2AWIA

Structure of prgx y153c mutant
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
300
structure length
298
Chain Sequence
FKIGSVLKQIRQELNYHQIDLYSGIMSKSVYIKVEADSRPISVEELSKFSERLGVNFFEILNRAGMNSVNETGKEKLLISKIFTNPDLFDKNFQRIEPKRLTSLQYFSIYLGYISIAHHYNIEVPTFNKTITSDLKHLYDKRTTFFGIDCEIVSNLLNVLPYEEVSSIIKPMYPIVDSFGKDYDLTIQTVLKNALTISIMNRNLKEAQYYINQFEHLKTIKNISINGYYDLEINYLKQIYQFLTDKNIDSYLNAVNIINIFKIIGKEDIHRSLVEELTKISAKEKFTPPKEVTMYYEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PrgX
publication title Structure of peptide sex pheromone receptor PrgX and PrgX/pheromone complexes and regulation of conjugation in Enterococcus faecalis.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Transcription
total genus 111
structure length 298
sequence length 300
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2005-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2awiA01
1.25.40.400 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2awiA02
4MCTA 1ZUGA 2PUDA 1O4XA 2PUEA 4JCYA 1ZVVA 4I6UA 3EUSA 1XWRA 1JWLA 2L8NA 2IVQA 2LYSA 1SQ8A 2MQKA 2IV1A 1LQCA 1WH8A 2L49A 1RZRA 1WETA 4Z5HA 2PUGA 1OSLA 1R69A 1LCCA 3F51A 4X4CA 3H5TA 4PU8A 4Z58A 4X4HA 1YSEA 2EWTA 3FYAA 4I6TA 4YG7B 3SCHA 1QP4A 4X4FA 4YARA 1HF0A 3F6WA 3R1FA 3L1PA 2CSFA 1ZPQA 3CECA 3G7DA 3ZHIA 1BDHA 1S7EA 3VK0A 2AW6A 3KJXA 2OFYA 1RPEL 2PIJA 3OQMA 4X4IA 2OR1L 3KZ3A 5A7LA 3JXDL 1PRUA 2KZ8A 2R1JL 1QPZA 2AXZA 1PERL 1GT0C 2LYJA 2AWIA 2XSDC 1BDIA 3CLCA 4IVZA 2GRLA 3O9XA 3IVPA 4I6RA 4PU4C 4J1XA 2AXVA 3PXPA 2AXUA 2XCJA 1RZRD 2A6CA 1ADRA 2XJ3A 1VPWA 1PRAA 4YG1A 3S8QA 2GRMA 3LISA 2IUOA 3BS3A 1POUA 4PU3C 1CQTA 3TRBA 1AU7A 2D5VA 2JCGA 3CROL 4PU7A 4Z59A 1UXDA 1ZZ7A 3SCFA 3OQOA 1RIOA 1UXCA 2BNOA 2ICPA 4OB4A 4X4GA 1QQAA 3F52A 1ZS4A 1LLIA 1EFAA 1QP0A 2HINA 3ZHMA 4O8BA 3FMYA 1Y7YA 2PUBA 1ZZ6A 1QQBA 3G5GA 4JCXA 1PRVA 2KEKA 2ICTA 2IVBA 3ZKCA 4X4BA 2JVLA 2PPXA 2LYQA 2LCVA 1ZZ9A 4X4EA 2BJCA 4J1WA 1LCDA 2WUSR 2R63A 1ZAYA 3RZZA 1JFTA 1ZZ8A 3JXCL 4FN3A 4IWRA 2O4AA 1RZSA 1NERA 2IU7A 4IA8A 2H8RA 1DW9A 1ZZCA 3SCGA 2KEIA 2PUFA 2B5AA 3UFDA 3QYXA 2EBYA 1NEQA 3GN5B 4Z5DA 4I8TA 3DNVB 1LMB3 4F8DA 3QF3A 4NDWA 3D1NI 2IVGA 2PUCA 2PE5A 3GBFA 3KXAA 3JXBC 4JQDA 2LYRA 2BNMA 1WIZA 5K98B 4FBIA 3GN5A 4X4DA 1UTXA 4GQMA 2MEZA 1OCTC 3LFPA 4GHJA 1X2LA 3FYMA 2GZUA 2KEJA 2LYKA 2EF8A 2XI8A 3QQ6A 4MCXA 4YBAA 4Z5CA 3BDNA 2CROA 3OMTA 2O49A 2PUAA 1JFSA 1ZZBA 2HSGA 3QWGA 1L1MA 2O38A 3OQNA 2LYLA 2BNNA 1JH9A 1DWKA 3OP9A 1PNRA 1IC8A 2KPJA 3HZIB 2WIUB 1X57A 1QP7A 1R63A 1CJGA 1WH6A 2FJRA 3MLFA 2LYPA 4YG4A 3BD1A 1E3OC 2AUWA 2XIUA 1B0NA 4Y42A 1Y9QA 3B7HA 3U3WA
chains in the Genus database with same CATH superfamily
3APDA 2ZIRA 3S7BA 4ER5A 1E8ZA 2MQKA 2GRNB 4NQ0A 2FEZA 2OVFA 2YHEA 1HX8A 2VEOA 4X4CA 1WAO1 3VLDA 3NAWA 3SCHA 4X4FA 3ZNGA 4Q2JA 1MYOA 3ZHIA 3PE4A 3CGHA 3VK0A 3NOGD 3CK8A 2AW6A 4PUCA 4X8QA 3LY9A 3FP3A 4YNDA 3AS8A 3BEEA 5KJNA 2LYJA 3QDNA 1JWGA 5KJMA 1IHBA 4BTAA 5DTMA 2A6CA 1H6KA 4ANXA 2PNNA 5AQ7A 2GRMA 3TRBA 2EIME 2D5VA 3CROL 2P9UG 3IKOB 4HOQA 2ICPA 3N71A 3C3OA 4KZCA 4YDEA 3E4BA 2LSVA 3CVQA 5D66A 1NL4A 2JVLA 1ZBPA 4GTMA 2PXTA 1ELWA 2ILRA 2NSZA 4FULA 3FUEA 3V30A 3PS6A 2Q7FA 5ARFA 3NQPA 4O1OA 3UIOC 5ENPD 2PUCA 3PZ2A 1TNZA 1IQRA 2L0IA 1UJJA 5G55A 4HNAD 4GHJA 3UXGA 3EJNA 1ZZBA 3ABKE 1L1MA 4RG6A 1N11A 4HFGA 3DPDA 4N2QA 1IC8A 2WIUB 5BNWA 4DX5D 2WXHA 5CHEE 3ZYKA 3AS5A 5FZRA 4G11A 2LAHA 3DSSA 1QZ2A 2IFUA 3A9XA 4MCTA 1ZUGA 2HCSA 3PUJA 3EUSA 2V0PA 4JD2G 2J8SD 4U0SA 4WNGA 1Y8MA 3FUMA 4PS3A 1R69A 3NROA 3V79K 1MX4A 3GUUA 1EPUA 4YDYA 4YG7B 2EWTA 1HF0A 3SFXA 3PZ1A 1ZPQA 3OKZA 1FPPA 2XZTG 3T8KA 4KZ0A 3UPVA 2JABA 4KVMA 1DNPA 3ISMC 2KATA 1GT0C 4I17A 2WXQA 3SBSA 5AAOA 2KM4A 4ILIA 1S70B 3UM1A 1H6OA 1X5BA 4YG1A 3ZYMA 4U8YD 2P9NG 4Z59A 4W9RA 1ZZ7A 1INZA 2GRPB 2XRZA 3MCXA 1Y7YA 4AY6A 2WXOA 4L9PA 5D2MC 3ABME 3AJIA 1HE8A 3ASGA 4G26A 1WDYA 5DRTA 2PPXA 1IHGA 1LCDA 4HOTA 2ETBA 5CMYA 2J9QA 2WXIA 3NZSA 1WG0A 5D0OD 4JHKA 1N4QA 1G3NB 2FF4A 4GB9A 5KCMA 1D8EA 3U66A 4C48B 5DSXA 2V8SE 2OOEA 4E6HA 3TEPA 4Q69A 2Y0BG 2O38A 2ZXWE 3ENEA 3ONLA 3ASFA 4A3TA 5HKPA 4LUNU 1B0NA 1OCRE 4G8LA 3VTXA 3MKQB 3U64A 1HQ1A 1Y6IA 3MYVA 2P9LG 3ZYLA 4UI9J 2VGEA 3Q73A 5G04C 5CECB 3CHPA 4CYMD 2L0TB 4EK9A 3PVLA 5AIJA 1OWPA 5JJTA 3SNXA 5JHBA 1KZOA 2AXVA 5DBKA 2VGXB 2XJ3A 5JJ6A 4F3VA 3MEJA 3HG0D 1O1RA 2JCGA 3MKRA 1QQAA 5FZSA 4GYOA 4APFA 2I9CA 4RLYA 4R7LA 4ER7A 2WMNA 3TFLA 2HE0A 2X6FA 2XGOA 4B8AA 1N54A 5EILA 2PXEA 3T5VA 3GZDA 2VSNA 5ENTD 1JFTA 1E96B 3QARA 4PS7A 2GRQB 1AWCB 2RFAA 2RD0A 4F1PA 4TV3A 5HRYA 3AG4E 3FYMA 2KBXA 2LYKA 4BSXA 2XI8A 3J5QB 3FH5A 3I5PA 2DYRE 3OP9A 1X57A 1R63A 2BKKB 4UI9C 2PXDA 2C0MA 2Y4TA 4ER3A 3IXEA 4TXRA 3L9TA 2WXMA 3DWLG 3HXFA 3Q47B 3RRMB 5EN5D 3FYAA 4I1AA 4RQIA 1E8XA 4A63B 1TYQG 5T8IA 4A55A 4NURA 3KJXA 4DX6D 1P5QA 4N5QA 2WXGA 2R1JL 1BDIA 3D9PA 3LVRE 3PXPA 4CT0A 1VPWA 3APFA 4B89A 4MRUA 2VTBA 1UXDA 2HM8A 3QWVA 5LP0A 3KD7A 1LLIA 1K1AA 3IBEA 4KBQA 4I1MA 1PRVA 4X4BA 4I9CA 4F7AA 3B7RL 4JA9A 4FHKA 2P9SG 5G05J 4A3VA 4L23A 2EBYA 3GN5B 4I9EA 1LMB3 1MJ0A 3B7SA 2XEVA 5B1AE 3GN5A 3OAWA 2WPVA 1H2VC 1FVFA 2J07A 4G24A 1E8YA 3GZDC 1OCOE 4FJZA 5A6CA 2LYLA 1ELKA 5G2NA 1O5MA 2KPJA 2XHEA 5EKQD 3L82A 1CJGA 4DE8A 2P9PG 4B0ZA 3DM5A 3G2UA 4GZ5A 2Y1LE 4LCTA 4JHRA 5DRYA 2R59A 3ZUVB 4O1PA 1WETA 1MQSA 2A4ZA 3FTUA 4Z5HA 1SA5A 2IEJA 2WM9A 3DSVA 4I6TA 1QP4A 4C0EA 1E7UA 3L1PA 3MX3A 2PZIA 4XIFA 4BESA 4ANUA 4BT8A 1LD8A 4TUMA 4PU4C 4TXQA 4M3OA 5ANRA 3IHYA 4FA6A 3G2WA 1POUA 3L17A 3ULQA 3BG0B 4HS2A 3F52A 1EFAA 3FU6A 5G05C 4DJAA 2XENA 5FJYA 2XS8A 3T9KA 2XEEA 4JCXA 1TJFA 2VSOE 5CEAA 4J8DA 4K5BA 2LXMA 4XZ4A 4U96D 1SVXA 3PRZA 4ACKA 3JQ1A 4J1WA 3TGOA 2FBNA 4GA1A 3FH7A 1ZAYA 3D9JA 4IWRA 3L16A 1WY6A 4I1OB 1TNYA 4FC8A 4I8TA 3FU5A 4BSZB 1E8WA 2C2LA 3AG2E 4JQDA 4BTBA 2QZAA 2L6JA 4X4DA 2X6HA 1UTXA 4GQMA 3SX0A 4C9BB 3G0TA 3ME5A 2EF8A 5FINA 5AYWD 2PUAA 1E90A 4JEUA 2M4HA 2JEKA 1K1BA 3HZIB 4BEPA 3MLFA 5ARGA 4EBAA 1SZAA 3QWWA 4PH4B 4Y42A 5AQAA 3ZW3A 2V5FA 4BWRA 4JC8A 5BXUA 3ZVVA 2IV1A 2X6IA 3QWPA 3AG3E 3TWXA 4J8YA 3S2AA 3F6WA 3R1FA 4OAVB 3S7FA 4Y6CA 2UY1A 3LXUX 2CG3A 1BU9A 2PIJA 1FVHA 4X4IA 4RSYA 4EPZA 1PRUA 4G2VA 4FADA 3VTYA 2B0OE 3Q5MA 2GRLA 1BPOA 1HU3A 2B6CA 3D9NA 3B13A 4FHJA 1QYMA 4G25A 3F6QA 4K03A 3SD5A 2PXQA 5CCMA 4H7XA 1O1TA 1CQTA 3HXEA 4PU7A 5LOZA 1RIOA 2J7UA 1L5JA 3C3QA 1NA0A 3J5PA 2DIWA 1QQBA 2P58C 3V2OA 4XE0A 5AARA 1W3BA 2CFZA 3FUFA 5KNGA 4AOFA 2LCVA 5J08A 4KXKB 2IF4A 4Q94A 1DCQA 3JXCL 