2AWIA

Structure of prgx y153c mutant
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
300
structure length
298
Chain Sequence
FKIGSVLKQIRQELNYHQIDLYSGIMSKSVYIKVEADSRPISVEELSKFSERLGVNFFEILNRAGMNSVNETGKEKLLISKIFTNPDLFDKNFQRIEPKRLTSLQYFSIYLGYISIAHHYNIEVPTFNKTITSDLKHLYDKRTTFFGIDCEIVSNLLNVLPYEEVSSIIKPMYPIVDSFGKDYDLTIQTVLKNALTISIMNRNLKEAQYYINQFEHLKTIKNISINGYYDLEINYLKQIYQFLTDKNIDSYLNAVNIINIFKIIGKEDIHRSLVEELTKISAKEKFTPPKEVTMYYEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of peptide sex pheromone receptor PrgX and PrgX/pheromone complexes and regulation of conjugation in Enterococcus faecalis.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Transcription
molecule keywords PrgX
total genus 111
structure length 298
sequence length 300
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2005-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2awiA01
1.25.40.400 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2awiA02
5K98B 3MLFA 1LQCA 1CJGA 4I8TA 1AU7A 1QPZA 4PU7A 3GN5A 3JXDL 4GQMA 1LCDA 4JCYA 1SQ8A 1QQBA 2LYSA 2OR1L 4Z5CA 3CLCA 1CQTA 2XIUA 2ICTA 3L1PA 3RZZA 2IVGA 2LYPA 2R63A 1JFSA 1JWLA 3BS3A 1HF0A 1WH6A 1Y9QA 3JXBC 3UFDA 1QP7A 3CECA 1XWRA 3QWGA 2O49A 3GN5B 2BNMA 3QF3A 1BDHA 2AXUA 1WIZA 4X4IA 4JCXA 4IWRA 1B0NA 1RIOA 4GHJA 4Y42A 3FYMA 2HSGA 1WETA 3SCFA 2AWIA 3FYAA 4FBIA 1E3OC 1ZPQA 4X4CA 1PERL 2L49A 4MCXA 2MQKA 1R63A 3B7HA 1BDIA 4J1WA 1ZZ8A 2IV1A 1ZZ9A 2WIUB 1QP0A 2CSFA 4X4FA 2CROA 2BJCA 1RPEL 2LYRA 3EUSA 1VPWA 1RZRD 3VK0A 1R69A 2XCJA 4X4BA 1ZZ6A 2GRMA 2GRLA 1GT0C 1JH9A 1DWKA 3OMTA 2PUDA 1L1MA 2PUGA 3BD1A 3BDNA 3QQ6A 4NDWA 2KEKA 4O8BA 4X4DA 2BNOA 4OB4A 2D5VA 2A6CA 3ZKCA 4Z59A 2WUSR 4PU4C 4Z5DA 4PU3C 2PE5A 2XSDC 1ZZBA 1YSEA 1WH8A 2AXVA 2GZUA 1ZAYA 3F51A 3DNVB 4YARA 3CROL 2XJ3A 1ZVVA 3ZHMA 2FJRA 1O4XA 2B5AA 1DW9A 1UXDA 2AW6A 2PUAA 2EBYA 4J1XA 3OP9A 3LFPA 1RZSA 2BNNA 2KEJA 1PRAA 2KZ8A 4FN3A 2XI8A 4F8DA 1LCCA 1PRVA 2PPXA 2PUEA 3ZHIA 4YG7B 4YG1A 1UXCA 3IVPA 2HINA 2IUOA 1NEQA 3R1FA 4X4HA 3OQOA 2AUWA 3GBFA 1PNRA 2IVBA 2H8RA 3G7DA 2O4AA 3D1NI 1POUA 2KEIA 3LISA 1LLIA 3HZIB 2IVQA 2LCVA 1X2LA 4Z5HA 4X4EA 2LYQA 1IC8A 4IA8A 3G5GA 3S8QA 3O9XA 3JXCL 2LYLA 3QYXA 1NERA 4MCTA 2O38A 3F6WA 3U3WA 2PUBA 1ZZ7A 2JCGA 2JVLA 1QQAA 3KJXA 1X57A 3KXAA 1QP4A 4IVZA 1LMB3 2OFYA 1ZS4A 4YBAA 2MEZA 4I6UA 3OQMA 1OSLA 1ZUGA 4I6TA 2IU7A 2PUFA 3OQNA 1JFTA 2L8NA 3SCGA 1OCTC 3FMYA 4Z58A 1S7EA 3F52A 2PUCA 2ICPA 2R1JL 4YG4A 2EF8A 2LYKA 4I6RA 3H5TA 4PU8A 1RZRA 5A7LA 2PIJA 2LYJA 3KZ3A 4X4GA 1ADRA 3PXPA 1PRUA 1ZZCA 1Y7YA 4JQDA 3SCHA 1UTXA 2KPJA 3TRBA 1EFAA 2EWTA 2AXZA
chains in the Genus database with same CATH superfamily
5K98B 5EYPF 3TWSA 3QC1A 3DBSA 3KSLA 1HFAA 5DTRA 4JCYA 2OR1L 4CDMA 2ZIRA 2ICTA 4WWPA 4I1MA 4BFRA 4WNGA 4EZJA 3JXBC 2YNQA 2O49A 1GW6A 1UJJA 5BV1A 1X5BA 2WXIA 3ULQA 3CV0A 4GHJA 4MBGA 3GZDC 4BT8A 3ULEG 4GTRA 2DCPA 5GAHi 3E32A 1R63A 4JEHA 2A4ZA 5FQ7A 2MHKA 1QP0A 5FTPA 4AJWA 3ZW3A 3QJZA 4UI9J 3QOWA 3V31A 1WM5A 3QQ6A 2X3MA 2GRRB 4U7EB 3MKQB 3LEWA 2V5FA 1ELWA 4I43A 5FT9A 3RJVA 3HXEA 4GZ5A 3ZHMA 2FFHA 5HKPA 2OEVA 1UXDA 2AW6A 1A17A 4J1XA 5ITZF 1NP7A 3ABKE 3UIOC 1VDYA 2WXNA 1N0QA 3SD5A 3TG5A 1UXCA 3GBFA 3G7DA 2KATA 5CMYA 3GUUA 4GA1A 1X2LA 1BPOA 2M63A 5ARFA 3SFXA 1BI7B 3QOUA 2QC9A 2PXEA 4HOTA 1NERA 4JZYA 3URZA 5HQ8A 3HYMB 4RQIA 3OXLA 2XEHA 1H19A 4L2LA 4I6UA 2XENA 1P5QA 3AU4A 3D9JA 2IOSA 2WXQA 3FH7A 5FIOA 4PU8A 4DX2A 4EQFA 1YYHA 3AS4A 1Y7YA 4AM9A 5AQAA 1HH8A 1LQCA 5ENSD 1NA3A 2J08A 3G2TA 3TL5A 1TN8A 3E37A 4HLEA 2RKKA 1SQ8A 4B94A 5J90A 3ZEFA 1CQTA 3GZDA 1MFQC 1KLXA 3DXKG 5AENA 4WAFA 3SCFA 2P9UG 4DLOA 3AG1E 5DT2A 3HHMA 3JUIA 4UUCA 1ZZ8A 2PXVA 3RRNB 2F8XK 2LYRA 2LUHA 1OXJA 4CDRA 2DIWA 2PUGA 3FU6A 3S7BA 2CHZA 4N39A 2P9PG 1SA5A 1SVXA 5AIJA 3PZ1A 2KEJA 2PM6A 1V54E 2R05A 3UINC 3EIJA 2IUOA 2LXLA 4O6FA 3DSTA 4KVMA 3NB2A 3CQCB 4DE9A 3TJPA 2DWZA 3GZ2A 3B13A 2LYLA 2KZTA 3L82A 2P9KG 1TJFA 4GTOA 3TWXA 3Q9NC 3FUKA 2ILRA 1OY3D 1MX2A 3QFIA 3TGOA 1BU9A 1FCHA 2J4DA 4F6RD 2WXRA 4J0UA 1S7EA 2J49A 1KT1A 2MYOA 4I6RA 4GU5A 4J7WA 1ADRA 3CHOA 3MKRA 4C0EA 3MV2B 1UG3A 1O1SA 3MX3A 4RG6A 1FVFA 2IO2C 4Z5CA 5BPPA 3PRZA 2GROB 3ABME 4GTVA 4FHKA 3DEPA 2P9SG 2EIME 5CBOA 2XXAA 4X4CA 3PEVB 5CRUA 3LY8A 4JVSA 4YDEA 4ME2A 3TWQA 1RZRD 3QB2A 4F1SA 1GT0C 3SGHA 3LQXA 4AXHA 3SY2A 3X2QE 2X6JA 4LUNU 1Z3YA 1W3BA 2PXTA 5ENRD 1DVPA 3MEJA 3EHNA 5KNHD 2R59A 3SHFA 3BU8A 2V5QC 4K5CA 4NACA 3SQVA 3C98A 2LAHA 4GTTA 3DSUA 3ZHIA 3ZRHA 4YG7B 4YG1A 2ZISA 1LD8A 5B1AE 2O4AA 4AOFA 4HOQA 5CBNA 3LDZA 3G5GA 2VTBA 4XZ4A 4IRUA 3D9PA 3R9AB 2WXPA 3NOGD 2RG8A 2QZAA 2ZXWE 1OSLA 5JHAA 4I6TA 2PXQA 4GB9A 4KT6B 1WAO1 1EDUA 3JUEA 2PUCA 2ZU6B 1OWLA 3H5TA 3OAWA 3L08A 3E30A 5A7LA 4G8LA 3UM1A 4X4GA 3TWUA 1ZZCA 3BG0B 2UWJG 2VEOA 2XIUA 3JYSA 3GYZA 1HF0A 4HFGA 4DX5D 4L7TA 2HE0A 2BNMA 5BW8C 3LJ3A 4APFA 3LY7A 1QQEA 1FVHA 3PE5A 3F6QA 4GAAA 1KZPA 2VSOE 5IY5E 2P9NG 3ML9A 5DBKA 1E3OC 2I6HA 3UX4A 1ZU2A 1IHGA 3B7HA 4U0UA 2CSFA 2JEKA 5EIDA 4UQXA 3HG0D 2WB2A 3NOCD 1YA0A 4CZ2D 4GYYA 3FY4A 3S7JA 5EILA 3QAQA 2CFZA 4NDWA 4LCTA 2PE5A 3F51A 2IOLA 3CLJA 3Q15A 3OP9A 1OCOE 1N11A 3E33A 5LOZA 2LXMA 4H7YA 1PRVA 1K8KG 3C5RA 3R7RA 4N2QA 3NAWA 4DUIA 4DLQA 3GW4A 3EU9A 3EHQA 4JEUA 5KBAA 2F0YA 4GTMA 4BEPA 2L1PA 5ENTD 5ENOD 5A23A 2WM9A 1X57A 4UWHA 3DSSA 5CECB 3LPZA 4AP2A 2CFUA 5EYLA 1TNUA 3ZKJA 2WQHA 1MYOA 1SW6A 1DULA 3PZ2A 2VGEA 3SFYA 2Y4TA 1TNZA 2Y4UA 3I4GA 3VLDA 1Z6TA 4CEMA 4BSXA 3JXIA 1N94A 5AN8A 2CHXA 4LEUA 5G05C 4CDNA 1NA0A 3KL4A 3R09A 3VTXA 3FYMA 3ZYQA 2AWIA 3BG1B 3MZLB 3ME5A 5B1BE 3E34A 3PZ4A 2KM4A 3IV0A 2F8YA 2CROA 5FQ4A 3IEGA 4XIFA 5T4YA 3IBEA 4FULA 4G26A 2EQXA 2P58C 4FJZA 3D9LA 3CHSA 4X8QA 1FT1A 3ZHEB 2J09A 2FJRA 1TNOA 4D10C 4ZFHA 2NYJA 3RO2A 1NZNA 1NEQA 3AG3E 4HB5A 5G05J 5LCWJ 4PS7A 3G0TA 4U95D 3F6WA 3AG2E 1ZZ7A 3SR4A 1S63A 1BD8A 3FTUA 4HQDA 3TWTA 3LYAA 2WMNA 1EYHA 5C2YA 1JFTA 3JQ1A 3D3MA 4A1SA 3DM5A 4J8DA 1O1TA 3HXCA 4PS8A 2EF8A 1ELRA 1L5JA 3EHMA 5EX0A 2HM8A 3V2XA 1ZBPA 1HE8A 4HXIA 3Q4AB 1HF8A 2XPIA 4JQDA 2EINE 3UMVA 3V79K 2EIKE 3RRMB 2V0PA 3KEAA 3KSQA 3GN5A 1EPUA 3DRAA 3OXFA 3TELA 1E90A 5ENPD 1UOHA 4ER7A 3ENEA 4RSYA 3C3QA 4HI9A 3RSEG 5AQ9A 3CVQA 2VGXB 2H6HA 4CGWA 1YMPA 2OCCE 4Y42A 4U63A 3DPYA 2L9BA 4IN3B 1MZCA 4K03A 3CVVA 5FWQA 4G2VA 4GYWA 2MQKA 3BEEA 3UM3A 1ZZ9A 4GA2A 1O5MA 3ESLA 4BESA 5DTQA 4R7LA 4JB8P 4UQYA 3EHRA 4HI8A 2NXPA 4LNBA 2IF4A 3C3OA 2VJ8A 2L6BA 4XX5A 5T3RA 1H2TC 3CR3A 2PUAA 3U66A 2WXHA 3SNXA 3R1FA 3FU3A 4Y6WA 