1GT0C

Crystal structure of a pou/hmg/dna ternary complex
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
155
structure length
137
Chain Sequence
PSDLEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMSKLKPLLEKWLNDAENLGLSRRRKKRTSIETNIRVALEKSFLENQKPTSEEITMIADQLNMEKEVIRVWFSNRRQKEKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords 5'-D(*TP*TP*CP*TP*TP*TP*GP*TP*TP*TP* GP*GP*AP* TP*GP*CP*TP*A
publication title Crystal Structure of a POU/Hmg/DNA Ternary Complex Suggests Differential Assembly of Oct4 and Sox2 on Two Enhancers
pubmed doi rcsb
source organism Homo sapiens
total genus 46
structure length 137
sequence length 155
ec nomenclature
pdb deposition date 2002-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00046 Homeodomain Homeodomain
C PF00157 Pou Pou domain - N-terminal to homeobox domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1gt0C02
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 1gt0C01
1QVTA 2L7MP 1JTYA 3UFDA 3HOXJ 1LMB3 2AWIA 4MCXA 1L1MA 1MSEC 5JLWA 3ZQFA 2DMPA 5DTDA 2Y9YA 5EEAA 2DMTA 2G0EA 3GTLJ 2XRLA 3C2BA 2X9DA 1UMQA 1DU0A 3JRGA 3HOUJ 3LSPA 3B6AA 4A3KJ 2KEJA 1NEQA 3H3VK 2Y9ZA 4M3EA 4J1WA 3B7HA 3Q0VA 2XPVA 3NARA 2H8RA 1LQCA 4A3FJ 4MFEA 2XGDA 1ZGWA 2HXIA 3S1RJ 2HI3A 5K7FA 4M3BA 3GTQJ 4A3JJ 2BJCA 4IHVA 1NTCA 3F51A 4DZJA 4W97A 2MGQA 1U78A 3OMTA 3I4NJ 3G7DA 1EF4A 2HOAA 2AUWA 2KEIA 3M4OJ 3CLCA 2X6OA 5GPAA 2M9HA 2MSYA 2Y2ZA 3OSGA 2AXUA 2LYLA 4J19A 3QPSA 3BQYA 3FISA 1IUFA 1GT0C 1PRUA 1Z0XA 2H1KA 2MQKA 4D5CA 4X4BA 3MN2A 1OJLA 2PUDA 1K61A 3OOUA 5C4JJ 3MLFA 3HBLA 4YBAA 1WH5A 2R5YB 3TP3A 1XS9A 3RZZA 1X57A 1VFCA 1ETXA 3ZQCA 4DYRA 2GRLA 4F8DA 2FJRA 1MBGA 1I3QJ 2EZHA 3S14J 1A6IA 3SFIA 1BDIA 2XPWA 2NS7A 2M8GX 4CYCA 3B6CA 1NK3P 3A03A 2LYJA 1WPKA 5F0HA 4UUSB 3K2AA 2Y31A 2XJ3A 3BS3A 2XPUA 2DN0A 4HNVA 4AC0A 1HOMA 1ETKA 2DA5A 2GM4A 5C4XJ 2N8GA 1FTZA 4A3BJ 2PUGA 2IUOA 2NVQJ 4MO7A 1IDZA 1ZK8A 2DA4A 5EZHA 2IVBA 3BR5A 1ZR4A 1JH9A 5E3NA 4B4CA 5M5XJ 4ABZA 4QSHA 1OCTC 5F27A 2L8NA 3GTGJ 3CECA 1QRYA 4A3IJ 3LISA 2ECCA 4X4IA 4BY7J 1PRAA 2TRTA 1MBJA 4BXXJ 1ZZ8A 1FTTA 3IV5A 2BNNA 1RR7A 5EGOA 2P81A 2O8KA 1ZZ6A 2K40A 3GTOJ 5FKNA 1PUFA 2DA3A 3LSRA 3S16J 1X2MA 3HEFA 5C44J 4S0HB 4QIWN 3RZDJ 3A01A 1H88C 4GQMA 2ZB9A 1O4XA 3R1FA 3MVPA 1VF9A 1AHDP 5E3LA 1RETA 1SFOJ 2LYPA 4IA8A 2DMNA 1YRNB 4GFBA 3DEWA 3ZQIA 2JMWA 1GV5A 4MFDA 3HOVJ 3JXCL 5E3OA 3S8QA 4IHWA 4Z5CA 3GTMJ 1VPWA 5J1RA 3TEDA 1IV6A 1Q1VA 5IPAA 3Q3SA 2IEKA 3MKLA 3HOWJ 1NK2P 3GN5B 4MLOA 3KJXA 1HDPA 1MH3A 3BG9A 1MBHA 1QQAA 3LSJA 2LTPA 2ME6A 1AU7A 2NS8A 1I50J 2CUEA 2O9LA 4W1UA 4BY1J 3BR1A 2LYKA 3ZQGA 3BDNA 1ETYA 2CJJA 3QWGA 4A3CJ 3UKGA 2FD5A 1WETA 1VNDA 3QF3A 5HODA 1B8IA 1GUUA 2ID3A 2LY9A 2M2EA 4QTRA 5DS9A 4PU3C 4JP0A 1ETQA 1P7JA 3Q0WA 2R63A 2EBIA 5J1UA 4AYBN 2HOSA 2NOGA 2IVGA 4Z5DA 1JT6A 1GV2A 1QP4A 2EF8A 3BTCA 2FJ1A 5GP9A 1ZTRA 3BTJA 4L5EA 1AKHB 4G12A 2L7FP 3Q0UA 2MEZA 3JXBC 3M3YJ 2AHQA 5EZGA 4BKXA 3BD1A 4NDLA 1NERA 1IGNA 2RAEA 1ZZCA 1WH8A 4J1XA 1YRNA 2K9SA 2B63J 1WH7A 4DW6A 1JKOC 2W48A 5F0FA 3QQAA 1X58A 3JRCA 1ZZBA 4X1EA 5IYDJ 1TWAJ 2LLKA 4JYKA 4X4HA 1LE8B 5FKKA 1JUMA 5EG0B 3JREA 1UXDA 1ADRA 2FQ4A 4B3AA 2LYSA 4IHXA 1POUA 1B72B 1OFCX 1X2NA 3ZHMA 3FK6A 4MIMA 5F0CA 2R0QC 2JA7J 1T56A 2DJNA 2LYRA 1MBFA 1YSEA 3CDLA 2LR8A 3E7LA 4XIDA 2EWTA 3WHCA 3QQ6A 1OSLA 4IEJA 1RZSA 1ZAYA 2L0KA 3TRBA 4PU4C 1DW9A 1WGXA 2ICPA 5EYRA 1LFBA 3GTJJ 3PO3J 4X4GA 1BL0A 2GZUA 1RPWA 3QPLA 1DU6A 2HINA 1SANA 4FE7A 1JKQC 4DYCA 2JCGA 4V2FA 3PO2J 5FKOA 3S2HJ 2XCJA 4FBIA 1APLC 1MBKA 3A02A 3EUSA 2CQQA 2CRGA 4X4EA 2ECBA 2BNOA 1BW6A 4I6TA 4DYQA 4YG4A 3HZIB 3O9XA 2JWTA 4A69C 2KZ8A 1AKHA 3OQOA 2BNMA 2E2IJ 1IRZA 1BDHA 1MBEA 4XRSA 5K7ZA 3LSGA 1LCCA 2E1OA 1IC8A 2E2HJ 2OFYA 3H5TA 1BJZA 2IBDA 2IVQA 3G1MA 5FKMA 4A93J 4X4CA 2DMQA 3IVPA 1ITYA 1SQ8A 2OPTA 3BR0A 4M3FA 2VKVA 1JFTA 2M0CA 4X4FA 2EZIA 1ETWA 2LYQA 2VPRA 5IOYA 3S1NJ 1B0NA 4JCYA 4MCTA 3RKQA 5FLVA 3JXDL 3CROL 1VI0A 2IV1A 4UUTA 3S2DJ 4RDUA 2R5ZB 4A3LJ 2YS9A 5FKLA 3K7AJ 1HCRA 2DMUA 4FE4A 1ZQ3P 4IVZA 4XK4A 4XRSG 5M5WJ 3BG3A 3JR9A 1PNRA 3TP0A 3RZOJ 2YU9J 1MH4A 1QQBA 4D7MA 2ME0A 3S1QJ 1ENHA 1P7IA 4AUXA 2O38A 3LOCA 3TW6A 4FN3A 1T33A 1F43A 2PUFA 2R5YA 4OB4A 5IP6A 4A3GJ 1OCPA 3KXAA 4A3DJ 2GBYA 1JGGA 4Z5HA 3TW7A 2JJ7A 5GPCA 1RIOA 3G5GA 1JKRC 2FX0A 3SCFA 4GHJA 4NDWA 3HB9A 4I6UA 1RZRD 3BR3A 2CU7A 2XB5A 3HOYJ 2HSGA 1ETOA 1W0UA 2R93J 4UUSA 4Y7NJ 2LK2A 2GLOA 4YG7B 3HGGA 1RKWA 2AXVA 1EFAA 1FEXA 2B5AA 3F6WA 4DZPA 2E2JJ 2CQXA 3S1MJ 2KDZA 1ORKA 2MW8A 2CUFA 2HYJA 2VKEA 5J3LA 1IJWC 2VI6A 3G1LA 2COBA 4FISA 2HOTA 2PUBA 1RKTA 3O8HA 1WH6A 4V2GA 3W6VA 2JA6J 3CQZJ 1ZS4A 3BTLA 3FKIJ 5K7HA 2ID6A 3HM5A 3ZQHA 2CROA 3JRIA 4M3DA 3HDDA 4JX6A 4C3JJ 3GBGA 1LCDA 2I10A 2IAIA 2QF7A 3JRBA 2JVLA 4Y42A 2EZKA 4I6RA 1U9NA 1LFUP 3SCHA 4I8TA 4D7NA 1UTXA 3F52A 3H0GJ 1U8BA 2XB0X 1PRVA 1TWFJ 3DNVB 2Y30A 2DA2A 1MNMC 2HQ5A 3BG5A 1JUSA 2L49A 1K83J 1Y9QA 4FTHA 2DTZA 3FK7A 2JK3A 5F1JA 1ZVVA 3OQNA 4M3GA 5E3MA 2JA5J 4PU7A 1X2LA 2PMZN 1I6HJ 4I6ZA 4A3EJ 5J1YA 3JRAA 2CSFA 2DA7A 3BT9A 1TC3C 2LP0A 1RESA 1JT0A 2AW6A 3GN5A 1GVDA 4XICA 1Y1WJ 3QYXA 4CYCB 1RZRA 5M3MJ 5IP9J 2EH3A 1ZZ7A 2K9NA 1H8AC 1HDDC 1U9OA 1UHSA 2XIUA 2R1JL 5C3EJ 2XGEA 1H89C 3O8GA 1ZUGA 4Z58A 3IH4A 1UXCA 2NVXJ 1JWLA 1IG7A 1QVUA 1PERL 5IYBJ 1ZR2A 2QCOA 4Y52J 3BR6A 3F0CA 2DA6A 2LVSA 5JLXA 4M6VA 2KT0A 5IOZA 2AXZA 4LOCA 4C3IJ 2Y0SN 4JX5A 5FJ8J 1R69A 1E3OC 2VUMJ 4JCXA 3CMYA 1JJ6C 1CJGA 2ELKA 1F36A 3JRHA 2LKXA 1G2HA 2PUAA 5EGOB 3HOZJ 2O4AA 2PUEA 1TWHJ 1A5JA 1S7EA 2AO9A 5FLMJ 1PUFB 2XI8A 4PU8A 3JRFA 1Z77A 4D5FA 3A01B 5F04A 4Z59A 2L7ZA 1LLIA 1QPIA 3FMYA 5BNGA 3VPRA 1Y7YA 3FYMA 1R63A 5F08A 3ZQLA 4RBOA 1LE8A 1JUPA 5EG0A 3OP9A 5IP7J 2GRMA 5EF6A 2TCTA 1W0TA 2R7ZJ 1B72A 1JKPC 5IYCJ 2YUSA 5K98B 3HGYA 2XSDC 1ETVA 3PXPA 5M3FJ 4IHYA 4BBSJ 2R92J 2EZLA 3SCGA 4YARA 3U3WA 1POGA 3NAUA 4JX4A 1QPZA 3D1NI 1WIZA 3ZHIA 3SDGA 3I4MJ 2KEKA 2LFBA 4BBRJ 4FCYA 9ANTA 1FJLA 2K9QA 3LFPA 4I76A 2EBYA 1BA5A 3ZKCA 3HKZN 2PUCA 2X48A 3FYAA 1QP0A 1B8IB 2PPXA 1HLVA 5A7LA 2WAQN 2LD5A 1R9TJ 3RQIA 2O7OA 4B1RA 2PIJA 2PE5A 4C2MJ 5M5YJ 1MSFC 2O49A 2LCVA 3BR2A 2EQRA 4XRMA 1UG2A 3GTPJ 3ZOBA 1RPEL 2WB1N 3G1OA 3OQMA 3CCYA 2L9RA 4C3HJ 3WHBA 1Y1VJ 3BTIA 2HXOA 1ZZ9A 2KPJA 2A6CA 3IH3A 3S17J 1XC5A 2E19A 2HDDA 1HF0A 2ICTA 4X4DA 2NVYJ 4A3MJ 3SJMA 1TWCJ 3DCFA 3FIWA 2WUSR 2DA1A 1WI3A 1FIPA 3OSFA 1DWKA 3LNQA 1WCMJ 1ZKGA 3GTKJ 4O8BA 1XG1A 3IH2A 1IDYA 3BQZA 2JA8J 1GDTA 2JN6A 1JFSA 2OR1L 4IWRA 4YG1A 3KZ3A 3PM1A 4X6AJ 2R5ZA 4JQDA 3VK0A 1JTXA 1ZPQA 2OF7A 1XWRA 1TWGJ 2WIUB 1FIAA 2MG4A 3L1PA 1BW5A 2D5VA 2WV1A 2M34A 2XGCA 2IU7A 5EDNA 1JJ8C 1D5YA 2NVTJ 3S15J 4EEFG 1QP7A 1CQTA 3OIOA 3GBFA 3JRDA
chains in the Genus database with same CATH superfamily
3RJPA 2L7MP 1JTYA 3UFDA 2QUFA 2M8EA 5E1WA 4ZYEA 2LLWA 4G94A 2DLLA 3RTRA 2DMPA 1E0EA 3FDYA 3IKTA 1LDJA 2BEOA 3GTLJ 3BG7A 1W5CC 3R61A 4CDGA 3JRGA 3CMEI 2HVQA 2VC1A 5DUIA 3VWBA 2LF8A 3Q5FA 4G9YA 2RQQA 2Y9ZA 3FF5A 5EJCA 4J1WA 2V9PA 1VQ8I 4DE9A 3S2WA 3OYJA 1OMIA 4MFEA 3R6SA 3K69A 3U1DA 4L9TA 1ZGWA 2UXNA 4R79A 2KJBA 5LBQA 2WC2A 2NAZA 3DPTA 2X51A 1ZG3A 3ABMH 2WY7Q 4DZJA 2MGQA 5CVVA 5E20A 1EF4A 2AUWA 2EIJH 2KEIA 3TELA 1I1GA 2A6HF 3V7SA 2NOJB 2XF5A 3GZ5A 5GPAA 3RQ4A 2MSYA 4ENJA 1V5GA 1K4TA 1J7KA 2VL8A 2ZNZA 4Q4ZF 3AAFA 2VE9A 1GT0C 1Z0XA 2H1KA 2VE8A 1OJLA 1K61A 1VQ7I 5E17F 3MLFA 4S05A 4YBAA 1WH5A 1YE9A 5TGTA 1PYVA 2Z1DA 1XS9A 3AG3H 2UV1A 4YEJA 3SR4A 3GEZA 1LUJB 4XN3A 2EZHA 5KHDA 1B9MA 4XLPF 3TDUC 2XPWA 3C18A 5B5EC 2NS7A 3SZGA 4ZTJA 3V8LA 1BM9A 2ZO4A 3A9YA 4X0GA 5DTRA 5E1XA 2CV0A 4UUSB 3K2AA 4ZZDA 1RI7A 2Y31A 2ZMEB 2XJ3A 4IOAF 3H1CA 3F8FA 1MDMB 4EKIA 1OISA 2YX7A 5C4XJ 3DU6A 3KCCA 5IY5H 2IUOA 1SC7A 3ULQB 2IVBA 1ZK8A 2DA4A 2QQ8A 1JH9A 2QSGX 5IT9Z 3KX2A 4A0YA 2PXEA 4ABZA 4II2A 2AXZA 2VQLA 3S32A 1ZG1A 2GXGA 5FO5A 4BY7J 1ZRDA 1FMVA 1PRAA 1A31A 2V1UA 4CA0A 1FTTA 2ADUA 2BNNA 1RR7A 2P81A 4BEHA 2R7FA 5B1AH 4IL6C 1PUFA 2BYVE 3S16J 3CCUI 3K1MA 1UELB 3HEFA 2LSOA 3DLLF 3RZDJ 1Y0NA 3AFHA 2YBDA 2L02A 4ZZLA 1AHDP 3VDXA 3GLXA 4ASNA 3DEWA 1WI9A 3ZQIA 4MFDA 3S93A 3ASNH 3NWTA 3CCRI 3S8QA 5BMZA 2FEZA 3CUOA 3WTUC 4UVAA 3L2RA 3BC8A 5IPAA 1EV7A 1Y8RB 4RAGA 3MEXA 3HOWJ 1S3JA 1MH3A 5HNFA 1TBXA 5ED4A 3FXQA 3HRMA 4H4KC 4XKVA 3CCJI 1OCRH 3LSJA 2LTPA 2DPDA 3PIPF 1AU7A 2NS8A 2E5ZA 2X6WA 4BY1J 3M1EA 4QWQA 1NHAA 4BQQA 2CG4A 2JQEA 1KGSA 4XQFA 2E1MB 1QU3A 3I56I 4UVCA 5L3BA 5LRSA 3SZPA 1VNDA 1VQNI 5HODA 4U7DA 4LIUA 2ID3A 3OWQA 3NRVA 4JP0A 2X4HA 2BW3A 1ETQA 4P1WA 5ILUA 2OJED 3Q0WA 3QU6A 4C9YA 4HZFA 2HEOA 4A12A 2NOGA 4YIRX 1HC8A 4WF2A 2FJ1A 3T8TA 4HDUA 1YS7A 4L5EA 4QPQA 3L2CA 3JXBC 4NQWA 3M3YJ 1ULYA 3FMSA 4EJOA 1NERA 4I7HA 3NEUA 1YRNA 2WY8Q 3PSIA 5J8CA 4E7KA 2W48A 1S7OA 2P0WA 2XC7A 4LLLA 3JRCA 4A2UA 2V26A 3J81Z 4X1EA 4E7JA 3CUQB 1FPQA 1YG2A 3FX3A 4D0PA 2P5LC 1S29A 3GLLA 1JUMA 1UXDA 4PJLA 5D4SA 3T5XA 3CO6C 4L5IA 5ICCA 2KRCA 3SEZA 2LYSA 4IHXA 2HPMA 1IXRC 1P2FA 3F6VA 1K78A 2F4IA 2JA7J 5F0CA 2R0QC 2QSFX 2I5UA 4PJJA 2P6TA 4G6QA 5KAIC 1YSEA 3M8FA 1VQ5I 2LR8A 4XIDA 1HKSA 1U0JA 3WHCA 3BPXA 2DFEA 5GADJ 2CWEA 3ZN0A 1LQ1A 2A5YB 1RZSA 3TRBA 4EQQA 1S7AA 1Y56A 1LFBA 3PO3J 3RPQA 4BXUA 5TRDA 1QHGA 3QPLA 3H3UA 1L0OC 5CYVA 5DD8A 2J7WA 1YIJI 5TISC 5FKOA 5L3DA 4NC8A 1APLC 1R49A 2YU3A 4X4EA 5F1RA 2ECBA 2XASA 1BW6A 4YG4A 5BQTA 3GYHX 3O9XA 1AKHA 3L9FA 4RB1A 3ZP5A 3O2PE 1CGPA 2BGCA 3OYNA 1MBEA 1YW9A 4XRSA 4IHTA 2VJ4A 2A6TA 3H5TA 4CHUA 1J59A 3GXOA 2IVQA 4QPOA 4U0YA 2CW8A 1D8KA 2A68F 4XL9A 3CP8A 1GXPA 2KRFA 2MC3A 2MABA 2OPTA 3BR0A 1O3SA 3FMRA 2M0CA 4X4FA 1JFTA 2K9LA 4KFCA 1YYVA 3BPVA 2G7HA 3TO9A 2L4AA 3DU5A 2VPRA 3QYBA 5LGUA 2LLVA 3P9CA 3U1KA 3RI4A 4UUTA 3J7AO 2XIGA 3S2DJ 3BJOA 4CCLA 5DM7F 2LMDA 2IS2A 2R5ZB 2BY1A 2VOOA 3K7AJ 4CICA 4PSWA 2F2EA 1XB4A 2IGMA 2R7VA 3RZOJ 1QQBA 1FMWA 3S1QJ 1Y6IA 3LOCA 2JA2A 3MD2A 1T33A 4FN3A 4EJWA 2BVMA 2Z2SB 4LLGF 4EKGA 5IP6A 4B43A 3KXAA 4OIRF 3JTGA 4A3DJ 4GYGA 1O3QA 2W25A 2C6YA 1JGGA 2BZTA 2JJ7A 4P5OA 3TW7A 3G5GA 4N4NB 3KE2A 1MMDA 2Z16A 5AONA 2VKDA 4QLCU 2HSGA 4F55A 2PJPA 4YG7B 2DOEA 3ZR8X 3HGGA 4FX0A 1BR2A 2YR2A 4BQAA 3F6WA 2E2JJ 4UV8A 2YSRA 1XDSA 2CQXA 3I71A 5LEKA 3S1MJ 1ORKA 2MD0A 2VI6A 5JHUA 2HOTA 1D1CA 1RKTA 4V2GA 2HS5A 3MZ8A 3PUFA 4LG0B 1EH6A 3JAMK 3KZIC 3FKIJ 4HEA2 4RB2C 3HM5A 4G7OF 1C0WA 2K02A 1YJ9I 4M3DA 3T8RA 2EFPA 4DQ2A 4Y33A 2I10A 1LCDA 3JRBA 2Q8KA 1P9QC 2JVLA 3O6BB 4Y42A 4I8TA 2EIMH 1LFUP 