2MRIA 3FY4A 4ER0A 3DBSA 3IEGA 3C3RA 1TN6A 3KEAA 4EKIA 3DNVB 3ASHA 3ZRHA 2PE5A 3TJPA 4WWNA 5GAGi 4N3AA 3CQCB 4N3BA 2BF0X 3FDHA 4GCOA 3UI2A 2EIJE 4LERA 4CDRA 1TR4A 3IHVA 2A5EA 4HLLA 5B3SE 1NFIE 1DWKA 1N0QA 5KJLA 4J8EA 4ILHB 4OAUC 4OVVA 5T4YA 1UG3A 2AUWA 3OXGA 4LSZE 3DSWA 5CMWA 3KSLA 4PS8A 4JVSA 3Q49B 4FLBA 4KVOA 4B94A 3Q9NC 4JEHA 3Q15A 3HRAA 3D9MA 2PL2A 4AV7A 3FUDA 3DSTA 4HRAA 5KJKA 3HDXA 1X81A 4WNEA 3KZ3A 1GW6A 4UWHA 4F6RD 1PERL 3L08A 5ENSD 1S63A 4G8KA 3FTWA 4NACA 1TN7A 4Q96A 4AEZC 3SF4A 3L6AA 3D3MA 4HOUA 5D0QD 3KS2A 5FIOA 1UXCA 4LNUD 3BQOA 4A1GA 2QC9A 2XZDG 5EX3A 3NOCD 2JQEA 3SQVA 3ASOE 1ZZ9A 2I1KA 4XEIG 2WXNA 3QAQA 3R7RA 4MLPA 5G04J 2IU7A 4JXTA 3GZCA 4CEMA 5AJDA 3KEZA 2J08A 3OTNA 4GPMA 3U4TA 2J4DA 3NZLA 3ULEG 4CGVA 2CHZA 1DULA 3UM0A 3PE3A 1JCSA 4JB8P 3VLFA 2CROA 3TXMA 2NC9A 3NBNB 3ZEFA 5JHAA 4UWLA 2V3CC 2F37A 2IQCA 3I3NA 3D9HA 4XX5A 2F8YA 1JWLA 2RKKA 1ZB1A 4CZ2D 3DRAA 4UQZA 4GMJA 4WAFA 3ONKA 4I43A 2XS1A 3F51A 3P2BA 4MBGA 4OBMA 3DEPA 3CR3A 5BXOA 4YARA 3JUEA 2H6FA 3PNLB 3AG1E 4PDXA 3SBTB 1OWNA 3HXBA 4U0ZA 3JCKC 3OWQA 4DK5A 3HVEB 4EQFA 1MHQA 3RRUA 2MOWA 4GTVA 3ULYA 4N5CA 1V55E 3MKQA 3A9ZA 3UM3A 5KWDA 3BUAA 1ZZ6A 2YINA 1QBQA 3I4RB 2DCPA 3CHRA 4WVLA 4XI9A 4UWGA 4WNDA 1N4RA 4G1TA 3FUNA 1KZPA 3LYAA 4GYYA 2PXFA 1PAQA 4F53A 4J8SA 2KEIA 1QZXA 1N9AA 4EZLA 1TEZA 4Z5DA 1NEQA 3TWRA 2VGXA 3X2QE 2JLBA 2IOLA 4GZDA 3GZSA 2FO7A 3SFYA 5ANLA 4CRWA 2ETCA 2R5SA 2MEZA 1OCTC 2GZUA 2Y3AA 2PXBA 3MJWA 4YVQC 4GTTA 5HS0A 4O60A 4HXIA 2LLVA 2R17C 3PEUB 3CSFA 1N52A 2PQRA 5EYPF 3CVUA 1Y9QA 4QQIA 3RK6A 2E0IA 3JQ0A 2L8NA 3EDTB 3KL4A 3SFZA 2PUGA 3RO2A 3QC1A 4HB5A 2KCKA 2E2EA 2R05A 4EBAG 3FULA 1TNBA 4APOA 3JXDL 3ZIMA 4LEUA 2XQ0A 3LY8A 4DPRA 2CFUA 3IVPA 4EZKA 4UQYA 4DLQA 2AXUA 2HO1A 2WVIA 4RG9A 4DLOA 5FQ6A 4OVUA 2L6BA 4BY6A 4AM9A 2IONA 4OB4A 5EIBE 1UOHA 4DX7D 2LNMA 2HINA 3UX4A 3FMYA 4I2ZA 3RAUA 3LCAA 1E7VA 4GTRA 3JXIA 4IULA 1DC2A 5BPPA 3LEWA 4TXPA 5T3RA 4JW1A 3HXDA 3ZXPA 2QY7A 1DW9A 2PUFA 2R03A 2B5AA 1H2TC 1OT8A 2H6IA 4DRXE 3UT8A 3FU3A 2BNMA 5ENRD 3AAAC 3CHQA 2KEJA 4U63A 1SW6A 4GMRA 4LG6A 3ZPJA 2L1PA 4AJWA 1HZ4A 2DYSE 2IOSA 4EHMA 4LRZA 3QNKA 2LYPA 1E3OC 2YQ8A 3DEOA 3CVXA 4EECA 2PUDA 5FTPA 1ZVVA 3E33A 2ONDA 4JHJA 5ENQD 1OSLA 1LCCA 4Z58A 2CSFA 1EYHA 5CBNA 2IO2C 3EHRA 2WQ7A 4ER6A 3CVLA 3EUVA 1FT1A 5JMND 1HF8A 3FUJA 3CLCA 2AWIA 2XSDC 2VJ8A 2EILE 1HFAA 5DT2A 2BEDA 1Z6TA 3R9AB 3BS3A 1AU7A 3VWSA 2MHKA 3Q4AB 2R02A 3FUIA 1TNUA 4Z68A 2HCNA 3OQOA 3CKCA 1TJCA 3ZHMA 1KT1A 3QKYA 4XKBA 1QP0A 2VYIA 4URKA 3ZHEB 4AIFA 1SZ9A 1NI1A 3WG7E 2LXLA 2IVBA 2WQ6A 2C0LA 3ZHEA 1LTXA 2LLWA 1OCZE 2KC7A 2GRRB 2QFCA 2NXPA 3ZPXA 2QYUA 1KPSB 1XGWA 2XXQA 2P9KG 3PZ4A 3ZGQA 1YCSB 3UT4A 4IYPA 1VDYA 3SO8A 3UKUG 4YBAA 4WNFA 4WWPA 2X6JA 3NDBB 4V3IA 2DZOA 2WXJA 2BNNA 4L7TA 3HHMA 4U8HA 4DX1A 3E32A 1HXIA 3FWVA 1OCCE 4HRMB 3ZFWA 4JCYA 1JWFA 3G2TA 4ATZD 1XWRA 2LYSA 4IRUA 1SQ8A 3QOUA 2YHCA 3NZUA 5LX8A 2WB2A 2I1JA 4M7CA 3MA5A 2LSUA 3Q78A 5JA4D 4EKGA 1PC2A 1RPEL 2KZTB 4HBDA 5IY5E 2KZ8A 5CEDB 3RKVA 2WXLA 4JZYA 1D8DA 1MFQC 3CK9A 1RZRD 3D9OA 4KYOB 2OVBA 4I6GA 3BU8A 2XGSA 2BTDA 2Y69E 2H6HA 1ELRA 4DI4A 3ZN3A 1DVPA 2OCCE 3CHSA 3SCFA 3RJVA 2PXVA 1H2UA 5E75A 2PUBA 1NA3A 4IN3B 5FQ8A 3FHEA 5CBOA 2ICTA 2LYQA 3FTZA 2BJCA 3EU5A 4DI3A 3RZZA 3TWTA 4U0UA 3T5XA 4NRHB 2XXPA 3Q75A 2GGFA 1RZSA 4QFVA 4IA8A 2H8RA 1IQUA 3CVVA 1ZZCA 3LPZA 1FCHA 3MV3B 2KXPC 4J7WA 4N39A 3D1NI 3UUXA 1SA4A 3AS4A 3NXHA 2F0YA 4H7YA 3ML9A 1MX6A 4ABNA 5ENNA 3KSQA 2ETAA 2IY0C 3U9WA 4GPKA 3PNTB 2FULA 4UWKA 5FT9A 2ZU6B 2FJRA 3UMVA 4WWOA 4YG4A 1XNFA 4DX2A 3I4GA 4ZHBA 1LF8A 1OXJA 2PUEA 3B7BA 1ZU2A 2BKGA 1JCRA 2I6HA 4CT4A 4GYWA 2V4HC 4HI8A 3JUIA 4CGWA 5A7DB 2PXKA 2I2OA 1BLXB 1YSEA 3CVNA 3PREA 4ANWA 2LNIA 3FEXA 3G7DA 1JCQA 3CSTA 1O1SA 3CVPA 4KMOA 2X3MA 1N0RA 3W9FA 1UN8A 4K0RA 3ASDA 1QPZA 2DBAA 1IXVA 4IVZA 3DXKG 3SI5A 4I6RA 4A1SA 5E76A 2IUOA 4GTQA 4BETA 3FUHA 1N4PA 5CRUA 1AP7A 2KCVA 3UQ3A 3QOWA 1SQMA 2OV8A 3PZDA 4GMLA 4X4GA 1ZS4A 5HQ8A 4Y6WA 3TWVA 1K8KG 4L1BA 3G5GA 5BW8C 3O4ZA 3JYSA 3HYMB 3BG1B 1V54E 4X4EA 3CLJA 3ESLA 3WXXA 4OYSA 3ASNE 3LS8A 4GZ6A 4FN3A 4TRQA 3TG4A 3NF1A 2MYOA 3TWUA 5AJLA 3GYZA 3Q79A 3D9KA 4HVBA 2IU1A 3TWWA 3QF3A 2X38A 3DPYA 2QYJA 2ZGGA 5EDSA 3LJNA 3LFPA 3E37A 3RIBA 3C72A 2O49A 3QJZA 4P29A 1JH9A 1Q2ZA 4GZ3A 2RFMA 4KT6B 3TAXA 5AQ9A 1U3DA 3O48A 5DTQA 2PM7A 2XPYA 1BD8A 3TXNA 4N2SA 5BUZA 3EHQA 4DE9A 4GZCA 3CHOA 2MXDA 3O9XA 2PXPA 3Q7AA 3GW4A 2WXRA 3V31A 4L2LA 1RZRA 1WH8A 3AU4A 3QK0A 4I6JA 4X4HA 3D9LA 3FEYA 3C98A 1KT0A 3ESKA 5H7PA 5FQ4A 3ZKJA 4GTPA 4N3CA 4JA7A 2AJAA 1DCEA 4U7EB 3IV0A 4YVOA 2OR1L 4CCAA 4FJYA 3A9YA 3B7TA 5JJ7A 2AXZA 4I6EA 1BI7B 3MZLB 2HFZA 5M72A 3DSXA 3URZA 4UQXA 2XRYA 3QFIA 3LISA 4PU3C 3HXCA 1U2ZA 3CQGB 2FO1E 1RW2A 4C0MA 1OWOA 1UW4B 4EZJA 1QB2A 2V4LA 3B7UX 5ITZF 4HLEA 2J49A 4E85A 1NW3A 5BV1A 2V5QC 1Z3YA 2WUSR 3L22A 2R63A 3CVWA 2XPZA 1D9SA 2VSXE 3EU9A 3AU5A 4CDNA 2RG8A 1YA0A 1YMPA 3HVEA 3CVYA 4NDWA 2IVGA 3GBFA 4JPSA 3QOXA 4ACLA 5K98B 1WIZA 3CEQA 2VGYA 4FBIA 3C5RA 4AP2A 1JUQA 3OMTA 1JFSA 4J6IA 1UN9A 3L13A 3UINC 1BI8B 1WH6A 1IYGA 2PM6A 3EHNA 2KCLA 3LVQE 3B7HA 3U3WA 2OEVA 5ENOD 5FWQA 3JXJA 1O4XA 4UI9K 2FFHA 3FU0A 4I6UA 1OWMA 4ATGA 4ANVA 2GW1A 4LNBA 5FZQA 2L49A 1HS6A 3TL5A 3ABLE 2CG2A 1HO8A 5C1DA 5LCWJ 3E30A 1TN8A 5AQBA 2XCCA 1S7EA 3FTYA 2GROB 4J8FA 2OFYA 3L54A 5J90A 2M63A 5A7LA 3PH0C 1EDUA 3UWPA 4HOSA 1H6PA 4HQDA 4NIKA 2HR2A 2X6KA 4G23A 3RU0A 4GAAA 3W9GA 4D10C 4U8VD 3FTSA 3MGBA 2XEHA 5KNHD 5CERB 1PY1A 5KBAA 3FTVA 1S64A 1B89A 1Z5SC 3CV0A 4ILGA 2KEKA 5EIDA 4FP7A 2VSYA 1A17A 1YYHA 2UWJG 2LAIA 4BT9A 2FI7A 2J09A 2XPIA 2YBDA 1QNFA 1NERA 2F8XK 3R7QA 2VQ2A 3R9MA 4EZIA 3FFLA 4HRLA 2WMOA 2IJGX 4MS6A 2ODRD 3EIJA 3KXAA 2LYRA 2EIKE 4UUCA 3QQ6A 3B95A 3TG5A 5BT1A 1WM5A 5EYLA 4U04A 3QWGA 4K5CA 3TELA 5CCLA 1QP7A 3UIPC 3R09A 1Z3XA 4BX8A 3BD1A 1S0PA 2ZGDA 4K5AB 2XIUA 4BFRA 5LCWC 3FTXA 4TUUA 3GZ2A 1FT2A 1H19A 2CHXA 3APCA 2VTBB 3CIAA 1LD7A 3CK7A 3S7DA 3KAEA 2H6GA 4PU8A 2HYZA 4YDWA 3PEVB 5EX0A 3LQXA 1MX2A 4BERA 3G2SA 5AENA 2WXPA 3SZ7A 1A5EA 3HIZA 3OQMA 2PXLA 2EQXA 3SY2A 3ML8A 2YNQA 4J1XA 2J4BA 4LNGA 4AVXA 2XCJA 1ADRA 1PRAA 1MZCA 3S8QA 1NP7A 1HH8A 5LFAA 4CDMA 1H0AA 4FU3A 3Q9UC 2LUHA 3S7JA 4O8BA 3PUKA 5A23A 3TWQA 4UWFA 4GA2A 3CHMA 4L2YA 4AXHA 2WXFA 3Q7FA 4FLHA 4U07A 1U3CA 4WUYA 3UTMA 3SHFA 3SCGA 3UT7A 3QYXA 3K9IA 3LDZA 1U2VG 3GZ1A 4F8DA 3MEKA 3FH8A 3EIQC 3T8MA 4GTSA 2BUGA 4BX9A 2LO6A 2L9BA 3RRNB 5CRVA 4GU5A 3ZXSA 4Z5CA 3PE5A 4F1SA 4HORA 4EQZA 2HSGA 3OQNA 4HRNA 1JPLA 3VLEA 1RZ4A 3DSUA 3PDNA 1K3ZD 2PXUA 4ZFHA 1EF1C 4RVBA 1KLXA 2A5UA 1OY3D 3SR4A 5C2YA 3D9IA 4JL0A 4O6FA 3LKUA 1OWLA 2IVQA 1N4SA 2OEWA 1LQCA 3OXFA 5DIZA 3H5TA 1OUVA 2WXKA 2EINE 3P1UA 4J0UA 3CECA 5HI7A 1BDHA 1N95A 3LY7A 2P9IG 3EHMA 2NYJA 4MKTA 4I2WA 2PQNA 2IO3C 2DWZA 4U95D 3UKRG 5B1BE 1HG2A 3UM2A 1HG5A 5BV0A 3FUKA 2BNOA 2CHWA 2AVPA 3M9LA 1TNOA 4DUIA 1QQEA 3ZKCA 4ME2A 2J7WA 3E34A 2KZTA 2P2CP 3OXLA 3PZ3A 3TWSA 4B8CB 3LJ3A 1ZZ8A 2O4AA 3QB2A 5DTRA 4XKCA 3UFDA 2ZISA 1NZNA 3DXMG 3MV2B 2R2LA 4YDOA 3SGHA 3JXBC 1UJKA 4GTOA 2XGMA 4XI0A 5JUWA 3G2VA 4B93B 2Y4UA 1X2LA 3BDNA 4MCXA 3CKBA 4GA0A 2UY1B 2XXAA 2XCBA 4AY5A 3ZYQA 1PNRA 3RSEG 2DZNA 5GAHi 5FQ7A 3NB2A 3V2XA 4HI9A 1N94A 3RO3A 2DVWA 2WQHA 3ZU7B 1IKND 5AN8A 4GCNA
