2AWIA

Structure of prgx y153c mutant
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
300
structure length
298
Chain Sequence
FKIGSVLKQIRQELNYHQIDLYSGIMSKSVYIKVEADSRPISVEELSKFSERLGVNFFEILNRAGMNSVNETGKEKLLISKIFTNPDLFDKNFQRIEPKRLTSLQYFSIYLGYISIAHHYNIEVPTFNKTITSDLKHLYDKRTTFFGIDCEIVSNLLNVLPYEEVSSIIKPMYPIVDSFGKDYDLTIQTVLKNALTISIMNRNLKEAQYYINQFEHLKTIKNISINGYYDLEINYLKQIYQFLTDKNIDSYLNAVNIINIFKIIGKEDIHRSLVEELTKISAKEKFTPPKEVTMYYEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PrgX
publication title Structure of peptide sex pheromone receptor PrgX and PrgX/pheromone complexes and regulation of conjugation in Enterococcus faecalis.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Transcription
total genus 111
structure length 298
sequence length 300
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2005-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2awiA01
1.25.40.400 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2awiA02
2XJ3A 1QQBA 4JCXA 2GRMA 1ZZ9A 4PU4C 1L1MA 3JXDL 1QP4A 3OQMA 1UXDA 2L8NA 2XSDC 1LCDA 2EWTA 4YG4A 4I8TA 1Y9QA 2LYQA 2WUSR 3U3WA 2KEJA 4Z59A 4Y42A 4JQDA 1PNRA 4J1WA 2IVBA 3UFDA 3D1NI 2H8RA 2PUCA 2KEIA 4JCYA 4X4FA 3BDNA 2AXUA 2A6CA 3LISA 1DW9A 4X4GA 4X4EA 5K98B 1NERA 4I6RA 3TRBA 1GT0C 4PU3C 1RIOA 2BNMA 1R69A 3OQNA 3BD1A 1AU7A 1R63A 2LYRA 3OP9A 4Z5DA 3G5GA 2AWIA 2PIJA 1JWLA 4GQMA 2R1JL 1PERL 2BNOA 4X4CA 1EFAA 4MCXA 3ZHMA 1UTXA 2XCJA 2CROA 2PE5A 1ZZ7A 2BJCA 3S8QA 1IC8A 1QPZA 3H5TA 1B0NA 1XWRA 1QP0A 1ADRA 4NDWA 2KEKA 3CLCA 4MCTA 3OMTA 1JFSA 4X4HA 2WIUB 3O9XA 2OR1L 2PUBA 1POUA 3GN5A 4YBAA 4F8DA 4YARA 2PPXA 1PRAA 2L49A 1X2LA 2AXVA 2MEZA 2XIUA 3JXBC 3OQOA 1E3OC 1ZAYA 2AXZA 2FJRA 3QWGA 4X4IA 1YSEA 1ZZ8A 2LYPA 2KPJA 2MQKA 1WH6A 5A7LA 1HF0A 2CSFA 1LLIA 3F6WA 2IU7A 2ICTA 1ZZ6A 1ZVVA 2IUOA 4I6TA 2HSGA 4IA8A 4O8BA 1X57A 4IVZA 3GBFA 1S7EA 4YG7B 2PUGA 4J1XA 4OB4A 3QQ6A 3CROL 1RPEL 4PU8A 3PXPA 3B7HA 3ZKCA 1Y7YA 2IV1A 4FBIA 4Z5CA 1QP7A 2LYSA 2EBYA 2LYLA 3SCGA 4YG1A 3SCHA 4X4BA 1RZRD 1O4XA 2XI8A 2PUEA 1DWKA 1WIZA 3G7DA 1ZZBA 3R1FA 1PRVA 4Z58A 1JH9A 3QYXA 2PUFA 1UXCA 4Z5HA 4X4DA 2O49A 1ZPQA 2GZUA 3KZ3A 1CQTA 2O4AA 3SCFA 3F51A 2R63A 3F52A 