1TQMA 1JE8A 4E6KG 2VBXA 3QYFA 1TWFJ 1VQ9I 5CPRB 1DP7P 4KT6A 4FTHA 2HQRA 2M45A 4ENMA 5CLSA 2ELJA 3G4SI 4XR6A 5H2FC 5E3MA 2HFHA 1X2LA 2PMZN 3OOPA 1IO2A 1ZGJA 2XAJA 4NBQA 4PSXA 2HCSA 3BT9A 4IJAA 2AW6A 2KIQA 4XLCA 1NH3A 4XICA 2XXQA 1SD6A 4C2UA 2DK5A 4HV5A 4OIPF 1UG0A 2K9NA 3D5LA 1H8AC 2XAGA 2CV2A 1U9OA 2BE5F 2IP2A 2R1JL 2LG4A 4HF1A 2DU9A 4PJ0C 3GFLA 1ZUGA 3COAC 3GX4X 4N9IA 5FRNA 2G7UA 2DT6A 4Y52J 3F72A 4AVZA 1H0MA 2Y0MA 5KNLA 2A61A 3FXKA 4JX5A 2V7FA 2EINH 2BY3A 3KYLA 1SFUA 2VUMJ 4IO9F 3JRHA 1QB2A 3ABUA 5EGOB 4BL0B 3HOZJ 2PUAA 3HPGA 5GTHC 5FLMJ 5HLTA 1D0ZA 2FQ3A 1Z77A 3ZMDA 1YW8A 4JQFA 4DNCA 5F04A 5FFZA 2L7ZA 1QPIA 2L9NA 5HLGA 4O3MA 2XAFA 4BU2A 4Q5SF 4WX9A 2QBYB 1R63A 3CO7C 3HPHA 1LE8A 3OP9A 2KIMA 3WTWC 2TCTA 3M8EA 5TJJA 5JFRA 2XSJC 1X1DA 1B72A 3PNTA 1JHHA 2QKLB 2L7KA 5K98B 3HGYA 5IT9K 4ETSA 3L7WA 4OBMA 1HSJA 4BXFA 2W7NA 1YJNI 3DKYA 1POGA 4ZDLA 5JVGF 3SDGA 3WG7H 3I4MJ 2ZFWA 4L9VA 4HQMA 4EV0A 2DK8A 3E5QA 4ZYHA 9ANTA 4I76A 2K3PA 3PQKA 2CO5A 3LL7A 2X48A 4HSTA 1HLVA 2Q2EA 3LQQA 2GAUA 1W7PB 2RVCA 2ZXJA 3VFZA 4C2MJ 3HJEA 2TDXA 2KJCA 3N97A 3HSFA 4HQEA 3SYTA 3GTPJ 1RPEL 2P7CB 3CJQB 3OQMA 1ZAOA 2L9RA 2PXKA 3SXYA 2HXOA 1O3RA 3KP2A 3S17J 1Y39A 2W57A 2MLGA 2QLZA 3WTYC 1HF0A 3LQXA 4LJZF 1TWCJ 4D1QA 1A35A 4IHSA 3FIWA 2DA1A 4NUBA 3WTVC 3MCZA 3LNQA 1WCMJ 2IJLA 2KRHA 4Y4RA 2VEOA 1XG1A 3AG2H 3BQZA 2JA8J 3VEPA 3TO6A 1SMTA 3VSLA 1EJ9A 1X1PA 2VQGA 3W6KB 4JQDA 1KA8A 3VK0A 1PP7U 2BHYA 2QYOA 2OF7A 1TWGJ 2WIUB 3L1PA 4N9HA 2D5VA 3GZCA 2M34A 3GMEA 4E7SA 2K27A 4M72A 1LB2A 3CCVI 4EEFG 1D5YA 1CQTA 1XMAA 1O7LA 1OCOH 3OIOA 2WTEA 1RUNA 3F8NA 3JW4A 5FLVA 3ECOA 1I1SA 2OCEA 1B9NA 4MCXA 1MSEC 1UJ8A 5DTMA 3H36A 3ZQFA 4F52A 5DTDA 1NG6A 2IXSA 1DPRA 1OYIA 2MFZA 2X9DA 1UMQA 3JCUC 5H6RA 4B09A 2CGPA 1U2ZA 3HOUJ 3LSPA 2W24A 3A4CA 5BOXA 4A3KJ 3SHFA 3K70D 1BOBA 3VYUB 2RNGA 1VTNC 4YG2F 1LQCA 4A3FJ 3OL3A 4XONA 2XGDA 5HVQC 1KQ0A 2XROA 2GIZA 3HL2A 2HI3A 3WGHA 2XUBA 4A3JJ 1FYKA 3F51A 5HDNA 1V55H 3R60A 1FLIA 2ZXIA 1U78A 4E4HA 3I4NJ 5DYMA 3OMTA 2V9VA 4H0EA 1ZG5A 1U2WA 2E7WA 2KHMA 2X6OA 3V7RA 4ZC3A 3TGNA 2DFIA 2P6SA 1R4MB 3R4KA 5LFAA 4A5NA 3N4MA 2LYLA 4J19A 3QPSA 1YITI 2O03A 1O57A 2KMUA 5DCMA 3SX0A 5E18F 4X4BA 2VJ5A 3IC7A 3HYIA 2BY2A 3OOUA 2O8XA 2UWMA 3HBLA 2D45A 2WAQA 4HSRA 4YIFA 1HSTA 2R5YB 3PSFA 3TP3A 1YLFA 3HHGA 3P5JA 2VOPA 1MBGA 1I3QJ 3S14J 3DTIA 2Z99A 5EEHA 3WODF 3M9LA 4IXAA 2F5DA 3RCOA 2KIUA 4E7HA 3WU1B 2V6EA 5F0HA 2E5NA 2CQNA 2HYGD 4U87A 4XORA 2OAZA 3FHZA 4HX8A 2WA0A 4E70A 2NNNA 4HNVA 2WWYA 2O61A 1HOMA 1ETKA 2EFOA 4HAMA 2PUGA 3E1SA 4A3BJ 1GHCA 2NVQJ 3DWLE 4MO7A 3QPHA 2X1EA 5EZHA 1D5VA 1IDZA 1JHFA 5KCMA 3U2RA 5E3NA 3HUGB 2V6CA 2VT2A 1W7PD 2JUCA 4A0XA 4CZCA 1OCTC 2LDUA 2HTJA 4X4IA 3CECA 4A3IJ 3IRRA 2ECCA 3BCAA 1WJ5A 2KL4A 1YOVB 4BXXJ 2ZJ2A 1FP1D 4OOIA 1ZZ8A 5GAHi 3IV5A 3E0JB 3FWEA 1A36A 2RN7A 1ZZ6A 2OA4A 3PUBA 1PDNC 4QIWN 3A01A 2DQLA 1H88C 1CF7B 1O4XA 1T6SA 3IUOA 4FETA 1X1BA 2VXZA 1RETA 2DMNA 4GYIA 1GV5A 1YFHA 3JXCL 4EJTA 3F21A 1IAWA 1TW3A 4Z5CA 4F3QA 3I59B 1IV6A 1ZELA 3Q3SA 1MJ9A 3SZTA 2V1NA 1NK2P 2DDBA 2LOOA 3DPLC 3CLOA 5FD5A 4U7BA 2K85A 1HDPA 3GFIA 1F5TA 3KJXA 1YTYA 1G4DA 1MBHA 2IA1A 4Q47A 2UXXA 3WU0A 3I53A 3QP6A 5J4YA 4OINF 3JAMZ 1TQIA 2CUEA 2O9LA 1BI3A 2FSWA 1OCCH 2M0MA 3V4GA 1JGSA 1IN6A 1K79A 4L18B 1HXDA 2PXPA 1OLTA 2CW0F 4ENKA 3QOEA 1NG7A 3QWGA 4A3CJ 1IW7F 1WRJA 4B47A 1HBXG 4JBAA 5DDGA 1B8IA 2EFNA 4QTRA 2Z3YA 5B3SH 4LB5A 2R63A 2CUJA 3H0DA 2ZC2A 2EBIA 3PNYA 1WJFA 5J1UA 2IVGA 2EA2A 1GV2A 4G7HF 4P9FA 2PJRA 2EF8A 2FF4A 1ZTRA 3BTJA 4F91B 3C3WA 4DJAA 1R6RA 2AHQA 3H35A 5B1BH 3H5AA 3MAJA 2OCCH 3FM3A 1IGNA 3QU3A 1BBYA 5DTQA 1WH7A 4DW6A 1DDNA 1X58A 1BJAA 2HR3A 5HDGA 4AIJA 3DP7A 1TWAJ 3V7CA 1LNWA 4LITA 1SD4A 1U5TC 5FKKA 1ADRA 2K7LA 3OR1C 3QAHA 3GZNB 2PMUA 4KNYA 1T56A 4PUSA 2XDVA 2IS6A 2AXLA 3ERED 4ESBA 2J7UA 4WK8F 1MBFA 5CVIA 3CDLA 5JI6A 4LB6B 3KZYA 4EM1A 4KN7X 1Z6TA 3FMQA 4Z2YA 1OSLA 1BI0A 1ZAYA 3T1BA 1PP8F 3ZPLA 3RPUA 3CJRB 3OMYA 2AQFA 4Y3OA 1DW9A 1WGXA 1HQCA 2XV4S 4O6JA 4X4GA 1OPCA 5D5XB 3UWPA 3AKZA 5FD6A 1SANA 5LRRA 4FE7A 3EYYA 2JCGA 3S2HJ 2XCJA 4FBIA 3QOWA 3JSPA 3EUSA 2NNYA 2STTA 4DYQA 3L2WA 2KZ8A 1R5GA 1IRZA 4XSZF 4R1HA 2E1OA 3ZPXA 2CUZA 2OU2A 2R7SA 2FA5A 1BJZA 1KQ8A 1Y0UA 2IBDA 1FYMA 2STWA 2HDCA 2D1VA 3BZKA 4FX4A 4MNUA 2B0LA 1ITYA 1SFXA 4AM3A 3M7GA 2VKVA 4CO8A 5IT3A 1HKQA 1Y8QB 2DBBA 3FM5A 2EZIA 3PFYA 2LYQA 1B0NA 3S1NJ 4BHPA 2CV1A 2XHKA 4JCYA 3JXDL 2MH2A 4O5VA 3L00A 1VI0A 2IV1A 1W5TA 4RDUA 5FKLA 2LKPA 4DE8A 1ONVA 1WKMA 3S3NA 4ZYDA 3TP0A 1MH4A 1Z7UA 2ME0A 1ENHA 1YIOA 4AUXA 2ETHA 2QZ8A 1LEBA 4MTEA 3DTKA 4OB4A 3QFIA 1G8XA 1VQPI 5BS6A 4Z5HA 5GPCA 2V4JC 1QGPA 2FX0A 4GHJA 5HS9A 4I6UA 1TLHB 2MC4A 2FNPA 3ISPA 3K4CA 4EM0B 2F5EA 3SDBA 3HOYJ 4EZIA 3Q9SA 1W0UA 3LAJA 1Z9CA 2GIVA 3W2AA 5DV5A 1RKWA 5DRTA 5CQEA 1FEXA 2B5AA 4DZPA 1WJCA 3VB2A 2KDZA 2VKEA 2DFFA 1T0FC 2HYJA 3KIOA 4ER5A 3G1LA 4FISA 1QO0D 3E6CC 2PUBA 2DODA 1IN7A 2LY2A 5KVRA 3OYMA 1WH6A 3C2HA 1WJDA 2A3SA 5GAEJ 2HVRA 2PQ8A 3LA2A 4L9JA 4PGHA 2CROA 2OBPA 3ZN1A 2Z33A 4CCOA 4JX6A 3GBGA 4KIFA 5J6XA 4P96A 2L1PA 5ICFA 3ZQQA 1QZZA 3F52A 3H0GJ 2EWNA 1PRVA 1X1AA 2DA2A 2HQ5A 2BVLA 1K83J 1Y9QA 3DPUA 3OYAA 2JK3A 1IXCA 4M3GA 1WFXA 4KIBA 4MEYF 5FRMA 4HV6A 1FBQA 3A0BC 4M6YA 5HS7A 1YS6A 5LHHA 1RESA 3MKWB 2YX4A 3GN5A 3CCMI 2K86A 5H20A 1ZN2A 1RZRA 4BAYA 1ZZ7A 2XKOA 3GO5A 3WTZA 2VBWA 1UHSA 2XIUA 5C3EJ 4BQOA 1H89C 2NVUB 4RA2A 3IH4A 1I39A 3LMMA 1MMNA 1S72I 1L3LA 4L5JA 3WGGA 3FBNB 1R23A 4RM2A 3LFKA 1W1WE 4KMUX 1TL8A 1JWLA 1IG7A 2M5WA 2JQ7A 1Z67A 2RC4A 3CLQA 5JHFA 1KYWA 5DD4A 1V3FA 3I64A 3P7NA 1N25A 1IV8A 3KYDB 4LK1F 5JLXA 3SFZA 4GGGA 3E97A 4LOCA 2VODA 2Y0SN 1EH8A 3K4MA 2DTRA 1T08B 2LRDA 4HNUA 5GAGJ 2LY1A 2QEXI 4BEHB 1TQPA 2AO9A 4PJMA 4HDVA 4CYDA 1PUFB 3VSKA 2M1BA 4E7LA 2EV6A 1FT9A 3CDHA 3IKVA 3ABTA 4C30A 3H5NA 1FOWA 3F8CA 5F08A 3ZQLA 4RBOA 5EG0A 2ZBKA 2GRMA 3LFUA 5EF6A 2ELHA 1VQMI 1XSVA 4Y13A 2YUSA 2RDPA 5HLHA 2B7EA 3M07A 1VQLI 2PEXA 1SVLA 1BI2A 2H09A 1XTAA 4PFPA 4IHYA 4BBSJ 2ODRD 3AG4H 2EZLA 4BNCA 4WCGA 4JX4A 1QPZA 3D1NI 3ZHIA 4F92B 3F22A 1G59A 2H27A 1JI8A 3CMAI 2DYSH 2K9QA 2LF7A 3LFPA 2EBYA 3GUUA 5J8FA 4CGZA 2KPMA 1N75A 1QP0A 5A7LA 4V19K 1XGSA 5K5RA 1I6XA 4GCVA 4RAFA 4A6EA 3I3LA 4S04A 3RQIA 4I2OA 1N78A 2BW3B 4BACA 4KDPA 1DGWY 3FZVA 5E79C 4FASD 2O49A 2MLKA 4CSWA 3WE3A 4EJVA 1R58A 3FXLA 1ZH5A 1X19A 2V1XA 3KEOA 3K10A 3EDPA 2L01A 4A0ZA 3OYBA 2LCVA 4XRMA 3DV8A 4YRVA 3F23A 3ZOBA 2FMYA 2WB1N 1IRXA 2PMZA 3LSMA 1DP3A 2ZNYA 3BTIA 4KISA 1IRGA 3BY6A 2R7UA 1ZZ9A 4RB0A 1R1VA 4KITB 2E19A 2BHZA 2HDDA 3OY9A 2E71A 4BJTA 3EUAA 3SJMA 5L3FA 3KP5A 5HDKA 3K0LA 3CCLI 3MKYB 3BG6A 1FIPA 4RS8A 3I4PA 1DWKA 4PZJA 1ZKGA 3GWZA 3WU2C 4O8BA 4MTDA 1IDYA 3IHUA 3O3KA 4IVNA 2V3CC 2OR1L 4IWRA 4YG1A 4L0ZB 5DEQA 1K78B 1WJBA 2ZMEC 2ISZA 4WWCA 2PXLA 3E6BA 1FIAA 2CS3A 2XGCA 3D0SA 3ESWB 4RGUA 3TOAA 4A5MA 3NDBB 5EDNA 3S15J 1QP7A 3RKWA 1QPMA 3GVAA 4NC7A 2PBIA 3HOXJ 3DXJF 2AWIA 4I0BA 5H6QA 1L1MA 4KA4A 2LC2A 3CJTB 4RAZA 4OIQF 3G71I 3IL2A 1U5TA 2Y9YA 3LQRA 1DULA 2JSCA 1BOAA 2G0EA 1H9TA 4UY8I 3C2BA 5JR3A 1SVOA 4N0BA 2VONA 4UUVA 3B6AA 3BCBA 2KEJA 1NEQA 4ER0A 1ZLJA 3H3VK 4M3EA 4YELA 1T98A 2IGKA 2JTVA 2VQCA 4XKWA 5A2QK 3B7HA 3CP2A 2E60A 3J7AY 2HXIA 3ZMUA 2HZTA 2IGNA 1ZLKA 4I99C 3TL4X 1G3YA 2V9KA 2JVGA 2Z9OA 4KT5C 4IHVA 3P9KA 4W97A 3F9KA 3VWSA 2HOAA 1TTYA 3KYCB 4KIGA 3CLCA 3DBRB 3ZMSA 2CW7A 2M9HA 3QWLA 4PFOA 4NB5A 3OSGA 3REOA 4II3A 4U0WA 3W6JB 3FISA 1IUFA 1PRUA 2W85A 2IS1A 2MQKA 2BOLA 4EK9A 3MN2A 2RREA 2PUDA 3AL0B 5C4JJ 1BN5A 4MGRA 2M7BA 3RZZA 3CMMA 2NS0A 1D1BA 4RB3C 1VFCA 1ETXA 4RMNA 3ZQCA 3HRUA 2GRLA 4F8DA 3UR3C 2KZVA 3D5RC 2FJRA 1XMXA 2GWRA 3PQJA 1FOKA 2FFHA 3CZ6A 3V42A 5KK1A 1TW2A 2Q0OA 3GZ6A 4ZYGA 4CYCA 3B6CA 4ZJZA 5ICGA 3A03A 4EMSA 1MJBA 3HTUA 2HGCA 4XOTA 1WPKA 4M9XA 3BS3A 2EFQA 2XGXA 2DN0A 4G6DA 3GW2A 4AC0A 3TEPA 3DTEA 2GM4A 2ZXHA 3QODA 4ESFA 5GTIC 3K6GA 5LGTA 4IQ4A 2VJIA 3CUQC 1BC7C 2ZSHB 2H6BA 4DBQA 5F27A 5LHGA 2FBIA 2L8NA 3LISA 1QRYA 2DYRH 2OZUA 1GXQA 4RLFA 3I55I 2K4BA 3C2GA 1T38A 1HQ1A 2VQHA 5DRYA 1F1ZA 3I58A 2HPIA 5LLQA 3L09A 1HW2A 2FNAA 2OV7A 2IA2A 5FKNA 2DA3A 5DUKA 3MFKA 3LSRA 4ENNA 3ELKA 4S0HB 4OAZA 2QA4I 1O3TA 1IN5A 3PNVA 2ZB9A 1MKMA 1T0FA 2OQGA 3MVPA 4XMYA 3HIFA 3H5RA 2JMWA 3G6EI 1WZ2A 2UUZA 5E3OA 4E7ZA 1ON2A 1VPWA 1MD0A 3H9QA 2R7WA 4NC6A 4BDZA 1Q1VA 3MMYB 4RGXA 2IEKA 4HRAA 2DT5A 1MMSA 1B4AA 5CQGA 4MLOA 3LSKA 2F6CA 3PJRA 2IS4A 1TNTA 2NYXA 3TBIA 5K5QA 3BOQA 2ME6A 4PGGA 3A0HC 2HVSA 1T95A 5CVJA 3EQLF 3BR1A 2LYKA 1IN8A 3BDNA 5D5UB 4N4OB 4XBFA 2BY0A 2CJJA 4KN4X 3LWFA 3UKGA 1J5YA 2FD5A 3A1YA 3CDIA 3GFJA 1UZCA 2R4GA 2ICWG 2LY9A 2QGUA 2M2EA 4Z6YA 3ML6A 5B66C 5HS8A 1LJ9A 5DS9A 4BDYA 2OZ6A 1P92A 4M71A 1P7JA 2X1DA 3W3CA 2HOSA 2HFZA 4AYBN 1A6QA 4BE0A 2XF7A 1JT6A 1FC3A 1QP4A 2D1HA 2QQ9A 2E35A 2R3SA 5GP9A 2HWVA 4G12A 1XCVA 2RNJA 1ERDA 3KETA 3OWTA 4ZTFA 1HA8A 2PG4A 1ZZCA 1R00A 4GXOA 4J1XA 2R7OA 3DQVC 1E3HA 2K9SA 2B63J 3R0JA 1JKOC 3WE2A 4IQJA 2K5CA 2RV8A 2R7TA 5IYDJ 4OU0A 2LNMA 1SFEA 2LLKA 4JYKA 4ZYAA 2VJJA 3WTSC 2W1OA 4J01A 1LE8B 1HW1A 2VBYA 4B3AA 4ESJA 2ACJA 1POUA 1MZBA 1B72B 4PCQA 1OFCX 2ESNA 1XMKA 1IF1A 3HOSA 1XN7A 2G9WA 2FE3A 3N05A 4LGWA 3OIPA 1T2KA 3BROA 1Z1DA 4ER6A 3K1NA 2E1CA 2NXNB 1V54H 4KYWA 2JVHA 2L9SA 1RPWA 2M87A 1DU6A 1USTA 1JKQC 4HX7A 5F6FA 4DYCA 4V2FA 3PO2J 4I01A 4C2TA 2ZJRF 2Q2EB 1MBKA 2CRGA 1E3PA 4MQVA 4I6TA 1Z21A 2DPUA 3SQNA 2MBFA 4KJZA 2JWTA 3LA7A 1M1EB 1FP2A 3OV8A 2E2IJ 2Y75A 2ZCWA 1Z3XA 3D5SC 3NZLA 3HRTA 1IC8A 3ZRGA 2E2HJ 5K1YA 1I3AA 3ERMA 4GO1A 2WADA 4FQGA 2O0YA 1W36C 1EH7A 2DMQA 2ISYA 2Y69H 1R36A 1SQ8A 5D6EA 3IVPA 5DT2A 3EUHA 4M3FA 1IUYA 2MD5A 3I54A 4AD9A 1FOXA 2YPRA 5ILVA 1ETWA 5F64A 4OMZA 5HNHA 4IRHA 3V8JA 3IAM2 4B44A 2HKOA 4MCTA 1OR7A 1SMYF 3RKQA 3MZHA 3JTHA 1S5LC 3CROL 1J2XA 1FX7A 2L9VA 2PXQA 3R0AA 3DKXA 2L4MA 2IPQX 2IRFG 2YS9A 1BR1A 2HOEA 4FE4A 2JUGA 1ZGAA 2FUG2 1PNRA 2ZJPF 3K1PA 3K4JA 2D2WA 2GOXB 4U0VA 1DPUA 1YX3A 2EB7A 3TW6A 4BH9A 1F43A 3LSIA 1PVEA 1J0RA 1X1CA 4DBRA 1PJRA 2LBFB 2PXFA 3KP4A 1F9NA 1KYZA 3X2QH 4KICA 3J80K 1XGNA 3SCFA 4NDWA 3CCSI 4XSXF 5L3CA 2XB5A 1RNLA 1J09A 1ETOA 2P4WA 3PIOF 2VPLA 4UUSA 4Y7NJ 1J9IA 2GLOA 3I9V2 2ZMEA 1FOYA 1WWXA 1MDMA 2JT1A 1X4PA 4BS9A 2CH0A 3A9ZA 2MW8A 1X3WB 2CUFA 3R09A 5J3LA 1IJWC 4IF4A 2HU9A 3J7YJ 4HLYA 1ZRCA 3W6VA 3RYRA 1ZS4A 2XXPA 4Q2JA 5FB2A 4U88A 3M1CA 5K7HA 2Z5UA 2ID6A 3JRIA 3HDDA 2W82A 4Y15A 2QF7A 3SCHA 1KQ9A 2XAUA 