3ZXSA 1POUA 1RW2A 4BERA 4ANXA 3TEPA 3FULA 5CHEE 4C48B 4DE8A 3LJNA 4ABNA 3RAUA 3PEUB 1UW4B 1PC2A 3APFA 2V4HC 3ZN3A 2PUFA 1K1BA 1BLXB 5KCMA 3A9ZA 5CCMA 5G55A 3SX0A 3RU0A 3CSTA 1E8XA 2FBNA 2VQ2A 5FQ8A 3D9NA 1DC2A 2XGMA 3UT8A 3FTVA 3SCHA 1MX6A 5C1DA 2FF4A 1N52A 1E7VA 3UM0A 4TUMA 1WG0A 3VWSA 2R63A 3BS3A 1XWRA 1N95A 4YNDA 5LX8A 4A1GA 4IWRA 4WNDA 4BY6A 3PUJA 3G2WA 2HSGA 3CVYA 2FO1E 3CHRA 4KZCA 4EKIA 1IXVA 2J7UA 2LSVA 4EPZA 4MCXA 2IV1A 4FC8A 2KBXA 2X38A 1RPEL 1HU3A 1R69A 4A55A 4X4BA 1QBQA 1JH9A 2WXFA 4V3IA 4FA6A 2XXPA 3D9IA 3ML8A 4EKGA 4LNGA 4Q69A 3UPVA 3PREA 5KJNA 3TWRA 3SF4A 2HFZA 1ZZBA 2R02A 3AU5A 3DNVB 2XJ3A 4N3BA 2EBYA 2WQ7A 3FUJA 1KZOA 4G1TA 3SZ7A 3Q47B 4AY6A 3ZHEA 2OEWA 1N4RA 3UKUG 3ASHA 4CT0A 2J7WA 4X4HA 4B8AA 2IEJA 2QFCA 5HRYA 3ZIMA 1H2UA 2KEIA 5HS0A 2C2LA 3O9XA 3FTZA 3J5QB 4HRAA 4MCTA 1HX8A 3V30A 4O1OA 3QOXA 1OWNA 3KJXA 2XPYA 3HDXA 3RIBA 3TWVA 2KCKA 3FMYA 3U4TA 4AV7A 4C0MA 3M9LA 4YG4A 2LYKA 3UT4A 3OWQA 3ZPJA 5DIZA 3O48A 2XCBA 2J8SD 5G04C 3MV3B 5DRYA 1H2VC 3D9HA 3HVEB 1E8YA 4LG6A 3ZXPA 5BXUA 4N3AA 5AARA 5JJ6A 2KCVA 5LCWC 4OVUA 4ACLA 3GN5B 1QNFA 4KXKB 1HG2A 2AXUA 4JCXA 5DRTA 3R7QA 1RZ4A 4BETA 4U0SA 3G2VA 5JUWA 2FULA 3LVRE 5M72A 3ABLE 4I9CA 3DSWA 5AQ7A 3I3NA 4BX8A 1VPWA 3P1UA 2XCJA 2XZDG 2R5SA 3BDNA 3ONKA 4OYSA 1HG5A 3FWVA 5DTMA 4U04A 4N2SA 4U07A 2PNNA 3W9FA 2EIJE 2X6FA 4N5CA 2PZIA 3CK8A 1DW9A 1JWGA 3T5XA 2B0OE 2P2CP 2BNNA 2B6CA 1X81A 2KZ8A 4FN3A 1JWFA 2E2EA 5D0OD 2KCLA 4I1OB 2KC7A 4MKTA 5CERB 4N3CA 4QQIA 4IULA 3JXCL 4CT4A 1KPSB 3GZCA 2PUBA 4I2WA 3KXAA 5JJTA 4IVZA 2J4BA 2OVFA 3PE3A 3A9XA 4GA0A 4ZHBA 3MCXA 1D8EA 3BQOA 1TN6A 2QY7A 5FINA 4MLPA 4CGVA 5ARGA 2ICPA 3FUEA 2L0TB 1NL4A 3IHYA 1LD7A 5D66A 2KPJA 4F53A 1XGWA 3ZYKA 1CJGA 1AU7A 4PU7A 2X6KA 4JHJA 1QQBA 3QDNA 5AJLA 2Y1LE 1TNBA 4NURA 2LAIA 3UFDA 3VTYA 3CECA 3FEYA 1OWOA 3TXNA 1BDHA 2OOEA 2XPZA 2GW1A 4GPKA 4OAUC 2YQ8A 2L49A 4EZLA 2VTBB 2XGOA 2OVBA 3HXFA 2XZTG 4H7XA 4X4FA 1OCZE 1QZ2A 3V2OA 2GRMA 3Q5MA 2AJAA 3L22A 3BD1A 4JXTA 2I9CA 2LLVA 3GZSA 3EJNA 4AVXA 3TG4A 1TYQG 4ACKA 2XSDC 1WH8A 4FHJA 4YARA 4ILIA 4YDYA 4QFVA 5KNGA 5CCLA 4BT9A 3CHPA 3LFPA 1MJ0A 4Q94A 2DVWA 3FUFA 1HZ4A 2PUEA 1OWMA 2WXGA 4B0ZA 1IKND 2IU1A 2WXMA 2PXKA 4G23A 2AUWA 1PNRA 4UI9K 1HQ1A 1NI1A 2LYQA 4IA8A 1N4QA 5EKQD 4BTAA 1MHQA 3B95A 3G2UA 4EZKA 4ER5A 4N5QA 4EBAA 5KJLA 4HVBA 3OQMA 1JCSA 1ZUGA 3ONLA 3PNTB 4J8EA 2L8NA 2WXKA 2NC9A 2E0IA 3B7RL 2BKKB 3PUKA 2PQNA 4O1PA 4GMJA 5JJ7A 4ANVA 3IKOB 5CMWA 3NROA 3TRBA 3HRAA 1D8DA 2JQEA 4I9EA 4I8TA 4GMRA 4APOA 3QARA 2LYSA 3ZUVB 3IHVA 3EUVA 3TFLA 3CSFA 3RKVA 4DI3A 4PH4B 2J9QA 3QWPA 2PL2A 2CG3A 2X6IA 2HR2A 3CVXA 4UWLA 3EIQC 1DCQA 2UY1B 4BSZB 4PDXA 1A5EA 4I6GA 4LERA 3DEOA 4NIKA 2ZGGA 1L1MA 4CCAA 4A3VA 5ENNA 4FU3A 1OWPA 4PU3C 2ODRD 2AXVA 4GTQA 3S7FA 2NSZA 3CVWA 1U2VG 4Q96A 4L2YA 3SFZA 3LY9A 5CRVA 3O4ZA 4ER0A 3K9IA 5BXOA 3RO3A 2GGFA 2KZTB 1UN8A 3UI2A 3D1NI 1JUQA 5T8IA 4GZCA 2IVQA 3MGBA 3CQGB 3QYXA 5ANRA 2LO6A 3DPDA 5B3SE 4Z68A 3UT7A 2JVLA 5LFAA 1QQAA 1IYGA 2J07A 4UQZA 1S0PA 4FLHA 1LMB3 3NF1A 4F7AA 1ELKA 2VGXA 4B89A 5H7PA 4FADA 3FTWA 4AIFA 3DWLG 2R1JL 5AQBA 3UXGA 2XS1A 1RZRA 3SBSA 3KZ3A 3UIPC 4JW1A 2FEZA 3TWWA 1TEZA 3E4BA 1KT0A 4RG9A 2XHEA 2AXZA 3D9MA 4KVOA 2IY0C 3FUDA 1WY6A 3T9KA 3JXDL 3NQPA 3FHEA 4OVVA 4FP7A 4Q2JA 4HOUA 1LTXA 2VGYA 3MA5A 3D9OA 3PZDA 3S2AA 4W9RA 3W9GA 2A5UA 3D9KA 5D0QD 4HS2A 4YVQC 3Q73A 5EIBE 2IFUA 2WMOA 3KAEA 3PNLB 2LLWA 4KBQA 2WIUB 5LP0A 3WXXA 5CEAA 3ZGQA 4GZ6A 2XXQA 1DWKA 2H6FA 4JD2G 4G25A 4WWOA 2D5VA 2A6CA 4Z59A 3FTSA 4HRLA 3QKYA 4MRUA 1ZAYA 5JMND 4AY5A 4EK9A 2XGSA 1PRAA 4XKCA 4GMLA 4DPRA 2XI8A 2FI7A 1U3DA 1N4SA 4OBMA 4DX1A 4TRQA 4O60A 3T8MA 1H6PA 1IC8A 1QYMA 4JC8A 2WXJA 3FUIA 3UM2A 4L23A 3NZLA 1K1AA 5AJDA 3CK9A 2V8SE 4NQ0A 5CEDB 3SCGA 3ISMC 1IQRA 1N54A 2I1KA 3F52A 3ASOE 3CKCA 4I6JA 3LCAA 2XEVA 4DK5A 4FLBA 1UTXA 4WNEA 4DX6D 3OXGA 3HXBA 3LS8A 3CLCA 2H6IA 4U8HA 1K3ZD 1WH6A 5J08A 3ZPXA 4XEIG 1IHBA 3QF3A 2XRYA 3RK6A 2PXUA 4WNFA 3WG7E 3B7SA 1IQUA 4XI9A 4ER3A 4E6HA 4XKBA 3P2BA 2Y69E 3T5VA 4X4DA 1INZA 5GAGi 2WUSR 2P9IG 1PY1A 1DNPA 3C3RA 2WVIA 4TUUA 5BV0A 3KEZA 1NFIE 3SO8A 4I2ZA 3L16A 1Z5SC 2I1JA 1V55E 4M3OA 3OQOA 1H6KA 4GYOA 2IQCA 3LKUA 3HVEA 4G24A 2VYIA 4Z5HA 2PQRA 1OCCE 4JL0A 2R17C 3L54A 5E75A 2VSYA 3B7UX 1E8ZA 4HOSA 4YBAA 2I2OA 1HXIA 2YHEA 2IU7A 4GTPA 2X6HA 4JPSA 4DI4A 2PXFA 3R9MA 3QWWA 2BUGA 1N0RA 3Q75A 4M7CA 4KMOA 3PS6A 2PXLA 4HNAD 1D9SA 3Q79A 2LYJA 3SI5A 2XS8A 3CVPA 4KZ0A 1S64A 3ZFWA 3NZSA 1TNYA 2FO7A 2GRNB 2V3CC 5E76A 1XNFA 4L1BA 2AVPA 2Y3AA 3RZZA 2LYPA 3ASDA 3Q9UC 4LNUD 2VSXE 3LVQE 1HS6A 3CGHA 3FUMA 2L6JA 3B7TA 3PVLA 1RIOA 4K5BA 5FQ6A 3ZNGA 2XRZA 3BUAA 4UI9C 5EN5D 4J6IA 1BDIA 2MOWA 3APCA 2L0IA 4JA7A 4ATZD 2GRLA 3QWVA 3ASFA 3KD7A 3PE4A 2KEKA 4UWKA 1UN9A 2HO1A 3ZKCA 1Y6IA 3TXMA 4Z5DA 3UQ3A 3ZU7B 3ESKA 2R03A 4EQZA 1SZ9A 3ZYMA 4YVOA 3IXEA 1G3NB 5BNWA 1LCCA 2PPXA 3OKZA 3FTYA 4HRNA 2KXPC 3FH5A 4ANWA 3A9YA 2R2LA 3I4RB 1LLIA 4MS6A 3DSVA 4J8YA 2O38A 2XCCA 3FEXA 2JCGA 4TXRA 2OFYA 1E96B 3S7DA 3NDBB 2DYSE 2A5EA 3NXHA 4GZ3A 2RFAA 1SQMA 1PAQA 1JCRA 3N71A 5G2NA 2F37A 1OCTC 5FZQA 2C0LA 2EILE 2DBAA 1MX4A 1QPZA 1LCDA 4I6EA 1U3CA 3HIZA 4XI0A 4ANUA 3PDNA 4L9PA 3U9WA 4U96D 3FUNA 3FYAA 2PXBA 4KYOB 3DXMG 2MRIA 1UJKA 5ANLA 3CK7A 2BJCA 4PUCA 4P29A 2ZGDA 3G2SA 3JXJA 2M4HA 4O8BA 3Q7AA 5BUZA 1QB2A 3EDTB 4ILHB 4DRXE 2H6GA 2GRQB 2GZUA 1E8WA 2BF0X 2DZOA 2ETBA 4JHKA 5D2MC 3FU0A 3L9TA 3T8KA 1RZSA 4B8CB 2QYUA 3FTXA 4EECA 3C72A 3HXDA 3IVPA 4BWRA 4FJYA 2V4LA 1N9AA 4HORA 5A6CA 3SBTB 1JPLA 4NRHB 2YHCA 4UWFA 2HCNA 2Q7FA 4TV3A 2UY1A 4RVBA 1OUVA 2WPVA 2CG2A 5EX3A 1ZS4A 3JCKC 2DZNA 3CHQA 3FUHA 1SA4A 3Q49B 4J8SA 3B7BA 3L13A 3VLEA 3PH0C 2HCSA 2Y0BG 5KJKA 4IYPA 2YINA 3ASNE 4URKA 2DYRE 3PXPA 1PRUA 2PUDA 5A7DB 4HBDA 3MLFA 4E85A 1LF8A 4YDWA 1S70B 2VSNA 4UWGA 5AAOA 3L1PA 2IVGA 1JWLA 1JFSA 1Y9QA 1DCEA 2ONDA 4JHRA 3FDHA 1QP7A 2GRPB 3ZVVA 2IO3C 4LSZE 1FT2A 4A63B 5FJYA 4C9BB 1H6OA 4X4IA 1YCSB 4A3TA 2C0MA 2PXDA 1B0NA 5HI7A 3FFLA 5EDSA 1WETA 1ZPQA 3ASGA 1OT8A 4HRMB 4J1WA 1Z3XA 3MKQA 2P9LG 3VK0A 3AAAC 1U2ZA 1SZAA 4GCOA 2BNOA 4OB4A 2CHWA 4ILGA 1FPPA 3MEKA 4JA9A 4PU4C 5FZRA 3CVUA 4K0RA 1YSEA 3MYVA 3NZUA 3CROL 1ZVVA 1O4XA 1AWCB 2OV8A 3RRUA 3ULYA 2MXDA 2HYZA 3APDA 3PZ3A 3Q78A 3QK0A 4GCNA 1AP7A 3CVLA 2HINA 4DX7D 2IVBA 2PM7A 5BT1A 3CIAA 2JLBA 4G11A 3HZIB 4X4EA 4F3VA 1WDYA 2ETAA 1OCRE 4XE0A 3U3WA 4U8VD 4Y6CA 5JA4D 3NBNB 4K5AB 2WXOA 3L6AA 1Y8MA 4F1PA 4Z58A 4J8FA 4BX9A 3ZYLA 1N4PA 1JCQA 1MQSA 4TXPA 5KWDA 2WQ6A 2LNIA 1TR4A 2WXLA 1O1RA 2IJGX 3J5PA 2IONA 1EFAA 4RLYA 3AS5A 2LNMA 3AS8A 3FU5A 2RFMA 4GQMA 2ETCA 4OAVB 3JQ0A 1ZB1A 2BTDA 3AJIA 3QWGA 5ENQD 3L17A 3OTNA 3LXUX 1WIZA 3CKBA 4WUYA 4LRZA 1H0AA 4FBIA 2LSUA 4BTBA 1PERL 2RD0A 3U64A 3CVNA 3EUSA 4I1AA 1ZZ6A 5JHBA 3OMTA 3CEQA 5AYWD 3UUXA 1Q2ZA 2PXPA 5FZSA 4B93B 4EHMA 1B89A 4ATGA 3Q7FA 5DSXA 2B5AA 1EF1C 2XEEA 4G8KA 4AEZC 4F8DA 2YBDA 4EBAG 2BEDA 1TJCA 4DJAA 3UKRG 5G04J 2H8RA 4YDOA 1E7UA 3LISA 2LCVA 2JABA 4PS3A 4GTSA 3CHMA 4HLLA 3S8QA 3I5PA 4U0ZA 3FH8A 3DSXA 4U8YD 4CRWA 3QNKA 4WWNA 4EZIA 3GZ1A 1HO8A 4GPMA 1QP4A 3UWPA 3UTMA 4TXQA 1NW3A 1BI8B 3FP3A 2MEZA 3AG4E 3OQNA 3MJWA 3EU5A 2BKGA 3KS2A 1TN7A 4CYMD 3VLFA 2QYJA 1QZXA 3TAXA 2PIJA 4I17A 4WVLA 4ER6A 5KJMA 2EWTA 4GZDA 2XQ0A