chains in the Genus database with same CATH topology
3APDA 3S7BA 4LCTA 4JHRA 3RK6A 2E0IA 3JQ0A 3GW4A 2L8NA 2R59A 3EDTB 1E8ZA 2WXRA 2MQKA 4NQ0A 4L2LA 2FEZA 3SFZA 1RZRA 1WH8A 1WETA 1MQSA 2A4ZA 2OVFA 4Z5HA 3AU4A 3FTUA 2PUGA 4GA1A 3RO2A 3QC1A 2YHEA 1HX8A 3QK0A 4X4CA 1WAO1 4I6JA 2WM9A 3VLDA 4X4HA 3D9LA 4I6TA 1QP4A 3SCHA 3FEYA 4X4FA 4C0EA 1E7UA 3C98A 1KT0A 3ESKA 3L1PA 2KCKA 2E2EA 3MX3A 5FQ4A 4N3CA 3ZHIA 3PE4A 3CGHA 3VK0A 3CK8A 2AW6A 2PZIA 3FULA 4JA7A 3LY9A 4PUCA 4XIFA 4EBAG 3FP3A 3IV0A 4YVOA 4APOA 2OR1L 4YNDA 3AS8A 3JXDL 4CCAA 4FJYA 3ZIMA 3BEEA 3B7TA 5JJ7A 4LEUA 2XQ0A 2AXZA 3LY8A 4ANUA 2LYJA 4DPRA 4I6EA 3QDNA 1JWGA 2CFUA 5KJNA 5KJMA 4BT8A 3IVPA 4EZKA 4PU4C 3MZLB 4UQYA 4BTAA 4DLQA 4M3OA 2AXUA 2HO1A 2WVIA 2A6CA 4RG9A 5ANRA 4DLOA 5M72A 1H6KA 3IHYA 3URZA 4ANXA 4UQXA 5FQ6A 2XRYA 2GRMA 3LISA 3G2WA 4OVUA 1POUA 4PU3C 4FA6A 3TRBA 3L17A 3CQGB 2D5VA 4BY6A 3CROL 4AM9A 3IKOB 3ULQA 3BG0B 4HS2A 4C0MA 4HOQA 1OWOA 4OB4A 2IONA 2ICPA 1UW4B 3N71A 4KZCA 3F52A 4EZJA 2V4LA 1EFAA 3B7UX 2HINA 3FU6A 3E4BA 5G05C 3UX4A 3FMYA 2LSVA 5FJYA 4I2ZA 4DJAA 4HLEA 4JCXA 1TJFA 2VSOE 3CVQA 3LCAA 4J8DA 1E7VA 2J49A 4E85A 4XZ4A 5BV1A 4IULA 2JVLA 3PRZA 1ZBPA 4ACKA 3JQ1A 4J1WA 1ELWA 1Z3YA 2ILRA 3TGOA 2FBNA 2NSZA 2WUSR 3FH7A 2R63A 3L22A 1ZAYA 2XPZA 3FUEA 2VSXE 3D9JA 3LEWA 4FULA 5BPPA 3AU5A 3PS6A 5T3RA 4CDNA 2Q7FA 4JW1A 4IWRA 2RG8A 3L16A 1WY6A 5ARFA 1YA0A 3NQPA 2QY7A 1DW9A 2PUFA 3HVEA 4I1OB 2B5AA 4FC8A 1H2TC 4I8TA 3FU5A 3CVYA 1E8WA 2C2LA 4NDWA 2PUCA 2IVGA 3UT8A 3GBFA 4JPSA 4JQDA 3FU3A 4ACLA 2BNMA 1WIZA 5K98B 4BTBA 3CEQA 2L6JA 2VGYA 4FBIA 4X4DA 2X6HA 1UTXA 4GQMA 1IQRA 1UJJA 2L0IA 3CHQA 5G55A 4AP2A 4C9BB 5FZRA 4GHJA 2KEJA 4U63A 2EF8A 3EJNA 5AYWD 1JUQA 3OMTA 2PUAA 1JFSA 1E90A 1ZZBA 4JEUA 3ZPJA 1L1MA 4AJWA 4RG6A 4J6IA 1HZ4A 1UN9A 4HFGA 3DPDA 3L13A 4N2QA 1IC8A 2JEKA 3HZIB 2IOSA 2WIUB 5BNWA 1WH6A 1IYGA 4EBAA 4LRZA 2WXHA 3QNKA 3MLFA 5CHEE 3AS5A 5ARGA 2LYPA 1SZAA 2PM6A 3EHNA 1E3OC 3QWWA 4G11A 4Y42A 4PH4B 3ZW3A 2KCLA 2LAHA 3LVQE 2YQ8A 3B7HA 3U3WA 1QZ2A 2IFUA 3CVXA 2V5FA 4EECA 4MCTA 1ZUGA 2PUDA 3PUJA 5FTPA 5FWQA 4BWRA 1O4XA 4UI9K 3FU0A 1ZVVA 4I6UA 3EUSA 2V0PA 1OWMA 4JC8A 4ATGA 4ANVA 2GW1A 4U0SA 4WNGA 5FZQA 3ZVVA 2IV1A 2X6IA 2L49A 2ONDA 1HS6A 3QWPA 4JHJA 1Y8MA 3FUMA 1OSLA 1R69A 4PS3A 3TL5A 1LCCA 2CG2A 1HO8A 4Z58A 1EPUA 5C1DA 4YG7B 2EWTA 5LCWJ 3S2AA 1HF0A 3F6WA 3R1FA 3S7FA 4Y6CA 2CSFA 1EYHA 1ZPQA 2UY1A 3LXUX 2CG3A 2XCCA 1S7EA 3FTYA 2WQ7A 3CVLA 4J8FA 2OFYA 3L54A 5J90A 2PIJA 1FVHA 4X4IA 2M63A 4KZ0A 4RSYA 5A7LA 4EPZA 1HF8A 4KVMA 3PH0C 1PRUA 1DNPA 1EDUA 4G2VA 3FUJA 4FADA 2KATA 3CLCA 1GT0C 4I17A 2AWIA 2XSDC 3VTYA 2WXQA 3Q5MA 2GRLA 1BPOA 3SBSA 1HU3A 2KM4A 4ILIA 3D9NA 3B13A 2VJ8A 4FHJA 4G25A 1HFAA 2HR2A 1X5BA 4K03A 3SD5A 2X6KA 4YG1A 4H7XA 5CCMA 1Z6TA 3ZYMA 3R9AB 3BS3A 4G23A 1CQTA 1AU7A 3SF4A 2MHKA 3Q4AB 3RU0A 4PU7A 4Z59A 3FUIA 4GAAA 4W9RA 1ZZ7A 5LOZA 3FTSA 4D10C 3CKCA 3OQOA 1RIOA 3MGBA 1INZA 1L5JA 1KT1A 3ZHMA 1TJCA 3QKYA 1QP0A 2VYIA 1NA0A 3MCXA 4XKBA 4URKA 1PY1A 1Y7YA 4AY6A 2DIWA 2WXOA 1QQBA 2P58C 3FTVA 3ZHEB 1B89A 4AIFA 3CV0A 4XE0A 1SZ9A 4ILGA 2KEKA 1W3BA 2CFZA 1HE8A 4FP7A 3ASGA 2VSYA 3FUFA 4G26A 2IVBA 2PPXA 2C0LA 4AOFA 3ZHEA 2LCVA 1A17A 1IHGA 5J08A 2WQ6A 1LCDA 2UWJG 2LAIA 4BT9A 4HOTA 4KXKB 2IF4A 2KC7A 2FI7A 4Q94A 5CMYA 2J09A 2QFCA 2NXPA 2XPIA 3JXCL 1QNFA 2J9QA 2MRIA 3FY4A 1NERA 1XGWA 2WXIA 3DBSA 3IEGA 3R7QA 2VQ2A 3NZSA 3ZGQA 3DNVB 3UT4A 3FFLA 2WMOA 2IJGX 4MS6A 3ASHA 3ZRHA 3EIJA 5D0OD 2PE5A 4IYPA 3KXAA 1VDYA 4JHKA 2FF4A 2LYRA 4GB9A 3TJPA 5KCMA 4WWNA 4N3AA 3CQCB 4N3BA 3U66A 2BF0X 3FDHA 4GCOA 2V8SE 3QQ6A 4YBAA 2OOEA 4LERA 3TG5A 4WNFA 4CDRA 4E6HA 4WWPA 1WM5A 4Q69A 2X6JA 5BT1A 3IHVA 4U04A 4V3IA 3QWGA 2O38A 2WXJA 2BNNA 4L7TA 1DWKA 3HHMA 4U8HA 5KJLA 4J8EA 3ENEA 4ILHB 5CCLA 1QP7A 3ONLA 1HXIA 3ASFA 3FWVA 4OVVA 5T4YA 4A3TA 1Z3XA 4BX8A 3BD1A 1S0PA 2AUWA 1UG3A 2XIUA 1B0NA 4LUNU 4BFRA 3FTXA 5LCWC 3OXGA 4TUUA 3GZ2A 3ZFWA 1H19A 5CMWA 4JCYA 1JWFA 2CHXA 3APCA 3G2TA 1XWRA 3VTXA 2LYSA 4IRUA 4JVSA 1SQ8A 3Q49B 3QOUA 4PS8A 4FLBA 3MKQB 4KVOA 2YHCA 4B94A 2VTBB 3NZUA 5LX8A 3U64A 4JEHA 2WB2A 3CIAA 3Q15A 3CK7A 3S7DA 1Y6IA 3KAEA 2I1JA 4PU8A 2HYZA 3MYVA 3D9MA 3PEVB 5EX0A 2PL2A 3MA5A 3ZYLA 4UI9J 2LSUA 4AV7A 3FUDA 3G2SA 1PC2A 5G04C 3CHPA 5AENA 2WXPA 5KJKA 3SZ7A 3HDXA 3HIZA 1RPEL 2KZTB 2L0TB 4WNEA 3OQMA 3PVLA 3KZ3A 1GW6A 4UWHA 2EQXA 2KZ8A 1PERL 5AIJA 1OWPA 3L08A 3RKVA 2WXLA 5JJTA 3FTWA 3ML8A 4JZYA 3SNXA 5JHBA 2YNQA 4J1XA 3CK9A 4NACA 2J4BA 4Q96A 4AEZC 4AVXA 2AXVA 5DBKA 3L6AA 2XCJA 1RZRD 1ADRA 3D3MA 2VGXB 3D9OA 2XJ3A 2OVBA 1PRAA 4KYOB 5JJ6A 3S8QA 1NP7A 1HH8A 2XGSA 4I6GA 4F3VA 5LFAA 2BTDA 4HOUA 4CDMA 5D0QD 1ELRA 4DI4A 2JCGA 3MKRA 1DVPA 3KS2A 3ZN3A 1H0AA 4FU3A 3CHSA 3SCFA 3S7JA 3RJVA 1UXCA 1QQAA 5FZSA 4GYOA 1H2UA 4O8BA 5E75A 3PUKA 2PUBA 2I9CA 1NA3A 4R7LA 4A1GA 5A23A 4IN3B 5FQ8A 3FHEA 4UWFA 2WMNA 2X6FA 2XGOA 5EX3A 2ICTA 1N54A 4GA2A 4B8AA 3T5VA 2LYQA 3CHMA 3FTZA 1ZZ9A 4L2YA 2BJCA 2I1KA 4AXHA 2WXNA 2WXFA 4DI3A 2VSNA 3RZZA 3QAQA 4FLHA 4U07A 4U0UA 3T5XA 1JFTA 1E96B 1U3CA 4NRHB 4WUYA 3R7RA 3QARA 2GGFA 4PS7A 4MLPA 1RZSA 4QFVA 2IU7A 5G04J 4JXTA 4IA8A 2H8RA 1IQUA 3SHFA 3CVVA 1ZZCA 3SCGA 3LPZA 3UT7A 4CEMA 3QYXA 1FCHA 1Y9QA 3K9IA 3MV3B 5AJDA 3KEZA 2J08A 3LDZA 3GZ1A 4F8DA 4N39A 3D1NI 3MEKA 3OTNA 3FH8A 2RD0A 3EIQC 3T8MA 3U4TA 2BUGA 3UUXA 2J4DA 4TV3A 3ZYKA 4BX9A 2LO6A 4CGVA 3AS4A 2L9BA 2XRZA 3RRNB 4H7YA 3FYMA 2CHZA 3ML9A 4GU5A 2LYKA 4Z5CA 2XI8A 3PE3A 3VLFA 3ZXSA 4BSXA 4ABNA 5ENNA 4F1SA 4HORA 2CROA 3TXMA 2NC9A 3U9WA 2HSGA 4GPKA 4HOSA 3FH5A 3ZEFA 3OQNA 3I5PA 4UWLA 5JHAA 3PNTB 1JPLA 3VLEA 3OP9A 2FULA 2IQCA 3PDNA 1X57A 4UWKA 5FT9A 1R63A 3I3NA 2ZU6B 1EF1C 2FJRA 3UMVA 4RVBA 4WWOA 4YG4A 1KLXA 1XNFA 