2OTJI 1MNDA 1U9NA 3OYKA 3OYFA 3S3MA 2DOAA 4I6RA 1UTXA 2XXAA 2M4GA 2XB0X 5DCMB 3DNVB 4TV7A 5FFXA 4BJ6C 4HA8A 2Q1ZB 1MNMC 3BG5A 2DTZA 2B9SA 5F1JA 3OQNA 2K9MA 1I27A 1BI1A 3EPZA 3Q9VA 4ITVA 1I6HJ 4I6ZA 5A2QZ 3JRAA 2DA7A 2CYYA 1IXSB 3FXUA 3KEYA 3OL4A 1REPC 1MFQC 2EPFA 4DGWB 5M3MJ 1G3TA 3CESA 2PXBA 3HHHA 1LEAA 3TKYA 2F48A 3RSNA 5J47A 3KEQA 4JOMA 4MQ9F 4XLFA 3DEEA 3K4KA 3O8GA 2DI3A 4YFXF 5ICEA 4IKFA 1R1TA 3G0TA 1R5HA 3TMOA 2NVXJ 5FLXK 4ER3A 3MQ0A 2XAHA 1QVUA 2KDOA 1G3SA 1ZR2A 4RAYA 2K3FA 2LVSA 4HW0A 4M6VA 2KT0A 2QKMB 3KPHA 3ZQ7A 4CCKA 4C3IJ 3HXLA 4UVBA 3I0TA 2IGOA 5IOZA 1X3ZB 4WXCA 1MGTA 1R69A 3CMYA 2IW5A 2LREA 2ELKA 1LFPA 4EGZA 3KLOA 4RGSA 1HKTA 1TWHJ 1V5FA 1TT0A 3OKZA 1MMAA 1IN4A 3CC2I 3K9TA 3GZDC 4D5FA 3A01B 2EV5A 2J5OA 2ZFUA 5AIQA 4Z59A 1LVKA 1LLIA 3FMYA 5BNGA 4M6XA 3KL4A 1ZARA 3CUQA 1WQ2A 3H9GA 1P6RA 3FYMA 1QZXA 1LKXA 4M73A 2WV0A 1SVMA 1XX5A 1LPQA 1W0TA 1JKPC 2XRNA 6PAXA 4M9ZA 1O7FA 1U3EM 3NQOA 3BWGA 2EFWA 3S8PA 5LHIA 3C7JA 1YI2I 3DLAA 5M3FJ 4MHGA 1FZPB 2X0LA 3QOPA 1SEUA 2PMHA 1WIZA 4KMFA 2XVCA 2LFBA 3BZ6A 3GUDA 3OS2A 4FCYA 3NWSA 2E34A 1BA5A 3ZKCA 4AWXB 1ZREA 4CCMA 2E1NA 4AVPA 1B8IB 3DM5A 3BJ6A 1D0YA 3SEQA 2LD5A 2O7OA 1B6AA 3OYHA 1JXSA 3PE5A 2PIJA 3H3ZA 5CVRA 2JZYA 5M5YJ 2PE5A 3I5UA 3U21A 1MSFC 2H1LA 3VYRB 2M4HA 3BR2A 2PJRB 2O3FA 1UG2A 3F3XA 3G1OA 5D8KB 2PXUA 3M8JA 3CCYA 1R7JA 2R7QA 2COMA 1YW7A 2MYSA 2H6CA 2DT7B 1YQAA 2EK5A 2HQNA 4OAYA 4HF0A 2A6CA 3IH3A 1XC5A 2RKHA 5KAFC 1QNTA 4X4DA 3RKYA 2NVYJ 3V8KA 3DCFA 3K4BA 2WUSR 1MJAA 1WJEA 3OSFA 1MW7A 1STZA 4CZZA 1U8RA 1USSA 3IH2A 3B73A 2I8DA 1TT5B 2DOFA 2JN6A 1LDKB 4IZZA 3PM1A 4X6AJ 2R5ZA 1ZPQA 2CFXA 1XWRA 2MG4A 1BW5A 5FGMA 2WV1A 3OYLA 2IU7A 4RGRA 1E17A 1JJ8C 3ROUA 3GBFA 3K4LA 1R4NB 1QVTA 1LMB3 1LDDA 2Y0SA 4B48A 2FU4A 3RIRA 5JLWA 3QP5A 2CQ7A 4RM3A 3FXOA 5EEAA 1XSDA 1HW5A 2DQRA 2DMTA 3HSEA 3ECHA 3G2BA 2XRLA 3QOXA 3CC4I 3VYTB 1DU0A 1YHQI 1W5SA 1GLNA 4ZDOA 2MH9A 5E8IA 3G3ZA 3KP6A 2DDAA 3RKXA 2GA2A 2P5VA 2VIXA 2XPVA 3NARA 3Q0VA 4HPQA 2H8RA 4EQZA 2GZWA 3HZJA 3S1RJ 2DO7A 2M7AA 2ZXWH 1LVAA 4ON0A 5K7FA 3OR2C 5ERIA 4M3BA 4BGDA 2VXDA 3GTQJ 1SFKA 4IX7A 2BJCA 1QQIA 1NTCA 4LG0A 3G7DA 4AIKA 4XLAA 3DEUA 2PXDA 3M9AA 3M4OJ 1G3WA 1AA7A 1FWZA 2Y2ZA 2AXUA 3BQYA 4LMYA 4D5CA 1ON1A 4CCJA 2W00A 1QBJA 3WGIA 5JUWA 4BE2A 3KP7A 4KUMA 1RZ4A 1TP4A 3W2VA 3JSOA 3LAPA 1X57A 4ER7A 2GQQA 4DYRA 1XD7A 4BE1A 4F7ZA 4XLNF 1NW3A 1N77A 1A6IA 3SFIA 1XPXA 1BDIA 2L2OA 2LKSA 3ZMVA 4L0YB 2DJIA 5D8LB 4BHBA 2PN6A 2M8GX 2WB1A 3E6DA 1NK3P 3RYPA 3A9XA 3QRFF 2LYJA 2E36A 5GAGi 2BV6A 2XPUA 2GA1A 2EIKH 3KLNA 2DA5A 2OC6A 2UZKA 2N8GA 1FTZA 1T8IA 1FYLA 2VKHA 4E7IA 4XOPA 2H8WA 2H94A 1ZYRF 2XF6A 3BR5A 3H9JA 5E8GA 2K4JA 4YFNF 3CJNA 1ZR4A 3E5XA 4EVIA 2VASA 4B4CA 5M5XJ 4QSHA 1J75A 2A69F 3EUHC 2MA3A 3GTGJ 3DBHB 1U6GA 4I02A 3GF2A 2TRTA 1MBJA 3ZMTA 4EJUA 4I0AA 1OR7C 1DUXC 4XN0A 5EGOA 3LA3A 5BPIA 1D8JA 2O8KA 2ESHA 1RR8C 3QPTA 4WXDA 2K40A 3GTOJ 1X2MA 5D5VB 3J80Z 5C44J 1WSUA 5J4VA 3ASOH 3BP8A 3MEJA 3NROA 3IWZA 4NQWB 4GQMA 1KU2A 3R1FA 1VF9A 4XLEA 4WVLA 3ABKH 5E3LA 1SFOJ 2LYPA 3W2WA 4IA8A 2PXVA 1YRNB 4GFBA 2R7DA 2VBZA 1BC8C 2QBYA 3HOVJ 3DBLB 3TDZC 3CCEI 3KFWX 4IHWA 3GTMJ 4EATA 5J1RA 3TEDA 2V1DA 4DOZA 1AOYA 3MKLA 4MEXF 4JK1X 1B59A 2QQAA 3GN5B 1FBUA 2EJRA 4LK0F 1R5ID 2O6GE 3BG9A 1QQAA 4J00A 1I50J 3DFGA 3E5UA 2CMPA 4XNFA 4W1UA 3RPUD 1D3YA 2OTLI 2E7XA 1KU7A 4LLNA 2JRTA 3ZQGA 1P4XA 4AIHA 3MWMA 1ETYA 1SAUA 1OYYA 1R22A 2QQBA 1RC9A 1WETA 3QF3A 2F5FA 3WG9A 2KISA 1GUUA 2O5RA 4PJNA 4AU7A 3EUKL 2X6YA 1X4OA 1VQKI 1W7PA 4PU3C 1MMGA 2W84A 2IT0A 3K4NA 1VQ6I 4Z5DA 2IA0A 2BBYA 1T39A 3CC7I 2A5WA 2P7VB 3C1DA 3BTCA 1KU9A 2R7RA 5LD2C 2MEZA 1AKHB 1ODDA 2L7FP 3Q0UA 4BYYA 2OD5A 2Y48A 5EZGA 4BKXA 5D4RA 3BD1A 3H92A 4NDLA 4Q48A 2DXIA 2RAEA 1V4RA 3HTSB 1WH8A 4LFUA 2CQKA 1E2XA 2FBKA 4ZH4F 3J7ZI 2GOMA 5F0FA 3QQAA 1ZZBA 2FBHA 1BIBA 2ZSIB 2RGVA 4X4HA 3MKZA 2L3DA 5EG0B 3JREA 2FQ4A 4B8XA 1Z6RA 2KLOA 5DCFA 2FRHA 3FBIB 4NNJA 1X3UA 5AIPA 1EA3A 3ZHMA 1KU3A 1X2NA 3FK6A 4MIMA 5FLXZ 5DSXA 1AWCA 2DJNA 3T0YA 3L2UA 2LYRA 1W4MA 3PFIA 4FHTA 2KIFA 1Q1HA 3GZDA 1QZEA 2EV0A 4YIIA 3E7LA 2A07F 4A6DA 1RRJA 2EWTA 3QQ6A 3ME5A 4IEJA 2R7XA 2L0KA 4PU4C 1B1BA 5JVTA 2E1MC 2ICPA 5EYRA 1UHWA 4ZDPA 3GTJJ 1QA6A 2W4SA 2FOKA 1BL0A 3IP4B 4UB8C 2GZUA 2HINA 2EA4A 3FKJA 1XSXA 2EILH 2X6XA 3TO7A 3ZXSA 3A02A 3ZCOA 3ZGKA 1IRFA 4IRIA 2CQQA 2FXAA 2BNOA 3HZIB 4WXHA 4A69C 3OQOA 2BNMA 1VQ4I 2JPCA 1BDHA 4PDKA 1TNSA 1R1UA 5K7ZA 3LSGA 1LCCA 1DQUA 2F4MB 1VQOI 2OFYA 4XKCA 2LNBA 1BR4A 5CVUA 2X1CA 3G1MA 5FKMA 4A93J 3CF2A 4X4CA 1VZ0A 3U9GA 4D9JA 1H9GA 2WAEA 3BZCA 4I98B 4OMYA 5IOYA 3UNGC 2HDWA 3F8BA 2GXBA 1G6NA 1FSEA 4XLHA 4A3LJ 1WVRA 4EGYA 1HCRA 1ZQ3P 2DMUA 4UXNA 5L3GA 4IVZA 3GCMA 4XK4A 4XRSG 5M5WJ 2HCNA 2VT3A 3BG3A 3JR9A 5J40A 1BIAA 1V5EA 2YU9J 4D7MA 1P7IA 2VLAA 1WHUA 4XKBA 2O38A 4CUGA 2PUFA 1QHHD 2XAQA 2R5YA 2RQPA 4A3GJ 1OCPA 2GBYA 5HLIA 4AYBA 1R71A 1RIOA 4UB6C 4CH7A 1U5TB 3TQNA 3VODA 1JKRC 2XKPA 2HNHA 3HB9A 4L9NA 4OWRB 3BR3A 2J5PA 2QM3A 2CU7A 1RUOA 2AS5F 1RZRD 1Z3YA 2ZKZA 3ABLH 2R93J 2LK2A 4YFKF 1YX5A 1UFMA 2OQRA 2AXVA 2PX9A 1EFAA 4HRIA 4XRFA 4RLQA 4XM3A 2LYCA 2BXYA 3WTXC 2VC0A 3TFLA 2HQAA 2COBA 3HUGA 3O8HA 2F5CA 3F8MA 2P8TA 2JA6J 2NRAC 3CQZJ 2IVMA 5CKTA 3BTLA 2ZJQF 2PLYA 4BJ5C 4IRGA 3BLYA 3AG1H 4G6TB 3ZQHA 3RDIA 4HLXA 1WJAA 4NHJA 3MZYA 1K7AA 2V79A 2OUMA 4HBLA 4C3JJ 2KP6A 2CSOA 4OIOF 2IAIA 1K4SA 4BUPA 2EZKA 1QZYA 3CD6I 1EKEA 2DW4A 4D7NA 2PXTA 1U8BA 3E6MA 1W36D 1CF7A 1TZLA 2Y30A 3EETA 3KP3A 1OKRA 2M3AA 3L2VA 1JUSA 2L49A 3K2ZA 2LBFA 1F4KA 3FK7A 3PL8A 1ZRFA 1SAXA 4PK4A 1ZVVA 1RIOH 4PU7A 2JA5J 2DAOA 3KZZA 3ONQA 4I09A 3HSRA 3P9IA 4A3EJ 3I59A 4BHCA 2PFBA 5J1YA 2AXTC 3FXRA 2CSFA 1TC3C 2LP0A 1JT0A 1DGRM 3OYDA 1GVDA 3OYCA 4P55A 2F5VA 1ACIA 1Y1WJ 3A2KA 4CYCB 3QYXA 3J81K 1KONA 2MXDA 5IP9J 2EH3A 2HTSA 1SD5A 4BQNA 5BPDA 2WAFA 4M9SA 1HDDC 2KZGA 3F6OA 1YO5C 2XGEA 2F4OB 4FT8A 2CFOA 4CXFA 4Z58A 4B3XA 1UXCA 2KQRA 3IAS2 1XGOA 1MIJA 1PERL 1D0XA 5IYBJ 3ZMZA 2QCOA 3BR6A 2JSPA 3OS1A 3CCQI 5L3EA 3F0CA 2DA6A 1P4AA 1UAAA 1OYWA 2QSHX 5FJ8J 3FHNA 1E3OC 4JCXA 1JJ6C 5CJ9A 5EEGA 1CJGA 1F36A 1UB9A 2DFHA 4Y17A 2LKXA 3EYIA 1G2HA 2O4AA 2PUEA 3HOTA 4LD5A 1A5JA 5HOOA 1S7EA 4HX4A 3L2QA 2XI8A 4PU8A 2A05A 3JRFA 1OQYA 3B02A 3HKZA 2A6EF 4UV9A 1S6LA 4ANJA 1K6OA 2FOWA 1Z7LA 4R8HA 3VOEA 1MNEA 1K6YA 5FROA 4P9UA 3VPRA 1Y7YA 1D1AA 5E1ZB 1JUPA 5IP7J 3TOBA 4IOCF 3OYGA 3HRSA 5GAHJ 3IRQA 2R7ZJ 4G7ZF 3S3OA 5IYCJ 2GXAA 1I5ZA 3FXJA 2P5KA 1KZHA 2QVOA 2XSDC 3BDDA 1ETVA 1UHMA 2PI0A 3IWFA 3PXPA 1FBSA 1IZ1A 1PUEE 3QYEA 3OS0A 2R92J 1P4WA 4YARA 3SCGA 3U3WA 1YJWI 1FNNA 3NAUA 3K70C 4GRIA 3HC7A 1Z05A 2VB6A 2KEKA 3DKWA 4BBRJ 2X85A 5LGNA 1FJLA 1A04A 1FY7A 1XCBA 2HZDA 3HKZN 3CTAA 2PUCA 3HG9A 4HF2A 3FYAA 3FXMA 1ZHFA 2VN2A 2PPXA 4G8XA 2WAQN 3LSHA 1R9TJ 4LG3A 4B1RA 4K2EA 3E3VA 2WBMA 4DIQA 3GFMA 1SD7A 5LEJA 2FMLA 2M30A 3OYEA 2QENA 4EM2A 3OIQA 2JRMA 2EQRA 3NXHA 2JPBA 3VYSB 1OCZH 4HYEA 3AL0C 4C3HJ 3WHBA 1S9HA 1Y1VJ 3LSTA 3OYIA 2HYFA 2KPJA 4LIVA 3G73A 1FSHA 2ICTA 1Z91A 3WTTC 5D5WB 4A3MJ 2BXZA 2HKXA 4M74A 2AQEA 1WI3A 4HG2A 1GVJA 1XDUA 5D6FA 3CF5F 4GDFA 3GTKJ 4IPAA 2KFDA 4AIDA 5ILSA 1GDTA 1JFSA 2QWWA 3KZ3A 2DCEA 2M4KA 2L54A 4HOBA 4UNOA 1JTXA 3BJAA 2KKOA 5K5OA 1S8NA 2L5QA 2LH9A 1XGMA 4UHTA 1UCRA 4HNTA 3DF8A 4F93B 2NVTJ 4CCNA 5DM6F 3JRDA
chains in the Genus database with same CATH topology
1QVTA 2L7MP 1JTYA 3UFDA 3HOXJ 1LMB3 2AWIA 4MCXA 1L1MA 1MSEC 5JLWA 3ZQFA 2DMPA 5DTDA 2Y9YA 5EEAA 2DMTA 2G0EA 3GTLJ 2XRLA 3C2BA 2X9DA 1UMQA 1DU0A 3JRGA 3HOUJ 3LSPA 3B6AA 4A3KJ 2KEJA 1NEQA 3H3VK 2Y9ZA 4M3EA 4J1WA 3B7HA 3Q0VA 2XPVA 3NARA 2H8RA 1LQCA 4A3FJ 4MFEA 2XGDA 1ZGWA 2HXIA 3S1RJ 2HI3A 5K7FA 4M3BA 3GTQJ 4A3JJ 2BJCA 4IHVA 1NTCA 3F51A 4DZJA 4W97A 2MGQA 1U78A 3OMTA 3I4NJ 3G7DA 1EF4A 2HOAA 2AUWA 2KEIA 3M4OJ 3CLCA 2X6OA 5GPAA 2M9HA 2MSYA 2Y2ZA 3OSGA 2AXUA 2LYLA 4J19A 3QPSA 3BQYA 3FISA 1IUFA 1GT0C 1PRUA 1Z0XA 2H1KA 2MQKA 4D5CA 4X4BA 3MN2A 1OJLA 2PUDA 1K61A 3OOUA 5C4JJ 3MLFA 3HBLA 4YBAA 1WH5A 2R5YB 3TP3A 1XS9A 3RZZA 1X57A 1VFCA 1ETXA 3ZQCA 4DYRA 2GRLA 4F8DA 2FJRA 1MBGA 1I3QJ 2EZHA 3S14J 1A6IA 3SFIA 1BDIA 2XPWA 2NS7A 2M8GX 4CYCA 3B6CA 1NK3P 3A03A 2LYJA 1WPKA 5F0HA 4UUSB 3K2AA 2Y31A 2XJ3A 3BS3A 2XPUA 2DN0A 4HNVA 4AC0A 1HOMA 1ETKA 2DA5A 2GM4A 5C4XJ 2N8GA 1FTZA 4A3BJ 2PUGA 2IUOA 2NVQJ 4MO7A 1IDZA 1ZK8A 2DA4A 5EZHA 2IVBA 3BR5A 1ZR4A 1JH9A 5E3NA 4B4CA 5M5XJ 4ABZA 4QSHA 1OCTC 5F27A 2L8NA 3GTGJ 3CECA 1QRYA 4A3IJ 3LISA 2ECCA 4X4IA 4BY7J 1PRAA 2TRTA 1MBJA 4BXXJ 1ZZ8A 1FTTA 3IV5A 2BNNA 1RR7A 5EGOA 2P81A 2O8KA 1ZZ6A 2K40A 3GTOJ 5FKNA 1PUFA 2DA3A 3LSRA 3S16J 1X2MA 3HEFA 5C44J 4S0HB 4QIWN 3RZDJ 3A01A 1H88C 4GQMA 2ZB9A 1O4XA 3R1FA 3MVPA 1VF9A 1AHDP 5E3LA 1RETA 1SFOJ 2LYPA 4IA8A 2DMNA 1YRNB 4GFBA 3DEWA 3ZQIA 2JMWA 1GV5A 4MFDA 3HOVJ 3JXCL 5E3OA 3S8QA 4IHWA 4Z5CA 3GTMJ 1VPWA 5J1RA 3TEDA 1IV6A 1Q1VA 5IPAA 3Q3SA 2IEKA 3MKLA 3HOWJ 1NK2P 3GN5B 4MLOA 3KJXA 1HDPA 1MH3A 3BG9A 1MBHA 1QQAA 3LSJA 2LTPA 2ME6A 1AU7A 2NS8A 1I50J 2CUEA 2O9LA 4W1UA 4BY1J 3BR1A 2LYKA 3ZQGA 3BDNA 1ETYA 2CJJA 3QWGA 4A3CJ 3UKGA 2FD5A 1WETA 1VNDA 3QF3A 5HODA 1B8IA 1GUUA 2ID3A 2LY9A 2M2EA 4QTRA 5DS9A 4PU3C 4JP0A 1ETQA 1P7JA 3Q0WA 2R63A 2EBIA 5J1UA 4AYBN 2HOSA 2NOGA 2IVGA 4Z5DA 1JT6A 1GV2A 1QP4A 2EF8A 3BTCA 2FJ1A 5GP9A 1ZTRA 3BTJA 4L5EA 1AKHB 4G12A 2L7FP 3Q0UA 2MEZA 3JXBC 3M3YJ 2AHQA 5EZGA 4BKXA 3BD1A 4NDLA 1NERA 1IGNA 2RAEA 1ZZCA 1WH8A 4J1XA 1YRNA 2K9SA 2B63J 1WH7A 4DW6A 1JKOC 2W48A 5F0FA 3QQAA 1X58A 3JRCA 1ZZBA 4X1EA 5IYDJ 1TWAJ 2LLKA 4JYKA 4X4HA 1LE8B 5FKKA 1JUMA 5EG0B 3JREA 1UXDA 1ADRA 2FQ4A 4B3AA 2LYSA 4IHXA 1POUA 1B72B 1OFCX 1X2NA 3ZHMA 3FK6A 4MIMA 5F0CA 2R0QC 2JA7J 1T56A 2DJNA 2LYRA 1MBFA 1YSEA 3CDLA 2LR8A 3E7LA 4XIDA 2EWTA 3WHCA 3QQ6A 1OSLA 4IEJA 1RZSA 1ZAYA 2L0KA 3TRBA 4PU4C 1DW9A 1WGXA 2ICPA 5EYRA 1LFBA 3GTJJ 3PO3J 4X4GA 1BL0A 2GZUA 1RPWA 3QPLA 1DU6A 2HINA 1SANA 4FE7A 1JKQC 4DYCA 2JCGA 4V2FA 3PO2J 5FKOA 3S2HJ 2XCJA 4FBIA 1APLC 1MBKA 3A02A 3EUSA 2CQQA 2CRGA 4X4EA 2ECBA 2BNOA 1BW6A 4I6TA 4DYQA 4YG4A 3HZIB 3O9XA 2JWTA 4A69C 2KZ8A 1AKHA 3OQOA 2BNMA 2E2IJ 1IRZA 1BDHA 1MBEA 4XRSA 5K7ZA 3LSGA 1LCCA 2E1OA 1IC8A 2E2HJ 2OFYA 3H5TA 1BJZA 2IBDA 2IVQA 3G1MA 5FKMA 4A93J 4X4CA 2DMQA 3IVPA 1ITYA 1SQ8A 2OPTA 3BR0A 4M3FA 2VKVA 1JFTA 2M0CA 4X4FA 2EZIA 1ETWA 2LYQA 2VPRA 5IOYA 3S1NJ 1B0NA 4JCYA 4MCTA 3RKQA 5FLVA 3JXDL 3CROL 1VI0A 2IV1A 4UUTA 3S2DJ 4RDUA 2R5ZB 4A3LJ 2YS9A 5FKLA 3K7AJ 