A;  3IH2 A;  3JRG A;  2PUG A;  2VKV A;  1IG7 A;  2NOG A;  2O8K A;  2XIU A;  2WB1 N;  1U9N A;  4M3B A;  4D7M A;  5IOZ A;  2EZI A;  5F04 A;  5EGO B;  2JA7 J;  2JJ7 A;  4RDU A;  3FK7 A;  4XID A;  1S7E A;  2LYL A;  3TP3 A;  1FTT A;  4XRS A;  3PO3 J;  5EDN A;  5M3F J;  4GQM A;  1QPZ A;  1HDP A;  1HDD C;  1ZZB A;  2HDD A;  3SCG A;  2TRT A;  2QF7 A;  4A3E J;  3TED A;  3M4O J;  3BG3 A;  1I6H J;  3JXC L;  3JRD A;  5A7L A;  2MG4 A;  1GV2 A;  2NVQ J;  2IUO A;  4YG1 A;  3G1O A;  4FBI A;  1LCD A;  2R7Z J;  1P7I A;  2O38 A;  3A01 B;  4MO7 A; 
#chains in the Genus database with same CATH topology
 1V5G A;  2QEX I;  1ZZ8 A;  3U1D A;  3RI4 A;  3ZKC A;  1D0Y A;  3BQY A;  2A05 A;  2GIV A;  2WB1 A;  2KRF A;  1KU7 A;  4X4C A;  2A3S A;  2CRG A;  2ODR D;  2L4M A;  3HGG A;  5IYB J;  1YG2 A;  3OYE A;  3CUO A;  3W2W A;  2DOD A;  4HOB A;  1FLI A;  4OWR B;  1UJ8 A;  1BA5 A;  3TO7 A;  4RM3 A;  1UXC A;  3I0T A;  3CCJ I;  5J1U A;  1YTY A;  3Q9S A;  2VE9 A;  4EGY A;  1R9T J;  1G3T A;  2IVQ A;  3LSK A;  3DBH B;  3F6W A;  4BY7 J;  4B3A A;  1R49 A;  3M1E A;  4X4B A;  2DCE A;  1HW5 A;  3O8H A;  2CG4 A;  2FA5 A;  1LDJ A;  3KYC B;  1BM9 A;  1JKP C;  3QPS A;  1W5T A;  2MXD A;  3MEX A;  1P4A A;  5D5U B;  3QU6 A;  3JR9 A;  2HWV A;  3ABM H;  3SZT A;  1I1G A;  1OFC X;  2G9W A;  1OR7 A;  4U87 A;  5KAI C;  4ER7 A;  2LNM A;  1LQC A;  5KHD A;  4OIO F;  2ECB A;  3HYI A;  3OOP A;  4LLL A;  4II2 A;  2KEJ A;  3PUB A;  1ORK A;  1VF9 A;  2Y9Z A;  4A3M J;  3DLA A;  1VZ0 A;  4PK4 A;  2GBY A;  2ZFU A;  1TP4 A;  2ZNY A;  4M9S A;  3GVA A;  3T8R A;  3HOW J;  2VC0 A;  1OSL A;  5IYC J;  1FSH A;  2L01 A;  2HZD A;  3HG9 A;  3K70 C;  5LBQ A;  1H8A C;  1FPQ A;  1ZLJ A;  5ILU A;  2OR1 L;  2XPU A;  4XLC A;  3PFI A;  4GCV A;  3K1M A;  1H89 C;  1MFQ C;  1MSE C;  4M72 A;  1ETX A;  3PM1 A;  3ZQ7 A;  1PUF B;  3NAR A;  5DD8 A;  4UUT A;  1WRJ A;  5L3D A;  3H5T A;  3JRC A;  4H4K C;  3E5U A;  4A0X A;  4AIH A;  3RZZ A;  3KZZ A;  5DV5 A;  4F8D A;  1T8I A;  2VQG A;  3JRE A;  2EFW A;  2GXB A;  5E3O A;  3JXD L;  2A69 F;  3E97 A;  2IGO A;  4D7N A;  1OYI A;  3CCV I;  3P5J A;  5K5O A;  2JUG A;  3UKG A;  5GP9 A;  2OCC H;  1PUE E;  2NXN B;  4EAT A;  4CH7 A;  5IP7 J;  2DT6 A;  2PE5 A;  4OIN F;  3G1M A;  2DMP A;  2LDU A;  2NOJ B;  2ZB9 A;  2Y75 A;  1LNW A;  3S3M A;  3ZR8 X;  2COB A;  2CSO A;  2P5L C;  3MZY A;  3B02 A;  2YUS A;  2Y31 A;  2AO9 A;  1TW2 A;  2W57 A;  2M34 A;  5DM7 F;  1F9N A;  2IVB A;  1A04 A;  2EFP A;  1JFT A;  2PXP A;  1LDK B;  2YU3 A;  5JVT A;  1JE8 A;  5FO5 A;  3TDU C;  3PO2 J;  5DM6 F;  2F5C A;  2PXK A;  3LA7 A;  1OLT A;  2DFF A;  2XAJ A;  4E7Z A;  3E5X A;  2ZFW A;  4NUB A;  1IV8 A;  3S1Q J;  4AU7 A;  1V4R A;  2EV5 A;  4IHV A;  3AL0 C;  1WET A;  5FKL A;  2PI0 A;  2BVM A;  1JKR C;  2ZME A;  4EQQ A;  1DU6 A;  4QTR A;  5DCF A;  1WI3 A;  2HOT A;  4LB5 A;  2RQQ A;  3DKW A;  1YW8 A;  1YIJ I;  3UNG C;  1P4X A;  4AVP A;  3V7C A;  3WE3 A;  2PXD A;  3HOX J;  1XGO A;  2M2E A;  2VE8 A;  2IPQ X;  1QGP A;  5EZG A;  3HEF A;  2HTS A;  5EJC A;  2EWT A;  1U6G A;  3H35 A;  3WHB A;  3GFI A;  5K7H A;  2R7W A;  3CCM I;  3VEP A;  3H3Z A;  4XN0 A;  3DFG A;  3ME5 A;  4IO9 F;  3FIW A;  3DP7 A;  1OCP A;  4EKI A;  1IW7 F;  5F27 A;  2O9L A;  5E3N A;  4NQW B;  3TMO A;  3CCU I;  3I3L A;  3I4P A;  1XB4 A;  5LGT A;  2GXA A;  3CLQ A;  1UTX A;  1OKR A;  2LK2 A;  4PSX A;  1RIO A;  4RLF A;  2LP0 A;  3S16 J;  1D3Y A;  3HOU J;  3W6K B;  2K9Q A;  1VND A;  1VQ5 I;  3KZI C;  4ER5 A;  2LBF B;  2QYO A;  1U5T C;  2PXF A;  1PYV A;  1AA7 A;  2IGM A;  2DFI A;  3JSO A;  5EEH A;  3CCQ I;  1FBS A;  1UG0 A;  1NK2 P;  3C1D A;  1UXD A;  3DTI A;  4BE1 A;  3I56 I;  3E6B A;  4GGG A;  2VQH A;  1VQ8 I;  1ZZ7 A;  4HNT A;  4IZZ A;  3MZ8 A;  1ZHF A;  1ZZC A;  1Z9C A;  1MDM B;  3FF5 A;  4A0Y A;  1DP7 P;  5K7Z A;  4A3F J;  1WZ2 A;  2MD0 A;  1VQ4 I;  5B5E C;  2O03 A;  3GYH X;  2LLW A;  1QQA A;  1K83 J;  1J0R A;  1O7F A;  3GTQ J;  2ZBK A;  4RA2 A;  3FMY A;  3H9J A;  1WCM J;  2MAB A;  1CGP A;  4ENN A;  2JVG A;  3K10 A;  3HTS B;  2IVG A;  3QOE A;  1ETQ A;  1FTZ A;  1OPC A;  3W3C A;  3GTO J;  2V1N A;  4C2T A;  1Y8R B;  1G8X A;  3NWS A;  4XOR A;  4A6D A;  3WTZ A;  4ZYH A;  4IXA A;  3QYE A;  2DQL A;  3BG7 A;  2G7U A;  3FXQ A;  4W97 A;  1T0F A;  1GXP A;  1GVJ A;  1QZE A;  4HST A;  3D5S C;  1Z21 A;  2ID6 A;  2KIM A;  4I01 A;  5ICG A;  4L0Z B;  3PXP A;  1R00 A;  3QQA A;  2R3S A;  2HQ5 A;  2R7S A;  5IP6 A;  2HDW A;  2COM A;  1QPI A;  5F08 A;  3D5L A;  2H6B A;  1AKH A;  2HVR A;  4ZYD A;  3E3V A;  1IAW A;  2DO7 A;  4MEX F;  3K7A J;  2OPT A;  1TQI A;  4ENK A;  4DIQ A;  1FMV A;  5JLW A;  2EZL A;  4YIR X;  2F4I A;  2A68 F;  1A6I A;  4AYB N;  3TL4 X;  2BNM A;  3AFH A;  3CCL I;  3P9K A;  1BBY A;  4FE7 A;  1Y0U A;  4BE2 A;  4UNO A;  3DPT A;  2P7C B;  2BY0 A;  4J00 A;  5LLQ A;  3G71 I;  4I6Z A;  4PSW A;  3WG7 H;  2KZ8 A;  4Q2J A;  1YIO A;  1H0M A;  4KFC A;  4XBF A;  1ZGJ A;  2P5V A;  2PMU A;  4IHX A;  3RKQ A;  4DOZ A;  3GBG A;  5FKK A;  1S8N A;  2BOL A;  5FRN A;  4CZZ A;  1NG7 A;  3GTG J;  3GEZ A;  4FQG A;  5CQG A;  3VOE