4UI9C 2A5UA 3I4GA 4XX5A 2C0MA 1LF8A 5C2YA 2Y4TA 3D9IA 4JL0A 2PUEA 4O6FA 1ZU2A 3LKUA 1JWLA 1OWLA 2IVQA 2I6HA 1LQCA 3OXFA 4GYWA 4UQZA 2WXMA 4CT4A 4GMJA 4WAFA 4CGWA 3JUIA 3ONKA 4I43A 3P2BA 3F51A 5DIZA 5A7DB 2I2OA 3H5TA 1OUVA 2WXKA 3Q47B 3RRMB 1YSEA 3CVNA 3FYAA 3P1UA 3PREA 3CR3A 4ANWA 3CVUA 4I1AA 4YARA 2LNIA 1E8XA 3FEXA 4J0UA 3CECA 3G7DA 5HI7A 5T8IA 3CSTA 1BDHA 3PNLB 4A55A 4NURA 3KJXA 3CVPA 4PDXA 3SBTB 1OWNA 3LY7A 4KMOA 2X3MA 4U0ZA 3JCKC 1P5QA 1UN8A 4K0RA 2WXGA 2R1JL 1QPZA 3ASDA 3EHMA 2DBAA 4MKTA 1BDIA 4I2WA 4IVZA 2PQNA 3D9PA 3LVRE 3SI5A 4DK5A 4I6RA 4A1SA 3HVEB 4EQFA 3PXPA 1MHQA 5E76A 4CT0A 1VPWA 2MOWA 3RRUA 3APFA 2IUOA 4N5CA 4B89A 1HG2A 3FUHA 4MRUA 2KCVA 3MKQA 3UQ3A 2VTBA 1SQMA 1HG5A 1UXDA 2OV8A 2HM8A 3PZDA 3QWVA 4GMLA 5BV0A 3FUKA 5LP0A 3KD7A 2BNOA 4X4GA 2CHWA 1ZS4A 1LLIA 2AVPA 3IBEA 5HQ8A 4Y6WA 1ZZ6A 4L1BA 3G5GA 2YINA 3O4ZA 4KBQA 3I4RB 2DCPA 5BW8C 3JYSA 4I1MA 1PRVA 3CHRA 3HYMB 4XI9A 1QQEA 3BG1B 4UWGA 3ZKCA 4WNDA 4X4BA 4G1TA 4ME2A 4I9CA 4X4EA 3CLJA 2KZTA 4F7AA 3ESLA 3OXLA 3B7RL 4OYSA 3WXXA 3FUNA 4B8CB 4JA9A 3LJ3A 4FHKA 1ZZ8A 3LS8A 4GZ6A 4FN3A 2O4AA 3LYAA 4TRQA 5G05J 3QB2A 4GYYA 4XKCA 1PAQA 4F53A 4J8SA 2KEIA 3TG4A 3NF1A 4L23A 4A3VA 3UFDA 4EZLA 1TEZA 2EBYA 1NEQA 3GN5B 4Z5DA 2VGXA 3GYZA 4I9EA 5AJLA 1LMB3 1NZNA 2JLBA 3D9KA 2IOLA 2IU1A 4HVBA 3MV2B 3QF3A 4GZDA 3GZSA 2X38A 3JXBC 2FO7A 1UJKA 3SGHA 3B7SA 2XEVA 3GN5A 2XGMA 3OAWA 5ANLA 5EDSA 4CRWA 4XI0A 2R5SA 2MEZA 3G2VA 1OCTC 3LFPA 1H2VC 1X2LA 1FVFA 2GZUA 2J07A 2WPVA 2Y4UA 3BDNA 2Y3AA 3MJWA 4MCXA 4G24A 3RIBA 3CKBA 1E8YA 4YVQC 4GA0A 2O49A 2UY1B 3CVWA 4FJZA 4HXIA 5A6CA 3QJZA 4P29A 2LYLA 1JH9A 2XCBA 1ELKA 4GZ3A 4AY5A 4KT6B 3TAXA 3ZYQA 1PNRA 5G2NA 2XHEA 2KPJA 5EKQD 5FQ7A 1U3DA 2R17C 3UPVA 1CJGA 3O48A 3PEUB 2PM7A 3CSFA 2XPYA 3RO3A 1N52A 3TXNA 4B0ZA 4N2SA 2PQRA 5BUZA 4GZCA 2WQHA 3G2UA 3CHOA 3O9XA 4GZ5A 4APFA 4GCNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MCT A;  1ZUG A;  2PUD A;  1O4X A;  2PUE A;  4JCY A;  1ZVV A;  4I6U A;  3EUS A;  1XWR A;  1JWL A;  2L8N A;  2IVQ A;  2LYS A;  1SQ8 A;  2MQK A;  2IV1 A;  1LQC A;  1WH8 A;  2L49 A;  1RZR A;  1WET A;  4Z5H A;  2PUG A;  1OSL A;  1R69 A;  1LCC A;  3F51 A;  4X4C A;  3H5T A;  4PU8 A;  4Z58 A;  4X4H A;  1YSE A;  2EWT A;  3FYA A;  4I6T A;  4YG7 B;  3SCH A;  1QP4 A;  4X4F A;  4YAR A;  1HF0 A;  3F6W A;  3R1F A;  3L1P A;  2CSF A;  1ZPQ A;  3CEC A;  3G7D A;  3ZHI A;  1BDH A;  1S7E A;  3VK0 A;  2AW6 A;  3KJX A;  2OFY A;  1RPE L;  2PIJ A;  3OQM A;  4X4I A;  2OR1 L;  3KZ3 A;  5A7L A;  3JXD L;  1PRU A;  2KZ8 A;  2R1J L;  1QPZ A;  2AXZ A;  1PER L;  1GT0 C;  2LYJ A;  2AWI A;  2XSD C;  1BDI A;  3CLC A;  4IVZ A;  2GRL A;  3O9X A;  3IVP A;  4I6R A;  4PU4 C;  4J1X A;  2AXV A;  3PXP A;  2AXU A;  2XCJ A;  1RZR D;  2A6C A;  1ADR A;  2XJ3 A;  1VPW A;  1PRA A;  4YG1 A;  3S8Q A;  2GRM A;  3LIS A;  2IUO A;  3BS3 A;  1POU A;  4PU3 C;  1CQT A;  3TRB A;  1AU7 A;  2D5V A;  2JCG A;  3CRO L;  4PU7 A;  4Z59 A;  1UXD A;  1ZZ7 A;  3SCF A;  3OQO A;  1RIO A;  1UXC A;  2BNO A;  2ICP A;  4OB4 A;  4X4G A;  1QQA A;  3F52 A;  1ZS4 A;  1LLI A;  1EFA A;  1QP0 A;  2HIN A;  3ZHM A;  4O8B A;  3FMY A;  1Y7Y A;  2PUB A;  1ZZ6 A;  1QQB A;  3G5G A;  4JCX A;  1PRV A;  2KEK A;  2ICT A;  2IVB A;  3ZKC A;  4X4B A;  2JVL A;  2PPX A;  2LYQ A;  2LCV A;  1ZZ9 A;  4X4E A;  2BJC A;  4J1W A;  1LCD A;  2WUS R;  2R63 A;  1ZAY A;  3RZZ A;  1JFT A;  1ZZ8 A;  3JXC L;  4FN3 A;  4IWR A;  2O4A A;  1RZS A;  1NER A;  2IU7 A;  4IA8 A;  2H8R A;  1DW9 A;  1ZZC A;  3SCG A;  2KEI A;  2PUF A;  2B5A A;  3UFD A;  3QYX A;  2EBY A;  1NEQ A;  3GN5 B;  4Z5D A;  4I8T A;  3DNV B;  1LMB 3;  4F8D A;  3QF3 A;  4NDW A;  3D1N I;  2IVG A;  2PUC A;  2PE5 A;  3GBF A;  3KXA A;  3JXB C;  4JQD A;  2LYR A;  2BNM A;  1WIZ A;  5K98 B;  4FBI A;  3GN5 A;  4X4D A;  1UTX A;  4GQM A;  2MEZ A;  1OCT C;  3LFP A;  4GHJ A;  1X2L A;  3FYM A;  2GZU A;  2KEJ A;  2LYK A;  2EF8 A;  2XI8 A;  3QQ6 A;  4MCX A;  4YBA A;  4Z5C A;  3BDN A;  2CRO A;  3OMT A;  2O49 A;  2PUA A;  1JFS A;  1ZZB A;  2HSG A;  3QWG A;  1L1M A;  2O38 A;  3OQN A;  2LYL A;  2BNN A;  1JH9 A;  1DWK A;  3OP9 A;  1PNR A;  1IC8 A;  2KPJ A;  3HZI B;  2WIU B;  1X57 A;  1QP7 A;  1R63 A;  1CJG A;  1WH6 A;  2FJR A;  3MLF A;  2LYP A;  4YG4 A;  3BD1 A;  1E3O C;  2AUW A;  2XIU A;  1B0N A;  4Y42 A;  1Y9Q A;  3B7H A;  3U3W A; 
#chains in the Genus database with same CATH topology
 3APD A;  2ZIR A;  3S7B A;  4ER5 A;  1E8Z A;  2MQK A;  2GRN B;  4NQ0 A;  2FEZ A;  2OVF A;  2YHE A;  1HX8 A;  2VEO A;  4X4C A;  1WAO 1;  3VLD A;  3NAW A;  3SCH A;  4X4F A;  3ZNG A;  4Q2J A;  1MYO A;  3ZHI A;  3PE4 A;  3CGH A;  3VK0 A;  3NOG D;  3CK8 A;  2AW6 A;  4PUC A;  4X8Q A;  3LY9 A;  3FP3 A;  4YND A;  3AS8 A;  3BEE A;  5KJN A;  2LYJ A;  3QDN A;  1JWG A;  5KJM A;  1IHB A;  4BTA A;  5DTM A;  2A6C A;  1H6K A;  4ANX A;  2PNN A;  5AQ7 A;  2GRM A;  3TRB A;  2EIM E;  2D5V A;  3CRO L;  2P9U G;  3IKO B;  4HOQ A;  2ICP A;  3N71 A;  3C3O A;  4KZC A;  4YDE A;  3E4B A;  2LSV A;  3CVQ A;  5D66 A;  1NL4 A;  2JVL A;  1ZBP A;  4GTM A;  2PXT A;  1ELW A;  2ILR A;  2NSZ A;  4FUL A;  3FUE A;  3V30 A;  3PS6 A;  2Q7F A;  5ARF A;  3NQP A;  4O1O A;  3UIO C;  5ENP D;  2PUC A;  3PZ2 A;  1TNZ A;  1IQR A;  2L0I A;  1UJJ A;  5G55 A;  4HNA D;  4GHJ A;  3UXG A;  3EJN A;  1ZZB A;  3ABK E;  1L1M A;  4RG6 A;  1N11 A;  4HFG A;  3DPD A;  4N2Q A;  1IC8 A;  2WIU B;  5BNW A;  4DX5 D;  2WXH A;  5CHE E;  3ZYK A;  3AS5 A;  5FZR A;  4G11 A;  2LAH A;  3DSS A;  1QZ2 A;  2IFU A;  3A9X A;  4MCT A;  1ZUG A;  2HCS A;  3PUJ A;  3EUS A;  2V0P A;  4JD2 G;  2J8S D;  4U0S A;  4WNG A;  1Y8M A;  3FUM A;  4PS3 A;  1R69 A;  3NRO A;  3V79 K;  1MX4 A;  3GUU A;  1EPU A;  4YDY A;  4YG7 B;  2EWT A;  1HF0 A;  3SFX A;  3PZ1 A;  1ZPQ A;  3OKZ A;  1FPP A;  2XZT G;  3T8K A;  4KZ0 A;  3UPV A;  2JAB A;  4KVM A;  1DNP A;  3ISM C;  2KAT A;  1GT0 C;  4I17 A;  2WXQ A;  3SBS A;  5AAO A;  2KM4 A;  4ILI A;  1S70 B;  3UM1 A;  1H6O A;  1X5B A;  4YG1 A;  3ZYM A;  4U8Y D;  2P9N G;  4Z59 A;  4W9R A;  1ZZ7 A;  1INZ A;  2GRP B;  2XRZ A;  3MCX A;  1Y7Y A;  4AY6 A;  2WXO A;  4L9P A;  5D2M C;  3ABM E;  3AJI A;  1HE8 A;  3ASG A;  4G26 A;  1WDY A;  5DRT A;  2PPX A;  1IHG A;  1LCD A;  4HOT A;  2ETB A;  5CMY A;  2J9Q A;  2WXI A;  3NZS A;  1WG0 A;  5D0O D;  4JHK A;  1N4Q A;  1G3N B;  2FF4 A;  4GB9 A;  5KCM A;  1D8E A;  3U66 A;  4C48 B;  5DSX A;  2V8S E;  2OOE A;  4E6H A;  3TEP A;  