1HCRA 2DMUA 4FE4A 1ZQ3P 4IVZA 4XK4A 4XRSG 5M5WJ 3BG3A 3JR9A 1PNRA 3TP0A 3RZOJ 2YU9J 1MH4A 1QQBA 4D7MA 2ME0A 3S1QJ 1ENHA 1P7IA 4AUXA 2O38A 3LOCA 3TW6A 4FN3A 1T33A 1F43A 2PUFA 2R5YA 4OB4A 5IP6A 4A3GJ 1OCPA 3KXAA 4A3DJ 2GBYA 1JGGA 4Z5HA 3TW7A 2JJ7A 5GPCA 1RIOA 3G5GA 1JKRC 2FX0A 3SCFA 4GHJA 4NDWA 3HB9A 4I6UA 1RZRD 3BR3A 2CU7A 2XB5A 3HOYJ 2HSGA 1ETOA 1W0UA 2R93J 4UUSA 4Y7NJ 2LK2A 2GLOA 4YG7B 3HGGA 1RKWA 2AXVA 1EFAA 1FEXA 2B5AA 3F6WA 4DZPA 2E2JJ 2CQXA 3S1MJ 2KDZA 1ORKA 2MW8A 2CUFA 2HYJA 2VKEA 5J3LA 1IJWC 2VI6A 3G1LA 2COBA 4FISA 2HOTA 2PUBA 1RKTA 3O8HA 1WH6A 4V2GA 3W6VA 2JA6J 3CQZJ 1ZS4A 3BTLA 3FKIJ 5K7HA 2ID6A 3HM5A 3ZQHA 2CROA 3JRIA 4M3DA 3HDDA 4JX6A 4C3JJ 3GBGA 1LCDA 2I10A 2IAIA 2QF7A 3JRBA 2JVLA 4Y42A 2EZKA 4I6RA 1U9NA 1LFUP 3SCHA 4I8TA 4D7NA 1UTXA 3F52A 3H0GJ 1U8BA 2XB0X 1PRVA 1TWFJ 3DNVB 2Y30A 2DA2A 1MNMC 2HQ5A 3BG5A 1JUSA 2L49A 1K83J 1Y9QA 4FTHA 2DTZA 3FK7A 2JK3A 5F1JA 1ZVVA 3OQNA 4M3GA 5E3MA 2JA5J 4PU7A 1X2LA 2PMZN 1I6HJ 4I6ZA 4A3EJ 5J1YA 3JRAA 2CSFA 2DA7A 3BT9A 1TC3C 2LP0A 1RESA 1JT0A 2AW6A 3GN5A 1GVDA 4XICA 1Y1WJ 3QYXA 4CYCB 1RZRA 5M3MJ 5IP9J 2EH3A 1ZZ7A 2K9NA 1H8AC 1HDDC 1U9OA 1UHSA 2XIUA 2R1JL 5C3EJ 2XGEA 1H89C 3O8GA 1ZUGA 4Z58A 3IH4A 1UXCA 2NVXJ 1JWLA 1IG7A 1QVUA 1PERL 5IYBJ 1ZR2A 2QCOA 4Y52J 3BR6A 3F0CA 2DA6A 2LVSA 5JLXA 4M6VA 2KT0A 5IOZA 2AXZA 4LOCA 4C3IJ 2Y0SN 4JX5A 5FJ8J 1R69A 1E3OC 2VUMJ 4JCXA 3CMYA 1JJ6C 1CJGA 2ELKA 1F36A 3JRHA 2LKXA 1G2HA 2PUAA 5EGOB 3HOZJ 2O4AA 2PUEA 1TWHJ 1A5JA 1S7EA 2AO9A 5FLMJ 1PUFB 2XI8A 4PU8A 3JRFA 1Z77A 4D5FA 3A01B 5F04A 4Z59A 2L7ZA 1LLIA 1QPIA 3FMYA 5BNGA 3VPRA 1Y7YA 3FYMA 1R63A 5F08A 3ZQLA 4RBOA 1LE8A 1JUPA 5EG0A 3OP9A 5IP7J 2GRMA 5EF6A 2TCTA 1W0TA 2R7ZJ 1B72A 1JKPC 5IYCJ 2YUSA 5K98B 3HGYA 2XSDC 1ETVA 3PXPA 5M3FJ 4IHYA 4BBSJ 2R92J 2EZLA 3SCGA 4YARA 3U3WA 1POGA 3NAUA 4JX4A 1QPZA 3D1NI 1WIZA 3ZHIA 3SDGA 3I4MJ 2KEKA 2LFBA 4BBRJ 4FCYA 9ANTA 1FJLA 2K9QA 3LFPA 4I76A 2EBYA 1BA5A 3ZKCA 3HKZN 2PUCA 2X48A 3FYAA 1QP0A 1B8IB 2PPXA 1HLVA 5A7LA 2WAQN 2LD5A 1R9TJ 3RQIA 2O7OA 4B1RA 2PIJA 2PE5A 4C2MJ 5M5YJ 1MSFC 2O49A 2LCVA 3BR2A 2EQRA 4XRMA 1UG2A 3GTPJ 3ZOBA 1RPEL 2WB1N 3G1OA 3OQMA 3CCYA 2L9RA 4C3HJ 3WHBA 1Y1VJ 3BTIA 2HXOA 1ZZ9A 2KPJA 2A6CA 3IH3A 3S17J 1XC5A 2E19A 2HDDA 1HF0A 2ICTA 4X4DA 2NVYJ 4A3MJ 3SJMA 1TWCJ 3DCFA 3FIWA 2WUSR 2DA1A 1WI3A 1FIPA 3OSFA 1DWKA 3LNQA 1WCMJ 1ZKGA 3GTKJ 4O8BA 1XG1A 3IH2A 1IDYA 3BQZA 2JA8J 1GDTA 2JN6A 1JFSA 2OR1L 4IWRA 4YG1A 3KZ3A 3PM1A 4X6AJ 2R5ZA 4JQDA 3VK0A 1JTXA 1ZPQA 2OF7A 1XWRA 1TWGJ 2WIUB 1FIAA 2MG4A 3L1PA 1BW5A 2D5VA 2WV1A 2M34A 2XGCA 2IU7A 5EDNA 1JJ8C 1D5YA 2NVTJ 3S15J 4EEFG 1QP7A 1CQTA 3OIOA 3GBFA 3JRDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QVT A;  2L7M P;  1JTY A;  3UFD A;  3HOX J;  1LMB 3;  2AWI A;  4MCX A;  1L1M A;  1MSE C;  5JLW A;  3ZQF A;  2DMP A;  5DTD A;  2Y9Y A;  5EEA A;  2DMT A;  2G0E A;  3GTL J;  2XRL A;  3C2B A;  2X9D A;  1UMQ A;  1DU0 A;  3JRG A;  3HOU J;  3LSP A;  3B6A A;  4A3K J;  2KEJ A;  1NEQ A;  3H3V K;  2Y9Z A;  4M3E A;  4J1W A;  3B7H A;  3Q0V A;  2XPV A;  3NAR A;  2H8R A;  1LQC A;  4A3F J;  4MFE A;  2XGD A;  1ZGW A;  2HXI A;  3S1R J;  2HI3 A;  5K7F A;  4M3B A;  3GTQ J;  4A3J J;  2BJC A;  4IHV A;  1NTC A;  3F51 A;  4DZJ A;  4W97 A;  2MGQ A;  1U78 A;  3OMT A;  3I4N J;  3G7D A;  1EF4 A;  2HOA A;  2AUW A;  2KEI A;  3M4O J;  3CLC A;  2X6O A;  5GPA A;  2M9H A;  2MSY A;  2Y2Z A;  3OSG A;  2AXU A;  2LYL A;  4J19 A;  3QPS A;  3BQY A;  3FIS A;  1IUF A;  1GT0 C;  1PRU A;  1Z0X A;  2H1K A;  2MQK A;  4D5C A;  4X4B A;  3MN2 A;  1OJL A;  2PUD A;  1K61 A;  3OOU A;  5C4J J;  3MLF A;  3HBL A;  4YBA A;  1WH5 A;  2R5Y B;  3TP3 A;  1XS9 A;  3RZZ A;  1X57 A;  1VFC A;  1ETX A;  3ZQC A;  4DYR A;  2GRL A;  4F8D A;  2FJR A;  1MBG A;  1I3Q J;  2EZH A;  3S14 J;  1A6I A;  3SFI A;  1BDI A;  2XPW A;  2NS7 A;  2M8G X;  4CYC A;  3B6C A;  1NK3 P;  3A03 A;  2LYJ A;  1WPK A;  5F0H A;  4UUS B;  3K2A A;  2Y31 A;  2XJ3 A;  3BS3 A;  2XPU A;  2DN0 A;  4HNV A;  4AC0 A;  1HOM A;  1ETK A;  2DA5 A;  2GM4 A;  5C4X J;  2N8G A;  1FTZ A;  4A3B J;  2PUG A;  2IUO A;  2NVQ J;  4MO7 A;  1IDZ A;  1ZK8 A;  2DA4 A;  5EZH A;  2IVB A;  3BR5 A;  1ZR4 A;  1JH9 A;  5E3N A;  4B4C A;  5M5X J;  4ABZ A;  4QSH A;  1OCT C;  5F27 A;  2L8N A;  3GTG J;  3CEC A;  1QRY A;  4A3I J;  3LIS A;  2ECC A;  4X4I A;  4BY7 J;  1PRA A;  2TRT A;  1MBJ A;  4BXX J;  1ZZ8 A;  1FTT A;  3IV5 A;  2BNN A;  1RR7 A;  5EGO A;  2P81 A;  2O8K A;  1ZZ6 A;  2K40 A;  3GTO J;  5FKN A;  1PUF A;  2DA3 A;  3LSR A;  3S16 J;  1X2M A;  3HEF A;  5C44 J;  4S0H B;  4QIW N;  3RZD J;  3A01 A;  1H88 C;  4GQM A;  2ZB9 A;  1O4X A;  3R1F A;  3MVP A;  1VF9 A;  1AHD P;  5E3L A;  1RET A;  1SFO J;  2LYP A;  4IA8 A;  2DMN A;  1YRN B;  4GFB A;  3DEW A;  3ZQI A;  2JMW A;  1GV5 A;  4MFD A;  3HOV J;  3JXC L;  5E3O A;  3S8Q A;  4IHW A;  4Z5C A;  3GTM J;  1VPW A;  5J1R A;  3TED A;  1IV6 A;  1Q1V A;  5IPA A;  3Q3S A;  2IEK A;  3MKL A;  3HOW J;  1NK2 P;  3GN5 B;  4MLO A;  3KJX A;  1HDP A;  1MH3 A;  3BG9 A;  1MBH A;  1QQA A;  3LSJ A;  2LTP A;  2ME6 A;  1AU7 A;  2NS8 A;  1I50 J;  2CUE A;  2O9L A;  4W1U A;  4BY1 J;  3BR1 A;  2LYK A;  3ZQG A;  3BDN A;  1ETY A;  2CJJ A;  3QWG A;  4A3C J;  3UKG A;  2FD5 A;  1WET A;  1VND A;  3QF3 A;  5HOD A;  1B8I A;  1GUU A;  2ID3 A;  2LY9 A;  2M2E A;  4QTR A;  5DS9 A;  4PU3 C;  4JP0 A;  1ETQ A;  1P7J A;  3Q0W A;  2R63 A;  2EBI A;  5J1U A;  4AYB N;  2HOS A;  2NOG A;  2IVG A;  4Z5D A;  1JT6 A;  1GV2 A;  1QP4 A;  2EF8 A;  3BTC A;  2FJ1 A;  5GP9 A;  1ZTR A;  3BTJ A;  4L5E A;  1AKH B;  4G12 A;  2L7F P;  3Q0U A;  2MEZ A;  3JXB C;  3M3Y J;  2AHQ A;  5EZG A;  4BKX A;  3BD1 A;  4NDL A;  1NER A;  1IGN A;  2RAE A;  1ZZC A;  1WH8 A;  4J1X A;  1YRN A;  2K9S A;  2B63 J;  1WH7 A;  4DW6 A;  1JKO C;  2W48 A;  5F0F A;  3QQA A;  1X58 A;  3JRC A;  1ZZB A;  4X1E A;  5IYD J;  1TWA J;  2LLK A;  4JYK A;  4X4H A;  1LE8 B;  5FKK A;  1JUM A;  5EG0 B;  3JRE A;  1UXD A;  1ADR A;  2FQ4 A;  4B3A A;  2LYS A;  4IHX A;  1POU A;  1B72 B;  1OFC X;  1X2N A;  3ZHM A;  3FK6 A;  4MIM A;  5F0C A;  2R0Q C;  2JA7 J;  1T56 A;  2DJN A;  2LYR A;  1MBF A;  1YSE A;  3CDL A;  2LR8 A;  3E7L A;  4XID A;  2EWT A;  3WHC A;  3QQ6 A;  1OSL A;  4IEJ A;  1RZS A;  1ZAY A;  2L0K A;  3TRB A;  4PU4 C;  1DW9 A;  1WGX A;  2ICP A;  5EYR A;  1LFB A;  3GTJ J;  3PO3 J;  4X4G A;  1BL0 A;  2GZU A;  1RPW A;  3QPL A;  1DU6 A;  2HIN A;  1SAN A;  4FE7 A;  1JKQ C;  4DYC A;  2JCG A;  4V2F A;  3PO2 J;  5FKO A;  3S2H J;  2XCJ A;  4FBI A;  1APL C;  1MBK A;  3A02 A;  3EUS A;  2CQQ A;  2CRG A;  4X4E A;  2ECB A;  2BNO A;  1BW6 A;  4I6T A;  4DYQ A;  4YG4 A;  3HZI B;  3O9X A;  2JWT A;  4A69 C;  2KZ8 A;  1AKH A;  3OQO A;  2BNM A;  2E2I J;  1IRZ A;  1BDH A;  1MBE A;  4XRS A;  5K7Z A;  3LSG A;  1LCC A;  2E1O A;  1IC8 A;  2E2H J;  2OFY A;  3H5T A;  1BJZ A;  2IBD A;  2IVQ A;  3G1M A;  5FKM A;  4A93 J;  4X4C A;  2DMQ A;  3IVP A;  1ITY A;  1SQ8 A;  2OPT A;  3BR0 A;  4M3F A;  2VKV A;  1JFT A;  2M0C A;  4X4F A;  2EZI A;  1ETW A;  2LYQ A;  2VPR A;  5IOY A;  3S1N J;  1B0N A;  4JCY A;  4MCT A;  3RKQ A;  5FLV A;  3JXD L;  3CRO L;  1VI0 A;  2IV1 A;  4UUT A;  3S2D J;  4RDU A;  2R5Z B;  4A3L J;  2YS9 A;  5FKL A;  3K7A J;  1HCR A;  2DMU A;  4FE4 A;  1ZQ3 P;  4IVZ A;  4XK4 A;  4XRS G;  5M5W J;  3BG3 A;  3JR9 A;  1PNR A;  3TP0 A;  3RZO J;  2YU9 J;  1MH4 A;  1QQB A;  4D7M A;  2ME0 A;  3S1Q J;  1ENH A;  1P7I A;  4AUX A;  2O38 A;  3LOC A;  3TW6 A;  4FN3 A;  1T33 A;  1F43 A;  2PUF A;  2R5Y A;  4OB4 A;  5IP6 A;  4A3G J;  1OCP A;  3KXA A;  4A3D J;  2GBY A;  1JGG A;  4Z5H A;  3TW7 A;  2JJ7 A;  5GPC A;  1RIO A;  3G5G A;  1JKR C;  2FX0 A;  3SCF A;  4GHJ A;  4NDW A;  3HB9 A;  4I6U A;  1RZR D;  3BR3 A;  2CU7 A;  2XB5 A;  3HOY J;  2HSG A;  1ETO A;  1W0U A;  2R93 J;  4UUS A;  4Y7N J;  2LK2 A;  2GLO A;  4YG7 B;  3HGG A;  1RKW A;  2AXV A;  1EFA A;  1FEX A;  2B5A A;  3F6W A;  4DZP A;  2E2J J;  2CQX A;  3S1M J;  2KDZ A;  1ORK A;  2MW8 A;  2CUF A;  2HYJ A;  2VKE A;  5J3L A;  1IJW C;  2VI6 A;  3G1L A;  2COB A;  4FIS A;  2HOT A;  2PUB A;  1RKT A;  3O8H A;  1WH6 A;  4V2G A;  3W6V A;  2JA6 J;  3CQZ J;  1ZS4 A;  3BTL A;  3FKI J;  5K7H A;  2ID6 A;  3HM5 A;  3ZQH A;  2CRO A;  3JRI A;  4M3D A;  3HDD A;  4JX6 A;  4C3J J;  3GBG A;  1LCD A;  2I10 A;  2IAI A;  2QF7 A;  3JRB A;  2JVL A;  4Y42 A;  2EZK A;  4I6R A;  1U9N A;  1LFU P;  3SCH A;  4I8T A;  4D7N A;  1UTX A;  3F52 A;  3H0G J;  1U8B A;  2XB0 X;  1PRV A;  1TWF J;  3DNV B;  2Y30 A;  2DA2 A;  1MNM C;  2HQ5 A;  3BG5 A;  1JUS A;  2L49 A;  1K83 J;  1Y9Q A;  4FTH A;  2DTZ A;  3FK7 A;  2JK3 A;  5F1J A;  1ZVV A;  3OQN A;  4M3G A;  5E3M A;  2JA5 J;  4PU7 A;  1X2L A;  2PMZ N;  1I6H J;  4I6Z A;  4A3E J;  5J1Y A;  3JRA A;  2CSF A;  2DA7 A;  3BT9 A;  1TC3 C;  2LP0 A;  1RES A;  1JT0 A;  2AW6 A;  3GN5 A;  1GVD A;  4XIC A;  1Y1W J;  3QYX A;  4CYC B;  1RZR A;  5M3M J;  5IP9 J;  2EH3 A;  1ZZ7 A;  2K9N A;  1H8A C;  1HDD C;  1U9O A;  1UHS A;  2XIU A;  2R1J L;  5C3E J;  2XGE A;  1H89 C;  3O8G A;  1ZUG A;  4Z58 A;  3IH4 A;  1UXC A;  2NVX J;  1JWL A;  1IG7 A;  1QVU A;  1PER L;  5IYB J;  1ZR2 A;  2QCO A;  4Y52 J;  3BR6 A;  3F0C A;  2DA6 A;  2LVS A;  5JLX A;  4M6V A;  2KT0 A;  5IOZ A;  2AXZ A;  4LOC A;  4C3I J;  2Y0S N;  4JX5 A;  5FJ8 J;  1R69 A;  1E3O C;  2VUM J;  4JCX A;  3CMY A;  1JJ6 C;  1CJG A;  2ELK A;  1F36 A;  3JRH A;  2LKX A;  1G2H A;  2PUA A;  5EGO B;  3HOZ J;  2O4A A;  2PUE A;  1TWH J;  1A5J A;  1S7E A;  2AO9 A;  5FLM J;  1PUF B;  2XI8 A;  4PU8 A;  3JRF A;  1Z77 A;  4D5F A;  3A01 B;  5F04 A;  4Z59 A;  2L7Z A;  1LLI A;  1QPI A;  3FMY A;  5BNG A;  3VPR A;  1Y7Y A;  3FYM A;  1R63 A;  5F08 A;  3ZQL A;  4RBO A;  1LE8 A;  1JUP A;  5EG0 A;  3OP9 A;  5IP7 J;  2GRM A;  5EF6 A;  2TCT A;  1W0T A;  2R7Z J;  1B72 A;  1JKP C;  5IYC J;  2YUS A;  5K98 B;  3HGY A;  2XSD C;  1ETV A;  3PXP A;  5M3F J;  4IHY A;  4BBS J;  2R92 J;  2EZL A;  3SCG A;  4YAR A;  3U3W A;  1POG A;  3NAU A;  4JX4 A;  1QPZ A;  3D1N I;  1WIZ A;  3ZHI A;  3SDG A;  3I4M J;  2KEK A;  2LFB A;  4BBR J;  4FCY A;  9ANT A;  1FJL A;  2K9Q A;  3LFP A;  4I76 A;  2EBY A;  1BA5 A;  3ZKC A;  3HKZ N;  2PUC A;  2X48 A;  3FYA A;  1QP0 A;  1B8I B;  2PPX A;  1HLV A;  5A7L A;  2WAQ N;  2LD5 A;  1R9T J;  3RQI A;  2O7O A;  4B1R A;  2PIJ A;  2PE5 A;  4C2M J;  5M5Y J;  1MSF C;  2O49 A;  2LCV A;  3BR2 A;  2EQR A;  4XRM A;  1UG2 A;  3GTP J;  3ZOB A;  1RPE L;  2WB1 N;  3G1O A;  3OQM A;  3CCY A;  2L9R A;  4C3H J;  3WHB A;  1Y1V J;  3BTI A;  2HXO A;  1ZZ9 A;  2KPJ A;  2A6C A;  3IH3 A;  3S17 J;  1XC5 A;  2E19 A;  2HDD A;  1HF0 A;  2ICT A;  4X4D A;  2NVY J;  4A3M J;  3SJM A;  1TWC J;  3DCF A;  3FIW A;  2WUS R;  2DA1 A;  1WI3 A;  1FIP A;  3OSF A;  1DWK A;  3LNQ A;  1WCM J;  1ZKG A;  3GTK J;  4O8B A;  1XG1 A;  3IH2 A;  1IDY A;  3BQZ A;  2JA8 J;  1GDT A;  2JN6 A;  1JFS A;  2OR1 L;  4IWR A;  4YG1 A;  3KZ3 A;  3PM1 A;  4X6A J;  2R5Z A;  4JQD A;  3VK0 A;  1JTX A;  1ZPQ A;  2OF7 A;  1XWR A;  1TWG J;  2WIU B;  1FIA A;  2MG4 A;  3L1P A;  1BW5 A;  2D5V A;  2WV1 A;  2M34 A;  2XGC A;  2IU7 A;  5EDN A;  1JJ8 C;  1D5Y A;  2NVT J;  3S15 J;  4EEF G;  1QP7 A;  1CQT A;  3OIO A;  3GBF A;  3JRD A; 