chains in the Genus database with same CATH topology
5K98B 4KZ0A 2Y4UA 1XGWA 3ZFWA 3NZSA 3I4GA 2FO7A 3ZYKA 1CJGA 5E76A 1AU7A 3QC1A 1XNFA 3DBSA 4PU7A 1HFAA 4L1BA 4JCYA 2X6KA 2OR1L 1QQBA 1Z6TA 4JHJA 3VLDA 4CEMA 4CDMA 2AVPA 4BSXA 2Y3AA 2ICTA 3QDNA 4WWPA 5AJLA 3RZZA 4I1MA 2LYPA 4BFRA 3ASDA 4WNGA 4EZJA 4NURA 2CHXA 2LAIA 3JXBC 2YNQA 3UFDA 4LEUA 5G05C 3VTYA 3CECA 2O49A 1GW6A 1UJJA 1NA0A 1X5BA 3FEYA 5BV1A 1OWOA 2VSXE 3LVQE 1HS6A 3CGHA 3TXNA 1BDHA 2WXIA 3FUMA 2L6JA 3B7TA 3CV0A 2OOEA 3ULQA 3VTXA 3PVLA 1RIOA 2XPZA 4GHJA 2GW1A 3FYMA 3ZYQA 4GPKA 5FQ6A 2AWIA 3BG1B 2XRZA 3MZLB 4BT8A 2YQ8A 2L49A 4UI9C 4EZLA 2VTBB 4J6IA 2DCPA 2XGOA 1R63A 1BDIA 2A4ZA 4JEHA 5FQ7A 2MHKA 2MOWA 2OVBA 2KM4A 3IV0A 1QP0A 3APCA 4X4FA 4H7XA 2L0IA 2CROA 4JA7A 5FTPA 4AJWA 3ZW3A 3QJZA 5FQ4A 1QZ2A 3IEGA 4UI9J 2GRMA 2GRLA 3Q5MA 3QWVA 4XIFA 5T4YA 3L22A 1WM5A 3BD1A 3ASFA 3IBEA 3KD7A 3PE4A 3QQ6A 4FULA 2KEKA 2X3MA 4UWKA 4JXTA 1UN9A 2I9CA 3GZSA 3EJNA 4AVXA 4G26A 2HO1A 3MKQB 3LEWA 3ZKCA 2EQXA 1Y6IA 3TG4A 4Z5DA 2V5FA 2P58C 3TXMA 3UQ3A 1ELWA 4FJZA 2XSDC 3ESKA 4ACKA 3D9LA 4I43A 3CHSA 1WH8A 4FHJA 5FT9A 4YARA 4GZ5A 3RJVA 3ZHEB 4ILIA 4QFVA 5CCLA 3ZHMA 2FJRA 1SZ9A 4BT9A 1UXDA 2AW6A 1A17A 4YVOA 4J1XA 3CHPA 3ZYMA 3LFPA 1NP7A 4D10C 5BNWA 3RO2A 1VDYA 4Q94A 3FUFA 1LCCA 2WXNA 1HZ4A 2PPXA 3SD5A 2PUEA 1OWMA 2WXGA 3FTYA 4B0ZA 1NZNA 2IU1A 3TG5A 1UXCA 2WXMA 4L2LA 4G23A 1NEQA 3FH5A 4ANWA 2AUWA 3GBFA 1PNRA 3I4RB 4UI9K 3G7DA 2KATA 5CMYA 5G05J 1LLIA 5LCWJ 4PS7A 4GA1A 1X2LA 4MS6A 2LYQA 4IA8A 1BPOA 2M63A 5ARFA 3QOUA 4HOTA 5EKQD 1NERA 2O38A 3F6WA 4BTAA 1MHQA 2XCCA 4JZYA 3G2UA 3URZA 5HQ8A 3HYMB 1ZZ7A 3FEXA 2JCGA 4EZKA 3OXLA 3FTUA 1H19A 2OFYA 4EBAA 5KJLA 1E96B 3LYAA 2WMNA 4HVBA 4I6UA 3OQMA 1EYHA 1P5QA 1ZUGA 3ONLA 3PNTB 1JFTA 4J8EA 2L8NA 2WXKA 2NC9A 5C2YA 3AU4A 3D9JA 3JQ1A 2E0IA 3S7DA 3B7RL 2IOSA 3D3MA 4A1SA 4PS8A 2WXQA 4J8DA 2EF8A 1ELRA 1L5JA 3EHMA 3PUKA 2PQNA 3FH7A 5EX0A 4GZ3A 4PU8A 2HM8A 1ZBPA 1HE8A 4GMJA 4HXIA 3Q4AB 4EQFA 1SQMA 4ANVA 1PAQA 3IKOB 5JJ7A 1HF8A 2XPIA 1Y7YA 4JQDA 3AS4A 3N71A 5G2NA 3UMVA 4AM9A 5CMWA 1OCTC 3TRBA 5FZQA 2C0LA 1HH8A 4I9EA 1LQCA 4I8TA 2DBAA 3RRMB 1NA3A 2V0PA 2J08A 1QPZA 3G2TA 3TL5A 4HLEA 3GN5A 1EPUA 4APOA 1LCDA 3QARA 1SQ8A 2LYSA 4B94A 5J90A 3ZEFA 3OXFA 1CQTA 3IHVA 4I6EA 1U3CA 1E90A 3HIZA 4XI0A 1KLXA 4ANUA 3PDNA 3CSFA 3RKVA 4DI3A 4PH4B 3ENEA 4RSYA 2J9QA 3QWPA 2PL2A 2CG3A 5AENA 3U9WA 4WAFA 3CVQA 2VGXB 4CGWA 4Y42A 2X6IA 4U63A 3SCFA 3FUNA 3FYAA 2L9BA 4IN3B 2HR2A 4KYOB 4K03A 4DLOA 3CVXA 4UWLA 3CVVA 5FWQA 2MRIA 3EIQC 3HHMA 3JUIA 1UJKA 4G2VA 2MQKA 4GYWA 2UY1B 5ANLA 3BEEA 1ZZ8A 1ZZ9A 4GA2A 4PDXA 4I6GA 3RRNB 3CK7A 2BJCA 4LERA 2LYRA 3ESLA 4P29A 4PUCA 3G2SA 4CDRA 2DIWA 1L1MA 2PUGA 4CCAA 4A3VA 5ENNA 3FU6A 4O8BA 4FU3A 3S7BA 2CHZA 5BUZA 3EDTB 4R7LA 4UQYA 1OWPA 4PU3C 4ILHB 2NXPA 2IF4A 4N39A 2AXVA 2GZUA 1E8WA 2BF0X 3S7FA 2NSZA 4JHKA 2VJ8A 4XX5A 3CVWA 3FU0A 5T3RA 1H2TC 3CR3A 2PUAA 4Q96A 4L2YA 5AIJA 2KEJA 2PM6A 1RZSA 3LY9A 3SFZA 3U66A 2WXHA 4B8CB 3O4ZA 3EIJA 3FTXA 4EECA 3K9IA 3IVPA 4BWRA 3RO3A 2IUOA 2GGFA 3SNXA 3R1FA 3FU3A 2KZTB 2V4LA 4FJYA 4O6FA 4Y6WA 3ZXSA 4HORA 1UN8A 4KVMA 3D1NI 1JUQA 1POUA 3CQCB 4GZCA 5T8IA 4ANXA 5A6CA 3TJPA 2IVQA 3MGBA 3SBTB 3FULA 1JPLA 3GZ2A 4NRHB 2YHCA 5CHEE 3CQGB 4UWFA 3QYXA 2LYLA 2Q7FA 2KZTA 3B13A 4F53A 4ABNA 4TV3A 5ANRA 2UY1A 3PEUB 1TJFA 1UW4B 2LO6A 3DPDA 1PC2A 3UT7A 3APFA 3FUKA 2JVLA 1OUVA 4RVBA 1QQAA 5LFAA 1IYGA 2ILRA 2J07A 2WPVA 2CG2A 1S0PA 4FLHA 1LMB3 4UQZA 1ZS4A 3JCKC 5EX3A 3CHQA 3FUHA 3ZN3A 3NF1A 4F7AA 2PUFA 3TGOA 1ELKA 3Q49B 2VGXA 4J8SA 1FCHA 2J4DA 5KCMA 4B89A 2WXRA 3L13A 3FTWA 4FADA 4J0UA 1S7EA 2J49A 3PH0C 3VLEA 4AIFA 1KT1A 5CCMA 5KJKA 5G55A 4IYPA 2R1JL 2YINA 3RU0A 3CSTA 1E8XA 4I6RA 4URKA 2FBNA 2VQ2A 5FQ8A 3D9NA 1RZRA 4GU5A 3SBSA 2XGMA 3KZ3A 3UT8A 1ADRA 3PXPA 1PRUA 3CHOA 3FTVA 2FEZA 4JW1A 3SCHA 3E4BA 1KT0A 3MKRA 1TEZA 2PUDA 4RG9A 2XHEA 4C0EA 3MV2B 2AXZA 3D9MA 1UG3A 5A7DB 2FF4A 3MLFA 4KVOA 5C1DA 3FUDA 4E85A 1LF8A 1WY6A 1N52A 3MX3A 3JXDL 1E7VA 4RG6A 1FVFA 2VSNA 3NQPA 4UWGA 4Z5CA 5BPPA 3FHEA 4OVVA 3L1PA 4FP7A 4HOUA 2IVGA 2R63A 1JWLA 1JFSA 3BS3A 2VGYA 1Y9QA 2ONDA 3PRZA 4JHRA 3FDHA 1QP7A 3MA5A 3D9OA 1XWRA 3PZDA 3ZVVA 3S2AA 5FJYA 4C9BB 4YNDA 5LX8A 4A1GA 4FHKA 4W9RA 4X4IA 4IWRA 4A3TA 2A5UA 2C0MA 4WNDA 1B0NA 5HI7A 3PUJA 4BY6A 3D9KA 3FFLA 3G2WA 2HSGA 1WETA 5D0QD 5EDSA 3CHRA 4KZCA 3CVYA 4HS2A 4YVQC 1ZPQA 4X4CA 3PEVB 3ASGA 2LSVA 4EPZA 4MCXA 2IFUA 2WMOA 4J1WA 3KAEA 2IV1A 3PNLB 4FC8A 3LY8A 4JVSA 2WIUB 4KBQA 2X38A 5LP0A 1RPEL 1Z3XA 1HU3A 3MKQA 4ME2A 1RZRD 3VK0A 3QB2A 1R69A 3WXXA 3ZGQA 4X4BA 4GZ6A 4A55A 4F1SA 1GT0C 1JH9A 3SGHA 1DWKA 2WXFA 4V3IA 1SZAA 4G25A 4FA6A 4GCOA 4WWOA 4AXHA 3D9IA 3ML8A 2BNOA 4OB4A 2CHWA 4Q69A 3UPVA 2D5VA 2A6CA 2X6JA 4Z59A 4PU4C 3MEKA 3PREA 4ILGA 3FTSA 1Z3YA 4JA9A 4LUNU 5FZRA 3SF4A 5KJNA 1ZZBA 1W3BA 3CVUA 3QKYA 1YSEA 3AU5A 3MYVA 1ZAYA 4K0RA 4MRUA 3NZUA 1DVPA 3DNVB 3CROL 2XJ3A 3EHNA 4N3BA 1ZVVA 1O4XA 2R59A 4AY5A 3SHFA 4NACA 2OV8A 2EBYA 3C98A 3RRUA 2LAHA 2XGSA 2WQ7A 3FUJA 1PRAA 4XKCA 4GMLA 4DPRA 2XI8A 3SZ7A 4G1TA 3Q47B 4AY6A 3ZHEA 3ZHIA 3ZRHA 2HYZA 4YG7B 3ASHA 4YG1A 3APDA 3QK0A 4GCNA 4CT0A 3CVLA 2HINA 4X4HA 2FI7A 1U3DA 4B8AA 2IVBA 2QFCA 2PM7A 4TRQA 3ZIMA 2O4AA 3CIAA 5BT1A 1H2UA 4AOFA 2JLBA 4G11A 2KEIA 4HOQA 3HZIB 3T8MA 4X4EA 3LDZA 4F3VA 1IC8A 2C2LA 3G5GA 3O9XA 3FTZA 2VTBA 4MCTA 4JC8A 4XE0A 4XZ4A 3U3WA 1HX8A 2WXJA 3FUIA 3D9PA 4IRUA 4Y6CA 4L23A 1OWNA 3R9AB 2WXPA 5AJDA 3CK9A 3KJXA 2XPYA 2V8SE 3HDXA 4NQ0A 3RIBA 2RG8A 5JHAA 1OSLA 4I6TA 2WXOA 3L6AA 3SCGA 2KCKA 4GB9A 4KT6B 1Y8MA 3FMYA 4Z58A 1IQRA 3F52A 1EDUA 1N54A 2PUCA 1WAO1 2I1KA 4J8FA 3CKCA 3U4TA 4I6JA 2ZU6B 4AV7A 4C0MA 4BX9A 3ZYLA 3LCAA 4YG4A 2LYKA 3UT4A 1MQSA 1OWLA 