2BNNA 1ZZCA 2GRLA 1JFTA 2KZ8A 2LCVA 3ZHIA 3LFPA 2AW6A 2AUWA 3JXCL 1ZS4A 1BDHA 3IVPA 2PUAA 1WH8A 2O38A 3EUSA 1RZRA 1LMB3 2JCGA 2LYJA 3KXAA 1LQCA 3L1PA 1LCCA 4I6UA 2IVGA 3CECA 3KJXA 3VK0A 1CJGA 1QQAA 2PUDA 3GN5B 2D5VA 1ZUGA 2EF8A 3FYMA 1WETA 4PU7A 1PRUA 2JVLA 1OSLA 4IWRA 3FYAA 4FN3A 1SQ8A 1NEQA 2HINA 3MLFA 2ICPA 1VPWA 1OCTC 3DNVB 3QF3A 4GHJA 2B5AA 3FMYA 1RZSA 2LYKA 2IVQA 3RZZA 3HZIB 2OFYA 3BS3A 1BDIA
chains in the Genus database with same CATH superfamily
3Q7FA 3SY2A 3L54A 4HOTA 1UOHA 5AQ9A 2XPYA 4Y6CA 3CK8A 3HRAA 2WQ6A 4F3VA 4U8VD 2PUCA 2KEIA 1TYQG 1E8WA 4O6FA 2A6CA 5K98B 2Y0BG 3GZSA 3R09A 5LOZA 1H2TC 2VJ8A 1FT1A 4EQFA 2IU1A 2PM7A 4UUCA 2WXPA 2MOWA 3PDNA 3Q7AA 4GZ3A 1YYHA 4RLYA 3ZHEB 4H7XA 4Y6WA 4UQYA 1N52A 2LLWA 3C3OA 3UIOC 3ME5A 4ER6A 3AS4A 4GA0A 5CHEE 1DCEA 3TXNA 3O4ZA 4HOUA 4BSZB 4IA8A 3GZDA 4IVZA 5DTQA 2J09A 3FULA 2WXOA 3SCHA 4KVOA 2XI8A 2KZTB 1JPLA 1DWKA 3G7DA 3R1FA 3DSVA 2VEOA 2CFUA 4X4DA 4PS3A 2GRLA 5DIZA 4E6HA 1LD7A 5ENNA 1O5MA 4B89A 3FHEA 3HXCA 3KAEA 3X2QE 3R7RA 4ABNA 1OSLA 4MS6A 2ETCA 5CCLA 1OY3D 2IONA 2YBDA 4HI9A 4BETA 3ML8A 3F6QA 4G24A 2GRPB 2DBAA 3E4BA 2GRMA 2RD0A 4PU4C 3Q75A 4YVOA 4I8TA 1WY6A 2PQRA 4Y42A 2YHCA 3ZYMA 1NZNA 1Z5SC 3ONKA 2WXKA 4LERA 4AVXA 2XEVA 4NQ0A 5LFAA 3ZRHA 1E96B 2IO2C 3CHPA 2C0MA 4J8SA 5JA4D 4WVLA 3NQPA 3RRUA 4X4CA 3FTXA 5ANLA 2CROA 2PE5A 1ZZ7A 3MCXA 1NL4A 4RG6A 4MCTA 1KLXA 4EZLA 3NZSA 4U95D 3KS2A 4DX6D 1N11A 3G2UA 1FVFA 5EIDA 5B1AE 4WWNA 5A6CA 1ZZ6A 4U0ZA 3NZUA 2AJAA 2PUGA 1JWGA 3PH0C 3CSFA 3PVLA 5AQ7A 4UI9C 1QP7A 5FT9A 5FINA 4GZ5A 3G2WA 2H6HA 4HXIA 5BNWA 3JUEA 2OOEA 3CHRA 2R59A 3W9GA 1ZPQA 3KZ3A 3ZXSA 5ENOD 2X6KA 3O48A 3DXMG 3LYAA 1IHGA 4EBAA 5BV1A 3U4TA 3L16A 3FTUA 4UWFA 4WWPA 2I1JA 4FN3A 1SQ8A 2WXGA 3KEAA 5B3SE 2VSNA 5G55A 3HHMA 4HRAA 2L8NA 1FPPA 5LCWJ 3T8MA 2J7UA 4HORA 4WWOA 2OV8A 3FUIA 1OT8A 4WNEA 2A5EA 4XKCA 1H2UA 3CHQA 5D0QD 4EPZA 3CVUA 2F0YA 2XRYA 4KZ0A 3TWVA 1BI7B 2XCCA 1ZU2A 3HVEA 3EU9A 3QAQA 4AP2A 2XCJA 3MEJA 4KBQA 4G25A 2WQ7A 4HLLA 3SGHA 4OYSA 2LXMA 3ONLA 4U7EB 4NDWA 3VWSA 3KL4A 4Z68A 3UWPA 3NDBB 3SX0A 3SR4A 1H6PA 5EILA 2CFZA 3GN5A 1UJJA 4XI0A 3PNLB 4X4IA 1YSEA 2MQKA 3ZN3A 3G2SA 3GZCA 4AEZC 4U0UA 4LG6A 3TJPA 