A;  2O4A A;  2HXO A;  4ENJ A;  3Q0V A;  3MKY B;  3DKY A;  3PNV A;  5IPA A;  1I5Z A;  1FEX A;  4X4H A;  2CUJ A;  4XKC A;  1KON A;  2IS2 A;  3IWF A;  3ZQL A;  2QWW A;  3LSI A;  5EEA A;  3HJE A;  1NK3 P;  5D4S A;  2IGK A;  4CSW A;  1BW5 A;  3F72 A;  4RS8 A;  1SAU A;  2M7A A;  4LK0 F;  4AYB A;  2NNY A;  5IP9 J;  2ICT A;  1TWC J;  1K7A A;  2PUF A;  2EIN H;  5DCM A;  4L9V A;  2NAZ A;  2DLL A;  3F3X A;  1RPE L;  2V6C A;  3S3O A;  4KIC A;  1ODD A;  1DPU A;  2E35 A;  2P7V B;  4I6T A;  3GFL A;  5E3L A;  1I50 J;  4DYR A;  3W2V A;  1P92 A;  2FUG 2;  4MTD A;  2DQR A;  5JHU A;  5LEK A;  1M1E B;  2IVM A;  2R5Y A;  4A12 A;  3NRV A;  3MEJ A;  3NZL A;  3VB2 A;  2FEZ A;  3HUG A;  4R79 A;  2LYQ A;  3GN5 A;  4KNY A;  3OMY A;  1MND A;  3H36 A;  1ZG1 A;  1KU2 A;  3BPV A;  2M9H A;  3Q3S A;  3E5Q A;  2E2J J;  2FML A;  3QYB A;  4B47 A;  4CUG A;  1P9Q C;  3DTE A;  5D6E A;  5GAH i;  5LFA A;  5C3E J;  2Q2E A;  3KP3 A;  1K61 A;  2KZG A;  3TDZ C;  3HDD A;  2QKL B;  5D8L B;  4AVZ A;  2JQE A;  4RGR A;  3NXH A;  4X4D A;  1HKT A;  4X4E A;  2GXG A;  2PXQ A;  2HOE A;  2X6Y A;  3KIO A;  3LSH A;  2KRH A;  2VBW A;  2LYC A;  2JTV A;  1G4D A;  5JFR A;  3CJN A;  2VQL A;  3BCA A;  1MW7 A;  1X19 A;  2XAH A;  4XLH A;  4IOA F;  2JRT A;  2J7W A;  2AQF A;  4XLN F;  2IA2 A;  2WA0 A;  1Z3Y A;  3MCZ A;  5IT3 A;  2PLY A;  1TW3 A;  4X0G A;  3I71 A;  3QFI A;  3K2Z A;  1RUO A;  2W25 A;  1RPW A;  2CW0 F;  3VYR B;  4RGU A;  2KDO A;  3M8J A;  1RKT A;  2CQ7 A;  2E5Z A;  5BQT A;  1N25 A;  3ZGK A;  3DWL E;  3GWZ A;  2LYS A;  3RTR A;  4L0Y B;  4PJN A;  4JBA A;  2LOO A;  2OU2 A;  1SD5 A;  3M8E A;  1O3R A;  4IX7 A;  2RN7 A;  1PVE A;  3RDI A;  5DYM A;  3FXL A;  2JA2 A;  4CCJ A;  1U8B A;  4F7Z A;  3B6A A;  4XR6 A;  4UUS B;  3WTT C;  2DFH A;  2LVS A;  1R36 A;  3BZ6 A;  3HIF A;  5FFZ A;  4RB1 A;  1UFM A;  3VK0 A;  2MEZ A;  4C9Y A;  1XSV A;  2DT5 A;  2ZME C;  1ON1 A;  4JK1 X;  2M8E A;  3W6J B;  2VOO A;  2HU9 A;  2R7O A;  4Z59 A;  2EWN A;  4ESJ A;  1FYL A;  3IAS 2;  1ETY A;  3WHC A;  1IN5 A;  2YX4 A;  3CJT B;  2VUM J;  2X9D A;  1OCT C;  4P96 A;  4PGH A;  2PJR A;  1ZAR A;  1HKQ A;  1TT5 B;  2V6E A;  3L2Q A;  2D1V A;  3BR2 A;  3MN2 A;  2XHK A;  2DA7 A;  1UCR A;  2Q0O A;  3ERM A;  3BJA A;  1ZGW A;  1VFC A;  4U0V A;  3NRO A;  2HNH A;  2EFQ A;  2K3P A;  1P4W A;  4AWX B;  1HBX G;  2OA4 A;  2BHY A;  2FOW A;  3FXM A;  2ISY A;  9ANT A;  2EV6 A;  1RIO H;  1IC8 A;  2L54 A;  1XDU A;  4X4F A;  3ABL H;  5HOO A;  1X3U A;  3C18 A;  1T95 A;  1YFH A;  1H88 C;  2ZXH A;  3GBF A;  2PXB A;  2XI8 A;  2LRE A;  3CD6 I;  3C2B A;  2GOM A;  3OS1 A;  2DA1 A;  2ECC A;  2DK5 A;  1REP C;  3V42 A;  4Z5H A;  2FNP A;  1JFS A;  2DU9 A;  2M3A A;  3BR3 A;  2K9L A;  1W4M A;  4YEL A;  1BC7 C;  2XF6 A;  4B8X A;  3FHN A;  4KJZ A;  1YO5 C;  3KYD B;  4IJA A;  5FRO A;  5FLX Z;  4ENM A;  4L5E A;  2PPX A;  2HR3 A;  3OSG A;  4A0Z A;  1YJN I;  2QM3 A;  3CCS I;  5C44 J;  4GYI A;  2H1K A;  2HGC A;  3BTC A;  3LSG A;  4QWQ A;  3CC2 I;  1W0T A;  4HSR A;  2Z3Y A;  2E1M C;  3GZ5 A;  5E8I A;  1IUY A;  1OCR H;  3DBR B;  1AOY A;  2FF4 A;  4PGG A;  1Y7Y A;  3Q0U A;  2XAG A;  1ETV A;  3TW6 A;  4BQO A;  4BXF A;  4E7S A;  3IH2 A;  2HVS A;  1S7O A;  2ZJR F;  3L2V A;  3GLL A;  1UB9 A;  4LLG F;  2VKV A;  5CPR B;  2PUG A;  2O8K A;  2NOG A;  3T1B A;  2XIU A;  5FD6 A;  2B0L A;  5LHI A;  1LEB A;  3IL2 A;  2EZI A;  3TEP A;  4HAM A;  3OYF A;  1ZLK A;  5EGO B;  1QPM A;  3FK7 A;  1D5Y A;  2RNJ A;  3G2B A;  1T0F C;  3GXO A;  5J6X A;  3TP3 A;  3PO3 J;  4GQM A;  2IA1 A;  3QOX A;  4UUV A;  2VJ4 A;  1HDD C;  2ESH A;  2PXE A;  2HDD A;  4PJJ A;  4OAY A;  1VQ7 I;  1W5S A;  1S7A A;  4XLP F;  3QYF A;  2STW A;  4I7H A;  4YII A;  5FGM A;  3ZN1 A;  3JRD A;  2JVH A;  2EJR A;  3JAM Z;  1GV2 A;  2NVQ J;  2XSJ C;  3P9I A;  4FBI A;  2R7Z J;  4S04 A;  2O38 A;  3A01 B;  4IHT A;  1VQN I;  1GDT A;  4IVZ A;  1IRX A;  2Y48 A;  3VYT B;  2JUC A;  4M3F A;  4MLO A;  2Y0M A;  2CQX A;  4GHJ A;  3IKV A;  2DOE A;  2CGP A;  2B63 J;  5E79 C;  5LD2 C;  1B8I B;  1YRN B;  2M0C A;  2HFZ A;  1NHA A;  4CZC A;  3FBI B;  1JTY A;  4Z6Y A;  3FYA A;  2LRD A;  1PUF A;  4HX7 A;  3BS3 A;  2A6C A;  3DU5 A;  5AIQ A;  1BR1 A;  4J1X A;  1Z3X A;  2XXP A;  2YPR A;  2MC3 A;  2L8N A;  1JTX A;  1EH7 A;  3ASN H;  1QU3 A;  2VKE A;  4CGZ A;  1QNT A;  3LSR A;  2Z33 A;  3Q0W A;  2YU9 J;  4IA8 A;  1X4O A;  1RET A;  4MQV A;  4UVA A;  3S8Q A;  1FY7 A;  1NER A;  4EKG A;  3ECO A;  4I02 A;  3QOW A;  1N78 A;  2PXV A;  3QPH A;  1SVM A;  3I4N J;  4HPQ A;  1MBE A;  3RQI A;  2H94 A;  3HUG B;  2LD5 A;  3HOT A;  1A36 A;  2DMN A;  2JSP A;  3I53 A;  4KYW A;  2GRM A;  2O0Y A;  2R92 J;  3DQV C;  2M8G X;  3RIR A;  3FZV A;  4AIK A;  4ZDP A;  2OV7 A;  3W6V A;  2L9S A;  4OB4 A;  3V4G A;  3FX3 A;  2R5Z A;  4BXX J;  2Q2E B;  2ZJ2 A;  2KLO A;  2MBF A;  3TKY A;  4PU7 A;  4IRI A;  1MMS A;  4UB8 C;  1I1S A;  5FKM A;  2QEN A;  5DSX A;  2LTP A;  5CLS A;  4EEF G;  1HST A;  3RKX A;  1MJA A;  3ELK A;  4OAZ A;  4NC7 A;  2QQA A;  4AM3 A;  2VAS A;  3F8F A;  4KMU X;  1HKS A;  2IS4 A;  2HEO A;  2QBY B;  3S15 