3H5TA 3OAWA 3L08A 5DIZA 3ZPJA 5A7LA 3O48A 2XCBA 2XEVA 2WQ6A 4X4GA 2LNIA 4DK5A 1ZZCA 2WXLA 3MV3B 2IJGX 4FLBA 5G04C 1UTXA 4WNEA 2IONA 1H2VC 1EFAA 2XQ0A 3HVEB 1E8YA 3AS5A 3OXGA 3AS8A 3FU5A 3LS8A 3BG0B 4GQMA 2UWJG 4N3AA 3CLCA 2XIUA 3JYSA 4U8HA 5JJ6A 3GYZA 3JQ0A 2KCVA 1HF0A 4HFGA 1WH6A 5LCWC 5J08A 4L7TA 2BTDA 3QWGA 4OVUA 4ACLA 3GN5B 1QNFA 3L17A 4KXKB 2BNMA 3QF3A 5BW8C 1HG2A 2XRYA 3LJ3A 3LXUX 2AXUA 3LY7A 1WIZA 4JCXA 3CKBA 3OTNA 1QQEA 1FVHA 3RK6A 3R7QA 4GAAA 4WUYA 2VSOE 5DBKA 3ML9A 4LRZA 4U0SA 1H0AA 4FBIA 1E3OC 2LSUA 3G2VA 4BTBA 1PERL 2I6HA 2FULA 3LVRE 3UX4A 5M72A 4WNFA 1ZU2A 1IHGA 3B7SA 2RD0A 1IQUA 4XI9A 3B7HA 4I9CA 4U0UA 3U64A 4CDNA 3CVNA 3I3NA 2CSFA 2JEKA 4BX8A 1VPWA 4UQXA 3EUSA 2WB2A 4E6HA 3P1UA 1YA0A 2XCJA 4I1AA 4GYYA 1ZZ6A 3FY4A 2R5SA 4XKBA 3S7JA 3OMTA 3P2BA 5JHBA 3CEQA 3QAQA 3BDNA 2CFZA 3T5VA 3ONKA 4NDWA 4OYSA 5AYWD 3UUXA 1HG5A 3FWVA 4X4DA 4U04A 4APFA 1INZA 5FZSA 4LCTA 2WUSR 4N2SA 2PE5A 4U07A 1B89A 1PY1A 1DNPA 3F51A 4ATGA 2X6FA 2IOLA 2WVIA 4N5CA 4TUUA 2PZIA 3CK8A 3CLJA 3KEZA 5BV0A 2B5AA 1DW9A 1JWGA 3Q15A 1EF1C 3T5XA 3OP9A 2BNNA 4I2ZA 2KZ8A 4FN3A 5LOZA 4AEZC 4F8DA 4H7YA 1PRVA 3L16A 3R7RA 1JWFA 2I1JA 4M3OA 4EBAG 2E2EA 1TJCA 4DJAA 4N2QA 5G04J 3OQOA 1H6KA 4DLQA 2H8RA 5D0OD 2KCLA 4I1OB 2KC7A 4GYOA 3GW4A 4MKTA 4N3CA 2IQCA 3LKUA 1E7UA 3HVEA 3LISA 2VYIA 4G24A 4Z5HA 2LCVA 2PQRA 4PS3A 3CHMA 4IULA 4JL0A 3S8QA 4JEUA 2R17C 3JXCL 3I5PA 4CT4A 4U0ZA 3FH8A 2PUBA 4CRWA 3L54A 3QNKA 3GZ1A 4WWNA 1HO8A 2VSYA 5E75A 5A23A 3B7UX 2WM9A 1X57A 3KXAA 1QP4A 4IVZA 2J4BA 2OVFA 4I2WA 4UWHA 1E8ZA 5JJTA 3PE3A 4HOSA 4YBAA 2I2OA 3FP3A 2MEZA 1HXIA 3MCXA 4GA0A 2YHEA 2IU7A 3OQNA 2X6HA 2QY7A 3LPZA 4JPSA 4AP2A 3MJWA 4DI4A 2CFUA 3QWWA 4MLPA 2BUGA 4CGVA 5ARGA 2ICPA 3FUEA 3KS2A 4KMOA 2WQHA 3PS6A 2L0TB 3VLFA 3TAXA 2PIJA 2LYJA 3IHYA 3SI5A 4I17A 5KJMA 2KPJA 3CVPA 2Y4TA 2EWTA 4GZDA 2J09A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5K98 B;  3MLF A;  1LQC A;  1CJG A;  4I8T A;  1AU7 A;  1QPZ A;  4PU7 A;  3GN5 A;  3JXD L;  4GQM A;  1LCD A;  4JCY A;  1SQ8 A;  1QQB A;  2LYS A;  2OR1 L;  4Z5C A;  3CLC A;  1CQT A;  2XIU A;  2ICT A;  3L1P A;  3RZZ A;  2IVG A;  2LYP A;  2R63 A;  1JFS A;  1JWL A;  3BS3 A;  1HF0 A;  1WH6 A;  1Y9Q A;  3JXB C;  3UFD A;  1QP7 A;  3CEC A;  1XWR A;  3QWG A;  2O49 A;  3GN5 B;  2BNM A;  3QF3 A;  1BDH A;  2AXU A;  1WIZ A;  4X4I A;  4JCX A;  4IWR A;  1B0N A;  1RIO A;  4GHJ A;  4Y42 A;  3FYM A;  2HSG A;  1WET A;  3SCF A;  2AWI A;  3FYA A;  4FBI A;  1E3O C;  1ZPQ A;  4X4C A;  1PER L;  2L49 A;  4MCX A;  2MQK A;  1R63 A;  3B7H A;  1BDI A;  4J1W A;  1ZZ8 A;  2IV1 A;  1ZZ9 A;  2WIU B;  1QP0 A;  2CSF A;  4X4F A;  2CRO A;  2BJC A;  1RPE L;  2LYR A;  3EUS A;  1VPW A;  1RZR D;  3VK0 A;  1R69 A;  2XCJ A;  4X4B A;  1ZZ6 A;  2GRM A;  2GRL A;  1GT0 C;  1JH9 A;  1DWK A;  3OMT A;  2PUD A;  1L1M A;  2PUG A;  3BD1 A;  3BDN A;  3QQ6 A;  4NDW A;  2KEK A;  4O8B A;  4X4D A;  2BNO A;  4OB4 A;  2D5V A;  2A6C A;  3ZKC A;  4Z59 A;  2WUS R;  4PU4 C;  4Z5D A;  4PU3 C;  2PE5 A;  2XSD C;  1ZZB A;  1YSE A;  1WH8 A;  2AXV A;  2GZU A;  1ZAY A;  3F51 A;  3DNV B;  4YAR A;  3CRO L;  2XJ3 A;  1ZVV A;  3ZHM A;  2FJR A;  1O4X A;  2B5A A;  1DW9 A;  1UXD A;  2AW6 A;  2PUA A;  2EBY A;  4J1X A;  3OP9 A;  3LFP A;  1RZS A;  2BNN A;  2KEJ A;  1PRA A;  2KZ8 A;  4FN3 A;  2XI8 A;  4F8D A;  1LCC A;  1PRV A;  2PPX A;  2PUE A;  3ZHI A;  4YG7 B;  4YG1 A;  1UXC A;  3IVP A;  2HIN A;  2IUO A;  1NEQ A;  3R1F A;  4X4H A;  3OQO A;  2AUW A;  3GBF A;  1PNR A;  2IVB A;  2H8R A;  3G7D A;  2O4A A;  3D1N I;  1POU A;  2KEI A;  3LIS A;  1LLI A;  3HZI B;  2IVQ A;  2LCV A;  1X2L A;  4Z5H A;  4X4E A;  2LYQ A;  1IC8 A;  4IA8 A;  3G5G A;  3S8Q A;  3O9X A;  3JXC L;  2LYL A;  3QYX A;  1NER A;  4MCT A;  2O38 A;  3F6W A;  3U3W A;  2PUB A;  1ZZ7 A;  2JCG A;  2JVL A;  1QQA A;  3KJX A;  1X57 A;  3KXA A;  1QP4 A;  4IVZ A;  1LMB 3;  2OFY A;  1ZS4 A;  4YBA A;  2MEZ A;  4I6U A;  3OQM A;  1OSL A;  1ZUG A;  4I6T A;  2IU7 A;  2PUF A;  3OQN A;  1JFT A;  2L8N A;  3SCG A;  1OCT C;  3FMY A;  4Z58 A;  1S7E A;  3F52 A;  2PUC A;  2ICP A;  2R1J L;  4YG4 A;  2EF8 A;  2LYK A;  4I6R A;  3H5T A;  4PU8 A;  1RZR A;  5A7L A;  2PIJ A;  2LYJ A;  3KZ3 A;  4X4G A;  1ADR A;  3PXP A;  1PRU A;  1ZZC A;  1Y7Y A;  4JQD A;  3SCH A;  1UTX A;  2KPJ A;  3TRB A;  1EFA A;  2EWT A;  2AXZ A; 
#chains in the Genus database with same CATH topology
 5K98 B;  5EYP F;  3TWS A;  3QC1 A;  3DBS A;  3KSL A;  1HFA A;  5DTR A;  4JCY A;  2OR1 L;  4CDM A;  2ZIR A;  2ICT A;  4WWP A;  4I1M A;  4BFR A;  4WNG A;  4EZJ A;  3JXB C;  2YNQ A;  2O49 A;  1GW6 A;  1UJJ A;  5BV1 A;  1X5B A;  2WXI A;  3ULQ A;  3CV0 A;  4GHJ A;  4MBG A;  3GZD C;  4BT8 A;  3ULE G;  4GTR A;  2DCP A;  5GAH i;  3E32 A;  1R63 A;  4JEH A;  2A4Z A;  5FQ7 A;  2MHK A;  1QP0 A;  5FTP A;  4AJW A;  3ZW3 A;  3QJZ A;  4UI9 J;  3QOW A;  3V31 A;  1WM5 A;  3QQ6 A;  2X3M A;  2GRR B;  4U7E B;  3MKQ B;  3LEW A;  2V5F A;  1ELW A;  4I43 A;  5FT9 A;  3RJV A;  3HXE A;  4GZ5 A;  3ZHM A;  2FFH A;  5HKP A;  2OEV A;  1UXD A;  2AW6 A;  1A17 A;  4J1X A;  5ITZ F;  1NP7 A;  3ABK E;  3UIO C;  1VDY A;  2WXN A;  1N0Q A;  3SD5 A;  3TG5 A;  1UXC A;  3GBF A;  3G7D A;  2KAT A;  5CMY A;  3GUU A;  4GA1 A;  1X2L A;  1BPO A;  2M63 A;  5ARF A;  3SFX A;  1BI7 B;  3QOU A;  2QC9 A;  2PXE A;  4HOT A;  1NER A;  4JZY A;  3URZ A;  5HQ8 A;  3HYM B;  4RQI A;  3OXL A;  2XEH A;  1H19 A;  4L2L A;  4I6U A;  2XEN A;  1P5Q A;  3AU4 A;  3D9J A;  2IOS A;  2WXQ A;  3FH7 A;  5FIO A;  4PU8 A;  4DX2 A;  4EQF A;  1YYH A;  3AS4 A;  1Y7Y A;  4AM9 A;  5AQA A;  1HH8 A;  1LQC A;  5ENS D;  1NA3 A;  2J08 A;  3G2T A;  3TL5 A;  1TN8 A;  3E37 A;  4HLE A;  2RKK A;  1SQ8 A;  4B94 A;  5J90 A;  3ZEF A;  1CQT A;  3GZD A;  1MFQ C;  1KLX A;  3DXK G;  5AEN A;  4WAF A;  3SCF A;  2P9U G;  4DLO A;  3AG1 E;  5DT2 A;  3HHM A;  3JUI A;  4UUC A;  1ZZ8 A;  2PXV A;  3RRN B;  2F8X K;  2LYR A;  2LUH A;  1OXJ A;  4CDR A;  2DIW A;  2PUG A;  3FU6 A;  3S7B A;  2CHZ A;  4N39 A;  2P9P G;  1SA5 A;  1SVX A;  5AIJ A;  3PZ1 A;  2KEJ A;  2PM6 A;  1V54 E;  2R05 A;  3UIN C;  3EIJ A;  2IUO A;  2LXL A;  4O6F A;  3DST A;  4KVM A;  3NB2 A;  3CQC B;  4DE9 A;  3TJP A;  2DWZ A;  3GZ2 A;  3B13 A;  2LYL A;  2KZT A;  3L82 A;  2P9K G;  1TJF A;  4GTO A;  3TWX A;  3Q9N C;  3FUK A;  2ILR A;  1OY3 D;  1MX2 A;  3QFI A;  3TGO A;  1BU9 A;  1FCH A;  2J4D A;  4F6R D;  2WXR A;  4J0U A;  1S7E A;  2J49 A;  1KT1 