#chains in the Genus database with same CATH topology
 3RJP A;  2L7M P;  1JTY A;  3UFD A;  2QUF A;  2M8E A;  5E1W A;  4ZYE A;  2LLW A;  4G94 A;  2DLL A;  3RTR A;  2DMP A;  1E0E A;  3FDY A;  3IKT A;  1LDJ A;  2BEO A;  3GTL J;  3BG7 A;  1W5C C;  3R61 A;  4CDG A;  3JRG A;  3CME I;  2HVQ A;  2VC1 A;  5DUI A;  3VWB A;  2LF8 A;  3Q5F A;  4G9Y A;  2RQQ A;  2Y9Z A;  3FF5 A;  5EJC A;  4J1W A;  2V9P A;  1VQ8 I;  4DE9 A;  3S2W A;  3OYJ A;  1OMI A;  4MFE A;  3R6S A;  3K69 A;  3U1D A;  4L9T A;  1ZGW A;  2UXN A;  4R79 A;  2KJB A;  5LBQ A;  2WC2 A;  2NAZ A;  3DPT A;  2X51 A;  1ZG3 A;  3ABM H;  2WY7 Q;  4DZJ A;  2MGQ A;  5CVV A;  5E20 A;  1EF4 A;  2AUW A;  2EIJ H;  2KEI A;  3TEL A;  1I1G A;  2A6H F;  3V7S A;  2NOJ B;  2XF5 A;  3GZ5 A;  5GPA A;  3RQ4 A;  2MSY A;  4ENJ A;  1V5G A;  1K4T A;  1J7K A;  2VL8 A;  2ZNZ A;  4Q4Z F;  3AAF A;  2VE9 A;  1GT0 C;  1Z0X A;  2H1K A;  2VE8 A;  1OJL A;  1K61 A;  1VQ7 I;  5E17 F;  3MLF A;  4S05 A;  4YBA A;  1WH5 A;  1YE9 A;  5TGT A;  1PYV A;  2Z1D A;  1XS9 A;  3AG3 H;  2UV1 A;  4YEJ A;  3SR4 A;  3GEZ A;  1LUJ B;  4XN3 A;  2EZH A;  5KHD A;  1B9M A;  4XLP F;  3TDU C;  2XPW A;  3C18 A;  5B5E C;  2NS7 A;  3SZG A;  4ZTJ A;  3V8L A;  1BM9 A;  2ZO4 A;  3A9Y A;  4X0G A;  5DTR A;  5E1X A;  2CV0 A;  4UUS B;  3K2A A;  4ZZD A;  1RI7 A;  2Y31 A;  2ZME B;  2XJ3 A;  4IOA F;  3H1C A;  3F8F A;  1MDM B;  4EKI A;  1OIS A;  2YX7 A;  5C4X J;  3DU6 A;  3KCC A;  5IY5 H;  2IUO A;  1SC7 A;  3ULQ B;  2IVB A;  1ZK8 A;  2DA4 A;  2QQ8 A;  1JH9 A;  2QSG X;  5IT9 Z;  3KX2 A;  4A0Y A;  2PXE A;  4ABZ A;  4II2 A;  2AXZ A;  2VQL A;  3S32 A;  1ZG1 A;  2GXG A;  5FO5 A;  4BY7 J;  1ZRD A;  1FMV A;  1PRA A;  1A31 A;  2V1U A;  4CA0 A;  1FTT A;  2ADU A;  2BNN A;  1RR7 A;  2P81 A;  4BEH A;  2R7F A;  5B1A H;  4IL6 C;  1PUF A;  2BYV E;  3S16 J;  3CCU I;  3K1M A;  1UEL B;  3HEF A;  2LSO A;  3DLL F;  3RZD J;  1Y0N A;  3AFH A;  2YBD A;  2L02 A;  4ZZL A;  1AHD P;  3VDX A;  3GLX A;  4ASN A;  3DEW A;  1WI9 A;  3ZQI A;  4MFD A;  3S93 A;  3ASN H;  3NWT A;  3CCR I;  3S8Q A;  5BMZ A;  2FEZ A;  3CUO A;  3WTU C;  4UVA A;  3L2R A;  3BC8 A;  5IPA A;  1EV7 A;  1Y8R B;  4RAG A;  3MEX A;  3HOW J;  1S3J A;  1MH3 A;  5HNF A;  1TBX A;  5ED4 A;  3FXQ A;  3HRM A;  4H4K C;  4XKV A;  3CCJ I;  1OCR H;  3LSJ A;  2LTP A;  2DPD A;  3PIP F;  1AU7 A;  2NS8 A;  2E5Z A;  2X6W A;  4BY1 J;  3M1E A;  4QWQ A;  1NHA A;  4BQQ A;  2CG4 A;  2JQE A;  1KGS A;  4XQF A;  2E1M B;  1QU3 A;  3I56 I;  4UVC A;  5L3B A;  5LRS A;  3SZP A;  1VND A;  1VQN I;  5HOD A;  4U7D A;  4LIU A;  2ID3 A;  3OWQ A;  3NRV A;  4JP0 A;  2X4H A;  2BW3 A;  1ETQ A;  4P1W A;  5ILU A;  2OJE D;  3Q0W A;  3QU6 A;  4C9Y A;  4HZF A;  2HEO A;  4A12 A;  2NOG A;  4YIR X;  1HC8 A;  4WF2 A;  2FJ1 A;  3T8T A;  4HDU A;  1YS7 A;  4L5E A;  4QPQ A;  3L2C A;  3JXB C;  4NQW A;  3M3Y J;  1ULY A;  3FMS A;  4EJO A;  1NER A;  4I7H A;  3NEU A;  1YRN A;  2WY8 Q;  3PSI A;  5J8C A;  4E7K A;  2W48 A;  1S7O A;  2P0W A;  2XC7 A;  4LLL A;  3JRC A;  4A2U A;  2V26 A;  3J81 Z;  4X1E A;  4E7J A;  3CUQ B;  1FPQ A;  1YG2 A;  3FX3 A;  4D0P A;  2P5L C;  1S29 A;  3GLL A;  1JUM A;  1UXD A;  4PJL A;  5D4S A;  3T5X A;  3CO6 C;  4L5I A;  5ICC A;  2KRC A;  3SEZ A;  2LYS A;  4IHX A;  2HPM A;  1IXR C;  1P2F A;  3F6V A;  1K78 A;  2F4I A;  2JA7 J;  5F0C A;  2R0Q C;  2QSF X;  2I5U A;  4PJJ A;  2P6T A;  4G6Q A;  5KAI C;  1YSE A;  3M8F A;  1VQ5 I;  2LR8 A;  4XID A;  1HKS A;  1U0J A;  3WHC A;  3BPX A;  2DFE A;  5GAD J;  2CWE A;  3ZN0 A;  1LQ1 A;  2A5Y B;  1RZS A;  3TRB A;  4EQQ A;  1S7A A;  1Y56 A;  1LFB A;  3PO3 J;  3RPQ A;  4BXU A;  5TRD A;  1QHG A;  3QPL A;  3H3U A;  1L0O C;  5CYV A;  5DD8 A;  2J7W A;  1YIJ I;  5TIS C;  5FKO A;  5L3D A;  4NC8 A;  1APL C;  1R49 A;  2YU3 A;  4X4E A;  5F1R A;  2ECB A;  2XAS A;  1BW6 A;  4YG4 A;  5BQT A;  3GYH X;  3O9X A;  1AKH A;  3L9F A;  4RB1 A;  3ZP5 A;  3O2P E;  1CGP A;  2BGC A;  3OYN A;  1MBE A;  1YW9 A;  4XRS A;  4IHT A;  2VJ4 A;  2A6T A;  3H5T A;  4CHU A;  1J59 A;  3GXO A;  2IVQ A;  4QPO A;  4U0Y A;  2CW8 A;  1D8K A;  2A68 F;  4XL9 A;  3CP8 A;  1GXP A;  2KRF A;  2MC3 A;  2MAB A;  2OPT A;  3BR0 A;  1O3S A;  3FMR A;  2M0C A;  4X4F A;  1JFT A;  2K9L A;  4KFC A;  1YYV A;  3BPV A;  2G7H A;  3TO9 A;  2L4A A;  3DU5 A;  2VPR A;  3QYB A;  5LGU A;  2LLV A;  3P9C A;  3U1K A;  3RI4 A;  4UUT A;  3J7A O;  2XIG A;  3S2D J;  3BJO A;  4CCL A;  5DM7 F;  2LMD A;  2IS2 A;  2R5Z B;  2BY1 A;  2VOO A;  3K7A J;  4CIC A;  4PSW A;  2F2E A;  1XB4 A;  2IGM A;  2R7V A;  3RZO J;  1QQB A;  1FMW A;  3S1Q J;  1Y6I A;  3LOC A;  2JA2 A;  3MD2 A;  1T33 A;  4FN3 A;  4EJW A;  2BVM A;  2Z2S B;  4LLG F;  4EKG A;  5IP6 A;  4B43 A;  3KXA A;  4OIR F;  3JTG A;  4A3D J;  4GYG A;  1O3Q A;  2W25 A;  2C6Y A;  1JGG A;  2BZT A;  2JJ7 A;  4P5O A;  3TW7 A;  3G5G A;  4N4N B;  3KE2 A;  1MMD A;  2Z16 A;  5AON A;  2VKD A;  4QLC U;  2HSG A;  4F55 A;  2PJP A;  4YG7 B;  2DOE A;  3ZR8 X;  3HGG A;  4FX0 A;  1BR2 A;  2YR2 A;  4BQA A;  3F6W A;  2E2J J;  4UV8 A;  2YSR A;  1XDS A;  2CQX A;  3I71 A;  5LEK A;  3S1M J;  1ORK A;  2MD0 A;  2VI6 A;  5JHU A;  2HOT A;  1D1C A;  1RKT A;  4V2G A;  2HS5 A;  3MZ8 A;  3PUF A;  4LG0 B;  1EH6 A;  3JAM K;  3KZI C;  3FKI J;  4HEA 2;  4RB2 C;  3HM5 A;  4G7O F;  1C0W A;  2K02 A;  1YJ9 I;  4M3D A;  3T8R A;  2EFP A;  4DQ2 A;  4Y33 A;  2I10 A;  1LCD A;  3JRB A;  2Q8K A;  1P9Q C;  2JVL A;  3O6B B;  4Y42 A;  4I8T A;  2EIM H;  1LFU P;  1TQM A;  1JE8 A;  4E6K G;  2VBX A;  3QYF A;  1TWF J;  1VQ9 I;  5CPR B;  1DP7 P;  4KT6 A;  4FTH A;  2HQR A;  2M45 A;  4ENM A;  5CLS A;  2ELJ A;  3G4S I;  4XR6 A;  5H2F C;  5E3M A;  2HFH A;  1X2L A;  2PMZ N;  3OOP A;  1IO2 A;  1ZGJ A;  2XAJ A;  4NBQ A;  4PSX A;  2HCS A;  3BT9 A;  4IJA A;  2AW6 A;  2KIQ A;  4XLC A;  1NH3 A;  4XIC A;  2XXQ A;  1SD6 A;  4C2U A;  2DK5 A;  4HV5 A;  4OIP F;  1UG0 A;  2K9N A;  3D5L A;  1H8A C;  2XAG A;  2CV2 A;  1U9O A;  2BE5 F;  2IP2 A;  2R1J L;  2LG4 A;  4HF1 A;  2DU9 A;  4PJ0 C;  3GFL A;  1ZUG A;  3COA C;  3GX4 X;  4N9I A;  5FRN A;  2G7U A;  2DT6 A;  4Y52 J;  3F72 A;  4AVZ A;  1H0M A;  2Y0M A;  5KNL A;  2A61 A;  3FXK A;  4JX5 A;  2V7F A;  2EIN H;  2BY3 A;  3KYL A;  1SFU A;  2VUM J;  4IO9 F;  3JRH A;  1QB2 A;  3ABU A;  5EGO B;  4BL0 B;  3HOZ J;  2PUA A;  3HPG A;  5GTH C;  5FLM J;  5HLT A;  1D0Z A;  2FQ3 A;  1Z77 A;  3ZMD A;  1YW8 A;  4JQF A;  4DNC A;  5F04 A;  5FFZ A;  2L7Z A;  1QPI A;  2L9N A;  5HLG A;  4O3M A;  2XAF A;  4BU2 A;  4Q5S F;  4WX9 A;  2QBY B;  1R63 A;  3CO7 C;  3HPH A;  1LE8 A;  3OP9 A;  2KIM A;  3WTW C;  2TCT A;  3M8E A;  5TJJ A;  5JFR A;  2XSJ C;  1X1D A;  1B72 A;  3PNT A;  1JHH A;  2QKL B;  2L7K A;  5K98 B;  3HGY A;  5IT9 K;  4ETS A;  3L7W A;  4OBM A;  1HSJ A;  4BXF A;  2W7N A;  1YJN I;  3DKY A;  1POG A;  4ZDL A;  5JVG F;  3SDG A;  3WG7 H;  3I4M J;  2ZFW A;  4L9V A;  4HQM A;  4EV0 A;  2DK8 A;  3E5Q A;  4ZYH A;  9ANT A;  4I76 A;  2K3P A;  3PQK A;  2CO5 A;  3LL7 A;  2X48 A;  4HST A;  1HLV A;  2Q2E A;  3LQQ A;  2GAU A;  1W7P B;  2RVC A;  2ZXJ A;  3VFZ A;  4C2M J;  3HJE A;  2TDX A;  2KJC A;  3N97 A;  3HSF A;  4HQE A;  3SYT A;  3GTP J;  1RPE L;  2P7C B;  3CJQ B;  3OQM A;  1ZAO A;  2L9R A;  2PXK A;  3SXY A;  2HXO A;  1O3R A;  3KP2 A;  3S17 J;  1Y39 A;  2W57 A;  2MLG A;  2QLZ A;  3WTY C;  1HF0 A;  3LQX A;  4LJZ F;  1TWC J;  4D1Q A;  1A35 A;  4IHS A;  3FIW A;  2DA1 A;  4NUB A;  3WTV C;  3MCZ A;  3LNQ A;  1WCM J;  2IJL A;  2KRH A;  4Y4R A;  2VEO A;  1XG1 A;  3AG2 H;  3BQZ A;  2JA8 J;  3VEP A;  3TO6 A;  1SMT A;  3VSL A;  1EJ9 A;  1X1P A;  2VQG A;  3W6K B;  4JQD A;  1KA8 A;  3VK0 A;  1PP7 U;  2BHY A;  2QYO A;  2OF7 A;  1TWG J;  2WIU B;  3L1P A;  4N9H A;  2D5V A;  3GZC A;  2M34 A;  3GME A;  4E7S A;  2K27 A;  4M72 A;  1LB2 A;  3CCV I;  4EEF G;  1D5Y A;  1CQT A;  1XMA A;  1O7L A;  1OCO H;  3OIO A;  2WTE A;  1RUN A;  3F8N A;  3JW4 A;  5FLV A;  3ECO A;  1I1S A;  2OCE A;  1B9N A;  4MCX A;  1MSE C;  1UJ8 A;  5DTM A;  3H36 A;  3ZQF A;  4F52 A;  5DTD A;  1NG6 A;  2IXS A;  1DPR A;  1OYI A;  2MFZ A;  2X9D A;  1UMQ A;  3JCU C;  5H6R A;  4B09 A;  2CGP A;  1U2Z A;  3HOU J;  3LSP A;  2W24 A;  3A4C A;  5BOX A;  4A3K J;  3SHF A;  3K70 D;  1BOB A;  3VYU B;  2RNG A;  1VTN C;  4YG2 F;  1LQC A;  4A3F J;  3OL3 A;  4XON A;  2XGD A;  5HVQ C;  1KQ0 A;  2XRO A;  2GIZ A;  3HL2 A;  2HI3 A;  3WGH A;  2XUB A;  4A3J J;  1FYK A;  3F51 A;  5HDN A;  1V55 H;  3R60 A;  1FLI A;  2ZXI A;  1U78 A;  4E4H A;  3I4N J;  5DYM A;  3OMT A;  2V9V A;  4H0E A;  1ZG5 A;  1U2W A;  2E7W A;  2KHM A;  2X6O A;  3V7R A;  4ZC3 A;  3TGN A;  2DFI A;  2P6S A;  1R4M B;  3R4K A;  5LFA A;  4A5N A;  3N4M A;  2LYL A;  4J19 A;  3QPS A;  1YIT I;  2O03 A;  1O57 A;  2KMU A;  5DCM A;  3SX0 A;  5E18 F;  4X4B A;  2VJ5 A;  3IC7 A;  3HYI A;  2BY2 A;  3OOU A;  2O8X A;  2UWM A;  3HBL A;  2D45 A;  2WAQ A;  4HSR A;  4YIF A;  1HST A;  2R5Y B;  3PSF A;  3TP3 A;  1YLF A;  3HHG A;  3P5J A;  2VOP A;  1MBG A;  1I3Q J;  3S14 J;  3DTI A;  2Z99 A;  5EEH A;  3WOD F;  3M9L A;  4IXA A;  2F5D A;  3RCO A;  2KIU A;  4E7H A;  3WU1 B;  2V6E A;  5F0H A;  2E5N A;  2CQN A;  2HYG D;  4U87 A;  4XOR A;  2OAZ A;  3FHZ A;  4HX8 A;  2WA0 A;  4E70 A;  2NNN A;  4HNV A;  2WWY A;  2O61 A;  1HOM A;  1ETK A;  2EFO A;  4HAM A;  2PUG A;  3E1S A;  4A3B J;  1GHC A;  2NVQ J;  3DWL E;  4MO7 A;  3QPH A;  2X1E A;  5EZH A;  1D5V A;  1IDZ A;  1JHF A;  5KCM A;  3U2R A;  5E3N A;  3HUG B;  2V6C A;  2VT2 A;  