J;  2LKX A;  2L02 A;  3MQ0 A;  3SR4 A;  4V2G A;  4M3G A;  1SMT A;  3F22 A;  3BG9 A;  3IVP A;  4Y33 A;  3JAM K;  2XAS A;  3BZC A;  1MD0 A;  2ZJQ F;  2NVU B;  3CJR B;  3DM5 A;  3DNV B;  4XIC A;  4IVN A;  2V26 A;  4UVC A;  2DJI A;  2DMU A;  1BDH A;  4NQW A;  2FQ3 A;  3OYA A;  2LYR A;  4ZYA A;  5CQE A;  3BDN A;  2K86 A;  3BTI A;  1WVR A;  4GO1 A;  1YLF A;  3P7N A;  3ZPX A;  1MH4 A;  2ADU A;  3IRR A;  3R4K A;  4IHS A;  4DNC A;  1KQ9 A;  2VB6 A;  2XCJ A;  1Z0X A;  4XK4 A;  5HLH A;  4CIC A;  2LBF A;  4X1E A;  1G3Y A;  1XG1 A;  2NVX J;  3SFZ A;  3VFZ A;  4BQA A;  2O8X A;  5BPI A;  3F8N A;  2OF7 A;  1QQB A;  2EIL H;  3VYU B;  1NW3 A;  3IAM 2;  4EJV A;  2DA2 A;  3HRM A;  3WE2 A;  2F4M B;  2MQK A;  2IP2 A;  4HRA A;  2QQ8 A;  1W7P B;  3HB9 A;  5AIP A;  2O6G E;  1SFX A;  4YEJ A;  1MDM A;  1BI2 A;  3OYK A;  3R61 A;  2M4G A;  1UG2 A;  3BRO A;  2CQN A;  1BIB A;  2KL4 A;  1XGS A;  4ZC3 A;  3CP2 A;  2VON A;  1X1D A;  2X0L A;  5F0H A;  2EB7 A;  1LUJ B;  1RC9 A;  3HC7 A;  2OD5 A;  2L4A A;  3I9V 2;  4Q48 A;  5K5R A;  5C4J J;  1TLH B;  2ME0 A;  4A69 C;  1IRG A;  1VPW A;  2ZSI B;  1I3Q J;  3HM5 A;  5DTM A;  2CO5 A;  1FX7 A;  2CQK A;  2V9V A;  4UHT A;  1Z67 A;  2VKH A;  2J5O A;  3B6C A;  5FJ8 J;  5FFX A;  3GZN B;  3LSP A;  1HQ1 A;  2ACJ A;  2IU7 A;  3QAH A;  2K9N A;  3CES A;  3HXL A;  3CQZ J;  2VXZ A;  3CZ6 A;  4V2F A;  5LRS A;  5K1Y A;  3F52 A;  3TO6 A;  5EYR A;  1LVK A;  1KZH A;  1APL C;  1POG A;  4FE4 A;  3BY6 A;  5E1Z B;  3KYL A;  3CDI A;  1ZG5 A;  2JQ7 A;  5TRD A;  1QVU A;  2Y69 H;  3MKZ A;  4I76 A;  4OIQ F;  1I3A A;  4M3D A;  1U78 A;  3IH3 A;  1VQM I;  1OCC H;  4LIU A;  2M87 A;  1GHC A;  1SQ8 A;  1JHH A;  1LE8 B;  2WAQ N;  1BI0 A;  1R6R A;  5TGT A;  4AC0 A;  3J7Y J;  4ZYG A;  3V7R A;  2XSD C;  5DUI A;  5E1W A;  3U21 A;  1J75 A;  5L3C A;  4G12 A;  2DYR H;  1T98 A;  4HW0 A;  3LA2 A;  3S2H J;  4EZI A;  3A0H C;  3LQX A;  1X58 A;  5EG0 B;  3DTK A;  1LFB A;  2MLK A;  5L3E A;  1YHQ I;  3SXY A;  3G6E I;  2HTJ A;  5TIS C;  3F23 A;  1TC3 C;  2GLO A;  3OQM A;  4ZTF A;  1GV5 A;  4F91 B;  1T39 A;  3FMQ A;  1D5V A;  2YR2 A;  2D1H A;  4B48 A;  1W1W E;  4P9F A;  3M1C A;  1SFK A;  4X6A J;  1WJB A;  1XMA A;  3GFM A;  3GO5 A;  3OIQ A;  4XSX F;  4CA0 A;  4UXN A;  1MMG A;  2W1O A;  4UY8 I;  2XVC A;  2WAQ A;  4LJZ F;  5ERI A;  1G3S A;  4BKX A;  2VT3 A;  4HEA 2;  3L09 A;  4G7Z F;  1KQ0 A;  2FXA A;  2O49 A;  3A9Y A;  1QHH D;  5EEG A;  1G59 A;  1S5L C;  2EV0 A;  1R63 A;  1A31 A;  3K4J A;  3R1F A;  1WH6 A;  1VQL I;  4CCL A;  3SEZ A;  1L1M A;  2GWR A;  2K02 A;  2NRA C;  1A35 A;  5FLV A;  2PUE A;  2HOS A;  4P1W A;  2OQR A;  3EDP A;  1IN4 A;  5JLX A;  2DPD A;  4U7D A;  1FWZ A;  2JWT A;  4BS9 A;  3S17 J;  2R7U A;  2WAF A;  4XNF A;  2GAU A;  3FBN B;  1JKQ C;  1XN7 A;  4HLX A;  5HVQ C;  4QPQ A;  1X1A A;  2B7E A;  3LAP A;  5KK1 A;  4EJU A;  5IOY A;  3JRB A;  3BR5 A;  3N4M A;  3BLY A;  1HQC A;  3GCM A;  3LFP A;  2RRE A;  3AG1 H;  3LST A;  1AU7 A;  2CQQ A;  4BU2 A;  2MA3 A;  2EBI A;  4C3I J;  1FYK A;  2FBI A;  1TT0 A;  5GPA A;  2R5Z B;  3OYB A;  2XUB A;  3LFU A;  5F6F A;  4BAC A;  4J19 A;  4O8B A;  1V5F A;  5DRT A;  1KGS A;  1OMI A;  1B0N A;  5LGU A;  1QA6 A;  2KDZ A;  1MMA A;  1JGS A;  3DEU A;  1MNE A;  3WU2 C;  2EA2 A;  3OL3 A;  1FOK A;  2FU4 A;  2AXV A;  3OYH A;  2H8W A;  3G7D A;  2LY2 A;  3RZD J;  1NH3 A;  5FD5 A;  2K40 A;  4ZJZ A;  1XD7 A;  4UUS A;  1X4P A;  2RVC A;  2OBP A;  4I99 C;  2ZXW H;  4LFU A;  3RCO A;  3E6C C;  3OP9 A;  1OJL A;  2FSW A;  2EK5 A;  2P8T A;  1KYZ A;  2LY1 A;  2PG4 A;  1DGR M;  3ZMT A;  2XRL A;  4BGD A;  3I54 A;  2L2O A;  2YBD A;  3FMR A;  2KEI A;  1R23 A;  4FX4 A;  2Y0S N;  2KRC A;  4E7I A;  5BMZ A;  4Y52 J;  3O8G A;  3CP8 A;  1ZK8 A;  3ZPL A;  1BC8 C;  1ZR2 A;  3BQZ A;  5F64 A;  3GZ6 A;  3KL4 A;  2ZCW A;  4XLA A;  1ZAY A;  3I59 B;  3SZG A;  3JTG A;  1DUX C;  2DDB A;  2A6T A;  3KX2 A;  5KNL A;  4A3G J;  4KIF A;  4RGS A;  1IRZ A;  3BG6 A;  3AG4 H;  4GFB A;  2WIU B;  2OTJ I;  2DTZ A;  1ZQ3 P;  2KIQ A;  1LLI A;  1USS A;  3OL4 A;  1BI3 A;  2P6T A;  3WTY C;  1Q1H A;  1TWG J;  3PL8 A;  1EV7 A;  5CVI A;  3OYG A;  1Z6R A;  4P5O A;  2UV1 A;  1IZ1 A;  3R0A A;  1T2K A;  1B1B A;  3MWM A;  4ZDL A;  5E18 F;  3J7A Y;  2NS0 A;  5K7F A;  3ZN0 A;  3GZD C;  1SVO A;  3TRB A;  2LC2 A;  4PDK A;  3CMY A;  1X3Z B;  2Y0S A;  4X4I A;  4BQN A;  3OSF A;  4F3Q A;  1MBH A;  2ZSH B;  1OCO H;  1IN7 A;  4XON A;  1MMN A;  5KAF C;  3LFK A;  3F9K A;  3MVP A;  3MAJ A;  3WOD F;  5BS6 A;  1BN5 A;  1X3W B;  1XMX A;  1I39 A;  4IF4 A;  1WI9 A;  5ICF A;  2QQ9 A;  2C6Y A;  2NS8 A;  1QP7 A;  5J47 A;  3GTL J;  1DDN A;  4NBQ A;  3TEL A;  3K0L A;  4I6R A;  1TBX A;  1IF1 A;  3AKZ A;  4AD9 A;  4YBA A;  2XB0 X;  4RM2 A;  1GLN A;  5F0F A;  3OMT A;  3CUQ B;  1FOX A;  2KPJ A;  3BR6 A;  1DU0 A;  1T38 A;  5GTH C;  2Q1Z B;  4FN3 A;  1BJA A;  2BXZ A;  3RJP A;  4CCM A;  1ZUG A;  2LYJ A;  3LQR A;  2OC6 A;  3RQ4 A;  3LNQ A;  3FXO A;  3I64 A;  1TWF J;  4C2M J;  2WWY A;  4I8T A;  5H20 A;  5LHH A;  5EGO A;  1SFE A;  3K4L A;  4EK9 A;  1Z7U A;  1BIA A;  1W36 