4Q69 A;  2Y0B G;  2O38 A;  2ZXW E;  3ENE A;  3ONL A;  3ASF A;  4A3T A;  5HKP A;  4LUN U;  1B0N A;  1OCR E;  4G8L A;  3VTX A;  3MKQ B;  3U64 A;  1HQ1 A;  1Y6I A;  3MYV A;  2P9L G;  3ZYL A;  4UI9 J;  2VGE A;  3Q73 A;  5G04 C;  5CEC B;  3CHP A;  4CYM D;  2L0T B;  4EK9 A;  3PVL A;  5AIJ A;  1OWP A;  5JJT A;  3SNX A;  5JHB A;  1KZO A;  2AXV A;  5DBK A;  2VGX B;  2XJ3 A;  5JJ6 A;  4F3V A;  3MEJ A;  3HG0 D;  1O1R A;  2JCG A;  3MKR A;  1QQA A;  5FZS A;  4GYO A;  4APF A;  2I9C A;  4RLY A;  4R7L A;  4ER7 A;  2WMN A;  3TFL A;  2HE0 A;  2X6F A;  2XGO A;  4B8A A;  1N54 A;  5EIL A;  2PXE A;  3T5V A;  3GZD A;  2VSN A;  5ENT D;  1JFT A;  1E96 B;  3QAR A;  4PS7 A;  2GRQ B;  1AWC B;  2RFA A;  2RD0 A;  4F1P A;  4TV3 A;  5HRY A;  3AG4 E;  3FYM A;  2KBX A;  2LYK A;  4BSX A;  2XI8 A;  3J5Q B;  3FH5 A;  3I5P A;  2DYR E;  3OP9 A;  1X57 A;  1R63 A;  2BKK B;  4UI9 C;  2PXD A;  2C0M A;  2Y4T A;  4ER3 A;  3IXE A;  4TXR A;  3L9T A;  2WXM A;  3DWL G;  3HXF A;  3Q47 B;  3RRM B;  5EN5 D;  3FYA A;  4I1A A;  4RQI A;  1E8X A;  4A63 B;  1TYQ G;  5T8I A;  4A55 A;  4NUR A;  3KJX A;  4DX6 D;  1P5Q A;  4N5Q A;  2WXG A;  2R1J L;  1BDI A;  3D9P A;  3LVR E;  3PXP A;  4CT0 A;  1VPW A;  3APF A;  4B89 A;  4MRU A;  2VTB A;  1UXD A;  2HM8 A;  3QWV A;  5LP0 A;  3KD7 A;  1LLI A;  1K1A A;  3IBE A;  4KBQ A;  4I1M A;  1PRV A;  4X4B A;  4I9C A;  4F7A A;  3B7R L;  4JA9 A;  4FHK A;  2P9S G;  5G05 J;  4A3V A;  4L23 A;  2EBY A;  3GN5 B;  4I9E A;  1LMB 3;  1MJ0 A;  3B7S A;  2XEV A;  5B1A E;  3GN5 A;  3OAW A;  2WPV A;  1H2V C;  1FVF A;  2J07 A;  4G24 A;  1E8Y A;  3GZD C;  1OCO E;  4FJZ A;  5A6C A;  2LYL A;  1ELK A;  5G2N A;  1O5M A;  2KPJ A;  2XHE A;  5EKQ D;  3L82 A;  1CJG A;  4DE8 A;  2P9P G;  4B0Z A;  3DM5 A;  3G2U A;  4GZ5 A;  2Y1L E;  4LCT A;  4JHR A;  5DRY A;  2R59 A;  3ZUV B;  4O1P A;  1WET A;  1MQS A;  2A4Z A;  3FTU A;  4Z5H A;  1SA5 A;  2IEJ A;  2WM9 A;  3DSV A;  4I6T A;  1QP4 A;  4C0E A;  1E7U A;  3L1P A;  3MX3 A;  2PZI A;  4XIF A;  4BES A;  4ANU A;  4BT8 A;  1LD8 A;  4TUM A;  4PU4 C;  4TXQ A;  4M3O A;  5ANR A;  3IHY A;  4FA6 A;  3G2W A;  1POU A;  3L17 A;  3ULQ A;  3BG0 B;  4HS2 A;  3F52 A;  1EFA A;  3FU6 A;  5G05 C;  4DJA A;  2XEN A;  5FJY A;  2XS8 A;  3T9K A;  2XEE A;  4JCX A;  1TJF A;  2VSO E;  5CEA A;  4J8D A;  4K5B A;  2LXM A;  4XZ4 A;  4U96 D;  1SVX A;  3PRZ A;  4ACK A;  3JQ1 A;  4J1W A;  3TGO A;  2FBN A;  4GA1 A;  3FH7 A;  1ZAY A;  3D9J A;  4IWR A;  3L16 A;  1WY6 A;  4I1O B;  1TNY A;  4FC8 A;  4I8T A;  3FU5 A;  4BSZ B;  1E8W A;  2C2L A;  3AG2 E;  4JQD A;  4BTB A;  2QZA A;  2L6J A;  4X4D A;  2X6H A;  1UTX A;  4GQM A;  3SX0 A;  4C9B B;  3G0T A;  3ME5 A;  2EF8 A;  5FIN A;  5AYW D;  2PUA A;  1E90 A;  4JEU A;  2M4H A;  2JEK A;  1K1B A;  3HZI B;  4BEP A;  3MLF A;  5ARG A;  4EBA A;  1SZA A;  3QWW A;  4PH4 B;  4Y42 A;  5AQA A;  3ZW3 A;  2V5F A;  4BWR A;  4JC8 A;  5BXU A;  3ZVV A;  2IV1 A;  2X6I A;  3QWP A;  3AG3 E;  3TWX A;  4J8Y A;  3S2A A;  3F6W A;  3R1F A;  4OAV B;  3S7F A;  4Y6C A;  2UY1 A;  3LXU X;  2CG3 A;  1BU9 A;  2PIJ A;  1FVH A;  4X4I A;  4RSY A;  4EPZ A;  1PRU A;  4G2V A;  4FAD A;  3VTY A;  2B0O E;  3Q5M A;  2GRL A;  1BPO A;  1HU3 A;  2B6C A;  3D9N A;  3B13 A;  4FHJ A;  1QYM A;  4G25 A;  3F6Q A;  4K03 A;  3SD5 A;  2PXQ A;  5CCM A;  4H7X A;  1O1T A;  1CQT A;  3HXE A;  4PU7 A;  5LOZ A;  1RIO A;  2J7U A;  1L5J A;  3C3Q A;  1NA0 A;  3J5P A;  2DIW A;  1QQB A;  2P58 C;  3V2O A;  4XE0 A;  5AAR A;  1W3B A;  2CFZ A;  3FUF A;  5KNG A;  4AOF A;  2LCV A;  5J08 A;  4KXK B;  2IF4 A;  4Q94 A;  1DCQ A;  3JXC L;  2MRI A;  3FY4 A;  4ER0 A;  3DBS A;  3IEG A;  3C3R A;  1TN6 A;  3KEA A;  4EKI A;  3DNV B;  3ASH A;  3ZRH A;  2PE5 A;  3TJP A;  4WWN A;  5GAG i;  4N3A A;  3CQC B;  4N3B A;  2BF0 X;  3FDH A;  4GCO A;  3UI2 A;  2EIJ E;  4LER A;  4CDR A;  1TR4 A;  3IHV A;  2A5E A;  4HLL A;  5B3S E;  1NFI E;  1DWK A;  1N0Q A;  5KJL A;  4J8E A;  4ILH B;  4OAU C;  4OVV A;  5T4Y A;  1UG3 A;  2AUW A;  3OXG A;  4LSZ E;  3DSW A;  5CMW A;  3KSL A;  4PS8 A;  4JVS A;  3Q49 B;  4FLB A;  4KVO A;  4B94 A;  3Q9N C;  4JEH A;  3Q15 A;  3HRA A;  3D9M A;  2PL2 A;  4AV7 A;  3FUD A;  3DST A;  4HRA A;  5KJK A;  3HDX A;  1X81 A;  4WNE A;  3KZ3 A;  1GW6 A;  4UWH A;  4F6R D;  1PER L;  3L08 A;  5ENS D;  1S63 A;  4G8K A;  3FTW A;  4NAC A;  1TN7 A;  4Q96 A;  4AEZ C;  3SF4 A;  3L6A A;  3D3M A;  4HOU A;  5D0Q D;  3KS2 A;  5FIO A;  1UXC A;  4LNU D;  3BQO A;  4A1G A;  2QC9 A;  2XZD G;  5EX3 A;  3NOC D;  2JQE A;  3SQV A;  3ASO E;  1ZZ9 A;  2I1K A;  4XEI G;  2WXN A;  3QAQ A;  3R7R A;  4MLP A;  5G04 J;  2IU7 A;  4JXT A;  3GZC A;  4CEM A;  5AJD A;  3KEZ A;  2J08 A;  3OTN A;  4GPM A;  3U4T A;  2J4D A;  3NZL A;  3ULE G;  4CGV A;  2CHZ A;  1DUL A;  3UM0 A;  3PE3 A;  1JCS A;  4JB8 P;  3VLF A;  2CRO A;  3TXM A;  2NC9 A;  3NBN B;  3ZEF A;  5JHA A;  4UWL A;  2V3C C;  2F37 A;  2IQC A;  3I3N A;  3D9H A;  4XX5 A;  2F8Y A;  1JWL A;  2RKK A;  1ZB1 A;  4CZ2 D;  3DRA A;  4UQZ A;  4GMJ A;  4WAF A;  3ONK A;  4I43 A;  2XS1 A;  3F51 A;  3P2B A;  4MBG A;  4OBM A;  3DEP A;  3CR3 A;  5BXO A;  4YAR A;  3JUE A;  2H6F A;  3PNL B;  3AG1 E;  4PDX A;  3SBT B;  1OWN A;  3HXB A;  4U0Z A;  3JCK C;  3OWQ A;  4DK5 A;  3HVE B;  4EQF A;  1MHQ A;  3RRU A;  2MOW A;  4GTV A;  3ULY A;  4N5C A;  1V55 E;  3MKQ A;  3A9Z A;  3UM3 A;  5KWD A;  3BUA A;  1ZZ6 A;  2YIN A;  1QBQ A;  3I4R B;  2DCP A;  3CHR A;  4WVL A;  4XI9 A;  4UWG A;  4WND A;  1N4R A;  4G1T A;  3FUN A;  1KZP A;  3LYA A;  4GYY A;  2PXF A;  1PAQ A;  4F53 A;  4J8S A;  2KEI A;  1QZX A;  1N9A A;  4EZL A;  1TEZ A;  4Z5D A;  1NEQ A;  3TWR A;  2VGX A;  3X2Q E;  2JLB A;  2IOL A;  4GZD A;  3GZS A;  2FO7 A;  3SFY A;  5ANL A;  4CRW A;  2ETC A;  2R5S A;  2MEZ A;  1OCT C;  2GZU A;  2Y3A A;  2PXB A;  3MJW A;  4YVQ C;  4GTT A;  5HS0 A;  4O60 A;  4HXI A;  2LLV A;  2R17 C;  3PEU B;  3CSF A;  1N52 A;  2PQR A;  5EYP F;  3CVU A;  1Y9Q A;  4QQI A;  3RK6 A;  2E0I A;  3JQ0 A;  2L8N A;  3EDT B;  3KL4 A;  3SFZ A;  2PUG A;  3RO2 A;  3QC1 A;  4HB5 A;  2KCK A;  2E2E A;  2R05 A;  4EBA G;  3FUL A;  1TNB A;  4APO A;  3JXD L;  3ZIM A;  4LEU A;  2XQ0 A;  3LY8 A;  4DPR A;  2CFU A;  3IVP A;  4EZK A;  4UQY A;  4DLQ A;  2AXU A;  2HO1 A;  2WVI A;  4RG9 A;  4DLO A;  5FQ6 A;  4OVU A;  2L6B A;  4BY6 A;  4AM9 A;  2ION A;  4OB4 A;  5EIB E;  1UOH A;  4DX7 D;  2LNM A;  2HIN A;  3UX4 A;  3FMY A;  4I2Z A;  3RAU A;  3LCA A;  