1W7P D;  2JUC A;  4A0X A;  4CZC A;  1OCT C;  2LDU A;  2HTJ A;  4X4I A;  3CEC A;  4A3I J;  3IRR A;  2ECC A;  3BCA A;  1WJ5 A;  2KL4 A;  1YOV B;  4BXX J;  2ZJ2 A;  1FP1 D;  4OOI A;  1ZZ8 A;  5GAH i;  3IV5 A;  3E0J B;  3FWE A;  1A36 A;  2RN7 A;  1ZZ6 A;  2OA4 A;  3PUB A;  1PDN C;  4QIW N;  3A01 A;  2DQL A;  1H88 C;  1CF7 B;  1O4X A;  1T6S A;  3IUO A;  4FET A;  1X1B A;  2VXZ A;  1RET A;  2DMN A;  4GYI A;  1GV5 A;  1YFH A;  3JXC L;  4EJT A;  3F21 A;  1IAW A;  1TW3 A;  4Z5C A;  4F3Q A;  3I59 B;  1IV6 A;  1ZEL A;  3Q3S A;  1MJ9 A;  3SZT A;  2V1N A;  1NK2 P;  2DDB A;  2LOO A;  3DPL C;  3CLO A;  5FD5 A;  4U7B A;  2K85 A;  1HDP A;  3GFI A;  1F5T A;  3KJX A;  1YTY A;  1G4D A;  1MBH A;  2IA1 A;  4Q47 A;  2UXX A;  3WU0 A;  3I53 A;  3QP6 A;  5J4Y A;  4OIN F;  3JAM Z;  1TQI A;  2CUE A;  2O9L A;  1BI3 A;  2FSW A;  1OCC H;  2M0M A;  3V4G A;  1JGS A;  1IN6 A;  1K79 A;  4L18 B;  1HXD A;  2PXP A;  1OLT A;  2CW0 F;  4ENK A;  3QOE A;  1NG7 A;  3QWG A;  4A3C J;  1IW7 F;  1WRJ A;  4B47 A;  1HBX G;  4JBA A;  5DDG A;  1B8I A;  2EFN A;  4QTR A;  2Z3Y A;  5B3S H;  4LB5 A;  2R63 A;  2CUJ A;  3H0D A;  2ZC2 A;  2EBI A;  3PNY A;  1WJF A;  5J1U A;  2IVG A;  2EA2 A;  1GV2 A;  4G7H F;  4P9F A;  2PJR A;  2EF8 A;  2FF4 A;  1ZTR A;  3BTJ A;  4F91 B;  3C3W A;  4DJA A;  1R6R A;  2AHQ A;  3H35 A;  5B1B H;  3H5A A;  3MAJ A;  2OCC H;  3FM3 A;  1IGN A;  3QU3 A;  1BBY A;  5DTQ A;  1WH7 A;  4DW6 A;  1DDN A;  1X58 A;  1BJA A;  2HR3 A;  5HDG A;  4AIJ A;  3DP7 A;  1TWA J;  3V7C A;  1LNW A;  4LIT A;  1SD4 A;  1U5T C;  5FKK A;  1ADR A;  2K7L A;  3OR1 C;  3QAH A;  3GZN B;  2PMU A;  4KNY A;  1T56 A;  4PUS A;  2XDV A;  2IS6 A;  2AXL A;  3ERE D;  4ESB A;  2J7U A;  4WK8 F;  1MBF A;  5CVI A;  3CDL A;  5JI6 A;  4LB6 B;  3KZY A;  4EM1 A;  4KN7 X;  1Z6T A;  3FMQ A;  4Z2Y A;  1OSL A;  1BI0 A;  1ZAY A;  3T1B A;  1PP8 F;  3ZPL A;  3RPU A;  3CJR B;  3OMY A;  2AQF A;  4Y3O A;  1DW9 A;  1WGX A;  1HQC A;  2XV4 S;  4O6J A;  4X4G A;  1OPC A;  5D5X B;  3UWP A;  3AKZ A;  5FD6 A;  1SAN A;  5LRR A;  4FE7 A;  3EYY A;  2JCG A;  3S2H J;  2XCJ A;  4FBI A;  3QOW A;  3JSP A;  3EUS A;  2NNY A;  2STT A;  4DYQ A;  3L2W A;  2KZ8 A;  1R5G A;  1IRZ A;  4XSZ F;  4R1H A;  2E1O A;  3ZPX A;  2CUZ A;  2OU2 A;  2R7S A;  2FA5 A;  1BJZ A;  1KQ8 A;  1Y0U A;  2IBD A;  1FYM A;  2STW A;  2HDC A;  2D1V A;  3BZK A;  4FX4 A;  4MNU A;  2B0L A;  1ITY A;  1SFX A;  4AM3 A;  3M7G A;  2VKV A;  4CO8 A;  5IT3 A;  1HKQ A;  1Y8Q B;  2DBB A;  3FM5 A;  2EZI A;  3PFY A;  2LYQ A;  1B0N A;  3S1N J;  4BHP A;  2CV1 A;  2XHK A;  4JCY A;  3JXD L;  2MH2 A;  4O5V A;  3L00 A;  1VI0 A;  2IV1 A;  1W5T A;  4RDU A;  5FKL A;  2LKP A;  4DE8 A;  1ONV A;  1WKM A;  3S3N A;  4ZYD A;  3TP0 A;  1MH4 A;  1Z7U A;  2ME0 A;  1ENH A;  1YIO A;  4AUX A;  2ETH A;  2QZ8 A;  1LEB A;  4MTE A;  3DTK A;  4OB4 A;  3QFI A;  1G8X A;  1VQP I;  5BS6 A;  4Z5H A;  5GPC A;  2V4J C;  1QGP A;  2FX0 A;  4GHJ A;  5HS9 A;  4I6U A;  1TLH B;  2MC4 A;  2FNP A;  3ISP A;  3K4C A;  4EM0 B;  2F5E A;  3SDB A;  3HOY J;  4EZI A;  3Q9S A;  1W0U A;  3LAJ A;  1Z9C A;  2GIV A;  3W2A A;  5DV5 A;  1RKW A;  5DRT A;  5CQE A;  1FEX A;  2B5A A;  4DZP A;  1WJC A;  3VB2 A;  2KDZ A;  2VKE A;  2DFF A;  1T0F C;  2HYJ A;  3KIO A;  4ER5 A;  3G1L A;  4FIS A;  1QO0 D;  3E6C C;  2PUB A;  2DOD A;  1IN7 A;  2LY2 A;  5KVR A;  3OYM A;  1WH6 A;  3C2H A;  1WJD A;  2A3S A;  5GAE J;  2HVR A;  2PQ8 A;  3LA2 A;  4L9J A;  4PGH A;  2CRO A;  2OBP A;  3ZN1 A;  2Z33 A;  4CCO A;  4JX6 A;  3GBG A;  4KIF A;  5J6X A;  4P96 A;  2L1P A;  5ICF A;  3ZQQ A;  1QZZ A;  3F52 A;  3H0G J;  2EWN A;  1PRV A;  1X1A A;  2DA2 A;  2HQ5 A;  2BVL A;  1K83 J;  1Y9Q A;  3DPU A;  3OYA A;  2JK3 A;  1IXC A;  4M3G A;  1WFX A;  4KIB A;  4MEY F;  5FRM A;  4HV6 A;  1FBQ A;  3A0B C;  4M6Y A;  5HS7 A;  1YS6 A;  5LHH A;  1RES A;  3MKW B;  2YX4 A;  3GN5 A;  3CCM I;  2K86 A;  5H20 A;  1ZN2 A;  1RZR A;  4BAY A;  1ZZ7 A;  2XKO A;  3GO5 A;  3WTZ A;  2VBW A;  1UHS A;  2XIU A;  5C3E J;  4BQO A;  1H89 C;  2NVU B;  4RA2 A;  3IH4 A;  1I39 A;  3LMM A;  1MMN A;  1S72 I;  1L3L A;  4L5J A;  3WGG A;  3FBN B;  1R23 A;  4RM2 A;  3LFK A;  1W1W E;  4KMU X;  1TL8 A;  1JWL A;  1IG7 A;  2M5W A;  2JQ7 A;  1Z67 A;  2RC4 A;  3CLQ A;  5JHF A;  1KYW A;  5DD4 A;  1V3F A;  3I64 A;  3P7N A;  1N25 A;  1IV8 A;  3KYD B;  4LK1 F;  5JLX A;  3SFZ A;  4GGG A;  3E97 A;  4LOC A;  2VOD A;  2Y0S N;  1EH8 A;  3K4M A;  2DTR A;  1T08 B;  2LRD A;  4HNU A;  5GAG J;  2LY1 A;  2QEX I;  4BEH B;  1TQP A;  2AO9 A;  4PJM A;  4HDV A;  4CYD A;  1PUF B;  3VSK A;  2M1B A;  4E7L A;  2EV6 A;  1FT9 A;  3CDH A;  3IKV A;  3ABT A;  4C30 A;  3H5N A;  1FOW A;  3F8C A;  5F08 A;  3ZQL A;  4RBO A;  5EG0 A;  2ZBK A;  2GRM A;  3LFU A;  5EF6 A;  2ELH A;  1VQM I;  1XSV A;  4Y13 A;  2YUS A;  2RDP A;  5HLH A;  2B7E A;  3M07 A;  1VQL I;  2PEX A;  1SVL A;  1BI2 A;  2H09 A;  1XTA A;  4PFP A;  4IHY A;  4BBS J;  2ODR D;  3AG4 H;  2EZL A;  4BNC A;  4WCG A;  4JX4 A;  1QPZ A;  3D1N I;  3ZHI A;  4F92 B;  3F22 A;  1G59 A;  2H27 A;  1JI8 A;  3CMA I;  2DYS H;  2K9Q A;  2LF7 A;  3LFP A;  2EBY A;  3GUU A;  5J8F A;  4CGZ A;  2KPM A;  1N75 A;  1QP0 A;  5A7L A;  4V19 K;  1XGS A;  5K5R A;  1I6X A;  4GCV A;  4RAF A;  4A6E A;  3I3L A;  4S04 A;  3RQI A;  4I2O A;  1N78 A;  2BW3 B;  4BAC A;  4KDP A;  1DGW Y;  3FZV A;  5E79 C;  4FAS D;  2O49 A;  2MLK A;  4CSW A;  3WE3 A;  4EJV A;  1R58 A;  3FXL A;  1ZH5 A;  1X19 A;  2V1X A;  3KEO A;  3K10 A;  3EDP A;  2L01 A;  4A0Z A;  3OYB A;  2LCV A;  4XRM A;  3DV8 A;  4YRV A;  3F23 A;  3ZOB A;  2FMY A;  2WB1 N;  1IRX A;  2PMZ A;  3LSM A;  1DP3 A;  2ZNY A;  3BTI A;  4KIS A;  1IRG A;  3BY6 A;  2R7U A;  1ZZ9 A;  4RB0 A;  1R1V A;  4KIT B;  2E19 A;  2BHZ A;  2HDD A;  3OY9 A;  2E71 A;  4BJT A;  3EUA A;  3SJM A;  5L3F A;  3KP5 A;  5HDK A;  3K0L A;  3CCL I;  3MKY B;  3BG6 A;  1FIP A;  4RS8 A;  3I4P A;  1DWK A;  4PZJ A;  1ZKG A;  3GWZ A;  3WU2 C;  4O8B A;  4MTD A;  1IDY A;  3IHU A;  3O3K A;  4IVN A;  2V3C C;  2OR1 L;  4IWR A;  4YG1 A;  4L0Z B;  5DEQ A;  1K78 B;  1WJB A;  2ZME C;  2ISZ A;  4WWC A;  2PXL A;  3E6B A;  1FIA A;  2CS3 A;  2XGC A;  3D0S A;  3ESW B;  4RGU A;  3TOA A;  4A5M A;  3NDB B;  5EDN A;  3S15 J;  1QP7 A;  3RKW A;  1QPM A;  3GVA A;  4NC7 A;  2PBI A;  3HOX J;  3DXJ F;  2AWI A;  4I0B A;  5H6Q A;  1L1M A;  4KA4 A;  2LC2 A;  3CJT B;  4RAZ A;  4OIQ F;  3G71 I;  3IL2 A;  1U5T A;  2Y9Y A;  3LQR A;  1DUL A;  2JSC A;  1BOA A;  2G0E A;  1H9T A;  4UY8 I;  3C2B A;  5JR3 A;  1SVO A;  4N0B A;  2VON A;  4UUV A;  3B6A A;  3BCB A;  2KEJ A;  1NEQ A;  4ER0 A;  1ZLJ A;  3H3V K;  4M3E A;  4YEL A;  1T98 A;  2IGK A;  2JTV A;  2VQC A;  4XKW A;  5A2Q K;  3B7H A;  3CP2 A;  2E60 A;  3J7A Y;  2HXI A;  3ZMU A;  2HZT A;  2IGN A;  1ZLK A;  4I99 C;  3TL4 X;  1G3Y A;  2V9K A;  2JVG A;  2Z9O A;  4KT5 C;  4IHV A;  3P9K A;  4W97 A;  3F9K A;  3VWS A;  2HOA A;  1TTY A;  3KYC B;  4KIG A;  3CLC A;  3DBR B;  3ZMS A;  2CW7 A;  2M9H A;  3QWL A;  4PFO A;  4NB5 A;  3OSG A;  3REO A;  4II3 A;  4U0W A;  3W6J B;  3FIS A;  1IUF A;  1PRU A;  2W85 A;  2IS1 A;  2MQK A;  2BOL A;  4EK9 A;  3MN2 A;  2RRE A;  2PUD A;  3AL0 B;  5C4J J;  1BN5 A;  4MGR A;  2M7B A;  3RZZ A;  3CMM A;  2NS0 A;  1D1B A;  4RB3 C;  1VFC A;  1ETX A;  4RMN A;  3ZQC A;  3HRU A;  2GRL A;  4F8D A;  3UR3 C;  2KZV A;  3D5R C;  2FJR A;  1XMX A;  2GWR A;  3PQJ A;  1FOK A;  2FFH A;  3CZ6 A;  3V42 A;  5KK1 A;  1TW2 A;  2Q0O A;  3GZ6 A;  4ZYG A;  4CYC A;  3B6C A;  4ZJZ A;  5ICG A;  3A03 A;  4EMS A;  1MJB A;  3HTU A;  2HGC A;  4XOT A;  1WPK A;  4M9X A;  3BS3 A;  2EFQ A;  2XGX A;  2DN0 A;  4G6D A;  3GW2 A;  4AC0 A;  3TEP A;  3DTE A;  2GM4 A;  2ZXH A;  3QOD A;  4ESF A;  5GTI C;  3K6G A;  5LGT A;  4IQ4 A;  2VJI A;  3CUQ C;  1BC7 C;  2ZSH B;  2H6B A;  4DBQ A;  5F27 A;  5LHG A;  2FBI A;  2L8N A;  3LIS A;  1QRY A;  2DYR H;  2OZU A;  1GXQ A;  4RLF A;  3I55 I;  2K4B A;  3C2G A;  1T38 A;  1HQ1 A;  2VQH A;  5DRY A;  1F1Z A;  3I58 A;  2HPI A;  5LLQ A;  3L09 A;  1HW2 A;  2FNA A;  2OV7 A;  2IA2 A;  5FKN A;  2DA3 A;  5DUK A;  3MFK A;  3LSR A;  4ENN A;  3ELK A;  4S0H B;  4OAZ A;  2QA4 I;  1O3T A;  1IN5 A;  3PNV A;  2ZB9 A;  1MKM A;  1T0F A;  2OQG A;  3MVP A;  4XMY A;  3HIF A;  3H5R A;  2JMW A;  3G6E I;  1WZ2 A;  2UUZ A;  5E3O A;  4E7Z A;  1ON2 A;  1VPW A;  1MD0 A;  3H9Q A;  2R7W A;  4NC6 A;  4BDZ A;  1Q1V A;  3MMY B;  4RGX A;  2IEK A;  4HRA A;  2DT5 A;  1MMS A;  1B4A A;  5CQG A;  4MLO A;  3LSK A;  2F6C A;  3PJR A;  2IS4 A;  1TNT A;  2NYX A;  3TBI A;  5K5Q A;  3BOQ A;  2ME6 A;  4PGG A;  3A0H C;  2HVS A;  1T95 A;  5CVJ A;  3EQL F;  3BR1 A;  2LYK A;  1IN8 A;  3BDN A;  5D5U B;  4N4O B;  4XBF A;  2BY0 A;  2CJJ A;  4KN4 X;  3LWF A;  3UKG A;  1J5Y A;  2FD5 A;  3A1Y A;  3CDI A;  3GFJ A;  1UZC A;  2R4G A;  2ICW G;  2LY9 A;  2QGU A;  2M2E A;  4Z6Y A;  3ML6 A;  5B66 C;  5HS8 A;  1LJ9 A;  5DS9 A;  4BDY A;  2OZ6 A;  1P92 A;  4M71 A;  1P7J A;  2X1D A;  3W3C A;  2HOS A;  2HFZ A;  4AYB N;  1A6Q A;  4BE0 A;  2XF7 A;  1JT6 A;  1FC3 A;  1QP4 A;  2D1H A;  2QQ9 A;  2E35 A;  2R3S A;  5GP9 A;  2HWV A;  4G12 A;  1XCV A;  2RNJ A;  1ERD A;  3KET A;  3OWT A;  4ZTF A;  1HA8 A;  2PG4 A;  1ZZC A;  1R00 A;  4GXO A;  4J1X A;  2R7O A;  3DQV C;  1E3H A;  2K9S A;  2B63 J;  3R0J A;  1JKO C;  3WE2 A;  4IQJ A;  2K5C A;  2RV8 A;  2R7T A;  5IYD J;  4OU0 A;  2LNM A;  1SFE A;  2LLK A;  4JYK A;  4ZYA A;  2VJJ A;  3WTS C;  2W1O A;  4J01 A;  1LE8 B;  1HW1 A;  2VBY A;  4B3A A;  4ESJ A;  2ACJ A;  1POU A;  1MZB A;  1B72 B;  4PCQ A;  1OFC X;  2ESN A;  1XMK A;  1IF1 A;  3HOS A;  1XN7 A;  2G9W A;  2FE3 A;  3N05 A;  4LGW A;  3OIP A;  1T2K A;  3BRO A;  1Z1D A;  4ER6 A;  3K1N A;  2E1C A;  2NXN B;  1V54 H;  4KYW A;  2JVH A;  2L9S A;  1RPW A;  2M87 A;  1DU6 A;  1UST A;  1JKQ C;  4HX7 A;  5F6F A;  4DYC A;  4V2F A;  3PO2 J;  4I01 A;  4C2T A;  2ZJR F;  2Q2E B;  1MBK A;  2CRG A;  1E3P A;  4MQV A;  4I6T A;  1Z21 A;  2DPU A;  3SQN A;  2MBF A;  4KJZ A;  2JWT A;  3LA7 A;  1M1E B;  1FP2 A;  3OV8 A;  2E2I J;  2Y75 A;  2ZCW A;  1Z3X A;  3D5S C;  3NZL A;  3HRT A;  1IC8 A;  3ZRG A;  2E2H J;  5K1Y A;  1I3A A;  3ERM A;  4GO1 A;  2WAD A;  4FQG A;  2O0Y A;  1W36 C;  1EH7 A;  2DMQ A;  2ISY A;  2Y69 H;  1R36 A;  1SQ8 A;  5D6E A;  3IVP A;  5DT2 A;  3EUH A;  4M3F A;  1IUY A;  