A;  2MYO A;  4I6R A;  4GU5 A;  4J7W A;  1ADR A;  3CHO A;  3MKR A;  4C0E A;  3MV2 B;  1UG3 A;  1O1S A;  3MX3 A;  4RG6 A;  1FVF A;  2IO2 C;  4Z5C A;  5BPP A;  3PRZ A;  2GRO B;  3ABM E;  4GTV A;  4FHK A;  3DEP A;  2P9S G;  2EIM E;  5CBO A;  2XXA A;  4X4C A;  3PEV B;  5CRU A;  3LY8 A;  4JVS A;  4YDE A;  4ME2 A;  3TWQ A;  1RZR D;  3QB2 A;  4F1S A;  1GT0 C;  3SGH A;  3LQX A;  4AXH A;  3SY2 A;  3X2Q E;  2X6J A;  4LUN U;  1Z3Y A;  1W3B A;  2PXT A;  5ENR D;  1DVP A;  3MEJ A;  3EHN A;  5KNH D;  2R59 A;  3SHF A;  3BU8 A;  2V5Q C;  4K5C A;  4NAC A;  3SQV A;  3C98 A;  2LAH A;  4GTT A;  3DSU A;  3ZHI A;  3ZRH A;  4YG7 B;  4YG1 A;  2ZIS A;  1LD8 A;  5B1A E;  2O4A A;  4AOF A;  4HOQ A;  5CBN A;  3LDZ A;  3G5G A;  2VTB A;  4XZ4 A;  4IRU A;  3D9P A;  3R9A B;  2WXP A;  3NOG D;  2RG8 A;  2QZA A;  2ZXW E;  1OSL A;  5JHA A;  4I6T A;  2PXQ A;  4GB9 A;  4KT6 B;  1WAO 1;  1EDU A;  3JUE A;  2PUC A;  2ZU6 B;  1OWL A;  3H5T A;  3OAW A;  3L08 A;  3E30 A;  5A7L A;  4G8L A;  3UM1 A;  4X4G A;  3TWU A;  1ZZC A;  3BG0 B;  2UWJ G;  2VEO A;  2XIU A;  3JYS A;  3GYZ A;  1HF0 A;  4HFG A;  4DX5 D;  4L7T A;  2HE0 A;  2BNM A;  5BW8 C;  3LJ3 A;  4APF A;  3LY7 A;  1QQE A;  1FVH A;  3PE5 A;  3F6Q A;  4GAA A;  1KZP A;  2VSO E;  5IY5 E;  2P9N G;  3ML9 A;  5DBK A;  1E3O C;  2I6H A;  3UX4 A;  1ZU2 A;  1IHG A;  3B7H A;  4U0U A;  2CSF A;  2JEK A;  5EID A;  4UQX A;  3HG0 D;  2WB2 A;  3NOC D;  1YA0 A;  4CZ2 D;  4GYY A;  3FY4 A;  3S7J A;  5EIL A;  3QAQ A;  2CFZ A;  4NDW A;  4LCT A;  2PE5 A;  3F51 A;  2IOL A;  3CLJ A;  3Q15 A;  3OP9 A;  1OCO E;  1N11 A;  3E33 A;  5LOZ A;  2LXM A;  4H7Y A;  1PRV A;  1K8K G;  3C5R A;  3R7R A;  4N2Q A;  3NAW A;  4DUI A;  4DLQ A;  3GW4 A;  3EU9 A;  3EHQ A;  4JEU A;  5KBA A;  2F0Y A;  4GTM A;  4BEP A;  2L1P A;  5ENT D;  5ENO D;  5A23 A;  2WM9 A;  1X57 A;  4UWH A;  3DSS A;  5CEC B;  3LPZ A;  4AP2 A;  2CFU A;  5EYL A;  1TNU A;  3ZKJ A;  2WQH A;  1MYO A;  1SW6 A;  1DUL A;  3PZ2 A;  2VGE A;  3SFY A;  2Y4T A;  1TNZ A;  2Y4U A;  3I4G A;  3VLD A;  1Z6T A;  4CEM A;  4BSX A;  3JXI A;  1N94 A;  5AN8 A;  2CHX A;  4LEU A;  5G05 C;  4CDN A;  1NA0 A;  3KL4 A;  3R09 A;  3VTX A;  3FYM A;  3ZYQ A;  2AWI A;  3BG1 B;  3MZL B;  3ME5 A;  5B1B E;  3E34 A;  3PZ4 A;  2KM4 A;  3IV0 A;  2F8Y A;  2CRO A;  5FQ4 A;  3IEG A;  4XIF A;  5T4Y A;  3IBE A;  4FUL A;  4G26 A;  2EQX A;  2P58 C;  4FJZ A;  3D9L A;  3CHS A;  4X8Q A;  1FT1 A;  3ZHE B;  2J09 A;  2FJR A;  1TNO A;  4D10 C;  4ZFH A;  2NYJ A;  3RO2 A;  1NZN A;  1NEQ A;  3AG3 E;  4HB5 A;  5G05 J;  5LCW J;  4PS7 A;  3G0T A;  4U95 D;  3F6W A;  3AG2 E;  1ZZ7 A;  3SR4 A;  1S63 A;  1BD8 A;  3FTU A;  4HQD A;  3TWT A;  3LYA A;  2WMN A;  1EYH A;  5C2Y A;  1JFT A;  3JQ1 A;  3D3M A;  4A1S A;  3DM5 A;  4J8D A;  1O1T A;  3HXC A;  4PS8 A;  2EF8 A;  1ELR A;  1L5J A;  3EHM A;  5EX0 A;  2HM8 A;  3V2X A;  1ZBP A;  1HE8 A;  4HXI A;  3Q4A B;  1HF8 A;  2XPI A;  4JQD A;  2EIN E;  3UMV A;  3V79 K;  2EIK E;  3RRM B;  2V0P A;  3KEA A;  3KSQ A;  3GN5 A;  1EPU A;  3DRA A;  3OXF A;  3TEL A;  1E90 A;  5ENP D;  1UOH A;  4ER7 A;  3ENE A;  4RSY A;  3C3Q A;  4HI9 A;  3RSE G;  5AQ9 A;  3CVQ A;  2VGX B;  2H6H A;  4CGW A;  1YMP A;  2OCC E;  4Y42 A;  4U63 A;  3DPY A;  2L9B A;  4IN3 B;  1MZC A;  4K03 A;  3CVV A;  5FWQ A;  4G2V A;  4GYW A;  2MQK A;  3BEE A;  3UM3 A;  1ZZ9 A;  4GA2 A;  1O5M A;  3ESL A;  4BES A;  5DTQ A;  4R7L A;  4JB8 P;  4UQY A;  3EHR A;  4HI8 A;  2NXP A;  4LNB A;  2IF4 A;  3C3O A;  2VJ8 A;  2L6B A;  4XX5 A;  5T3R A;  1H2T C;  3CR3 A;  2PUA A;  3U66 A;  2WXH A;  3SNX A;  3R1F A;  3FU3 A;  4Y6W A;  3ZXS A;  1POU A;  1RW2 A;  4BER A;  4ANX A;  3TEP A;  3FUL A;  5CHE E;  4C48 B;  4DE8 A;  3LJN A;  4ABN A;  3RAU A;  3PEU B;  1UW4 B;  1PC2 A;  3APF A;  2V4H C;  3ZN3 A;  2PUF A;  1K1B A;  1BLX B;  5KCM A;  3A9Z A;  5CCM A;  5G55 A;  3SX0 A;  3RU0 A;  3CST A;  1E8X A;  2FBN A;  2VQ2 A;  5FQ8 A;  3D9N A;  1DC2 A;  2XGM A;  3UT8 A;  3FTV A;  3SCH A;  1MX6 A;  5C1D A;  2FF4 A;  1N52 A;  1E7V A;  3UM0 A;  4TUM A;  1WG0 A;  3VWS A;  2R63 A;  3BS3 A;  1XWR A;  1N95 A;  4YND A;  5LX8 A;  4A1G A;  4IWR A;  4WND A;  4BY6 A;  3PUJ A;  3G2W A;  2HSG A;  3CVY A;  2FO1 E;  3CHR A;  4KZC A;  4EKI A;  1IXV A;  2J7U A;  2LSV A;  4EPZ A;  4MCX A;  2IV1 A;  4FC8 A;  2KBX A;  2X38 A;  1RPE L;  1HU3 A;  1R69 A;  4A55 A;  4X4B A;  1QBQ A;  1JH9 A;  2WXF A;  4V3I A;  4FA6 A;  2XXP A;  3D9I A;  3ML8 A;  4EKG A;  4LNG A;  4Q69 A;  3UPV A;  3PRE A;  5KJN A;  3TWR A;  3SF4 A;  2HFZ A;  1ZZB A;  2R02 A;  3AU5 A;  3DNV B;  2XJ3 A;  4N3B A;  2EBY A;  2WQ7 A;  3FUJ A;  1KZO A;  4G1T A;  3SZ7 A;  3Q47 B;  4AY6 A;  3ZHE A;  2OEW A;  1N4R A;  3UKU G;  3ASH A;  4CT0 A;  2J7W A;  4X4H A;  4B8A A;  2IEJ A;  2QFC A;  5HRY A;  3ZIM A;  1H2U A;  2KEI A;  5HS0 A;  2C2L A;  3O9X A;  3FTZ A;  3J5Q B;  4HRA A;  4MCT A;  1HX8 A;  3V30 A;  4O1O A;  3QOX A;  1OWN A;  3KJX A;  2XPY A;  3HDX A;  3RIB A;  3TWV A;  2KCK A;  3FMY A;  3U4T A;  4AV7 A;  4C0M A;  3M9L A;  4YG4 A;  2LYK A;  3UT4 A;  3OWQ A;  3ZPJ A;  5DIZ A;  3O48 A;  2XCB A;  2J8S D;  5G04 C;  3MV3 B;  5DRY A;  1H2V C;  3D9H A;  3HVE B;  1E8Y A;  4LG6 A;  3ZXP A;  5BXU A;  4N3A A;  5AAR A;  5JJ6 A;  2KCV A;  5LCW C;  4OVU A;  4ACL A;  3GN5 B;  1QNF A;  4KXK B;  1HG2 A;  2AXU A;  4JCX A;  5DRT A;  3R7Q A;  1RZ4 A;  4BET A;  4U0S A;  3G2V A;  5JUW A;  2FUL A;  3LVR E;  5M72 A;  3ABL E;  4I9C A;  3DSW A;  5AQ7 A;  3I3N A;  4BX8 A;  1VPW A;  3P1U A;  2XCJ A;  2XZD G;  2R5S A;  3BDN A;  3ONK A;  4OYS A;  1HG5 A;  3FWV A;  5DTM A;  4U04 A;  4N2S A;  4U07 A;  2PNN A;  3W9F A;  2EIJ E;  2X6F A;  4N5C A;  2PZI A;  3CK8 A;  1DW9 A;  1JWG A;  3T5X A;  2B0O E;  2P2C P;  2BNN A;  2B6C A;  1X81 A;  2KZ8 A;  4FN3 A;  1JWF A;  2E2E A;  5D0O D;  2KCL A;  4I1O B;  2KC7 A;  4MKT A;  5CER B;  4N3C A;  4QQI A;  4IUL A;  3JXC L;  4CT4 A;  1KPS B;  3GZC A;  2PUB A;  4I2W A;  3KXA A;  5JJT A;  4IVZ A;  2J4B A;  2OVF A;  3PE3 A;  3A9X A;  4GA0 A;  4ZHB A;  3MCX A;  1D8E A;  3BQO A;  1TN6 A;  2QY7 A;  5FIN A;  4MLP A;  4CGV A;  5ARG A;  2ICP A;  3FUE A;  2L0T B;  1NL4 A;  3IHY A;  1LD7 A;  5D66 A;  2KPJ A;  4F53 A;  1XGW A;  3ZYK A;  1CJG A;  1AU7 A;  4PU7 A;  2X6K A;  4JHJ A;  1QQB A;  3QDN A;  5AJL A;  2Y1L E;  1TNB A;  4NUR A;  2LAI A;  3UFD A;  3VTY A;  3CEC A;  3FEY A;  1OWO A;  3TXN A;  1BDH A;  2OOE A;  2XPZ A;  2GW1 A;  4GPK A;  4OAU