1E7V A;  4GTR A;  3JXI A;  4IUL A;  1DC2 A;  5BPP A;  3LEW A;  4TXP A;  5T3R A;  4JW1 A;  3HXD A;  3ZXP A;  2QY7 A;  1DW9 A;  2PUF A;  2R03 A;  2B5A A;  1H2T C;  1OT8 A;  2H6I A;  4DRX E;  3UT8 A;  3FU3 A;  2BNM A;  5ENR D;  3AAA C;  3CHQ A;  2KEJ A;  4U63 A;  1SW6 A;  4GMR A;  4LG6 A;  3ZPJ A;  2L1P A;  4AJW A;  1HZ4 A;  2DYS E;  2IOS A;  4EHM A;  4LRZ A;  3QNK A;  2LYP A;  1E3O C;  2YQ8 A;  3DEO A;  3CVX A;  4EEC A;  2PUD A;  5FTP A;  1ZVV A;  3E33 A;  2OND A;  4JHJ A;  5ENQ D;  1OSL A;  1LCC A;  4Z58 A;  2CSF A;  1EYH A;  5CBN A;  2IO2 C;  3EHR A;  2WQ7 A;  4ER6 A;  3CVL A;  3EUV A;  1FT1 A;  5JMN D;  1HF8 A;  3FUJ A;  3CLC A;  2AWI A;  2XSD C;  2VJ8 A;  2EIL E;  1HFA A;  5DT2 A;  2BED A;  1Z6T A;  3R9A B;  3BS3 A;  1AU7 A;  3VWS A;  2MHK A;  3Q4A B;  2R02 A;  3FUI A;  1TNU A;  4Z68 A;  2HCN A;  3OQO A;  3CKC A;  1TJC A;  3ZHM A;  1KT1 A;  3QKY A;  4XKB A;  1QP0 A;  2VYI A;  4URK A;  3ZHE B;  4AIF A;  1SZ9 A;  1NI1 A;  3WG7 E;  2LXL A;  2IVB A;  2WQ6 A;  2C0L A;  3ZHE A;  1LTX A;  2LLW A;  1OCZ E;  2KC7 A;  2GRR B;  2QFC A;  2NXP A;  3ZPX A;  2QYU A;  1KPS B;  1XGW A;  2XXQ A;  2P9K G;  3PZ4 A;  3ZGQ A;  1YCS B;  3UT4 A;  4IYP A;  1VDY A;  3SO8 A;  3UKU G;  4YBA A;  4WNF A;  4WWP A;  2X6J A;  3NDB B;  4V3I A;  2DZO A;  2WXJ A;  2BNN A;  4L7T A;  3HHM A;  4U8H A;  4DX1 A;  3E32 A;  1HXI A;  3FWV A;  1OCC E;  4HRM B;  3ZFW A;  4JCY A;  1JWF A;  3G2T A;  4ATZ D;  1XWR A;  2LYS A;  4IRU A;  1SQ8 A;  3QOU A;  2YHC A;  3NZU A;  5LX8 A;  2WB2 A;  2I1J A;  4M7C A;  3MA5 A;  2LSU A;  3Q78 A;  5JA4 D;  4EKG A;  1PC2 A;  1RPE L;  2KZT B;  4HBD A;  5IY5 E;  2KZ8 A;  5CED B;  3RKV A;  2WXL A;  4JZY A;  1D8D A;  1MFQ C;  3CK9 A;  1RZR D;  3D9O A;  4KYO B;  2OVB A;  4I6G A;  3BU8 A;  2XGS A;  2BTD A;  2Y69 E;  2H6H A;  1ELR A;  4DI4 A;  3ZN3 A;  1DVP A;  2OCC E;  3CHS A;  3SCF A;  3RJV A;  2PXV A;  1H2U A;  5E75 A;  2PUB A;  1NA3 A;  4IN3 B;  5FQ8 A;  3FHE A;  5CBO A;  2ICT A;  2LYQ A;  3FTZ A;  2BJC A;  3EU5 A;  4DI3 A;  3RZZ A;  3TWT A;  4U0U A;  3T5X A;  4NRH B;  2XXP A;  3Q75 A;  2GGF A;  1RZS A;  4QFV A;  4IA8 A;  2H8R A;  1IQU A;  3CVV A;  1ZZC A;  3LPZ A;  1FCH A;  3MV3 B;  2KXP C;  4J7W A;  4N39 A;  3D1N I;  3UUX A;  1SA4 A;  3AS4 A;  3NXH A;  2F0Y A;  4H7Y A;  3ML9 A;  1MX6 A;  4ABN A;  5ENN A;  3KSQ A;  2ETA A;  2IY0 C;  3U9W A;  4GPK A;  3PNT B;  2FUL A;  4UWK A;  5FT9 A;  2ZU6 B;  2FJR A;  3UMV A;  4WWO A;  4YG4 A;  1XNF A;  4DX2 A;  3I4G A;  4ZHB A;  1LF8 A;  1OXJ A;  2PUE A;  3B7B A;  1ZU2 A;  2BKG A;  1JCR A;  2I6H A;  4CT4 A;  4GYW A;  2V4H C;  4HI8 A;  3JUI A;  4CGW A;  5A7D B;  2PXK A;  2I2O A;  1BLX B;  1YSE A;  3CVN A;  3PRE A;  4ANW A;  2LNI A;  3FEX A;  3G7D A;  1JCQ A;  3CST A;  1O1S A;  3CVP A;  4KMO A;  2X3M A;  1N0R A;  3W9F A;  1UN8 A;  4K0R A;  3ASD A;  1QPZ A;  2DBA A;  1IXV A;  4IVZ A;  3DXK G;  3SI5 A;  4I6R A;  4A1S A;  5E76 A;  2IUO A;  4GTQ A;  4BET A;  3FUH A;  1N4P A;  5CRU A;  1AP7 A;  2KCV A;  3UQ3 A;  3QOW A;  1SQM A;  2OV8 A;  3PZD A;  4GML A;  4X4G A;  1ZS4 A;  5HQ8 A;  4Y6W A;  3TWV A;  1K8K G;  4L1B A;  3G5G A;  5BW8 C;  3O4Z A;  3JYS A;  3HYM B;  3BG1 B;  1V54 E;  4X4E A;  3CLJ A;  3ESL A;  3WXX A;  4OYS A;  3ASN E;  3LS8 A;  4GZ6 A;  4FN3 A;  4TRQ A;  3TG4 A;  3NF1 A;  2MYO A;  3TWU A;  5AJL A;  3GYZ A;  3Q79 A;  3D9K A;  4HVB A;  2IU1 A;  3TWW A;  3QF3 A;  2X38 A;  3DPY A;  2QYJ A;  2ZGG A;  5EDS A;  3LJN A;  3LFP A;  3E37 A;  3RIB A;  3C72 A;  2O49 A;  3QJZ A;  4P29 A;  1JH9 A;  1Q2Z A;  4GZ3 A;  2RFM A;  4KT6 B;  3TAX A;  5AQ9 A;  1U3D A;  3O48 A;  5DTQ A;  2PM7 A;  2XPY A;  1BD8 A;  3TXN A;  4N2S A;  5BUZ A;  3EHQ A;  4DE9 A;  4GZC A;  3CHO A;  2MXD A;  3O9X A;  2PXP A;  3Q7A A;  3GW4 A;  2WXR A;  3V31 A;  4L2L A;  1RZR A;  1WH8 A;  3AU4 A;  3QK0 A;  4I6J A;  4X4H A;  3D9L A;  3FEY A;  3C98 A;  1KT0 A;  3ESK A;  5H7P A;  5FQ4 A;  3ZKJ A;  4GTP A;  4N3C A;  4JA7 A;  2AJA A;  1DCE A;  4U7E B;  3IV0 A;  4YVO A;  2OR1 L;  4CCA A;  4FJY A;  3A9Y A;  3B7T A;  5JJ7 A;  2AXZ A;  4I6E A;  1BI7 B;  3MZL B;  2HFZ A;  5M72 A;  3DSX A;  3URZ A;  4UQX A;  2XRY A;  3QFI A;  3LIS A;  4PU3 C;  3HXC A;  1U2Z A;  3CQG B;  2FO1 E;  1RW2 A;  4C0M A;  1OWO A;  1UW4 B;  4EZJ A;  1QB2 A;  2V4L A;  3B7U X;  5ITZ F;  4HLE A;  2J49 A;  4E85 A;  1NW3 A;  5BV1 A;  2V5Q C;  1Z3Y A;  2WUS R;  3L22 A;  2R63 A;  3CVW A;  2XPZ A;  1D9S A;  2VSX E;  3EU9 A;  3AU5 A;  4CDN A;  2RG8 A;  1YA0 A;  1YMP A;  3HVE A;  3CVY A;  4NDW A;  2IVG A;  3GBF A;  4JPS A;  3QOX A;  4ACL A;  5K98 B;  1WIZ A;  3CEQ A;  2VGY A;  4FBI A;  3C5R A;  4AP2 A;  1JUQ A;  3OMT A;  1JFS A;  4J6I A;  1UN9 A;  3L13 A;  3UIN C;  1BI8 B;  1WH6 A;  1IYG A;  2PM6 A;  3EHN A;  2KCL A;  3LVQ E;  3B7H A;  3U3W A;  2OEV A;  5ENO D;  5FWQ A;  3JXJ A;  1O4X A;  4UI9 K;  2FFH A;  3FU0 A;  4I6U A;  1OWM A;  4ATG A;  4ANV A;  2GW1 A;  4LNB A;  5FZQ A;  2L49 A;  1HS6 A;  3TL5 A;  3ABL E;  2CG2 A;  1HO8 A;  5C1D A;  5LCW J;  3E30 A;  1TN8 A;  5AQB A;  2XCC A;  1S7E A;  3FTY A;  2GRO B;  4J8F A;  2OFY A;  3L54 A;  5J90 A;  2M63 A;  5A7L A;  3PH0 C;  1EDU A;  3UWP A;  4HOS A;  1H6P A;  4HQD A;  4NIK A;  2HR2 A;  2X6K A;  4G23 A;  3RU0 A;  4GAA A;  3W9G A;  4D10 C;  4U8V D;  3FTS A;  3MGB A;  2XEH A;  5KNH D;  5CER B;  1PY1 A;  5KBA A;  3FTV A;  1S64 A;  1B89 A;  1Z5S C;  3CV0 A;  4ILG A;  2KEK A;  5EID A;  4FP7 A;  2VSY A;  1A17 A;  1YYH A;  2UWJ G;  2LAI A;  4BT9 A;  2FI7 A;  2J09 A;  2XPI A;  2YBD A;  1QNF A;  1NER A;  2F8X K;  3R7Q A;  2VQ2 A;  3R9M A;  4EZI A;  3FFL A;  4HRL A;  2WMO A;  2IJG X;  4MS6 A;  2ODR D;  3EIJ A;  3KXA A;  2LYR A;  2EIK E;  4UUC A;  3QQ6 A;  3B95 A;  3TG5 A;  5BT1 A;  1WM5 A;  5EYL A;  4U04 A;  3QWG A;  4K5C A;  3TEL A;  5CCL A;  1QP7 A;  3UIP C;  3R09 A;  1Z3X A;  4BX8 A;  3BD1 A;  1S0P A;  2ZGD A;  4K5A B;  2XIU A;  4BFR A;  5LCW C;  3FTX A;  4TUU A;  3GZ2 A;  1FT2 A;  1H19 A;  2CHX A;  3APC A;  2VTB B;  3CIA A;  1LD7 A;  3CK7 A;  3S7D A;  3KAE A;  2H6G A;  4PU8 A;  2HYZ A;  4YDW A;  3PEV B;  5EX0 A;  3LQX A;  1MX2 A;  4BER A;  3G2S A;  5AEN A;  2WXP A;  3SZ7 A;  1A5E A;  3HIZ A;  3OQM A;  2PXL A;  2EQX A;  3SY2 A;  3ML8 A;  2YNQ A;  4J1X A;  2J4B A;  4LNG A;  4AVX A;  2XCJ A;  1ADR A;  1PRA A;  1MZC A;  3S8Q A;  1NP7 A;  1HH8 A;  5LFA A;  4CDM A;  1H0A A;  4FU3 A;  3Q9U C;  2LUH A;  3S7J A;  4O8B A;  3PUK A;  