2MD5 A;  3I54 A;  4AD9 A;  1FOX A;  2YPR A;  5ILV A;  1ETW A;  5F64 A;  4OMZ A;  5HNH A;  4IRH A;  3V8J A;  3IAM 2;  4B44 A;  2HKO A;  4MCT A;  1OR7 A;  1SMY F;  3RKQ A;  3MZH A;  3JTH A;  1S5L C;  3CRO L;  1J2X A;  1FX7 A;  2L9V A;  2PXQ A;  3R0A A;  3DKX A;  2L4M A;  2IPQ X;  2IRF G;  2YS9 A;  1BR1 A;  2HOE A;  4FE4 A;  2JUG A;  1ZGA A;  2FUG 2;  1PNR A;  2ZJP F;  3K1P A;  3K4J A;  2D2W A;  2GOX B;  4U0V A;  1DPU A;  1YX3 A;  2EB7 A;  3TW6 A;  4BH9 A;  1F43 A;  3LSI A;  1PVE A;  1J0R A;  1X1C A;  4DBR A;  1PJR A;  2LBF B;  2PXF A;  3KP4 A;  1F9N A;  1KYZ A;  3X2Q H;  4KIC A;  3J80 K;  1XGN A;  3SCF A;  4NDW A;  3CCS I;  4XSX F;  5L3C A;  2XB5 A;  1RNL A;  1J09 A;  1ETO A;  2P4W A;  3PIO F;  2VPL A;  4UUS A;  4Y7N J;  1J9I A;  2GLO A;  3I9V 2;  2ZME A;  1FOY A;  1WWX A;  1MDM A;  2JT1 A;  1X4P A;  4BS9 A;  2CH0 A;  3A9Z A;  2MW8 A;  1X3W B;  2CUF A;  3R09 A;  5J3L A;  1IJW C;  4IF4 A;  2HU9 A;  3J7Y J;  4HLY A;  1ZRC A;  3W6V A;  3RYR A;  1ZS4 A;  2XXP A;  4Q2J A;  5FB2 A;  4U88 A;  3M1C A;  5K7H A;  2Z5U A;  2ID6 A;  3JRI A;  3HDD A;  2W82 A;  4Y15 A;  2QF7 A;  3SCH A;  1KQ9 A;  2XAU A;  2OTJ I;  1MND A;  1U9N A;  3OYK A;  3OYF A;  3S3M A;  2DOA A;  4I6R A;  1UTX A;  2XXA A;  2M4G A;  2XB0 X;  5DCM B;  3DNV B;  4TV7 A;  5FFX A;  4BJ6 C;  4HA8 A;  2Q1Z B;  1MNM C;  3BG5 A;  2DTZ A;  2B9S A;  5F1J A;  3OQN A;  2K9M A;  1I27 A;  1BI1 A;  3EPZ A;  3Q9V A;  4ITV A;  1I6H J;  4I6Z A;  5A2Q Z;  3JRA A;  2DA7 A;  2CYY A;  1IXS B;  3FXU A;  3KEY A;  3OL4 A;  1REP C;  1MFQ C;  2EPF A;  4DGW B;  5M3M J;  1G3T A;  3CES A;  2PXB A;  3HHH A;  1LEA A;  3TKY A;  2F48 A;  3RSN A;  5J47 A;  3KEQ A;  4JOM A;  4MQ9 F;  4XLF A;  3DEE A;  3K4K A;  3O8G A;  2DI3 A;  4YFX F;  5ICE A;  4IKF A;  1R1T A;  3G0T A;  1R5H A;  3TMO A;  2NVX J;  5FLX K;  4ER3 A;  3MQ0 A;  2XAH A;  1QVU A;  2KDO A;  1G3S A;  1ZR2 A;  4RAY A;  2K3F A;  2LVS A;  4HW0 A;  4M6V A;  2KT0 A;  2QKM B;  3KPH A;  3ZQ7 A;  4CCK A;  4C3I J;  3HXL A;  4UVB A;  3I0T A;  2IGO A;  5IOZ A;  1X3Z B;  4WXC A;  1MGT A;  1R69 A;  3CMY A;  2IW5 A;  2LRE A;  2ELK A;  1LFP A;  4EGZ A;  3KLO A;  4RGS A;  1HKT A;  1TWH J;  1V5F A;  1TT0 A;  3OKZ A;  1MMA A;  1IN4 A;  3CC2 I;  3K9T A;  3GZD C;  4D5F A;  3A01 B;  2EV5 A;  2J5O A;  2ZFU A;  5AIQ A;  4Z59 A;  1LVK A;  1LLI A;  3FMY A;  5BNG A;  4M6X A;  3KL4 A;  1ZAR A;  3CUQ A;  1WQ2 A;  3H9G A;  1P6R A;  3FYM A;  1QZX A;  1LKX A;  4M73 A;  2WV0 A;  1SVM A;  1XX5 A;  1LPQ A;  1W0T A;  1JKP C;  2XRN A;  6PAX A;  4M9Z A;  1O7F A;  1U3E M;  3NQO A;  3BWG A;  2EFW A;  3S8P A;  5LHI A;  3C7J A;  1YI2 I;  3DLA A;  5M3F J;  4MHG A;  1FZP B;  2X0L A;  3QOP A;  1SEU A;  2PMH A;  1WIZ A;  4KMF A;  2XVC A;  2LFB A;  3BZ6 A;  3GUD A;  3OS2 A;  4FCY A;  3NWS A;  2E34 A;  1BA5 A;  3ZKC A;  4AWX B;  1ZRE A;  4CCM A;  2E1N A;  4AVP A;  1B8I B;  3DM5 A;  3BJ6 A;  1D0Y A;  3SEQ A;  2LD5 A;  2O7O A;  1B6A A;  3OYH A;  1JXS A;  3PE5 A;  2PIJ A;  3H3Z A;  5CVR A;  2JZY A;  5M5Y J;  2PE5 A;  3I5U A;  3U21 A;  1MSF C;  2H1L A;  3VYR B;  2M4H A;  3BR2 A;  2PJR B;  2O3F A;  1UG2 A;  3F3X A;  3G1O A;  5D8K B;  2PXU A;  3M8J A;  3CCY A;  1R7J A;  2R7Q A;  2COM A;  1YW7 A;  2MYS A;  2H6C A;  2DT7 B;  1YQA A;  2EK5 A;  2HQN A;  4OAY A;  4HF0 A;  2A6C A;  3IH3 A;  1XC5 A;  2RKH A;  5KAF C;  1QNT A;  4X4D A;  3RKY A;  2NVY J;  3V8K A;  3DCF A;  3K4B A;  2WUS R;  1MJA A;  1WJE A;  3OSF A;  1MW7 A;  1STZ A;  4CZZ A;  1U8R A;  1USS A;  3IH2 A;  3B73 A;  2I8D A;  1TT5 B;  2DOF A;  2JN6 A;  1LDK B;  4IZZ A;  3PM1 A;  4X6A J;  2R5Z A;  1ZPQ A;  2CFX A;  1XWR A;  2MG4 A;  1BW5 A;  5FGM A;  2WV1 A;  3OYL A;  2IU7 A;  4RGR A;  1E17 A;  1JJ8 C;  3ROU A;  3GBF A;  3K4L A;  1R4N B;  1QVT A;  1LMB 3;  1LDD A;  2Y0S A;  4B48 A;  2FU4 A;  3RIR A;  5JLW A;  3QP5 A;  2CQ7 A;  4RM3 A;  3FXO A;  5EEA A;  1XSD A;  1HW5 A;  2DQR A;  2DMT A;  3HSE A;  3ECH A;  3G2B A;  2XRL A;  3QOX A;  3CC4 I;  3VYT B;  1DU0 A;  1YHQ I;  1W5S A;  1GLN A;  4ZDO A;  2MH9 A;  5E8I A;  3G3Z A;  3KP6 A;  2DDA A;  3RKX A;  2GA2 A;  2P5V A;  2VIX A;  2XPV A;  3NAR A;  3Q0V A;  4HPQ A;  2H8R A;  4EQZ A;  2GZW A;  3HZJ A;  3S1R J;  2DO7 A;  2M7A A;  2ZXW H;  1LVA A;  4ON0 A;  5K7F A;  3OR2 C;  5ERI A;  4M3B A;  4BGD A;  2VXD A;  3GTQ J;  1SFK A;  4IX7 A;  2BJC A;  1QQI A;  1NTC A;  4LG0 A;  3G7D A;  4AIK A;  4XLA A;  3DEU A;  2PXD A;  3M9A A;  3M4O J;  1G3W A;  1AA7 A;  1FWZ A;  2Y2Z A;  2AXU A;  3BQY A;  4LMY A;  4D5C A;  1ON1 A;  4CCJ A;  2W00 A;  1QBJ A;  3WGI A;  5JUW A;  4BE2 A;  3KP7 A;  4KUM A;  1RZ4 A;  1TP4 A;  3W2V A;  3JSO A;  3LAP A;  1X57 A;  4ER7 A;  2GQQ A;  4DYR A;  1XD7 A;  4BE1 A;  4F7Z A;  4XLN F;  1NW3 A;  1N77 A;  1A6I A;  3SFI A;  1XPX A;  1BDI A;  2L2O A;  2LKS A;  3ZMV A;  4L0Y B;  2DJI A;  5D8L B;  4BHB A;  2PN6 A;  2M8G X;  2WB1 A;  3E6D A;  1NK3 P;  3RYP A;  3A9X A;  3QRF F;  2LYJ A;  2E36 A;  5GAG i;  2BV6 A;  2XPU A;  2GA1 A;  2EIK H;  3KLN A;  2DA5 A;  2OC6 A;  2UZK A;  2N8G A;  1FTZ A;  1T8I A;  1FYL A;  2VKH A;  4E7I A;  4XOP A;  2H8W A;  2H94 A;  1ZYR F;  2XF6 A;  3BR5 A;  3H9J A;  5E8G A;  2K4J A;  4YFN F;  3CJN A;  1ZR4 A;  3E5X A;  4EVI A;  2VAS A;  4B4C A;  5M5X J;  4QSH A;  1J75 A;  2A69 F;  3EUH C;  2MA3 A;  3GTG J;  3DBH B;  1U6G A;  4I02 A;  3GF2 A;  2TRT A;  1MBJ A;  3ZMT A;  4EJU A;  4I0A A;  1OR7 C;  1DUX C;  4XN0 A;  5EGO A;  3LA3 A;  5BPI A;  1D8J A;  2O8K A;  2ESH A;  1RR8 C;  3QPT A;  4WXD A;  2K40 A;  3GTO J;  1X2M A;  5D5V B;  3J80 Z;  5C44 J;  1WSU A;  5J4V A;  3ASO H;  3BP8 A;  3MEJ A;  3NRO A;  3IWZ A;  4NQW B;  4GQM A;  1KU2 A;  3R1F A;  1VF9 A;  4XLE A;  4WVL A;  3ABK H;  5E3L A;  1SFO J;  2LYP A;  3W2W A;  4IA8 A;  2PXV A;  1YRN B;  4GFB A;  2R7D A;  2VBZ A;  1BC8 C;  2QBY A;  3HOV J;  3DBL B;  3TDZ C;  3CCE I;  3KFW X;  4IHW A;  3GTM J;  4EAT A;  5J1R A;  3TED A;  2V1D A;  4DOZ A;  1AOY A;  3MKL A;  4MEX F;  4JK1 X;  1B59 A;  2QQA A;  3GN5 B;  1FBU A;  2EJR A;  4LK0 F;  1R5I D;  2O6G E;  3BG9 A;  1QQA A;  4J00 A;  1I50 J;  3DFG A;  3E5U A;  2CMP A;  4XNF A;  4W1U A;  3RPU D;  1D3Y A;  2OTL I;  2E7X A;  1KU7 A;  4LLN A;  2JRT A;  3ZQG A;  1P4X A;  4AIH A;  3MWM A;  1ETY A;  1SAU A;  1OYY A;  1R22 A;  2QQB A;  1RC9 A;  1WET A;  3QF3 A;  2F5F A;  3WG9 A;  2KIS A;  1GUU A;  2O5R A;  4PJN A;  4AU7 A;  3EUK L;  2X6Y A;  1X4O A;  1VQK I;  1W7P A;  4PU3 C;  1MMG A;  2W84 A;  2IT0 A;  3K4N A;  1VQ6 I;  4Z5D A;  2IA0 A;  2BBY A;  1T39 A;  3CC7 I;  2A5W A;  2P7V B;  3C1D A;  3BTC A;  1KU9 A;  2R7R A;  5LD2 C;  2MEZ A;  1AKH B;  1ODD A;  2L7F P;  3Q0U A;  4BYY A;  2OD5 A;  2Y48 A;  5EZG A;  4BKX A;  5D4R A;  3BD1 A;  3H92 A;  4NDL A;  4Q48 A;  2DXI A;  2RAE A;  1V4R A;  3HTS B;  1WH8 A;  4LFU A;  2CQK A;  1E2X A;  2FBK A;  4ZH4 F;  3J7Z I;  2GOM A;  5F0F A;  3QQA A;  1ZZB A;  2FBH A;  1BIB A;  2ZSI B;  2RGV A;  4X4H A;  3MKZ A;  2L3D A;  5EG0 B;  3JRE A;  2FQ4 A;  4B8X A;  1Z6R A;  2KLO A;  5DCF A;  2FRH A;  3FBI B;  4NNJ A;  1X3U A;  5AIP A;  1EA3 A;  3ZHM A;  1KU3 A;  1X2N A;  3FK6 A;  4MIM A;  5FLX Z;  5DSX A;  1AWC A;  2DJN A;  3T0Y A;  3L2U A;  2LYR A;  1W4M A;  3PFI A;  4FHT A;  2KIF A;  1Q1H A;  3GZD A;  1QZE A;  2EV0 A;  4YII A;  3E7L A;  2A07 F;  4A6D A;  1RRJ A;  2EWT A;  3QQ6 A;  3ME5 A;  4IEJ A;  2R7X A;  2L0K A;  4PU4 C;  1B1B A;  5JVT A;  2E1M C;  2ICP A;  5EYR A;  1UHW A;  4ZDP A;  3GTJ J;  1QA6 A;  2W4S A;  2FOK A;  1BL0 A;  3IP4 B;  4UB8 C;  2GZU A;  2HIN A;  2EA4 A;  3FKJ A;  1XSX A;  2EIL H;  2X6X A;  3TO7 A;  3ZXS A;  3A02 A;  3ZCO A;  3ZGK A;  1IRF A;  4IRI A;  2CQQ A;  2FXA A;  2BNO A;  3HZI B;  4WXH A;  4A69 C;  3OQO A;  2BNM A;  1VQ4 I;  2JPC A;  1BDH A;  4PDK A;  1TNS A;  1R1U A;  5K7Z A;  3LSG A;  1LCC A;  1DQU A;  2F4M B;  1VQO I;  2OFY A;  4XKC A;  2LNB A;  1BR4 A;  5CVU A;  2X1C A;  3G1M A;  5FKM A;  4A93 J;  3CF2 A;  4X4C A;  1VZ0 A;  3U9G A;  4D9J A;  1H9G A;  2WAE A;  3BZC A;  4I98 B;  4OMY A;  5IOY A;  3UNG C;  2HDW A;  3F8B A;  2GXB A;  1G6N A;  1FSE A;  4XLH A;  4A3L J;  1WVR A;  4EGY A;  1HCR A;  1ZQ3 P;  2DMU A;  4UXN A;  5L3G A;  4IVZ A;  3GCM A;  4XK4 A;  4XRS G;  5M5W J;  2HCN A;  2VT3 A;  3BG3 A;  3JR9 A;  5J40 A;  1BIA A;  1V5E A;  2YU9 J;  4D7M A;  1P7I A;  2VLA A;  1WHU A;  4XKB A;  2O38 A;  4CUG A;  2PUF A;  1QHH D;  2XAQ A;  2R5Y A;  2RQP A;  4A3G J;  1OCP A;  2GBY A;  5HLI A;  4AYB A;  1R71 A;  1RIO A;  4UB6 C;  4CH7 A;  1U5T B;  3TQN A;  3VOD A;  1JKR C;  2XKP A;  2HNH A;  3HB9 A;  4L9N A;  4OWR B;  3BR3 A;  2J5P A;  2QM3 A;  2CU7 A;  1RUO A;  2AS5 F;  1RZR D;  1Z3Y A;  2ZKZ A;  3ABL H;  2R93 J;  2LK2 A;  4YFK F;  1YX5 A;  1UFM A;  2OQR A;  2AXV A;  2PX9 A;  1EFA A;  4HRI A;  4XRF A;  4RLQ A;  4XM3 A;  2LYC A;  2BXY A;  3WTX C;  2VC0 A;  3TFL A;  2HQA A;  2COB A;  3HUG A;  3O8H A;  2F5C A;  3F8M A;  2P8T A;  2JA6 J;  2NRA C;  3CQZ J;  2IVM A;  5CKT A;  3BTL A;  2ZJQ F;  2PLY A;  4BJ5 C;  4IRG A;  3BLY A;  3AG1 H;  4G6T B;  3ZQH A;  3RDI A;  4HLX A;  1WJA A;  4NHJ A;  3MZY A;  1K7A A;  2V79 A;  2OUM A;  4HBL A;  4C3J J;  2KP6 A;  2CSO A;  4OIO F;  2IAI A;  1K4S A;  4BUP A;  2EZK A;  1QZY A;  3CD6 I;  1EKE A;  2DW4 A;  4D7N A;  2PXT A;  1U8B A;  3E6M A;  1W36 D;  1CF7 A;  1TZL A;  2Y30 A;  3EET A;  3KP3 A;  1OKR A;  2M3A A;  3L2V A;  1JUS A;  2L49 A;  3K2Z A;  2LBF A;  1F4K A;  3FK7 A;  3PL8 A;  1ZRF A;  1SAX A;  4PK4 A;  1ZVV A;  1RIO H;  4PU7 A;  2JA5 J;  2DAO A;  3KZZ A;  3ONQ A;  4I09 A;  3HSR A;  3P9I A;  4A3E J;  3I59 A;  4BHC A;  2PFB A;  5J1Y A;  2AXT C;  3FXR A;  2CSF A;  1TC3 C;  2LP0 A;  1JT0 A;  1DGR M;  3OYD A;  1GVD A;  3OYC A;  4P55 A;  2F5V A;  1ACI A;  1Y1W J;  3A2K A;  4CYC B;  3QYX A;  3J81 K;  1KON A;  2MXD A;  5IP9 J;  2EH3 A;  2HTS A;  1SD5 A;  4BQN A;  5BPD A;  2WAF A;  4M9S A;  1HDD C;  2KZG A;  3F6O A;  1YO5 C;  2XGE A;  2F4O B;  4FT8 A;  2CFO A;  4CXF A;  4Z58 A;  4B3X A;  1UXC A;  2KQR A;  3IAS 2;  1XGO A;  1MIJ A;  1PER L;  1D0X A;  5IYB J;  3ZMZ A;  2QCO A;  3BR6 A;  2JSP A;  3OS1 A;  3CCQ I;  5L3E A;  3F0C A;  2DA6 A;  1P4A A;  1UAA A;  1OYW A;  2QSH X;  5FJ8 J;  3FHN A;  1E3O C;  4JCX A;  1JJ6 C;  5CJ9 A;  5EEG A;  1CJG A;  1F36 A;  1UB9 A;  2DFH A;  4Y17 A;  2LKX A;  3EYI A;  1G2H A;  