D;  3KZY A;  1TWA J;  2LSO A;  4P55 A;  1HC8 A;  1JKO C;  3NAU A;  3CO6 C;  2AWI A;  4MQ9 F;  2W85 A;  2N8G A;  4KT6 A;  4LGW A;  3HRS A;  3C2G A;  4GDF A;  1MZB A;  2R0Q C;  1GVD A;  4MCX A;  2JMW A;  3HHG A;  3REO A;  2IRF G;  3KFW X;  1IXR C;  2EIM H;  3A01 A;  3OYC A;  3M7G A;  1ZRD A;  4Q5S F;  1ETW A;  3HOZ J;  2VOD A;  1FBU A;  3HKZ N;  3O2P E;  3MLF A;  2LY9 A;  1UHS A;  2IJL A;  3ULQ B;  2R7T A;  4F52 A;  1B8I A;  4DZJ A;  1YRN A;  2DA5 A;  3K4C A;  5J8F A;  3A9Z A;  2HI3 A;  1OR7 C;  5D8K B;  1Y56 A;  4QLC U;  2LLK A;  4M74 A;  3LOC A;  3T8T A;  5M5Y J;  3GTM J;  2WY7 Q;  3S14 J;  1KYW A;  1XGN A;  4FT8 A;  2L49 A;  5CVU A;  1UAA A;  4CYC B;  3HPG A;  3U9G A;  2DBB A;  1PNR A;  2EIK H;  1EKE A;  4L5J A;  2DMQ A;  4BYY A;  4HQM A;  3JRG A;  2M4H A;  2AXL A;  2BBY A;  1IG7 A;  5CJ9 A;  2M45 A;  4IQJ A;  2KKO A;  4BE0 A;  2EPF A;  4G9Y A;  3I55 I;  2UWM A;  4ZTJ A;  2K27 A;  4WXH A;  1D1B A;  3HKZ A;  2JA7 J;  2JJ7 A;  3KP5 A;  2Z9O A;  2VJJ A;  2MD5 A;  3ROU A;  1FTT A;  3VWS A;  2K4B A;  5EDN A;  3KET A;  1PJR A;  3FWE A;  1HDP A;  4EM1 A;  5B66 C;  2LF8 A;  4KUM A;  4CDG A;  2HKX A;  2QVO A;  4Q47 A;  1ZZB A;  4GYG A;  2A6H F;  1TQP A;  2TRT A;  1WJA A;  2XXA A;  1R71 A;  2X51 A;  5CKT A;  4A3E J;  2M5W A;  1B6A A;  1YS7 A;  2H6C A;  3BG3 A;  3M4O J;  2A61 A;  3KP4 A;  3JXC L;  3EQL F;  3IHU A;  5DTQ A;  5CYV A;  2XAU A;  2KMU A;  3AAF A;  2A5W A;  1LCD A;  3FMS A;  3NQO A;  1JGG A;  3OWT A;  3S32 A;  4AIJ A;  3KPH A;  2NVY J;  3OOU A;  1F5T A;  4PZJ A;  3OYD A;  5DTR A;  1S3J A;  5LHG A;  1JT6 A;  2L0K A;  2PXT A;  4Z2Y A;  3HTU A;  3ESW B;  1B59 A;  2XGE A;  2VL8 A;  5H6R A;  4WCG A;  3WTX C;  2QBY A;  2Z16 A;  2EH3 A;  2JZY A;  2BV6 A;  4XRS G;  3FXR A;  1K4T A;  2R93 J;  3F6O A;  3F8B A;  1FC3 A;  4WF2 A;  2QA4 I;  1R5H A;  2HFH A;  3BJO A;  2DA4 A;  4NHJ A;  1OCZ H;  2DI3 A;  3RZO J;  2QKM B;  4HX8 A;  1WH8 A;  3CMA I;  2VKD A;  5GTI C;  1D8J A;  3SDG A;  1J2X A;  1E3H A;  3GME A;  3DEE A;  3QF3 A;  2PN6 A;  2BY1 A;  3CO7 C;  4Y42 A;  4JCY A;  1HOM A;  4M9Z A;  3EET A;  3LSJ A;  1YW7 A;  3QPT A;  1JUM A;  1X2N A;  3K1N A;  1OYW A;  3TQN A;  1BDI A;  3GW2 A;  3ZRG A;  3RPQ A;  1MBG A;  2BGC A;  3DXJ F;  3FIS A;  5HNH A;  4XM3 A;  1JUS A;  4EJT A;  2XKP A;  2RNG A;  3WTW C;  1F36 A;  3KP2 A;  2KJB A;  2NNN A;  3PUF A;  3P9C A;  4QPO A;  3EUA A;  3SCF A;  1Y39 A;  4ESB A;  2NVT J;  2HCS A;  3PQK A;  3GZC A;  3BDD A;  3S1N J;  4WXD A;  2VJI A;  3HOS A;  3SYT A;  2FJR A;  4DGW B;  4XRM A;  5CVV A;  2ZJP F;  2LKP A;  1BW6 A;  3PIO F;  1LMB 3;  5HOD A;  1W7P A;  4DYQ A;  1ZG3 A;  2BXY A;  3IV5 A;  1YX5 A;  1MMD A;  1XMK A;  2H1L A;  2KIU A;  4WK8 F;  1XCV A;  1LCC A;  1R1T A;  3KEY A;  2GQQ A;  1QHG A;  3DPL C;  3G1L A;  3F0C A;  3U1K A;  3E6M A;  3BTL A;  1MJ9 A;  2RAE A;  4HDV A;  2BHZ A;  3QYX A;  3S2W A;  1H9T A;  4A93 J;  2KT0 A;  3M9L A;  1TZL A;  3OY9 A;  1IGN A;  2LLV A;  3SDB A;  2PUB A;  1T33 A;  3BP8 A;  5KCM A;  4HLY A;  3RYP A;  3L2R A;  4YG4 A;  4HRI A;  2ISZ A;  2K9M A;  1X57 A;  2M7B A;  3K6G A;  4MIM A;  1WGX A;  1MBK A;  4XKV A;  2Q8K A;  5HLI A;  1ZTR A;  2UZK A;  1Y8Q B;  5E3M A;  2PUC A;  5GAG J;  3SJM A;  5FKO A;  1UHM A;  4MHG A;  2E5N A;  1FOY A;  5L3B A;  1WKM A;  1ZKG A;  2UXN A;  4XKB A;  3WU0 A;  3K4M A;  2YS9 A;  4IL6 C;  2M30 A;  2MH9 A;  5DDG A;  2BY3 A;  3TW7 A;  4A3K J;  2FRH A;  3ZMZ A;  4DW6 A;  3DU6 A;  2HPI A;  1E2X A;  2QCO A;  3S93 A;  2BNO A;  1IDZ A;  3BTJ A;  3S1R J;  1QB2 A;  5TJJ A;  3RSN A;  1CJG A;  2HQN A;  3VOD A;  1LE8 A;  4A3B J;  2VPR A;  4Z5D A;  3A02 A;  5M5X J;  1QBJ A;  2CSF A;  4Z58 A;  4Y7N J;  2F5F A;  3ZQI A;  1IN6 A;  5M5W J;  5ICE A;  2PEX A;  3AG3 H;  2A6E F;  2JRM A;  4E70 A;  2QSG X;  3H5A A;  5EG0 A;  1UMQ A;  5HS8 A;  1JJ8 C;  4OMY A;  1MNM C;  1LKX A;  1GUU A;  2Y9Y A;  3T5X A;  3PE5 A;  2R1J L;  1DW9 A;  1XSD A;  2L7M P;  3KCC A;  4RAY A;  2R7F A;  1G6N A;  1WH5 A;  4MTE A;  3U3W A;  1LFP A;  1MBF A;  5CVR A;  4W1U A;  5L3G A;  1QZY A;  1XS9 A;  1O4X A;  2W48 A;  4N9H A;  2GRL A;  2BY2 A;  2KFD A;  2KHM A;  3UR3 C;  2VPL A;  3OIO A;  2Z99 A;  3OV8 A;  1W5C C;  2IEK A;  3OYM A;  2JVL A;  3H3V K;  3BD1 A;  3ECH A;  4A5N A;  1ZH5 A;  1F43 A;  4B44 A;  4YFN F;  2CH0 A;  1U8R A;  2WAE A;  4C2U A;  1EH6 A;  3L9F A;  5HLG A;  3GLX A;  3QWG A;  4L18 B;  3F21 A;  2XKO A;  2FD5 A;  3ZHI A;  1QRY A;  3RKY A;  4BL0 B;  2ICW G;  4LD5 A;  1W7P D;  2R7V A;  4BBS J;  1ULY A;  3K4N A;  1WJC A;  2KPM A;  3DKX A;  1DGW Y;  2LKS A;  2K85 A;  5HNF A;  3H9Q A;  2PX9 A;  5J3L A;  3EYY A;  1OQY A;  3KZ3 A;  1HXD A;  2CS3 A;  3CJQ B;  4HNU A;  1VTN C;  4A6E A;  1SMY F;  5J4V A;  2W4S A;  2A07 F;  2CV2 A;  4C3J J;  2VBY A;  1PP7 U;  2JA8 J;  4YG7 B;  1YS6 A;  2CYY A;  1RKW A;  1D1C A;  4EJO A;  5BOX A;  4I2O A;  2AXU A;  3KP6 A;  1ZVV A;  4M6X A;  2M4K A;  2EFO A;  3ZQG A;  2KIS A;  5ILS A;  1IJW C;  1QQI A;  4KMF A;  3QRF F;  2D5V A;  1FIP A;  1YYV A;  4H0E A;  2V9K A;  1WJD A;  2XRN A;  4U88 A;  2WAD A;  3FM3 A;  1KQ8 