C;  2YQ8 A;  2L49 A;  4EZL A;  2VTB B;  2XGO A;  2OVB A;  3HXF A;  2XZT G;  4H7X A;  4X4F A;  1OCZ E;  1QZ2 A;  3V2O A;  2GRM A;  3Q5M A;  2AJA A;  3L22 A;  3BD1 A;  4JXT A;  2I9C A;  2LLV A;  3GZS A;  3EJN A;  4AVX A;  3TG4 A;  1TYQ G;  4ACK A;  2XSD C;  1WH8 A;  4FHJ A;  4YAR A;  4ILI A;  4YDY A;  4QFV A;  5KNG A;  5CCL A;  4BT9 A;  3CHP A;  3LFP A;  1MJ0 A;  4Q94 A;  2DVW A;  3FUF A;  1HZ4 A;  2PUE A;  1OWM A;  2WXG A;  4B0Z A;  1IKN D;  2IU1 A;  2WXM A;  2PXK A;  4G23 A;  2AUW A;  1PNR A;  4UI9 K;  1HQ1 A;  1NI1 A;  2LYQ A;  4IA8 A;  1N4Q A;  5EKQ D;  4BTA A;  1MHQ A;  3B95 A;  3G2U A;  4EZK A;  4ER5 A;  4N5Q A;  4EBA A;  5KJL A;  4HVB A;  3OQM A;  1JCS A;  1ZUG A;  3ONL A;  3PNT B;  4J8E A;  2L8N A;  2WXK A;  2NC9 A;  2E0I A;  3B7R L;  2BKK B;  3PUK A;  2PQN A;  4O1P A;  4GMJ A;  5JJ7 A;  4ANV A;  3IKO B;  5CMW A;  3NRO A;  3TRB A;  3HRA A;  1D8D A;  2JQE A;  4I9E A;  4I8T A;  4GMR A;  4APO A;  3QAR A;  2LYS A;  3ZUV B;  3IHV A;  3EUV A;  3TFL A;  3CSF A;  3RKV A;  4DI3 A;  4PH4 B;  2J9Q A;  3QWP A;  2PL2 A;  2CG3 A;  2X6I A;  2HR2 A;  3CVX A;  4UWL A;  3EIQ C;  1DCQ A;  2UY1 B;  4BSZ B;  4PDX A;  1A5E A;  4I6G A;  4LER A;  3DEO A;  4NIK A;  2ZGG A;  1L1M A;  4CCA A;  4A3V A;  5ENN A;  4FU3 A;  1OWP A;  4PU3 C;  2ODR D;  2AXV A;  4GTQ A;  3S7F A;  2NSZ A;  3CVW A;  1U2V G;  4Q96 A;  4L2Y A;  3SFZ A;  3LY9 A;  5CRV A;  3O4Z A;  4ER0 A;  3K9I A;  5BXO A;  3RO3 A;  2GGF A;  2KZT B;  1UN8 A;  3UI2 A;  3D1N I;  1JUQ A;  5T8I A;  4GZC A;  2IVQ A;  3MGB A;  3CQG B;  3QYX A;  5ANR A;  2LO6 A;  3DPD A;  5B3S E;  4Z68 A;  3UT7 A;  2JVL A;  5LFA A;  1QQA A;  1IYG A;  2J07 A;  4UQZ A;  1S0P A;  4FLH A;  1LMB 3;  3NF1 A;  4F7A A;  1ELK A;  2VGX A;  4B89 A;  5H7P A;  4FAD A;  3FTW A;  4AIF A;  3DWL G;  2R1J L;  5AQB A;  3UXG A;  2XS1 A;  1RZR A;  3SBS A;  3KZ3 A;  3UIP C;  4JW1 A;  2FEZ A;  3TWW A;  1TEZ A;  3E4B A;  1KT0 A;  4RG9 A;  2XHE A;  2AXZ A;  3D9M A;  4KVO A;  2IY0 C;  3FUD A;  1WY6 A;  3T9K A;  3JXD L;  3NQP A;  3FHE A;  4OVV A;  4FP7 A;  4Q2J A;  4HOU A;  1LTX A;  2VGY A;  3MA5 A;  3D9O A;  3PZD A;  3S2A A;  4W9R A;  3W9G A;  2A5U A;  3D9K A;  5D0Q D;  4HS2 A;  4YVQ C;  3Q73 A;  5EIB E;  2IFU A;  2WMO A;  3KAE A;  3PNL B;  2LLW A;  4KBQ A;  2WIU B;  5LP0 A;  3WXX A;  5CEA A;  3ZGQ A;  4GZ6 A;  2XXQ A;  1DWK A;  2H6F A;  4JD2 G;  4G25 A;  4WWO A;  2D5V A;  2A6C A;  4Z59 A;  3FTS A;  4HRL A;  3QKY A;  4MRU A;  1ZAY A;  5JMN D;  4AY5 A;  4EK9 A;  2XGS A;  1PRA A;  4XKC A;  4GML A;  4DPR A;  2XI8 A;  2FI7 A;  1U3D A;  1N4S A;  4OBM A;  4DX1 A;  4TRQ A;  4O60 A;  3T8M A;  1H6P A;  1IC8 A;  1QYM A;  4JC8 A;  2WXJ A;  3FUI A;  3UM2 A;  4L23 A;  3NZL A;  1K1A A;  5AJD A;  3CK9 A;  2V8S E;  4NQ0 A;  5CED B;  3SCG A;  3ISM C;  1IQR A;  1N54 A;  2I1K A;  3F52 A;  3ASO E;  3CKC A;  4I6J A;  3LCA A;  2XEV A;  4DK5 A;  4FLB A;  1UTX A;  4WNE A;  4DX6 D;  3OXG A;  3HXB A;  3LS8 A;  3CLC A;  2H6I A;  4U8H A;  1K3Z D;  1WH6 A;  5J08 A;  3ZPX A;  4XEI G;  1IHB A;  3QF3 A;  2XRY A;  3RK6 A;  2PXU A;  4WNF A;  3WG7 E;  3B7S A;  1IQU A;  4XI9 A;  4ER3 A;  4E6H A;  4XKB A;  3P2B A;  2Y69 E;  3T5V A;  4X4D A;  1INZ A;  5GAG i;  2WUS R;  2P9I G;  1PY1 A;  1DNP A;  3C3R A;  2WVI A;  4TUU A;  5BV0 A;  3KEZ A;  1NFI E;  3SO8 A;  4I2Z A;  3L16 A;  1Z5S C;  2I1J A;  1V55 E;  4M3O A;  3OQO A;  1H6K A;  4GYO A;  2IQC A;  3LKU A;  3HVE A;  4G24 A;  2VYI A;  4Z5H A;  2PQR A;  1OCC E;  4JL0 A;  2R17 C;  3L54 A;  5E75 A;  2VSY A;  3B7U X;  1E8Z A;  4HOS A;  4YBA A;  2I2O A;  1HXI A;  2YHE A;  2IU7 A;  4GTP A;  2X6H A;  4JPS A;  4DI4 A;  2PXF A;  3R9M A;  3QWW A;  2BUG A;  1N0R A;  3Q75 A;  4M7C A;  4KMO A;  3PS6 A;  2PXL A;  4HNA D;  1D9S A;  3Q79 A;  2LYJ A;  3SI5 A;  2XS8 A;  3CVP A;  4KZ0 A;  1S64 A;  3ZFW A;  3NZS A;  1TNY A;  2FO7 A;  2GRN B;  2V3C C;  5E76 A;  1XNF A;  4L1B A;  2AVP A;  2Y3A A;  3RZZ A;  2LYP A;  3ASD A;  3Q9U C;  4LNU D;  2VSX E;  3LVQ E;  1HS6 A;  3CGH A;  3FUM A;  2L6J A;  3B7T A;  3PVL A;  1RIO A;  4K5B A;  5FQ6 A;  3ZNG A;  2XRZ A;  3BUA A;  4UI9 C;  5EN5 D;  4J6I A;  1BDI A;  2MOW A;  3APC A;  2L0I A;  4JA7 A;  4ATZ D;  2GRL A;  3QWV A;  3ASF A;  3KD7 A;  3PE4 A;  2KEK A;  4UWK A;  1UN9 A;  2HO1 A;  3ZKC A;  1Y6I A;  3TXM A;  4Z5D A;  3UQ3 A;  3ZU7 B;  3ESK A;  2R03 A;  4EQZ A;  1SZ9 A;  3ZYM A;  4YVO A;  3IXE A;  1G3N B;  5BNW A;  1LCC A;  2PPX A;  3OKZ A;  3FTY A;  4HRN A;  2KXP C;  3FH5 A;  4ANW A;  3A9Y A;  2R2L A;  3I4R B;  1LLI A;  4MS6 A;  3DSV A;  4J8Y A;  2O38 A;  2XCC A;  3FEX A;  2JCG A;  4TXR A;  2OFY A;  1E96 B;  3S7D A;  3NDB B;  2DYS E;  2A5E A;  3NXH A;  4GZ3 A;  2RFA A;  1SQM A;  1PAQ A;  1JCR A;  3N71 A;  5G2N A;  2F37 A;  1OCT C;  5FZQ A;  2C0L A;  2EIL E;  2DBA A;  1MX4 A;  1QPZ A;  1LCD A;  4I6E A;  1U3C A;  3HIZ A;  4XI0 A;  4ANU A;  3PDN A;  4L9P A;  3U9W A;  4U96 D;  3FUN A;  3FYA A;  2PXB A;  4KYO B;  3DXM G;  2MRI A;  1UJK A;  5ANL A;  3CK7 A;  2BJC A;  4PUC A;  4P29 A;  2ZGD A;  3G2S A;  3JXJ A;  2M4H A;  4O8B A;  3Q7A A;  5BUZ A;  1QB2 A;  3EDT B;  4ILH B;  4DRX E;  2H6G A;  2GRQ B;  2GZU A;  1E8W A;  2BF0 X;  2DZO A;  2ETB A;  4JHK A;  5D2M C;  3FU0 A;  3L9T A;  3T8K A;  1RZS A;  4B8C B;  2QYU A;  3FTX A;  4EEC A;  3C72 A;  3HXD A;  3IVP A;  4BWR A;  4FJY A;  2V4L A;  1N9A A;  4HOR A;  5A6C A;  3SBT B;  1JPL A;  4NRH B;  2YHC A;  4UWF A;  2HCN A;  2Q7F A;  4TV3 A;  2UY1 A;  4RVB A;  1OUV A;  2WPV A;  2CG2 A;  5EX3 A;  1ZS4 A;  3JCK C;  2DZN A;  3CHQ A;  3FUH A;  1SA4 A;  3Q49 B;  4J8S A;  3B7B A;  3L13 A;  3VLE A;  3PH0 C;  2HCS A;  2Y0B G;  5KJK A;  4IYP A;  2YIN A;  3ASN E;  4URK A;  2DYR E;  3PXP A;  1PRU A;  2PUD A;  5A7D B;  4HBD A;  3MLF A;  4E85 A;  1LF8 A;  4YDW A;  1S70 B;  2VSN A;  4UWG A;  5AAO A;  3L1P A;  2IVG A;  1JWL A;  1JFS A;  1Y9Q A;  1DCE A;  2OND A;  4JHR A;  3FDH A;  1QP7 A;  2GRP B;  3ZVV A;  2IO3 C;  4LSZ E;  1FT2 A;  4A63 B;  5FJY A;  4C9B B;  1H6O A;  4X4I A;  1YCS B;  4A3T A;  2C0M A;  2PXD A;  1B0N A;  5HI7 A;  3FFL A;  5EDS A;  1WET A;  1ZPQ A;  3ASG A;  1OT8 A;  4HRM B;  4J1W A;  1Z3X A;  3MKQ A;  2P9L G;  3VK0 A;  3AAA C;  1U2Z A;  1SZA A;  4GCO A;  2BNO A;  4OB4 A;  2CHW A;  4ILG A;  1FPP A;  3MEK A;  4JA9 A;  4PU4 C;  5FZR A;  3CVU A;  4K0R A;  1YSE A;  3MYV A;  3NZU A;  3CRO L;  1ZVV A;  1O4X A;  1AWC B;  2OV8 A;  3RRU A;  3ULY A;  