5A23 A;  3TWQ A;  4UWF A;  4GA2 A;  3CHM A;  4L2Y A;  4AXH A;  2WXF A;  3Q7F A;  4FLH A;  4U07 A;  1U3C A;  4WUY A;  3UTM A;  3SHF A;  3SCG A;  3UT7 A;  3QYX A;  3K9I A;  3LDZ A;  1U2V G;  3GZ1 A;  4F8D A;  3MEK A;  3FH8 A;  3EIQ C;  3T8M A;  4GTS A;  2BUG A;  4BX9 A;  2LO6 A;  2L9B A;  3RRN B;  5CRV A;  4GU5 A;  3ZXS A;  4Z5C A;  3PE5 A;  4F1S A;  4HOR A;  4EQZ A;  2HSG A;  3OQN A;  4HRN A;  1JPL A;  3VLE A;  1RZ4 A;  3DSU A;  3PDN A;  1K3Z D;  2PXU A;  4ZFH A;  1EF1 C;  4RVB A;  1KLX A;  2A5U A;  1OY3 D;  3SR4 A;  5C2Y A;  3D9I A;  4JL0 A;  4O6F A;  3LKU A;  1OWL A;  2IVQ A;  1N4S A;  2OEW A;  1LQC A;  3OXF A;  5DIZ A;  3H5T A;  1OUV A;  2WXK A;  2EIN E;  3P1U A;  4J0U A;  3CEC A;  5HI7 A;  1BDH A;  1N95 A;  3LY7 A;  2P9I G;  3EHM A;  2NYJ A;  4MKT A;  4I2W A;  2PQN A;  2IO3 C;  2DWZ A;  4U95 D;  3UKR G;  5B1B E;  1HG2 A;  3UM2 A;  1HG5 A;  5BV0 A;  3FUK A;  2BNO A;  2CHW A;  2AVP A;  3M9L A;  1TNO A;  4DUI A;  1QQE A;  3ZKC A;  4ME2 A;  2J7W A;  3E34 A;  2KZT A;  2P2C P;  3OXL A;  3PZ3 A;  3TWS A;  4B8C B;  3LJ3 A;  1ZZ8 A;  2O4A A;  3QB2 A;  5DTR A;  4XKC A;  3UFD A;  2ZIS A;  1NZN A;  3DXM G;  3MV2 B;  2R2L A;  4YDO A;  3SGH A;  3JXB C;  1UJK A;  4GTO A;  2XGM A;  4XI0 A;  5JUW A;  3G2V A;  4B93 B;  2Y4U A;  1X2L A;  3BDN A;  4MCX A;  3CKB A;  4GA0 A;  2UY1 B;  2XXA A;  2XCB A;  4AY5 A;  3ZYQ A;  1PNR A;  3RSE G;  2DZN A;  5GAH i;  5FQ7 A;  3NB2 A;  3V2X A;  4HI9 A;  1N94 A;  3RO3 A;  2DVW A;  2WQH A;  3ZU7 B;  1IKN D;  5AN8 A;  4GCN A; 
#chains in the Genus database with same CATH homology
 3APD A;  3S7B A;  4LCT A;  4JHR A;  3RK6 A;  2E0I A;  3JQ0 A;  3GW4 A;  2L8N A;  2R59 A;  3EDT B;  1E8Z A;  2WXR A;  2MQK A;  4NQ0 A;  4L2L A;  2FEZ A;  3SFZ A;  1RZR A;  1WH8 A;  1WET A;  1MQS A;  2A4Z A;  2OVF A;  4Z5H A;  3AU4 A;  3FTU A;  2PUG A;  4GA1 A;  3RO2 A;  3QC1 A;  2YHE A;  1HX8 A;  3QK0 A;  4X4C A;  1WAO 1;  4I6J A;  2WM9 A;  3VLD A;  4X4H A;  3D9L A;  4I6T A;  1QP4 A;  3SCH A;  3FEY A;  4X4F A;  4C0E A;  1E7U A;  3C98 A;  1KT0 A;  3ESK A;  3L1P A;  2KCK A;  2E2E A;  3MX3 A;  5FQ4 A;  4N3C A;  3ZHI A;  3PE4 A;  3CGH A;  3VK0 A;  3CK8 A;  2AW6 A;  2PZI A;  3FUL A;  4JA7 A;  3LY9 A;  4PUC A;  4XIF A;  4EBA G;  3FP3 A;  3IV0 A;  4YVO A;  4APO A;  2OR1 L;  4YND A;  3AS8 A;  3JXD L;  4CCA A;  4FJY A;  3ZIM A;  3BEE A;  3B7T A;  5JJ7 A;  4LEU A;  2XQ0 A;  2AXZ A;  3LY8 A;  4ANU A;  2LYJ A;  4DPR A;  4I6E A;  3QDN A;  1JWG A;  2CFU A;  5KJN A;  5KJM A;  4BT8 A;  3IVP A;  4EZK A;  4PU4 C;  3MZL B;  4UQY A;  4BTA A;  4DLQ A;  4M3O A;  2AXU A;  2HO1 A;  2WVI A;  2A6C A;  4RG9 A;  5ANR A;  4DLO A;  5M72 A;  1H6K A;  3IHY A;  3URZ A;  4ANX A;  4UQX A;  5FQ6 A;  2XRY A;  2GRM A;  3LIS A;  3G2W A;  4OVU A;  1POU A;  4PU3 C;  4FA6 A;  3TRB A;  3L17 A;  3CQG B;  2D5V A;  4BY6 A;  3CRO L;  4AM9 A;  3IKO B;  3ULQ A;  3BG0 B;  4HS2 A;  4C0M A;  4HOQ A;  1OWO A;  4OB4 A;  2ION A;  2ICP A;  1UW4 B;  3N71 A;  4KZC A;  3F52 A;  4EZJ A;  2V4L A;  1EFA A;  3B7U X;  2HIN A;  3FU6 A;  3E4B A;  5G05 C;  3UX4 A;  3FMY A;  2LSV A;  5FJY A;  4I2Z A;  4DJA A;  4HLE A;  4JCX A;  1TJF A;  2VSO E;  3CVQ A;  3LCA A;  4J8D A;  1E7V A;  2J49 A;  4E85 A;  4XZ4 A;  5BV1 A;  4IUL A;  2JVL A;  3PRZ A;  1ZBP A;  4ACK A;  3JQ1 A;  4J1W A;  1ELW A;  1Z3Y A;  2ILR A;  3TGO A;  2FBN A;  2NSZ A;  2WUS R;  3FH7 A;  2R63 A;  3L22 A;  1ZAY A;  2XPZ A;  3FUE A;  2VSX E;  3D9J A;  3LEW A;  4FUL A;  5BPP A;  3AU5 A;  3PS6 A;  5T3R A;  4CDN A;  2Q7F A;  4JW1 A;  4IWR A;  2RG8 A;  3L16 A;  1WY6 A;  5ARF A;  1YA0 A;  3NQP A;  2QY7 A;  1DW9 A;  2PUF A;  3HVE A;  4I1O B;  2B5A A;  4FC8 A;  1H2T C;  4I8T A;  3FU5 A;  3CVY A;  1E8W A;  2C2L A;  4NDW A;  2PUC A;  2IVG A;  3UT8 A;  3GBF A;  4JPS A;  4JQD A;  3FU3 A;  4ACL A;  2BNM A;  1WIZ A;  5K98 B;  4BTB A;  3CEQ A;  2L6J A;  2VGY A;  4FBI A;  4X4D A;  2X6H A;  1UTX A;  4GQM A;  1IQR A;  1UJJ A;  2L0I A;  3CHQ A;  5G55 A;  4AP2 A;  4C9B B;  5FZR A;  4GHJ A;  2KEJ A;  4U63 A;  2EF8 A;  3EJN A;  5AYW D;  1JUQ A;  3OMT A;  2PUA A;  1JFS A;  1E90 A;  1ZZB A;  4JEU A;  3ZPJ A;  1L1M A;  4AJW A;  4RG6 A;  4J6I A;  1HZ4 A;  1UN9 A;  4HFG A;  3DPD A;  3L13 A;  4N2Q A;  1IC8 A;  2JEK A;  3HZI B;  2IOS A;  2WIU B;  5BNW A;  1WH6 A;  1IYG A;  4EBA A;  4LRZ A;  2WXH A;  3QNK A;  3MLF A;  5CHE E;  3AS5 A;  5ARG A;  2LYP A;  1SZA A;  2PM6 A;  3EHN A;  1E3O C;  3QWW A;  4G11 A;  4Y42 A;  4PH4 B;  3ZW3 A;  2KCL A;  2LAH A;  3LVQ E;  2YQ8 A;  3B7H A;  3U3W A;  1QZ2 A;  2IFU A;  3CVX A;  2V5F A;  4EEC A;  4MCT A;  1ZUG A;  2PUD A;  3PUJ A;  5FTP A;  5FWQ A;  4BWR A;  1O4X A;  4UI9 K;  3FU0 A;  1ZVV A;  4I6U A;  3EUS A;  2V0P A;  1OWM A;  4JC8 A;  4ATG A;  4ANV A;  2GW1 A;  4U0S A;  4WNG A;  5FZQ A;  3ZVV A;  2IV1 A;  2X6I A;  2L49 A;  2OND A;  1HS6 A;  3QWP A;  4JHJ A;  1Y8M A;  3FUM A;  1OSL A;  1R69 A;  4PS3 A;  3TL5 A;  1LCC A;  2CG2 A;  1HO8 A;  4Z58 A;  1EPU A;  5C1D A;  4YG7 B;  2EWT A;  5LCW J;  3S2A A;  1HF0 A;  3F6W A;  3R1F A;  3S7F A;  4Y6C A;  2CSF A;  1EYH A;  1ZPQ A;  2UY1 A;  3LXU X;  2CG3 A;  2XCC A;  1S7E A;  3FTY A;  2WQ7 A;  3CVL A;  4J8F A;  2OFY A;  3L54 A;  5J90 A;  2PIJ A;  1FVH A;  4X4I A;  2M63 A;  4KZ0 A;  4RSY A;  5A7L A;  4EPZ A;  1HF8 A;  4KVM A;  3PH0 C;  1PRU A;  1DNP A;  1EDU A;  4G2V A;  3FUJ A;  4FAD A;  2KAT A;  3CLC A;  1GT0 C;  4I17 A;  2AWI A;  2XSD C;  3VTY A;  2WXQ A;  3Q5M A;  2GRL A;  1BPO A;  3SBS A;  1HU3 A;  2KM4 A;  4ILI A;  3D9N A;  3B13 A;  2VJ8 A;  4FHJ A;  4G25 A;  1HFA A;  2HR2 A;  1X5B A;  4K03 A;  3SD5 A;  2X6K A;  4YG1 A;  4H7X A;  5CCM A;  1Z6T A;  3ZYM A;  3R9A B;  3BS3 A;  4G23 A;  1CQT A;  1AU7 A;  3SF4 A;  2MHK A;  3Q4A B;  3RU0 A;  4PU7 A;  4Z59 A;  3FUI A;  4GAA A;  4W9R A;  1ZZ7 A;  5LOZ A;  3FTS A;  4D10 C;  3CKC A;  3OQO A;  1RIO A;  3MGB A;  1INZ A;  1L5J A;  1KT1 A;  3ZHM A;  1TJC A;  3QKY A;  1QP0 A;  2VYI A;  1NA0 A;  3MCX A;  4XKB A;  4URK A;  1PY1 A;  1Y7Y A;  4AY6 A;  2DIW A;  2WXO A;  1QQB A;  2P58 C;  3FTV A;  3ZHE B;  1B89 A;  4AIF A;  3CV0 A;  4XE0 A;  1SZ9 A;  4ILG A;  2KEK A;  1W3B A;  2CFZ A;  1HE8 A;  4FP7 A;  3ASG A;  2VSY A;  3FUF A;  4G26 A;  2IVB A;  2PPX A;  2C0L A;  4AOF A;  3ZHE A;  2LCV A;  1A17 A;  1IHG A;  5J08 A;  2WQ6 A;  1LCD A;  2UWJ G;  2LAI A;  4BT9 A;  4HOT A;  4KXK B;  2IF4 A;  2KC7 A;  2FI7 A;  4Q94 A;  5CMY A;  2J09 A;  2QFC A;  2NXP A;  2XPI A;  3JXC L;  1QNF A;  2J9Q A;  2MRI A;  3FY4 A;  1NER A;  1XGW A;  2WXI A;  3DBS A;  3IEG A;  3R7Q A;  2VQ2 A;  3NZS A;  3ZGQ A;  3DNV B;  3UT4 A;  3FFL A;  2WMO A;  2IJG X;  4MS6 A;  3ASH A;  3ZRH A;  3EIJ A;  5D0O D;  2PE5 A;  4IYP A;  3KXA A;  1VDY A;  4JHK A;  2FF4 A;  2LYR A;  4GB9 A;  3TJP A;  5KCM A;  4WWN A;  4N3A A;  3CQC B;  4N3B A;  3U66 A;  2BF0 X;  3FDH A;  4GCO A;  2V8S E;  3QQ6 A;  4YBA A;  2OOE A;  4LER A;  3TG5 A;  4WNF A;  4CDR A;  4E6H A;  4WWP A;  1WM5 A;  4Q69 A;  2X6J A;  5BT1 A;  3IHV A;  4U04 A;  4V3I A;  3QWG A;  2O38 A;  2WXJ A;  2BNN A;  4L7T A;  1DWK A;  3HHM A;  4U8H A;  5KJL A;  4J8E A;  3ENE A;  4ILH B;  5CCL A;  1QP7 A;  3ONL A;  1HXI A;  3ASF A;  3FWV A;  4OVV A;  5T4Y A;  4A3T A;  1Z3X A;  4BX8 A;  3BD1 A;  1S0P A;  2AUW A;  1UG3 A;  2XIU A;  1B0N A;  4LUN U;  4BFR A;  3FTX A;  5LCW C;  3OXG A;  4TUU A;  3GZ2 A;  3ZFW A;  1H19 A;  5CMW A;  4JCY A;  1JWF A;  2CHX A;  3APC A;  3G2T A;  1XWR A;  3VTX A;  2LYS A;  4IRU A;  4JVS A;  1SQ8 A;  3Q49 B;  3QOU A;  4PS8 A;  4FLB A;  3MKQ B;  4KVO A;  2YHC A;  4B94 A;  2VTB B;  3NZU A;  5LX8 A;  3U64 A;  4JEH A;  2WB2 A;  3CIA A;  3Q15 A;  3CK7 A;  3S7D A;  1Y6I A;  3KAE A;  2I1J A;  4PU8 A;  2HYZ A;  3MYV A;  3D9M A;  3PEV B;  5EX0 A;  2PL2 A;  3MA5 A;  3ZYL A;  4UI9 J;  2LSU A;  4AV7 A;  3FUD A;  3G2S A;  1PC2 A;  5G04 C;  3CHP A;  5AEN A;  2WXP A;  5KJK A;  3SZ7 A;  3HDX A;  3HIZ A;  1RPE L;  2KZT B;  2L0T B;  4WNE A;  3OQM A;  3PVL A;  3KZ3 A;  1GW6 A;  4UWH A;  2EQX A;  2KZ8 A;  1PER L;  5AIJ A;  1OWP A;  3L08 A;  3RKV A;  2WXL A;  5JJT A;  3FTW A;  3ML8 A;  4JZY A;  3SNX A;  5JHB A;  2YNQ A;  4J1X A;  3CK9 A;  4NAC A;  2J4B A;  4Q96 A;  4AEZ C;  4AVX A;  2AXV A;  5DBK A;  3L6A A;  2XCJ A;  1RZR D;  1ADR A;  3D3M A;  2VGX B;  3D9O A;  2XJ3 A;  2OVB A;  1PRA A;  4KYO B;  5JJ6 A;  3S8Q A;  1NP7 A;  1HH8 A;  2XGS A;  4I6G A;  4F3V A;  5LFA A;  2BTD A;  4HOU A;  4CDM A;  5D0Q D;  1ELR A;  4DI4 A;  2JCG A;  3MKR A;  1DVP A;  3KS2 A;  3ZN3 A;  1H0A A;  4FU3 A;  3CHS A;  3SCF A;  3S7J A;  3RJV A;  1UXC A;  1QQA A;  5FZS A;  4GYO A;  1H2U A;  4O8B A;  5E75 A;  3PUK A;  2PUB A;  2I9C A;  1NA3 A;  4R7L A;  4A1G A;  5A23 A;  4IN3 B;  5FQ8 A;  3FHE A;  4UWF A;  2WMN A;  2X6F A;  2XGO A;  5EX3 A;  2ICT A;  1N54 A;  4GA2 A;  4B8A A;  3T5V A;  2LYQ A;  3CHM A;  3FTZ A;  1ZZ9 A;  4L2Y A;  2BJC A;  2I1K A;  4AXH A;  2WXN A;  2WXF A;  4DI3 A;  2VSN A;  3RZZ A;  3QAQ A;  4FLH A;  4U07 A;  4U0U A;  3T5X A;  1JFT A;  1E96 B;  1U3C A;  4NRH B;  4WUY A;  3R7R A;  3QAR A;  2GGF A;  4PS7 A;  4MLP A;  1RZS A;  4QFV A;  2IU7 A;  5G04 J;  4JXT A;  4IA8 A;  2H8R A;  1IQU A;  3SHF A;  3CVV A;  1ZZC A;  3SCG A;  3LPZ A;  3UT7 A;  4CEM A;  3QYX A;  1FCH A;  1Y9Q A;  3K9I A;  3MV3 B;  5AJD A;  3KEZ A;  2J08 A;  3LDZ A;  3GZ1 A;  4F8D A;  4N39 A;  3D1N I;  3MEK A;  3OTN A;  3FH8 A;  2RD0 A;  3EIQ C;  3T8M A;  3U4T A;  2BUG A;  3UUX A;  2J4D A;  4TV3 A;  3ZYK A;  4BX9 A;  2LO6 A;  4CGV A;  3AS4 A;  2L9B A;  2XRZ A;  3RRN B;  4H7Y A;  3FYM A;  2CHZ A;  3ML9 A;  4GU5 A;  2LYK A;  4Z5C A;  2XI8 A;  3PE3 A;  3VLF A;  3ZXS A;  4BSX A;  4ABN A;  5ENN A;  4F1S A;  4HOR A;  2CRO A;  3TXM A;  2NC9 A;  3U9W A;  2HSG A;  4GPK A;  4HOS A;  3FH5 A;  3ZEF A;  3OQN A;  3I5P A;  4UWL A;  5JHA A;  3PNT B;  1JPL A;  3VLE A;  3OP9 A;  2FUL A;  2IQC A;  3PDN A;  1X57 A;  4UWK A;  5FT9 A;  1R63 A;  3I3N A;  2ZU6 B;  1EF1 C;  2FJR A;  3UMV A;  4RVB A;  4WWO A;  4YG4 A;  1KLX A;  1XNF A;  4UI9 C;  2A5U A;  3I4G A;  4XX5 A;  2C0M A;  1LF8 A;  5C2Y A;  2Y4T A;  3D9I A;  4JL0 A;  2PUE A;  4O6F A;  1ZU2 A;  3LKU A;  1JWL A;  1OWL A;  2IVQ A;  2I6H A;  1LQC A;  3OXF A;  4GYW A;  4UQZ A;  2WXM A;  4CT4 A;  4GMJ A;  4WAF A;  4CGW A;  3JUI A;  3ONK A;  4I43 A;  3P2B A;  3F51 A;  5DIZ A;  5A7D B;  2I2O A;  3H5T A;  1OUV A;  2WXK A;  3Q47 B;  3RRM B;  1YSE A;  3CVN A;  3FYA A;  3P1U A;  3PRE A;  3CR3 A;  4ANW A;  3CVU A;  4I1A A;  4YAR A;  2LNI A;  1E8X A;  3FEX A;  4J0U A;  3CEC A;  3G7D A;  5HI7 A;  5T8I A;  3CST A;  1BDH A;  3PNL B;  4A55 A;  4NUR A;  3KJX A;  3CVP A;  4PDX A;  3SBT B;  1OWN A;  3LY7 A;  4KMO A;  2X3M A;  4U0Z A;  3JCK C;  1P5Q A;  1UN8 A;  4K0R A;  2WXG A;  2R1J L;  1QPZ A;  3ASD A;  3EHM A;  2DBA A;  4MKT A;  1BDI A;  4I2W A;  4IVZ A;  2PQN A;  3D9P A;  3LVR E;  3SI5 A;  4DK5 A;  4I6R A;  4A1S A;  3HVE B;  4EQF A;  3PXP A;  1MHQ A;  5E76 A;  4CT0 A;  1VPW A;  2MOW A;  3RRU A;  3APF A;  2IUO A;  4N5C A;  4B89 A;  1HG2 A;  3FUH A;  4MRU A;  2KCV A;  3MKQ A;  3UQ3 A;  2VTB A;  1SQM A;  1HG5 A;  1UXD A;  2OV8 A;  2HM8 A;  3PZD A;  3QWV A;  4GML A;  5BV0 A;  3FUK A;  5LP0 A;  3KD7 A;  2BNO A;  4X4G A;  2CHW A;  1ZS4 A;  1LLI A;  2AVP A;  3IBE A;  5HQ8 A;  4Y6W A;  1ZZ6 A;  4L1B A;  3G5G A;  2YIN A;  3O4Z A;  4KBQ A;  3I4R B;  2DCP A;  5BW8 C;  3JYS A;  4I1M A;  1PRV A;  3CHR A;  3HYM B;  4XI9 A;  1QQE A;  3BG1 B;  4UWG A;  3ZKC A;  4WND A;  4X4B A;  4G1T A;  4ME2 A;  4I9C A;  4X4E A;  3CLJ A;  2KZT A;  4F7A A;  3ESL A;  3OXL A;  3B7R L;  4OYS A;  3WXX A;  3FUN A;  4B8C B;  4JA9 A;  3LJ3 A;  4FHK A;  1ZZ8 A;  3LS8 A;  4GZ6 A;  4FN3 A;  2O4A A;  3LYA A;  4TRQ A;  5G05 J;  3QB2 A;  4GYY A;  4XKC A;  1PAQ A;  4F53 A;  4J8S A;  2KEI A;  3TG4 A;  3NF1 A;  4L23 A;  4A3V A;  3UFD A;  4EZL A;  1TEZ A;  2EBY A;  1NEQ A;  3GN5 B;  4Z5D A;  2VGX A;  3GYZ A;  4I9E A;  5AJL A;  1LMB 3;  1NZN A;  2JLB A;  3D9K A;  2IOL A;  2IU1 A;  4HVB A;  3MV2 B;  3QF3 A;  4GZD A;  3GZS A;  2X38 A;  3JXB C;  2FO7 A;  1UJK A;  3SGH A;  3B7S A;  2XEV A;  3GN5 A;  2XGM A;  3OAW A;  5ANL A;  5EDS A;  4CRW A;  4XI0 A;  2R5S A;  2MEZ A;  3G2V A;  1OCT C;  3LFP A;  1H2V C;  1X2L A;  1FVF A;  2GZU A;  2J07 A;  2WPV A;  2Y4U A;  3BDN A;  2Y3A A;  3MJW A;  4MCX A;  4G24 A;  3RIB A;  3CKB A;  1E8Y A;  4YVQ C;  4GA0 A;  2O49 A;  2UY1 B;  3CVW A;  4FJZ A;  4HXI A;  5A6C A;  3QJZ A;  4P29 A;  2LYL A;  1JH9 A;  2XCB A;  1ELK A;  4GZ3 A;  4AY5 A;  4KT6 B;  3TAX A;  3ZYQ A;  1PNR A;  5G2N A;  2XHE A;  2KPJ A;  5EKQ D;  5FQ7 A;  1U3D A;  2R17 C;  3UPV A;  1CJG A;  3O48 A;  3PEU B;  2PM7 A;  3CSF A;  2XPY A;  3RO3 A;  1N52 A;  3TXN A;  4B0Z A;  4N2S A;  2PQR A;  5BUZ A;  4GZC A;  2WQH A;  3G2U A;  3CHO A;  3O9X A;  4GZ5 A;  4APF A;  4GCN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...