A;  2V7F A;  4B43 A;  3SCH A;  3Q5F A;  4MFE A;  1JT0 A;  1RI7 A;  4G94 A;  1SEU A;  2M0M A;  1P2F A;  2AXT C;  4HF0 A;  2E7X A;  4FTH A;  1R5I D;  3CRO L;  4YFX F;  4L9N A;  1K79 A;  2O7O A;  1WSU A;  4EJW A;  1FOW A;  1AWC A;  1JJ6 C;  3D1N I;  3VYS B;  4L9T A;  3O3K A;  5DS9 A;  4O3M A;  4YIF A;  2QZ8 A;  1YQA A;  5LGN A;  2BJC A;  3I59 A;  2BW3 B;  3IH4 A;  4HV5 A;  4BY1 J;  1UZC A;  1T6S A;  3GUU A;  3TO9 A;  3JRA A;  2LFB A;  1N75 A;  3NDB B;  1ZS4 A;  2H27 A;  2RQP A;  1RRJ A;  1N77 A;  1EH8 A;  3CME I;  3CLC A;  2P6S A;  5LRR A;  5ILV A;  2V4J C;  2LF7 A;  2K4J A;  1WWX A;  2V1D A;  3I58 A;  3O6B B;  2L7K A;  3HZJ A;  3L2C A;  4MCT A;  2DT7 B;  5H2F C;  2QSF X;  3E1S A;  1LQ1 A;  5E20 A;  4IHY A;  3G5G A;  2IGN A;  2WUS R;  2ID3 A;  5HDK A;  3H3U A;  2JCG A;  3LAJ A;  4TV7 A;  2E1N A;  1KA8 A;  4XLF A;  3IKT A;  1FMW A;  2QUF A;  3H1C A;  3K70 D;  3CC7 I;  2R7D A;  3ZQC A;  1K4S A;  1U2W A;  1HCR A;  1JHF A;  3CEC A;  2QLZ A;  1YE9 A;  1ZRC A;  1P7J A;  1PDN C;  1ZZ9 A;  4WVL A;  4U7B A;  1IXS B;  3BT9 A;  5B1A H;  4FX0 A;  1VQ9 I;  2L3D A;  3CF2 A;  5AON A;  4QSH A;  4AUX A;  4PU4 C;  4LG3 A;  3E7L A;  4G6T B;  4G6Q A;  1TL8 A;  1XDS A;  1R69 A;  4B3X A;  2LR8 A;  4N9I A;  5BPD A;  4G7O F;  5GAE J;  2FJ1 A;  3GUD A;  4KIT B;  2F4O B;  3HGY A;  2HCN A;  3L00 A;  4ON0 A;  1A5J A;  2L5Q A;  1JXS A;  3TGN A;  3SZP A;  3CUQ A;  4MGR A;  4ZDO A;  4U0W A;  1BI1 A;  1VI0 A;  2HOA A;  4DBQ A;  3SX0 A;  4JX6 A;  2STT A;  3L1P A;  1PRU A;  2HQA A;  2CV0 A;  1EF4 A;  1QZZ A;  3ZHM A;  4UV8 A;  2RDP A;  4PJ0 C;  2DMT A;  4XL9 A;  2DOA A;  1WJE A;  2V79 A;  3A2K A;  3BZK A;  4KIG A;  2LCV A;  1VQP I;  2FBK A;  3CMM A;  2GOX B;  1XCB A;  3FXK A;  5D5V B;  1H9G A;  1F4K A;  2P5K A;  4HG2 A;  4ABZ A;  2PMH A;  2P4W A;  1SVL A;  3DF8 A;  4B4C A;  3GX4 X;  3BPX A;  4HA8 A;  3HSF A;  3L2U A;  1X1P A;  3GTK J;  2CMP A;  4BAY A;  4KIB A;  3PQJ A;  2X6W A;  4CO8 A;  4F92 B;  5D5W B;  4LOC A;  4O6J A;  3KE2 A;  2V3C C;  3I4M J;  2K5C A;  3ZMD A;  1FP1 D;  2F6C A;  4GRI A;  3ASO H;  2FQ4 A;  2H8R A;  1POU A;  1Y1W J;  1XWR A;  1BL0 A;  4CYD A;  2HDC A;  5D6F A;  1Z1D A;  4RLQ A;  5F1J A;  1K78 B;  3E6D A;  1STZ A;  1X2L A;  5FKN A;  2RC4 A;  3OR1 C;  4BQQ A;  1S9H A;  4ETS A;  2PUA A;  2O5R A;  1J59 A;  5IT9 Z;  2H09 A;  2F5V A;  2QQB A;  4IWR A;  2OAZ A;  1QZX A;  2XAQ A;  2FE3 A;  3IP4 B;  1CF7 B;  3Q9V A;  1F1Z A;  2D45 A;  2IXS A;  3M07 A;  4HBL A;  4Y13 A;  4CYC A;  5GPC A;  3FK6 A;  1QP0 A;  3U2R A;  4ESF A;  2B9S A;  1Z7L A;  2XXQ A;  4BEH A;  3FHZ A;  2PJP A;  2Z2S B;  3MKL A;  4WX9 A;  1V54 H;  5HDN A;  4UB6 C;  2X1D A;  4BHB A;  2WV1 A;  2JA5 J;  3C7J A;  5DRY A;  3FDY A;  3V8K A;  2XRO A;  1ETK A;  3ZCO A;  4G8X A;  2DPU A;  2OZ6 A;  3HZI B;  4IQ4 A;  2DJN A;  2LYP A;  1Y6I A;  3QU3 A;  1ON2 A;  1FT9 A;  3ABU A;  4IEJ A;  4E4H A;  3PIP F;  3ERE D;  1Z6T A;  1LPQ A;  2K3F A;  1G2H A;  2GA1 A;  3PSF A;  4XRF A;  2Z5U A;  1WIZ A;  2OQG A;  1RZR D;  1ETO A;  4EMS A;  2OZU A;  4J01 A;  5EZH A;  4IHW A;  1B4A A;  1TQM A;  4RB3 C;  5FB2 A;  2HYF A;  4HNV A;  1V3F A;  5B1B H;  1LVA A;  4G7H F;  3M8F A;  2EIJ H;  2ZXJ A;  4M71 A;  5B3S H;  5J1Y A;  1DQU A;  3R60 A;  1NEQ A;  2BEO A;  2G7H A;  1IV6 A;  1YSE A;  2NS7 A;  1IRF A;  4V19 K;  1D8K A;  3RKW A;  5JUW A;  5A2Q Z;  3WTS C;  1BJZ A;  5HS7 A;  3H0D A;  3HRT A;  3DV8 A;  4YRV A;  2F5D A;  1QP4 A;  3OQO A;  1FSE A;  4KDP A;  3HL2 A;  1MJB A;  5DUK A;  3QQ6 A;  1SAX A;  2I5U A;  5JR3 A;  2MW8 A;  3A0B C;  3FXU A;  2KQR A;  5DTD A;  4XQF A;  3MD2 A;  4I0B A;  4DE9 A;  4YG2 F;  3AL0 B;  4WWC A;  2DA3 A;  3J80 Z;  4IOC F;  2PBI A;  4BJ6 C;  5K5Q A;  1DPR A;  3OYI A;  4PJL A;  1U9N A;  4D7M A;  5IOZ A;  3G4S I;  3BJ6 A;  3WGH A;  5F04 A;  2IW5 A;  2KJC A;  2LYL A;  2PQ8 A;  1SC7 A;  2VIX A;  4E7H A;  4XRS A;  5IT9 K;  4ANJ A;  3PNY A;  2R7R A;  4KT5 C;  4K2E A;  3ABK H;  5GAH J;  4ER3 A;  2QF7 A;  3L7W A;  3LSM A;  4MNU A;  3WTU C;  5H6Q A;  2LMD A;  1E17 A;  1KU3 A;  3K4B A;  4YG1 A;  1BR4 A;  1RR8 C;  4BJ5 C;  1P7I A;  3ML6 A;  5E17 F;  2BNN A;  3W2A A;  1XC5 A;  3BG5 A;  5BNG A;  3ZMV A;  2EZK A;  3OYL A;  1LJ9 A;  1BOB A;  1R4N B;  3D0S A;  3FKI J;  4HF1 A;  1W0U A;  1ZRF A;  6PAX A;  1U5T B;  3CTA A;  4BHP A;  1QVT A;  1Z91 A;  2E2H J;  3KP7 A;  3DLL F;  3R09 A;  2ZC2 A;  1ZR4 A;  3F8C A;  4IRG A;  4OU0 A;  1J09 A;  2DFE A;  4DYC A;  1U2Z A;  2PXU A;  4C30 A;  2O61 A;  2P81 A;  2HPM A;  2XC7 A;  1ZGA A;  1B72 B;  3ZQH A;  1SD7 A;  4DJA A;  4LG0 B;  1DWK A;  3OR2 C;  1A6Q A;  5F1R A;  2CUF A;  1R1V A;  1V5E A;  2VBZ A;  2L7F P;  2IS6 A;  3FYM A;  3K4K A;  2W00 A;  3ZQF A;  3OKZ A;  3S3N A;  2IS1 A;  5J4Y A;  1CQT A;  5A2Q K;  2E1C A;  2E19 A;  2ELJ A;  2F5E A;  2WY8 Q;  3C2H A;  4Z5C A;  2HQR A;  1TNT A;  1OIS A;  2DN0 A;  5DD4 A;  1XGM A;  1B9M A;  2F2E A;  3LMM A;  1YIT I;  2FNA A;  5E1X A;  3PJR A;  1J9I A;  1HA8 A;  2XV4 S;  3ZP5 A;  2VEO A;  3V8L A;  2W24 A;  2XIG A;  4NC8 A;  4ZZL A;  3GF2 A;  3SHF A;  2X1E A;  3H5R A;  4IKF