2O4A A;  2PUE A;  3HOT A;  4LD5 A;  1A5J A;  5HOO A;  1S7E A;  4HX4 A;  3L2Q A;  2XI8 A;  4PU8 A;  2A05 A;  3JRF A;  1OQY A;  3B02 A;  3HKZ A;  2A6E F;  4UV9 A;  1S6L A;  4ANJ A;  1K6O A;  2FOW A;  1Z7L A;  4R8H A;  3VOE A;  1MNE A;  1K6Y A;  5FRO A;  4P9U A;  3VPR A;  1Y7Y A;  1D1A A;  5E1Z B;  1JUP A;  5IP7 J;  3TOB A;  4IOC F;  3OYG A;  3HRS A;  5GAH J;  3IRQ A;  2R7Z J;  4G7Z F;  3S3O A;  5IYC J;  2GXA A;  1I5Z A;  3FXJ A;  2P5K A;  1KZH A;  2QVO A;  2XSD C;  3BDD A;  1ETV A;  1UHM A;  2PI0 A;  3IWF A;  3PXP A;  1FBS A;  1IZ1 A;  1PUE E;  3QYE A;  3OS0 A;  2R92 J;  1P4W A;  4YAR A;  3SCG A;  3U3W A;  1YJW I;  1FNN A;  3NAU A;  3K70 C;  4GRI A;  3HC7 A;  1Z05 A;  2VB6 A;  2KEK A;  3DKW A;  4BBR J;  2X85 A;  5LGN A;  1FJL A;  1A04 A;  1FY7 A;  1XCB A;  2HZD A;  3HKZ N;  3CTA A;  2PUC A;  3HG9 A;  4HF2 A;  3FYA A;  3FXM A;  1ZHF A;  2VN2 A;  2PPX A;  4G8X A;  2WAQ N;  3LSH A;  1R9T J;  4LG3 A;  4B1R A;  4K2E A;  3E3V A;  2WBM A;  4DIQ A;  3GFM A;  1SD7 A;  5LEJ A;  2FML A;  2M30 A;  3OYE A;  2QEN A;  4EM2 A;  3OIQ A;  2JRM A;  2EQR A;  3NXH A;  2JPB A;  3VYS B;  1OCZ H;  4HYE A;  3AL0 C;  4C3H J;  3WHB A;  1S9H A;  1Y1V J;  3LST A;  3OYI A;  2HYF A;  2KPJ A;  4LIV A;  3G73 A;  1FSH A;  2ICT A;  1Z91 A;  3WTT C;  5D5W B;  4A3M J;  2BXZ A;  2HKX A;  4M74 A;  2AQE A;  1WI3 A;  4HG2 A;  1GVJ A;  1XDU A;  5D6F A;  3CF5 F;  4GDF A;  3GTK J;  4IPA A;  2KFD A;  4AID A;  5ILS A;  1GDT A;  1JFS A;  2QWW A;  3KZ3 A;  2DCE A;  2M4K A;  2L54 A;  4HOB A;  4UNO A;  1JTX A;  3BJA A;  2KKO A;  5K5O A;  1S8N A;  2L5Q A;  2LH9 A;  1XGM A;  4UHT A;  1UCR A;  4HNT A;  3DF8 A;  4F93 B;  2NVT J;  4CCN A;  5DM6 F;  3JRD A; 
#chains in the Genus database with same CATH homology
 1QVT A;  2L7M P;  1JTY A;  3UFD A;  3HOX J;  1LMB 3;  2AWI A;  4MCX A;  1L1M A;  1MSE C;  5JLW A;  3ZQF A;  2DMP A;  5DTD A;  2Y9Y A;  5EEA A;  2DMT A;  2G0E A;  3GTL J;  2XRL A;  3C2B A;  2X9D A;  1UMQ A;  1DU0 A;  3JRG A;  3HOU J;  3LSP A;  3B6A A;  4A3K J;  2KEJ A;  1NEQ A;  3H3V K;  2Y9Z A;  4M3E A;  4J1W A;  3B7H A;  3Q0V A;  2XPV A;  3NAR A;  2H8R A;  1LQC A;  4A3F J;  4MFE A;  2XGD A;  1ZGW A;  2HXI A;  3S1R J;  2HI3 A;  5K7F A;  4M3B A;  3GTQ J;  4A3J J;  2BJC A;  4IHV A;  1NTC A;  3F51 A;  4DZJ A;  4W97 A;  2MGQ A;  1U78 A;  3OMT A;  3I4N J;  3G7D A;  1EF4 A;  2HOA A;  2AUW A;  2KEI A;  3M4O J;  3CLC A;  2X6O A;  5GPA A;  2M9H A;  2MSY A;  2Y2Z A;  3OSG A;  2AXU A;  2LYL A;  4J19 A;  3QPS A;  3BQY A;  3FIS A;  1IUF A;  1GT0 C;  1PRU A;  1Z0X A;  2H1K A;  2MQK A;  4D5C A;  4X4B A;  3MN2 A;  1OJL A;  2PUD A;  1K61 A;  3OOU A;  5C4J J;  3MLF A;  3HBL A;  4YBA A;  1WH5 A;  2R5Y B;  3TP3 A;  1XS9 A;  3RZZ A;  1X57 A;  1VFC A;  1ETX A;  3ZQC A;  4DYR A;  2GRL A;  4F8D A;  2FJR A;  1MBG A;  1I3Q J;  2EZH A;  3S14 J;  1A6I A;  3SFI A;  1BDI A;  2XPW A;  2NS7 A;  2M8G X;  4CYC A;  3B6C A;  1NK3 P;  3A03 A;  2LYJ A;  1WPK A;  5F0H A;  4UUS B;  3K2A A;  2Y31 A;  2XJ3 A;  3BS3 A;  2XPU A;  2DN0 A;  4HNV A;  4AC0 A;  1HOM A;  1ETK A;  2DA5 A;  2GM4 A;  5C4X J;  2N8G A;  1FTZ A;  4A3B J;  2PUG A;  2IUO A;  2NVQ J;  4MO7 A;  1IDZ A;  1ZK8 A;  2DA4 A;  5EZH A;  2IVB A;  3BR5 A;  1ZR4 A;  1JH9 A;  5E3N A;  4B4C A;  5M5X J;  4ABZ A;  4QSH A;  1OCT C;  5F27 A;  2L8N A;  3GTG J;  3CEC A;  1QRY A;  4A3I J;  3LIS A;  2ECC A;  4X4I A;  4BY7 J;  1PRA A;  2TRT A;  1MBJ A;  4BXX J;  1ZZ8 A;  1FTT A;  3IV5 A;  2BNN A;  1RR7 A;  5EGO A;  2P81 A;  2O8K A;  1ZZ6 A;  2K40 A;  3GTO J;  5FKN A;  1PUF A;  2DA3 A;  3LSR A;  3S16 J;  1X2M A;  3HEF A;  5C44 J;  4S0H B;  4QIW N;  3RZD J;  3A01 A;  1H88 C;  4GQM A;  2ZB9 A;  1O4X A;  3R1F A;  3MVP A;  1VF9 A;  1AHD P;  5E3L A;  1RET A;  1SFO J;  2LYP A;  4IA8 A;  2DMN A;  1YRN B;  4GFB A;  3DEW A;  3ZQI A;  2JMW A;  1GV5 A;  4MFD A;  3HOV J;  3JXC L;  5E3O A;  3S8Q A;  4IHW A;  4Z5C A;  3GTM J;  1VPW A;  5J1R A;  3TED A;  1IV6 A;  1Q1V A;  5IPA A;  3Q3S A;  2IEK A;  3MKL A;  3HOW J;  1NK2 P;  3GN5 B;  4MLO A;  3KJX A;  1HDP A;  1MH3 A;  3BG9 A;  1MBH A;  1QQA A;  3LSJ A;  2LTP A;  2ME6 A;  1AU7 A;  2NS8 A;  1I50 J;  2CUE A;  2O9L A;  4W1U A;  4BY1 J;  3BR1 A;  2LYK A;  3ZQG A;  3BDN A;  1ETY A;  2CJJ A;  3QWG A;  4A3C J;  3UKG A;  2FD5 A;  1WET A;  1VND A;  3QF3 A;  5HOD A;  1B8I A;  1GUU A;  2ID3 A;  2LY9 A;  2M2E A;  4QTR A;  5DS9 A;  4PU3 C;  4JP0 A;  1ETQ A;  1P7J A;  3Q0W A;  2R63 A;  2EBI A;  5J1U A;  4AYB N;  2HOS A;  2NOG A;  2IVG A;  4Z5D A;  1JT6 A;  1GV2 A;  1QP4 A;  2EF8 A;  3BTC A;  2FJ1 A;  5GP9 A;  1ZTR A;  3BTJ A;  4L5E A;  1AKH B;  4G12 A;  2L7F P;  3Q0U A;  2MEZ A;  3JXB C;  3M3Y J;  2AHQ A;  5EZG A;  4BKX A;  3BD1 A;  4NDL A;  1NER A;  1IGN A;  2RAE A;  1ZZC A;  1WH8 A;  4J1X A;  1YRN A;  2K9S A;  2B63 J;  1WH7 A;  4DW6 A;  1JKO C;  2W48 A;  5F0F A;  3QQA A;  1X58 A;  3JRC A;  1ZZB A;  4X1E A;  5IYD J;  1TWA J;  2LLK A;  4JYK A;  4X4H A;  1LE8 B;  5FKK A;  1JUM A;  5EG0 B;  3JRE A;  1UXD A;  1ADR A;  2FQ4 A;  4B3A A;  2LYS A;  4IHX A;  1POU A;  1B72 B;  1OFC X;  1X2N A;  3ZHM A;  3FK6 A;  4MIM A;  5F0C A;  2R0Q C;  2JA7 J;  1T56 A;  2DJN A;  2LYR A;  1MBF A;  1YSE A;  3CDL A;  2LR8 A;  3E7L A;  4XID A;  2EWT A;  3WHC A;  3QQ6 A;  1OSL A;  4IEJ A;  1RZS A;  1ZAY A;  2L0K A;  3TRB A;  4PU4 C;  1DW9 A;  1WGX A;  2ICP A;  5EYR A;  1LFB A;  3GTJ J;  3PO3 J;  4X4G A;  1BL0 A;  2GZU A;  1RPW A;  3QPL A;  1DU6 A;  2HIN A;  1SAN A;  4FE7 A;  1JKQ C;  4DYC A;  2JCG A;  4V2F A;  3PO2 J;  5FKO A;  3S2H J;  2XCJ A;  4FBI A;  1APL C;  1MBK A;  3A02 A;  3EUS A;  2CQQ A;  2CRG A;  4X4E A;  2ECB A;  2BNO A;  1BW6 A;  4I6T A;  4DYQ A;  4YG4 A;  3HZI B;  3O9X A;  2JWT A;  4A69 C;  2KZ8 A;  1AKH A;  3OQO A;  2BNM A;  2E2I J;  1IRZ A;  1BDH A;  1MBE A;  4XRS A;  5K7Z A;  3LSG A;  1LCC A;  2E1O A;  1IC8 A;  2E2H J;  2OFY A;  3H5T A;  1BJZ A;  2IBD A;  2IVQ A;  3G1M A;  5FKM A;  4A93 J;  4X4C A;  2DMQ A;  3IVP A;  1ITY A;  1SQ8 A;  2OPT A;  3BR0 A;  4M3F A;  2VKV A;  1JFT A;  2M0C A;  4X4F A;  2EZI A;  1ETW A;  2LYQ A;  2VPR A;  5IOY A;  3S1N J;  1B0N A;  4JCY A;  4MCT A;  3RKQ A;  5FLV A;  3JXD L;  3CRO L;  1VI0 A;  2IV1 A;  4UUT A;  3S2D J;  4RDU A;  2R5Z B;  4A3L J;  2YS9 A;  5FKL A;  3K7A J;  1HCR A;  2DMU A;  4FE4 A;  1ZQ3 P;  4IVZ A;  4XK4 A;  4XRS G;  5M5W J;  3BG3 A;  3JR9 A;  1PNR A;  3TP0 A;  3RZO J;  2YU9 J;  1MH4 A;  1QQB A;  4D7M A;  2ME0 A;  3S1Q J;  1ENH A;  1P7I A;  4AUX A;  2O38 A;  3LOC A;  3TW6 A;  4FN3 A;  1T33 A;  1F43 A;  2PUF A;  2R5Y A;  4OB4 A;  5IP6 A;  4A3G J;  1OCP A;  3KXA A;  4A3D J;  2GBY A;  1JGG A;  4Z5H A;  3TW7 A;  2JJ7 A;  5GPC A;  1RIO A;  3G5G A;  1JKR C;  2FX0 A;  3SCF A;  4GHJ A;  4NDW A;  3HB9 A;  4I6U A;  1RZR D;  3BR3 A;  2CU7 A;  2XB5 A;  3HOY J;  2HSG A;  1ETO A;  1W0U A;  2R93 J;  4UUS A;  4Y7N J;  2LK2 A;  2GLO A;  4YG7 B;  3HGG A;  1RKW A;  2AXV A;  1EFA A;  1FEX A;  2B5A A;  3F6W A;  4DZP A;  2E2J J;  2CQX A;  3S1M J;  2KDZ A;  1ORK A;  2MW8 A;  2CUF A;  2HYJ A;  2VKE A;  5J3L A;  1IJW C;  2VI6 A;  3G1L A;  2COB A;  4FIS A;  2HOT A;  2PUB A;  1RKT A;  3O8H A;  1WH6 A;  4V2G A;  3W6V A;  2JA6 J;  3CQZ J;  1ZS4 A;  3BTL A;  3FKI J;  5K7H A;  2ID6 A;  3HM5 A;  3ZQH A;  2CRO A;  3JRI A;  4M3D A;  3HDD A;  4JX6 A;  4C3J J;  3GBG A;  1LCD A;  2I10 A;  2IAI A;  2QF7 A;  3JRB A;  2JVL A;  4Y42 A;  2EZK A;  4I6R A;  1U9N A;  1LFU P;  3SCH A;  4I8T A;  4D7N A;  1UTX A;  3F52 A;  3H0G J;  1U8B A;  2XB0 X;  1PRV A;  1TWF J;  3DNV B;  2Y30 A;  2DA2 A;  1MNM C;  2HQ5 A;  3BG5 A;  1JUS A;  2L49 A;  1K83 J;  1Y9Q A;  4FTH A;  2DTZ A;  3FK7 A;  2JK3 A;  5F1J A;  1ZVV A;  3OQN A;  4M3G A;  5E3M A;  2JA5 J;  4PU7 A;  1X2L A;  2PMZ N;  1I6H J;  4I6Z A;  4A3E J;  5J1Y A;  3JRA A;  2CSF A;  2DA7 A;  3BT9 A;  1TC3 C;  2LP0 A;  1RES A;  1JT0 A;  2AW6 A;  3GN5 A;  1GVD A;  4XIC A;  1Y1W J;  3QYX A;  4CYC B;  1RZR A;  5M3M J;  5IP9 J;  2EH3 A;  1ZZ7 A;  2K9N A;  1H8A C;  1HDD C;  1U9O A;  1UHS A;  2XIU A;  2R1J L;  5C3E J;  2XGE A;  1H89 C;  3O8G A;  1ZUG A;  4Z58 A;  3IH4 A;  1UXC A;  2NVX J;  1JWL A;  1IG7 A;  1QVU A;  1PER L;  5IYB J;  1ZR2 A;  2QCO A;  4Y52 J;  3BR6 A;  3F0C A;  2DA6 A;  2LVS A;  5JLX A;  4M6V A;  2KT0 A;  5IOZ A;  2AXZ A;  4LOC A;  4C3I J;  2Y0S N;  4JX5 A;  5FJ8 J;  1R69 A;  1E3O C;  2VUM J;  4JCX A;  3CMY A;  1JJ6 C;  1CJG A;  2ELK A;  1F36 A;  3JRH A;  2LKX A;  1G2H A;  2PUA A;  5EGO B;  3HOZ J;  2O4A A;  2PUE A;  1TWH J;  1A5J A;  1S7E A;  2AO9 A;  5FLM J;  1PUF B;  2XI8 A;  4PU8 A;  3JRF A;  1Z77 A;  4D5F A;  3A01 B;  5F04 A;  4Z59 A;  2L7Z A;  1LLI A;  1QPI A;  3FMY A;  5BNG A;  3VPR A;  1Y7Y A;  3FYM A;  1R63 A;  5F08 A;  3ZQL A;  4RBO A;  1LE8 A;  1JUP A;  5EG0 A;  3OP9 A;  5IP7 J;  2GRM A;  5EF6 A;  2TCT A;  1W0T A;  2R7Z J;  1B72 A;  1JKP C;  5IYC J;  2YUS A;  5K98 B;  3HGY A;  2XSD C;  1ETV A;  3PXP A;  5M3F J;  4IHY A;  4BBS J;  2R92 J;  2EZL A;  3SCG A;  4YAR A;  3U3W A;  1POG A;  3NAU A;  4JX4 A;  1QPZ A;  3D1N I;  1WIZ A;  3ZHI A;  3SDG A;  3I4M J;  2KEK A;  2LFB A;  4BBR J;  4FCY A;  9ANT A;  1FJL A;  2K9Q A;  3LFP A;  4I76 A;  2EBY A;  1BA5 A;  3ZKC A;  3HKZ N;  2PUC A;  2X48 A;  3FYA A;  1QP0 A;  1B8I B;  2PPX A;  1HLV A;  5A7L A;  2WAQ N;  2LD5 A;  1R9T J;  3RQI A;  2O7O A;  4B1R A;  2PIJ A;  2PE5 A;  4C2M J;  5M5Y J;  1MSF C;  2O49 A;  2LCV A;  3BR2 A;  2EQR A;  4XRM A;  1UG2 A;  3GTP J;  3ZOB A;  1RPE L;  2WB1 N;  3G1O A;  3OQM A;  3CCY A;  2L9R A;  4C3H J;  3WHB A;  1Y1V J;  3BTI A;  2HXO A;  1ZZ9 A;  2KPJ A;  2A6C A;  3IH3 A;  3S17 J;  1XC5 A;  2E19 A;  2HDD A;  1HF0 A;  2ICT A;  4X4D A;  2NVY J;  4A3M J;  3SJM A;  1TWC J;  3DCF A;  3FIW A;  2WUS R;  2DA1 A;  1WI3 A;  1FIP A;  3OSF A;  1DWK A;  3LNQ A;  1WCM J;  1ZKG A;  3GTK J;  4O8B A;  1XG1 A;  3IH2 A;  1IDY A;  3BQZ A;  2JA8 J;  1GDT A;  2JN6 A;  1JFS A;  2OR1 L;  4IWR A;  4YG1 A;  3KZ3 A;  3PM1 A;  4X6A J;  2R5Z A;  4JQD A;  3VK0 A;  1JTX A;  1ZPQ A;  2OF7 A;  1XWR A;  1TWG J;  2WIU B;  1FIA A;  2MG4 A;  3L1P A;  1BW5 A;  2D5V A;  2WV1 A;  2M34 A;  2XGC A;  2IU7 A;  5EDN A;  1JJ8 C;  1D5Y A;  2NVT J;  3S15 J;  4EEF G;  1QP7 A;  1CQT A;  3OIO A;  3GBF A;  3JRD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...