2MXD A;  2HYZ A;  3APD A;  3PZ3 A;  3Q78 A;  3QK0 A;  4GCN A;  1AP7 A;  3CVL A;  2HIN A;  4DX7 D;  2IVB A;  2PM7 A;  5BT1 A;  3CIA A;  2JLB A;  4G11 A;  3HZI B;  4X4E A;  4F3V A;  1WDY A;  2ETA A;  1OCR E;  4XE0 A;  3U3W A;  4U8V D;  4Y6C A;  5JA4 D;  3NBN B;  4K5A B;  2WXO A;  3L6A A;  1Y8M A;  4F1P A;  4Z58 A;  4J8F A;  4BX9 A;  3ZYL A;  1N4P A;  1JCQ A;  1MQS A;  4TXP A;  5KWD A;  2WQ6 A;  2LNI A;  1TR4 A;  2WXL A;  1O1R A;  2IJG X;  3J5P A;  2ION A;  1EFA A;  4RLY A;  3AS5 A;  2LNM A;  3AS8 A;  3FU5 A;  2RFM A;  4GQM A;  2ETC A;  4OAV B;  3JQ0 A;  1ZB1 A;  2BTD A;  3AJI A;  3QWG A;  5ENQ D;  3L17 A;  3OTN A;  3LXU X;  1WIZ A;  3CKB A;  4WUY A;  4LRZ A;  1H0A A;  4FBI A;  2LSU A;  4BTB A;  1PER L;  2RD0 A;  3U64 A;  3CVN A;  3EUS A;  4I1A A;  1ZZ6 A;  5JHB A;  3OMT A;  3CEQ A;  5AYW D;  3UUX A;  1Q2Z A;  2PXP A;  5FZS A;  4B93 B;  4EHM A;  1B89 A;  4ATG A;  3Q7F A;  5DSX A;  2B5A A;  1EF1 C;  2XEE A;  4G8K A;  4AEZ C;  4F8D A;  2YBD A;  4EBA G;  2BED A;  1TJC A;  4DJA A;  3UKR G;  5G04 J;  2H8R A;  4YDO A;  1E7U A;  3LIS A;  2LCV A;  2JAB A;  4PS3 A;  4GTS A;  3CHM A;  4HLL A;  3S8Q A;  3I5P A;  4U0Z A;  3FH8 A;  3DSX A;  4U8Y D;  4CRW A;  3QNK A;  4WWN A;  4EZI A;  3GZ1 A;  1HO8 A;  4GPM A;  1QP4 A;  3UWP A;  3UTM A;  4TXQ A;  1NW3 A;  1BI8 B;  3FP3 A;  2MEZ A;  3AG4 E;  3OQN A;  3MJW A;  3EU5 A;  2BKG A;  3KS2 A;  1TN7 A;  4CYM D;  3VLF A;  2QYJ A;  1QZX A;  3TAX A;  2PIJ A;  4I17 A;  4WVL A;  4ER6 A;  5KJM A;  2EWT A;  4GZD A;  2XQ0 A; 
#chains in the Genus database with same CATH homology
 5K98 B;  4KZ0 A;  2Y4U A;  1XGW A;  3ZFW A;  3NZS A;  3I4G A;  2FO7 A;  3ZYK A;  1CJG A;  5E76 A;  1AU7 A;  3QC1 A;  1XNF A;  3DBS A;  4PU7 A;  1HFA A;  4L1B A;  4JCY A;  2X6K A;  2OR1 L;  1QQB A;  1Z6T A;  4JHJ A;  3VLD A;  4CEM A;  4CDM A;  2AVP A;  4BSX A;  2Y3A A;  2ICT A;  3QDN A;  4WWP A;  5AJL A;  3RZZ A;  4I1M A;  2LYP A;  4BFR A;  3ASD A;  4WNG A;  4EZJ A;  4NUR A;  2CHX A;  2LAI A;  3JXB C;  2YNQ A;  3UFD A;  4LEU A;  5G05 C;  3VTY A;  3CEC A;  2O49 A;  1GW6 A;  1UJJ A;  1NA0 A;  1X5B A;  3FEY A;  5BV1 A;  1OWO A;  2VSX E;  3LVQ E;  1HS6 A;  3CGH A;  3TXN A;  1BDH A;  2WXI A;  3FUM A;  2L6J A;  3B7T A;  3CV0 A;  2OOE A;  3ULQ A;  3VTX A;  3PVL A;  1RIO A;  2XPZ A;  4GHJ A;  2GW1 A;  3FYM A;  3ZYQ A;  4GPK A;  5FQ6 A;  2AWI A;  3BG1 B;  2XRZ A;  3MZL B;  4BT8 A;  2YQ8 A;  2L49 A;  4UI9 C;  4EZL A;  2VTB B;  4J6I A;  2DCP A;  2XGO A;  1R63 A;  1BDI A;  2A4Z A;  4JEH A;  5FQ7 A;  2MHK A;  2MOW A;  2OVB A;  2KM4 A;  3IV0 A;  1QP0 A;  3APC A;  4X4F A;  4H7X A;  2L0I A;  2CRO A;  4JA7 A;  5FTP A;  4AJW A;  3ZW3 A;  3QJZ A;  5FQ4 A;  1QZ2 A;  3IEG A;  4UI9 J;  2GRM A;  2GRL A;  3Q5M A;  3QWV A;  4XIF A;  5T4Y A;  3L22 A;  1WM5 A;  3BD1 A;  3ASF A;  3IBE A;  3KD7 A;  3PE4 A;  3QQ6 A;  4FUL A;  2KEK A;  2X3M A;  4UWK A;  4JXT A;  1UN9 A;  2I9C A;  3GZS A;  3EJN A;  4AVX A;  4G26 A;  2HO1 A;  3MKQ B;  3LEW A;  3ZKC A;  2EQX A;  1Y6I A;  3TG4 A;  4Z5D A;  2V5F A;  2P58 C;  3TXM A;  3UQ3 A;  1ELW A;  4FJZ A;  2XSD C;  3ESK A;  4ACK A;  3D9L A;  4I43 A;  3CHS A;  1WH8 A;  4FHJ A;  5FT9 A;  4YAR A;  4GZ5 A;  3RJV A;  3ZHE B;  4ILI A;  4QFV A;  5CCL A;  3ZHM A;  2FJR A;  1SZ9 A;  4BT9 A;  1UXD A;  2AW6 A;  1A17 A;  4YVO A;  4J1X A;  3CHP A;  3ZYM A;  3LFP A;  1NP7 A;  4D10 C;  5BNW A;  3RO2 A;  1VDY A;  4Q94 A;  3FUF A;  1LCC A;  2WXN A;  1HZ4 A;  2PPX A;  3SD5 A;  2PUE A;  1OWM A;  2WXG A;  3FTY A;  4B0Z A;  1NZN A;  2IU1 A;  3TG5 A;  1UXC A;  2WXM A;  4L2L A;  4G23 A;  1NEQ A;  3FH5 A;  4ANW A;  2AUW A;  3GBF A;  1PNR A;  3I4R B;  4UI9 K;  3G7D A;  2KAT A;  5CMY A;  5G05 J;  1LLI A;  5LCW J;  4PS7 A;  4GA1 A;  1X2L A;  4MS6 A;  2LYQ A;  4IA8 A;  1BPO A;  2M63 A;  5ARF A;  3QOU A;  4HOT A;  5EKQ D;  1NER A;  2O38 A;  3F6W A;  4BTA A;  1MHQ A;  2XCC A;  4JZY A;  3G2U A;  3URZ A;  5HQ8 A;  3HYM B;  1ZZ7 A;  3FEX A;  2JCG A;  4EZK A;  3OXL A;  3FTU A;  1H19 A;  2OFY A;  4EBA A;  5KJL A;  1E96 B;  3LYA A;  2WMN A;  4HVB A;  4I6U A;  3OQM A;  1EYH A;  1P5Q A;  1ZUG A;  3ONL A;  3PNT B;  1JFT A;  4J8E A;  2L8N A;  2WXK A;  2NC9 A;  5C2Y A;  3AU4 A;  3D9J A;  3JQ1 A;  2E0I A;  3S7D A;  3B7R L;  2IOS A;  3D3M A;  4A1S A;  4PS8 A;  2WXQ A;  4J8D A;  2EF8 A;  1ELR A;  1L5J A;  3EHM A;  3PUK A;  2PQN A;  3FH7 A;  5EX0 A;  4GZ3 A;  4PU8 A;  2HM8 A;  1ZBP A;  1HE8 A;  4GMJ A;  4HXI A;  3Q4A B;  4EQF A;  1SQM A;  4ANV A;  1PAQ A;  3IKO B;  5JJ7 A;  1HF8 A;  2XPI A;  1Y7Y A;  4JQD A;  3AS4 A;  3N71 A;  5G2N A;  3UMV A;  4AM9 A;  5CMW A;  1OCT C;  3TRB A;  5FZQ A;  2C0L A;  1HH8 A;  4I9E A;  1LQC A;  4I8T A;  2DBA A;  3RRM B;  1NA3 A;  2V0P A;  2J08 A;  1QPZ A;  3G2T A;  3TL5 A;  4HLE A;  3GN5 A;  1EPU A;  4APO A;  1LCD A;  3QAR A;  1SQ8 A;  2LYS A;  4B94 A;  5J90 A;  3ZEF A;  3OXF A;  1CQT A;  3IHV A;  4I6E A;  1U3C A;  1E90 A;  3HIZ A;  4XI0 A;  1KLX A;  4ANU A;  3PDN A;  3CSF A;  3RKV A;  4DI3 A;  4PH4 B;  3ENE A;  4RSY A;  2J9Q A;  3QWP A;  2PL2 A;  2CG3 A;  5AEN A;  3U9W A;  4WAF A;  3CVQ A;  2VGX B;  4CGW A;  4Y42 A;  2X6I A;  4U63 A;  3SCF A;  3FUN A;  3FYA A;  2L9B A;  4IN3 B;  2HR2 A;  4KYO B;  4K03 A;  4DLO A;  3CVX A;  4UWL A;  3CVV A;  5FWQ A;  2MRI A;  3EIQ C;  3HHM A;  3JUI A;  1UJK A;  4G2V A;  2MQK A;  4GYW A;  2UY1 B;  5ANL A;  3BEE A;  1ZZ8 A;  1ZZ9 A;  4GA2 A;  4PDX A;  4I6G A;  3RRN B;  3CK7 A;  2BJC A;  4LER A;  2LYR A;  3ESL A;  4P29 A;  4PUC A;  3G2S A;  4CDR A;  2DIW A;  1L1M A;  2PUG A;  4CCA A;  4A3V A;  5ENN A;  3FU6 A;  4O8B A;  4FU3 A;  3S7B A;  2CHZ A;  5BUZ A;  3EDT B;  4R7L A;  4UQY A;  1OWP A;  4PU3 C;  4ILH B;  2NXP A;  2IF4 A;  4N39 A;  2AXV A;  2GZU A;  1E8W A;  2BF0 X;  3S7F A;  2NSZ A;  4JHK A;  2VJ8 A;  4XX5 A;  3CVW A;  3FU0 A;  5T3R A;  1H2T C;  3CR3 A;  2PUA A;  4Q96 A;  4L2Y A;  5AIJ A;  2KEJ A;  2PM6 A;  1RZS A;  3LY9 A;  3SFZ A;  3U66 A;  2WXH A;  4B8C B;  3O4Z A;  3EIJ A;  3FTX A;  4EEC A;  3K9I A;  3IVP A;  4BWR A;  3RO3 A;  2IUO A;  2GGF A;  3SNX A;  3R1F A;  3FU3 A;  2KZT B;  2V4L A;  4FJY A;  4O6F A;  4Y6W A;  3ZXS A;  4HOR A;  1UN8 A;  4KVM A;  3D1N I;  1JUQ A;  1POU A;  3CQC B;  4GZC A;  5T8I A;  4ANX A;  5A6C A;  3TJP A;  2IVQ A;  3MGB A;  3SBT B;  3FUL A;  1JPL A;  3GZ2 A;  4NRH B;  2YHC A;  5CHE E;  3CQG B;  4UWF A;  3QYX A;  2LYL A;  2Q7F A;  2KZT A;  3B13 A;  4F53 A;  