A;  5L3F A;  3JXB C;  4HF2 A;  4UVB A;  1UEL B;  3MMY B;  4FET A;  4E7L A;  2R7Q A;  3BR0 A;  3J80 K;  4JYK A;  3MZH A;  3QOP A;  4BBR J;  2MFZ A;  2YSR A;  2CW8 A;  1SFO J;  3R6S A;  3CUQ C;  3KEO A;  2VN2 A;  1XTA A;  2XGX A;  2G0E A;  4RAZ A;  2CWE A;  1EJ9 A;  1UHW A;  3VSK A;  1T08 B;  2BE5 F;  2LNB A;  4CHU A;  2GZU A;  2OTL I;  2L9V A;  3F6V A;  4A5M A;  4OOI A;  3A1Y A;  1YJW I;  5DEQ A;  1VQO I;  2WBM A;  2XGD A;  4FHT A;  1HW1 A;  1BOA A;  3WG9 A;  1RZS A;  1Y0N A;  2DYS H;  3MFK A;  4KA4 A;  2WC2 A;  4EQZ A;  1JH9 A;  4ZH4 F;  3D5R C;  2CUE A;  4ZZD A;  1Q1V A;  1O3S A;  3K9T A;  4M6V A;  2JPB A;  4RBO A;  3EUK L;  3OS0 A;  2E2I J;  3OIP A;  3TOB A;  2DXI A;  5K98 B;  1I27 A;  3SQN A;  2R4G A;  1X1C A;  4E7J A;  2ZKZ A;  1IUF A;  3KEQ A;  1TTY A;  4I98 B;  2R7X A;  2XGC A;  2VBX A;  4G6D A;  3CC4 I;  2XAF A;  1RES A;  4ER0 A;  3H9G A;  4PU3 C;  3GTJ J;  3PSI A;  2X6O A;  3EYI A;  2TCT A;  2X48 A;  1DUL A;  3BCB A;  3LIS A;  4XOT A;  2IAI A;  3BOQ A;  3PNT A;  3CCE I;  3F8M A;  2PUD A;  5M3M J;  4BEH B;  3NWT A;  1D0X A;  4L9J A;  2XDV A;  2RV8 A;  5HDG A;  2DDA A;  3JRH A;  2OFY A;  1IXC A;  3CLO A;  3HHH A;  2VQC A;  4FAS D;  3DPU A;  4PU8 A;  2HSG A;  2KP6 A;  2IT0 A;  4LIT A;  3N97 A;  1R4M B;  3RYR A;  4BDY A;  2VJ5 A;  4M73 A;  1O3T A;  1WJF A;  4BNC A;  3B73 A;  3ISP A;  2XJ3 A;  1ONV A;  2OJE D;  2L1P A;  4PFO A;  1G3W A;  4MEY F;  4OIR F;  4BHC A;  4NNJ A;  4HDU A;  4A3C J;  2EBY A;  4RAG A;  1L0O C;  3JCU C;  3LL7 A;  2W82 A;  4B09 A;  1MSF C;  2V1X A;  2M1B A;  2WTE A;  1RZ4 A;  1XSX A;  1IN8 A;  2QSH X;  4YFK F;  2O3F A;  2ZXI A;  2E1O A;  3A03 A;  2XPV A;  5HLT A;  2W7N A;  1LFU P;  2IA0 A;  4HYE A;  4UV9 A;  1E0E A;  4HV6 A;  2JK3 A;  2XB5 A;  1QO0 D;  4B1R A;  2AXZ A;  1FBQ A;  2E71 A;  1EA3 A;  3S2D J;  3ZQQ A;  2HIN A;  2PFB A;  1W36 C;  2X1C A;  3CDL A;  1K6O A;  2MSY A;  1HW2 A;  1LB2 A;  2DAO A;  3B7H A;  1E3P A;  2EZH A;  3EUH A;  3ABT A;  3DCF A;  4YAR A;  1O57 A;  4D5F A;  2BW3 A;  5F0C A;  1RR7 A;  4XOP A;  3LWF A;  2CV1 A;  1IO2 A;  1XPX A;  2CU7 A;  3HRU A;  2GM4 A;  5E8G A;  2OUM A;  1ENH A;  2P0W A;  1L3L A;  2IV1 A;  2BYV E;  2V9P A;  2X85 A;  4I0A A;  2ZME B;  4BXU A;  4KIS A;  1K6Y A;  1ACI A;  1J5Y A;  2LYK A;  3BC8 A;  2UXX A;  1PRA A;  4LIV A;  2CUZ A;  3CDH A;  4D1Q A;  1WJ5 A;  4CCN A;  4XKW A;  5J40 A;  4IPA A;  1GXQ A;  4II3 A;  1O3Q A;  4I6U A;  2X4H A;  2PIJ A;  1PP8 F;  1KU9 A;  3GTP J;  2GA2 A;  5FRM A;  1E3O C;  1TNS A;  2DOF A;  1WH7 A;  5EF6 A;  3ONQ A;  4A3J J;  1Z77 A;  2VLA A;  1X2M A;  3O9X A;  2PMZ N;  4C3H J;  3JTH A;  2K9S A;  1V55 H;  1WPK A;  3E0J B;  4EM2 A;  2MGQ A;  2DTR A;  2Y30 A;  4F93 B;  2JN6 A;  1R1U A;  1ZZ6 A;  2E7W A;  5FLM J;  4OBM A;  2EQR A;  1BR2 A;  4N4O B;  4CXF A;  4FIS A;  4EV0 A;  2ZNZ A;  3HOY J;  3G73 A;  2VI6 A;  4LMY A;  2AW6 A;  3V7S A;  2CFX A;  2HZT A;  4DQ2 A;  1X1B A;  2IBD A;  3ZOB A;  2E60 A;  1R22 A;  2FBH A;  1ZYR F;  2LH9 A;  3CCR I;  3ZXS A;  3IRQ A;  1YX3 A;  2YX7 A;  2PMZ A;  1ERD A;  1TWH J;  3DBL B;  5HS9 A;  1R5G A;  3M3Y J;  4JQD A;  2E1M B;  3VDX A;  3OQN A;  2L9R A;  3KXA A;  3H0G J;  4RAF A;  4HQE A;  2J5P A;  1AHD P;  2KZV A;  1IDY A;  3HSR A;  2NYX A;  5DT2 A;  2RKH A;  2AQE A;  3HOV J;  3L2W A;  1HF0 A;  4L5I A;  4PFP A;  4JP0 A;  3QWL A;  5D4R A;  4E7K A;  2B5A A;  3RPU A;  3QP6 A;  2EF8 A;  2ZO4 A;  1P6R A;  1PRV A;  4ZYE A;  3COA C;  5CVJ A;  3JRI A;  4BJT A;  2JA6 J;  2R63 A;  2CW7 A;  1K78 A;  3FKJ A;  1C0W A;  2X6X A;  2I8D A;  4RB0 A;  4OIP F;  1R7J A;  1T56 A;  2HVQ A;  2HXI A;  3HPH A;  1MIJ A;  1NG6 A;  4PCQ A;  1VQ6 I;  1AKH B;  2KEK A;  4RB2 C;  4NC6 A;  2MH2 A;  1FNN A;  1CF7 A;  3BWG A;  4JX4 A;  2CFO A;  2UUZ A;  3J81 Z;  3CCY A;  2E34 A;  5IY5 H;  2JPC A;  4LB6 B;  4NDW A;  4A3I J;  2CRO A;  1WFX A;  4M9X A;  3OWQ A;  3X2Q H;  1R58 A;  1FZP B;  1S29 A;  4Y3O A;  5JI6 A;  4R8H A;  3WGG A;  2EFN A;  4XN3 A;  4X4G A;  4N4N B;  4Y17 A;  4A3D J;  4BH9 A;  2MLG A;  3UWP A;  2GZW A;  2HYG D;  1MKM A;  4D0P A;  2HS5 A;  4EVI A;  3R0J A;  1SD6 A;  2D2W A;  2L9N A;  3TOA A;  4AID A;  2F48 A;  2HYJ A;  2WV0 A;  2JSC A;  4CCO A;  2XF7 A;  1SAN A;  2BZT A;  3DEW A;  3NEU A;  3JRF A;  1S6L A;  2V1U A;  1MH3 A;  2TDX A;  4DZP A;  4A3L J;  5J8C A;  2CJJ A;  4RMN A;  4E6K G;  1MGT A;  3OYN A;  2Y2Z A;  4I09 A;  3A9X A;  5LEJ A;  1YW9 A;  4NDL A;  4ER6 A;  3T0Y A;  4MFD A;  1VQK I;  2K7L A;  1JWL A;  1FYM A;  2DA6 A;  2AUW A;  2XF5 A;  2DW4 A;  4RGX A;  2VC1 A;  2LG4 A;  1Y9Q A;  3G0T A;  1U9O A;  1Z05 A;  5ED4 A;  3VPR A;  2QGU A;  3BR1 A;  5DCM B;  3TP0 A;  2MYS A;  4J1W A;  2FX0 A;  4XLE A;  2ME6 A;  4D5C A;  3EPZ A;  3MKW B;  4FCY A;  4BDZ A;  1RUN A;  3G3Z A;  4O5V A;  5JVG F;  1YOV B;  4S0H B;  5GAD J;  4Q4Z F;  1B9N A;  3UFD A;  1FJL A;  3GFJ A;  1UST A;  2VT2 A;  3VSL A;  3KLN A;  2FMY A;  4PUS A;  5FLX K;  2R5Y B;  2EA4 A;  3OYJ A;  3ZMS A;  3LA3 A;  3GN5 B;  4HZF A;  1S72 I;  4A2U A;  1XX5 A;  4XMY A;  3J7Z I;  1LEA A;  2A5Y B;  3QP5 A;  2ICP A;  1MBJ A;  2ELH A;  4PJM A;  4JCX A;  2AHQ A;  2FOK A;  3V8J A;  1HLV A;  1YI2 I;  4JOM A;  5J1R A;  2XPW A;  3SEQ A;  4DE8 A;  5IYD J;  3SFI A;  4M3E A;  2DK8 A;  3J7A O;  1U3E M;  4KN7 X;  2HKO A;  4OMZ A;  1ZEL A;  4ITV A;  2FFH A;  4WXC A;  4DBR A;  3JW4 A;  1NTC A;  4CCK A;  4M6Y A;  4LK1 F;  2I10 A;  5C4X J;  3WGI A;  3QOD A;  2JT1 A;  2VXD A;  3K2A A;  3M9A A;  4R1H A;  1ZN2 A;  3HSE A;  3OS2 A;  3VWB A;  3EUS A;  1ADR A;  2MC4 A;  2PXL A;  3TBI A;  3J81 K;  3RPU D;  1ZPQ A;  2J7U A;  1FP2 A;  1JUP A;  4LLN A;  1SD4 A;  2ESN A;  4EM0 B;  3EUH C;  2RGV A;  5ICC A;  3LQQ A;  4HX4 A;  3TFL A;  2ELK A;  3S1M J;  2W84 A;  2ETH A;  2BVL A;  1OYY A;  4U0Y A;  4XSZ F;  3IUO A;  2L7Z A;  1YJ9 I;  3AG2 H;  4IRH A;  4F55 A;  1PER L;  1U5T A;  3HBL A;  4EGZ A;  1EFA A;  1RNL A;  4P9U A;  3F51 A;  4QIW N;  1WHU A;  3QPL A;  1RZR A;  4JX5 A;  1ITY A;  3GZD A;  3WTV C;  1B72 A;  3H92 A;  3IC7 A;  1U0J A;  1SFU A;  5GAG i;  1GT0 C;  1FIA A;  2OCE A;  4Y15 A;  4LG0 A;  3FXJ A;  4N0B A;  4NB5 A;  4KN4 X;  3CF5 F;  1Y1V J;  3K69 A;  4S05 A;  4D9J A;  5KVR A;  1WQ2 A;  4Y4R A;  5JHF A;  3WU1 B;  2WB1 N;  2PJR B;  3A4C A;  2GIZ A;  3I5U A;  4M3B A;  4ASN A;  1LDD A;  1J7K A;  1HSJ A;  4RDU A;  2E36 A;  1DP3 A;  4XID A;  1S7E A;  2VOP A;  1D0Z A;  1ZAO A;  2KIF A;  3C3W A;  3IWZ A;  1O7L A;  3N05 A;  3PFY A;  5M3F J;  1QPZ A;  1I6X A;  4GXO A;  4JQF A;  3KLO A;  3SCG A;  3ZMU A;  3TED A;  3JSP A;  1I6H J;  2Z1D A;  4BUP A;  5A7L A;  2MG4 A;  3FM5 A;  2IUO A;  1D1A A;  5D5X B;  3H5N A;  3K1P A;  2AS5 F;  3S8P A;  3G1O A;  1JI8 A;  3KJX A;  1ZRE A;  4MO7 A; 
#chains in the Genus database with same CATH homology
 1XC5 A;  3BG5 A;  5BNG A;  1GDT A;  1ZZ8 A;  4IVZ A;  2EZK A;  3OOU A;  2NVY J;  4M3F A;  4MLO A;  3FKI J;  2CQX A;  3ZKC A;  3BQY A;  4GHJ A;  1JT6 A;  2L0K A;  2B63 J;  1W0U A;  2XGE A;  4X4C A;  1B8I B;  1YRN B;  2CRG A;  1QVT A;  2M0C A;  2E2H J;  5IYB J;  3HGG A;  1ZR4 A;  2EH3 A;  1JTY A;  4XRS G;  2R93 J;  1BA5 A;  4DYC A;  1UXC A;  3FYA A;  1PUF A;  2P81 A;  5J1U A;  3BS3 A;  1B72 B;  2A6C A;  2DA4 A;  3ZQH A;  1R9T J;  3RZO J;  2IVQ A;  4J1X A;  1DWK A;  1WH8 A;  2L8N A;  3F6W A;  1JTX A;  2VKE A;  4BY7 J;  4B3A A;  3SDG A;  2CUF A;  3LSR A;  3QF3 A;  2L7F P;  4Y42 A;  3Q0W A;  2YU9 J;  3FYM A;  1HOM A;  4IA8 A;  3O8H A;  4X4B A;  3ZQF A;  3LSJ A;  1RET A;  1CQT A;  1JKP C;  2E19 A;  3QPS A;  1JUM A;  1X2N A;  3S8Q A;  1NER A;  1BDI A;  4Z5C A;  3JR9 A;  2DN0 A;  1MBG A;  2BNN A;  3FIS A;  1OFC X;  3I4N J;  1MBE A;  1JUS A;  3RQI A;  2LD5 A;  1F36 A;  2DMN A;  1LQC A;  2GRM A;  2R92 J;  2M8G X;  2ECB A;  3W6V A;  3SCF A;  3JXB C;  2KEJ A;  4OB4 A;  2NVT J;  1ORK A;  1VF9 A;  2R5Z A;  4BXX J;  2Y9Z A;  3S1N J;  4A3M J;  3BR0 A;  2GBY A;  4JYK A;  2FJR A;  4PU7 A;  4BBR J;  4XRM A;  5FKM A;  3HOW J;  1OSL A;  2LTP A;  1BW6 A;  5IYC J;  4EEF G;  5HOD A;  4DYQ A;  1SFO J;  1LMB 3;  3IV5 A;  1H8A C;  1LCC A;  2G0E A;  2OR1 L;  3G1L A;  3F0C A;  2XPU A;  3S15 J;  3BTL A;  2LKX A;  2RAE A;  1H89 C;  3QYX A;  2GZU A;  1MSE C;  4A93 J;  2KT0 A;  4V2G A;  1ETX A;  3PM1 A;  4M3G A;  1PUF B;  3NAR A;  1IGN A;  3BG9 A;  4UUT A;  1T33 A;  3H5T A;  2XGD A;  3IVP A;  2PUB A;  3JRC A;  4YG4 A;  1RZS A;  3RZZ A;  1X57 A;  4F8D A;  3JRE A;  4MIM A;  1WGX A;  1MBK A;  1JH9 A;  1ZTR A;  2CUE A;  5E3O A;  1Q1V A;  4XIC A;  3JXD L;  5E3M A;  3DNV B;  4M6V A;  4RBO A;  2E2I J;  2DMU A;  4D7N A;  1BDH A;  5K98 B;  2LYR A;  3UKG A;  5GP9 A;  1IUF A;  5FKO A;  3SJM A;  3BDN A;  3BTI A;  5IP7 J;  1ZKG A;  2XGC A;  2PE5 A;  2YS9 A;  3G1M A;  2DMP A;  1MH4 A;  1RES A;  2ZB9 A;  4PU3 C;  3GTJ J;  2XCJ A;  4A3K J;  1Z0X A;  2COB A;  2X6O A;  4XK4 A;  3TW7 A;  4X1E A;  2TCT A;  2X48 A;  4DW6 A;  3LIS A;  2YUS A;  2Y31 A;  2AO9 A;  2IAI A;  2QCO A;  1XG1 A;  2M34 A;  2NVX J;  2IVB A;  2BNO A;  1IDZ A;  2PUD A;  3BTJ A;  1JFT A;  5M3M J;  3S1R J;  1QQB A;  2OF7 A;  1CJG A;  3PO2 J;  1LE8 A;  4A3B J;  2DA2 A;  3JRH A;  2VPR A;  2OFY A;  3S1Q J;  4Z5D A;  3A02 A;  2MQK A;  5M5X J;  2CSF A;  3HB9 A;  4Y7N J;  4IHV A;  4Z58 A;  3ZQI A;  1WET A;  5FKL A;  1JKR C;  5M5W J;  4PU8 A;  1UG2 A;  1DU6 A;  2HSG A;  4QTR A;  1WI3 A;  2HOT A;  5EG0 A;  1UMQ A;  1JJ8 C;  1MNM C;  1GUU A;  2Y9Y A;  5F0H A;  3HOX J;  2R1J L;  2M2E A;  1DW9 A;  2L7M P;  5EZG A;  1D5Y A;  1JKO C;  2XJ3 A;  2PUC A;  3HEF A;  5C4J J;  2ME0 A;  4A69 C;  1WH5 A;  2EWT A;  3U3W A;  1VPW A;  1I3Q J;  3HM5 A;  4A3C J;  1MBF A;  3WHB A;  2EBY A;  5K7H A;  4W1U A;  3B6C A;  3FIW A;  1XS9 A;  1O4X A;  1MSF C;  2W48 A;  1OCP A;  5FJ8 J;  2GRL A;  5F27 A;  2O9L A;  3LSP A;  5E3N A;  2IU7 A;  3OIO A;  2E1O A;  2K9N A;  3A03 A;  2XPV A;  1LFU P;  3CQZ J;  1UTX A;  2IEK A;  2LK2 A;  1RIO A;  4B1R A;  2JK3 A;  2XB5 A;  2LP0 A;  4V2F A;  2AXZ A;  2JVL A;  3H3V K;  3S2D J;  3S16 J;  2HIN A;  3BD1 A;  3KJX A;  5EYR A;  1APL C;  3HOU J;  1F43 A;  3CDL A;  1POG A;  2K9Q A;  1VND A;  2MSY A;  4FE4 A;  3B7H A;  3QWG A;  2EZH A;  1QVU A;  3DCF A;  4I76 A;  4M3D A;  1U78 A;  4YAR A;  2FD5 A;  3IH3 A;  3ZHI A;  1QRY A;  4D5F A;  1NK2 P;  1SQ8 A;  1UXD A;  5F0C A;  1LE8 B;  1RR7 A;  2WAQ N;  4BBS J;  4AC0 A;  1ZZ7 A;  2CU7 A;  2GM4 A;  2XSD C;  1ENH A;  2IV1 A;  1ZZC A;  4G12 A;  5K7Z A;  4A3F J;  5J3L A;  3KZ3 A;  3S2H J;  2LYK A;  1PRA A;  1X58 A;  5EG0 B;  1QQA A;  1LFB A;  1K83 J;  1TC3 C;  3GTQ J;  3FMY A;  4I6U A;  2PIJ A;  1WCM J;  2GLO A;  3OQM A;  4C3J J;  2JA8 J;  1GV5 A;  4YG7 B;  1RKW A;  3GTP J;  2IVG A;  1ETQ A;  1FTZ A;  3GTO J;  2AXU A;  1ZVV A;  1E3O C;  4X6A J;  1WH7 A;  3ZQG A;  5EF6 A;  4A3J J;  1IJW C;  1Z77 A;  4W97 A;  2D5V A;  1FIP A;  1X2M A;  3O9X A;  2PMZ N;  4BKX A;  2ID6 A;  4C3H J;  3PXP A;  2K9S A;  1WPK A;  3QQA A;  2O49 A;  3SCH A;  4MFE A;  1JT0 A;  2HQ5 A;  5IP6 A;  2MGQ A;  2Y30 A;  1QPI A;  5F08 A;  1R63 A;  1AKH A;  3R1F A;  2JN6 A;  1WH6 A;  1ZZ6 A;  1L1M A;  5FLM J;  3CRO L;  4FTH A;  2EQR A;  5FLV A;  2O7O A;  4FIS A;  2PUE A;  2HOS A;  3K7A J;  2OPT A;  5JLX A;  3HOY J;  1JJ6 C;  5JLW A;  3D1N I;  2EZL A;  2JWT A;  3S17 J;  2VI6 A;  1A6I A;  5DS9 A;  1JKQ C;  4AYB N;  2BJC A;  2BNM A;  3IH4 A;  2AW6 A;  4FE7 A;  4BY1 J;  2IBD A;  2LFB A;  3ZOB A;  3JRA A;  4I6Z A;  5IOY A;  3JRB A;  1ZS4 A;  3BR5 A;  2KZ8 A;  3LFP A;  3CLC A;  1TWH J;  3RKQ A;  1AU7 A;  4IHX A;  3GBG A;  5FKK A;  2CQQ A;  3GTG J;  3M3Y J;  4JQD A;  1JGG A;  3OQN A;  2O4A A;  2EBI A;  2L9R A;  4C3I J;  5GPA A;  3KXA A;  2HXO A;  3H0G J;  3Q0V A;  1AHD P;  2R5Z B;  4MCT A;  1IDY A;  5IPA A;  4J19 A;  1FEX A;  4O8B A;  4X4H A;  4IHY A;  3HOV J;  1B0N A;  1HF0 A;  3G5G A;  3ZQL A;  2WUS R;  2ID3 A;  4JP0 A;  2KDZ A;  2JCG A;  5EEA A;  1NK3 P;  1BW5 A;  2B5A A;  2EF8 A;  2AXV A;  1PRV A;  3ZQC A;  1HCR A;  3CEC A;  3G7D A;  5IP9 J;  3JRI A;  2ICT A;  3RZD J;  1P7J A;  1TWC J;  2JA6 J;  1ZZ9 A;  2R63 A;  2PUF A;  2K40 A;  4UUS A;  3BT9 A;  1RPE L;  1T56 A;  2HXI A;  4QSH A;  4AUX A;  3OP9 A;  4I6T A;  1OJL A;  5E3L A;  1I50 J;  4DYR A;  3E7L A;  4PU4 C;  1AKH B;  2XRL A;  2KEK A;  1R69 A;  2LR8 A;  4JCY A;  2R5Y A;  2KEI A;  4JX4 A;  2Y0S N;  2LYQ A;  2FJ1 A;  3GN5 A;  4Y52 J;  3HGY A;  3O8G A;  1ZK8 A;  1A5J A;  3CCY A;  2M9H A;  3Q3S A;  1ZR2 A;  1VI0 A;  3BQZ A;  4A3I J;  2E2J J;  4NDW A;  2HOA A;  2CRO A;  4JX6 A;  3L1P A;  1ZAY A;  1PRU A;  5C3E J;  1K61 A;  1EF4 A;  3HDD A;  3ZHM A;  4X4D A;  4A3G J;  1IRZ A;  2DMT A;  4X4G A;  4GFB A;  2WIU B;  4X4E A;  4A3D J;  2DTZ A;  1ZQ3 P;  2LCV A;  1LLI A;  1TWG J;  2HYJ A;  3F52 A;  1SAN A;  3DEW A;  3JRF A;  4ABZ A;  1MH3 A;  4DZP A;  4B4C A;  4A3L J;  5K7F A;  2CJJ A;  3TRB A;  2Y2Z A;  4NDL A;  3GTK J;  3CMY A;  4MFD A;  1JWL A;  4X4I A;  1RPW A;  4LOC A;  3OSF A;  2DA6 A;  2AUW A;  3I4M J;  1RKT A;  1POU A;  2H8R A;  2FQ4 A;  1MBH A;  1Y1W J;  2LYS A;  1XWR A;  1Y9Q A;  1BL0 A;  1U9O A;  1U8B A;  3VPR A;  3B6A A;  3BR1 A;  3TP0 A;  5F1J A;  4UUS B;  3MVP A;  1X2L A;  4J1W A;  2FX0 A;  5FKN A;  2ME6 A;  2LVS A;  4D5C A;  4FCY A;  3VK0 A;  4S0H B;  3UFD A;  2MEZ A;  2PUA A;  1FJL A;  2NS8 A;  1QP7 A;  4IWR A;  3GTL J;  2R5Y B;  4I6R A;  3GN5 B;  4YBA A;  4Z59 A;  2XB0 X;  1ETY A;  5F0F A;  2ICP A;  3WHC A;  4CYC A;  5GPC A;  1MBJ A;  3OMT A;  2KPJ A;  4JCX A;  3FK6 A;  1QP0 A;  3BR6 A;  1DU0 A;  2AHQ A;  4FN3 A;  2VUM J;  2X9D A;  1HLV A;  1OCT C;  5J1R A;  1ZUG A;  2LYJ A;  2XPW A;  3MKL A;  5IYD J;  3SFI A;  4M3E A;  3LNQ A;  2WV1 A;  2JA5 J;  1TWF J;  4C2M J;  4I8T A;  3BR2 A;  1ETK A;  3MN2 A;  5EGO A;  2DA7 A;  3HZI B;  1NTC A;  2DJN A;  1ZGW A;  2LYP A;  1TWA J;  2I10 A;  1VFC A;  5C4X J;  4IEJ A;  3K2A A;  1G2H A;  3NAU A;  2AWI A;  3EUS A;  1WIZ A;  1RZR D;  1ADR A;  9ANT A;  2N8G A;  1ETO A;  1IC8 A;  4X4F A;  2R0Q C;  1GVD A;  5EZH A;  4IHW A;  4MCX A;  2JMW A;  1ZPQ A;  1H88 C;  3GBF A;  2XI8 A;  4HNV A;  1JUP A;  3C2B A;  3A01 A;  2DA1 A;  2ECC A;  5J1Y A;  1ETW A;  1NEQ A;  3HOZ J;  2ELK A;  3S1M J;  4Z5H A;  1JFS A;  1IV6 A;  3HKZ N;  3MLF A;  1YSE A;  2NS7 A;  2LY9 A;  1UHS A;  3BR3 A;  1BJZ A;  2L7Z A;  1PER L;  1B8I A;  3HBL A;  4DZJ A;  2DA5 A;  1YRN A;  1EFA A;  3F51 A;  3OQO A;  4QIW N;  1QP4 A;  3QPL A;  4L5E A;  2PPX A;  2HI3 A;  3OSG A;  1RZR A;  5C44 J;  4JX5 A;  2H1K A;  1ITY A;  3QQ6 A;  3BTC A;  2LLK A;  3LSG A;  3LOC A;  2MW8 A;  5M5Y J;  1B72 A;  1W0T A;  3GTM J;  3S14 J;  1GT0 C;  1FIA A;  2L49 A;  5DTD A;  4CYC B;  1Y7Y A;  3Q0U A;  1Y1V J;  1ETV A;  2DA3 A;  1PNR A;  3TW6 A;  2DMQ A;  3IH2 A;  3JRG A;  2PUG A;  2VKV A;  1IG7 A;  2NOG A;  2O8K A;  2XIU A;  2WB1 N;  1U9N A;  4M3B A;  4D7M A;  5IOZ A;  2EZI A;  5F04 A;  5EGO B;  2JA7 J;  2JJ7 A;  4RDU A;  3FK7 A;  4XID A;  1S7E A;  2LYL A;  3TP3 A;  1FTT A;  4XRS A;  3PO3 J;  5EDN A;  5M3F J;  4GQM A;  1QPZ A;  1HDP A;  1HDD C;  1ZZB A;  2HDD A;  3SCG A;  2TRT A;  2QF7 A;  4A3E J;  3TED A;  3M4O J;  3BG3 A;  1I6H J;  3JXC L;  3JRD A;  5A7L A;  2MG4 A;  1GV2 A;  2NVQ J;  2IUO A;  4YG1 A;  3G1O A;  4FBI A;  1LCD A;  2R7Z J;  1P7I A;  2O38 A;  3A01 B;  4MO7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...