4ABN A;  4TV3 A;  5ANR A;  2UY1 A;  3PEU B;  1TJF A;  1UW4 B;  2LO6 A;  3DPD A;  1PC2 A;  3UT7 A;  3APF A;  3FUK A;  2JVL A;  1OUV A;  4RVB A;  1QQA A;  5LFA A;  1IYG A;  2ILR A;  2J07 A;  2WPV A;  2CG2 A;  1S0P A;  4FLH A;  1LMB 3;  4UQZ A;  1ZS4 A;  3JCK C;  5EX3 A;  3CHQ A;  3FUH A;  3ZN3 A;  3NF1 A;  4F7A A;  2PUF A;  3TGO A;  1ELK A;  3Q49 B;  2VGX A;  4J8S A;  1FCH A;  2J4D A;  5KCM A;  4B89 A;  2WXR A;  3L13 A;  3FTW A;  4FAD A;  4J0U A;  1S7E A;  2J49 A;  3PH0 C;  3VLE A;  4AIF A;  1KT1 A;  5CCM A;  5KJK A;  5G55 A;  4IYP A;  2R1J L;  2YIN A;  3RU0 A;  3CST A;  1E8X A;  4I6R A;  4URK A;  2FBN A;  2VQ2 A;  5FQ8 A;  3D9N A;  1RZR A;  4GU5 A;  3SBS A;  2XGM A;  3KZ3 A;  3UT8 A;  1ADR A;  3PXP A;  1PRU A;  3CHO A;  3FTV A;  2FEZ A;  4JW1 A;  3SCH A;  3E4B A;  1KT0 A;  3MKR A;  1TEZ A;  2PUD A;  4RG9 A;  2XHE A;  4C0E A;  3MV2 B;  2AXZ A;  3D9M A;  1UG3 A;  5A7D B;  2FF4 A;  3MLF A;  4KVO A;  5C1D A;  3FUD A;  4E85 A;  1LF8 A;  1WY6 A;  1N52 A;  3MX3 A;  3JXD L;  1E7V A;  4RG6 A;  1FVF A;  2VSN A;  3NQP A;  4UWG A;  4Z5C A;  5BPP A;  3FHE A;  4OVV A;  3L1P A;  4FP7 A;  4HOU A;  2IVG A;  2R63 A;  1JWL A;  1JFS A;  3BS3 A;  2VGY A;  1Y9Q A;  2OND A;  3PRZ A;  4JHR A;  3FDH A;  1QP7 A;  3MA5 A;  3D9O A;  1XWR A;  3PZD A;  3ZVV A;  3S2A A;  5FJY A;  4C9B B;  4YND A;  5LX8 A;  4A1G A;  4FHK A;  4W9R A;  4X4I A;  4IWR A;  4A3T A;  2A5U A;  2C0M A;  4WND A;  1B0N A;  5HI7 A;  3PUJ A;  4BY6 A;  3D9K A;  3FFL A;  3G2W A;  2HSG A;  1WET A;  5D0Q D;  5EDS A;  3CHR A;  4KZC A;  3CVY A;  4HS2 A;  4YVQ C;  1ZPQ A;  4X4C A;  3PEV B;  3ASG A;  2LSV A;  4EPZ A;  4MCX A;  2IFU A;  2WMO A;  4J1W A;  3KAE A;  2IV1 A;  3PNL B;  4FC8 A;  3LY8 A;  4JVS A;  2WIU B;  4KBQ A;  2X38 A;  5LP0 A;  1RPE L;  1Z3X A;  1HU3 A;  3MKQ A;  4ME2 A;  1RZR D;  3VK0 A;  3QB2 A;  1R69 A;  3WXX A;  3ZGQ A;  4X4B A;  4GZ6 A;  4A55 A;  4F1S A;  1GT0 C;  1JH9 A;  3SGH A;  1DWK A;  2WXF A;  4V3I A;  1SZA A;  4G25 A;  4FA6 A;  4GCO A;  4WWO A;  4AXH A;  3D9I A;  3ML8 A;  2BNO A;  4OB4 A;  2CHW A;  4Q69 A;  3UPV A;  2D5V A;  2A6C A;  2X6J A;  4Z59 A;  4PU4 C;  3MEK A;  3PRE A;  4ILG A;  3FTS A;  1Z3Y A;  4JA9 A;  4LUN U;  5FZR A;  3SF4 A;  5KJN A;  1ZZB A;  1W3B A;  3CVU A;  3QKY A;  1YSE A;  3AU5 A;  3MYV A;  1ZAY A;  4K0R A;  4MRU A;  3NZU A;  1DVP A;  3DNV B;  3CRO L;  2XJ3 A;  3EHN A;  4N3B A;  1ZVV A;  1O4X A;  2R59 A;  4AY5 A;  3SHF A;  4NAC A;  2OV8 A;  2EBY A;  3C98 A;  3RRU A;  2LAH A;  2XGS A;  2WQ7 A;  3FUJ A;  1PRA A;  4XKC A;  4GML A;  4DPR A;  2XI8 A;  3SZ7 A;  4G1T A;  3Q47 B;  4AY6 A;  3ZHE A;  3ZHI A;  3ZRH A;  2HYZ A;  4YG7 B;  3ASH A;  4YG1 A;  3APD A;  3QK0 A;  4GCN A;  4CT0 A;  3CVL A;  2HIN A;  4X4H A;  2FI7 A;  1U3D A;  4B8A A;  2IVB A;  2QFC A;  2PM7 A;  4TRQ A;  3ZIM A;  2O4A A;  3CIA A;  5BT1 A;  1H2U A;  4AOF A;  2JLB A;  4G11 A;  2KEI A;  4HOQ A;  3HZI B;  3T8M A;  4X4E A;  3LDZ A;  4F3V A;  1IC8 A;  2C2L A;  3G5G A;  3O9X A;  3FTZ A;  2VTB A;  4MCT A;  4JC8 A;  4XE0 A;  4XZ4 A;  3U3W A;  1HX8 A;  2WXJ A;  3FUI A;  3D9P A;  4IRU A;  4Y6C A;  4L23 A;  1OWN A;  3R9A B;  2WXP A;  5AJD A;  3CK9 A;  3KJX A;  2XPY A;  2V8S E;  3HDX A;  4NQ0 A;  3RIB A;  2RG8 A;  5JHA A;  1OSL A;  4I6T A;  2WXO A;  3L6A A;  3SCG A;  2KCK A;  4GB9 A;  4KT6 B;  1Y8M A;  3FMY A;  4Z58 A;  1IQR A;  3F52 A;  1EDU A;  1N54 A;  2PUC A;  1WAO 1;  2I1K A;  4J8F A;  3CKC A;  3U4T A;  4I6J A;  2ZU6 B;  4AV7 A;  4C0M A;  4BX9 A;  3ZYL A;  3LCA A;  4YG4 A;  2LYK A;  3UT4 A;  1MQS A;  1OWL A;  3H5T A;  3OAW A;  3L08 A;  5DIZ A;  3ZPJ A;  5A7L A;  3O48 A;  2XCB A;  2XEV A;  2WQ6 A;  4X4G A;  2LNI A;  4DK5 A;  1ZZC A;  2WXL A;  3MV3 B;  2IJG X;  4FLB A;  5G04 C;  1UTX A;  4WNE A;  2ION A;  1H2V C;  1EFA A;  2XQ0 A;  3HVE B;  1E8Y A;  3AS5 A;  3OXG A;  3AS8 A;  3FU5 A;  3LS8 A;  3BG0 B;  4GQM A;  2UWJ G;  4N3A A;  3CLC A;  2XIU A;  3JYS A;  4U8H A;  5JJ6 A;  3GYZ A;  3JQ0 A;  2KCV A;  1HF0 A;  4HFG A;  1WH6 A;  5LCW C;  5J08 A;  4L7T A;  2BTD A;  3QWG A;  4OVU A;  4ACL A;  3GN5 B;  1QNF A;  3L17 A;  4KXK B;  2BNM A;  3QF3 A;  5BW8 C;  1HG2 A;  2XRY A;  3LJ3 A;  3LXU X;  2AXU A;  3LY7 A;  1WIZ A;  4JCX A;  3CKB A;  3OTN A;  1QQE A;  1FVH A;  3RK6 A;  3R7Q A;  4GAA A;  4WUY A;  2VSO E;  5DBK A;  3ML9 A;  4LRZ A;  4U0S A;  1H0A A;  4FBI A;  1E3O C;  2LSU A;  3G2V A;  4BTB A;  1PER L;  2I6H A;  2FUL A;  3LVR E;  3UX4 A;  5M72 A;  4WNF A;  1ZU2 A;  1IHG A;  3B7S A;  2RD0 A;  1IQU A;  4XI9 A;  3B7H A;  4I9C A;  4U0U A;  3U64 A;  4CDN A;  3CVN A;  3I3N A;  2CSF A;  2JEK A;  4BX8 A;  1VPW A;  4UQX A;  3EUS A;  2WB2 A;  4E6H A;  3P1U A;  1YA0 A;  2XCJ A;  4I1A A;  4GYY A;  1ZZ6 A;  3FY4 A;  2R5S A;  4XKB A;  3S7J A;  3OMT A;  3P2B A;  5JHB A;  3CEQ A;  3QAQ A;  3BDN A;  2CFZ A;  3T5V A;  3ONK A;  4NDW A;  4OYS A;  5AYW D;  3UUX A;  1HG5 A;  3FWV A;  4X4D A;  4U04 A;  4APF A;  1INZ A;  5FZS A;  4LCT A;  2WUS R;  4N2S A;  2PE5 A;  4U07 A;  1B89 A;  1PY1 A;  1DNP A;  3F51 A;  4ATG A;  2X6F A;  2IOL A;  2WVI A;  4N5C A;  4TUU A;  2PZI A;  3CK8 A;  3CLJ A;  3KEZ A;  5BV0 A;  2B5A A;  1DW9 A;  1JWG A;  3Q15 A;  1EF1 C;  3T5X A;  3OP9 A;  2BNN A;  4I2Z A;  2KZ8 A;  4FN3 A;  5LOZ A;  4AEZ C;  4F8D A;  4H7Y A;  1PRV A;  3L16 A;  3R7R A;  1JWF A;  2I1J A;  4M3O A;  4EBA G;  2E2E A;  1TJC A;  4DJA A;  4N2Q A;  5G04 J;  3OQO A;  1H6K A;  4DLQ A;  2H8R A;  5D0O D;  2KCL A;  4I1O B;  2KC7 A;  4GYO A;  3GW4 A;  4MKT A;  4N3C A;  2IQC A;  3LKU A;  1E7U A;  3HVE A;  3LIS A;  2VYI A;  4G24 A;  4Z5H A;  2LCV A;  2PQR A;  4PS3 A;  3CHM A;  4IUL A;  4JL0 A;  3S8Q A;  4JEU A;  2R17 C;  3JXC L;  3I5P A;  4CT4 A;  4U0Z A;  3FH8 A;  2PUB A;  4CRW A;  3L54 A;  3QNK A;  3GZ1 A;  4WWN A;  1HO8 A;  2VSY A;  5E75 A;  5A23 A;  3B7U X;  2WM9 A;  1X57 A;  3KXA A;  1QP4 A;  4IVZ A;  2J4B A;  2OVF A;  4I2W A;  4UWH A;  1E8Z A;  5JJT A;  3PE3 A;  4HOS A;  4YBA A;  2I2O A;  3FP3 A;  2MEZ A;  1HXI A;  3MCX A;  4GA0 A;  2YHE A;  2IU7 A;  3OQN A;  2X6H A;  2QY7 A;  3LPZ A;  4JPS A;  4AP2 A;  3MJW A;  4DI4 A;  2CFU A;  3QWW A;  4MLP A;  2BUG A;  4CGV A;  5ARG A;  2ICP A;  3FUE A;  3KS2 A;  4KMO A;  2WQH A;  3PS6 A;  2L0T B;  3VLF A;  3TAX A;  2PIJ A;  2LYJ A;  3IHY A;  3SI5 A;  4I17 A;  5KJM A;  2KPJ A;  3CVP A;  2Y4T A;  2EWT A;  4GZD A;  2J09 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...