1K1AA 2P9PG 3PZ4A 3WG7E 5FZSA 2YQ8A 3RKVA 1DC2A 3CKCA 3ZHEA 3MGBA 3SCGA 4YG1A 5AQAA 1D9SA 3D3MA 3F52A 2KZ8A 1HG5A 1OCOE 1Y8MA 4A1SA 1ZS4A 1Z3XA 2O38A 4CDRA 3ABME 5CEDB 1S63A 2EF8A 5ITZF 5FJYA 2B5AA 1RZSA 1SZAA 4UWKA 3FH8A 1S64A 1QQBA 5J08A 1QP4A 5ANRA 2FF4A 1X81A 3D9JA 3FTZA 3UINC 1JCQA 3P2BA 3ESKA 3TWRA 5KJKA 1NERA 1E7UA 4PU3C 1KT0A 4GMRA 4GCNA 3OP9A 4Z5DA 3JQ1A 3M9LA 2RG8A 3OWQA 4URKA 1HE8A 5BV0A 4BY6A 1HO8A 2WMOA 1EFAA 4HVBA 4UI9K 1HS6A 3V31A 3E32A 2XXAA 2OEWA 4MBGA 2WM9A 1BPOA 3OMTA 1W3BA 2P9UG 1DNPA 2C0LA 3GZDC 4JD2G 4D10C 1FCHA 2R03A 3IKOB 2L49A 1OWMA 3U64A 2HYZA 2DYSE 2FJRA 1QYMA 2FEZA 3A9XA 4U96D 5ENRD 1X57A 3GBFA 3DPYA 3Q15A 2VYIA 3MV2B 2MRIA 4HRLA 2FFHA 4L2LA 3VLFA 2PUEA 5HQ8A 2X6HA 3AG1E 3ZGQA 1N9AA 3F51A 2LCVA 1OXJA 2E0IA 4UI9J 2BEDA 2Y4UA 3Q4AB 5CRVA 1BU9A 3Q9UC 3CECA 2B6CA 3LY9A 4BWRA 5ARGA 3RRMB 4FHKA 1HG2A 3DSSA 3DNVB 3EHMA 4FLBA 2QY7A 3DEPA 5DT2A 1X5BA 4DX2A 3OQMA 3TG5A 3Q78A 3FUNA 3ZKJA 3TWQA 2WUSR 1MYOA 5CBOA 3EUVA 1MHQA 5BXUA 2F37A 4L2YA 4ZFHA 5FQ6A 1RIOA 1R69A 1O1TA 3BD1A 3ABKE 4RVBA 4CRWA 4DE9A 2J08A 4G8LA 1NI1A 3CVQA 3CLCA 1NA3A 3TWTA 3DM5A 1TNUA 2EIKE 3QWWA 4K5CA 2WXJA 1QQEA 3QK0A 2IJGX 4O60A 2QC9A 1O1SA 3U66A 3JXJA 4E85A 4JA9A 4PS7A 1BD8A 4U8HA 3SQVA 3CROL 4N3CA 4OVVA 2PXUA 1N95A 1N4PA 3GZ1A 5KJLA 3FUJA 4B8CB 2DVWA 4AJWA 5IY5E 5JHBA 1K1BA 5J90A 4JEHA 4GTOA 1HFAA 3SHFA 2UY1B 2O4AA 4GA2A 2BUGA 3TWWA 3AJIA 3LFPA 4WNDA 3JXCL 3HYMB 3CHOA 3MZLB 1ZB1A 1RZRA 2B0OE 3HXBA 1LQCA 3A9ZA 2CHXA 1QQAA 1RZ4A 2VGYA 3FH5A 4I9EA 1JCRA 4G11A 1WETA 4IWRA 2HINA 2YINA 2LYKA 2IVQA 2GRNB 3R7QA 3UKRG 4YNDA 2ZGGA 4NRHB 4ER5A 4JB8P 2M63A 2Y1LE 4ER7A 3ZU7B 3MV3B 4V3IA 4BERA 3FEXA 1E7VA 3QJZA 3LCAA 4APFA 2XXQA 3CKBA 1WG0A 1Z6TA 3I4GA 4N3AA 2J4BA 1GT0C 1BI8B 3FY4A 4HBDA 1AU7A 2NSZA 2PIJA 1NA0A 2R1JL 3P1UA 1UTXA 1QPZA 4GYWA 5E75A 2LUHA 3B7RL 3E37A 3PE5A 2J9QA 5BW8C 5AENA 2ETBA 4YARA 2PPXA 3A9YA 4LRZA 4N5CA 1X2LA 1E3OC 3UT8A 2EILE 3CVYA 1HF0A 2CSFA 5AQBA 3QOUA 3ASNE 5E76A 1ZVVA 2IEJA 4O1PA 4I1MA 4L7TA 3MA5A 1UN8A 4YG7B 4UWHA 2XEHA 4N2QA 4ER0A 2WXLA 1XGWA 4EBAG 4Q2JA 1OWPA 1E8XA 2EBYA 4GB9A 1H19A 2LYLA 2NC9A 3UQ3A 1AWCB 1N54A 3Q73A 4KZCA 2WXRA 2GGFA 3QYXA 4JW1A 3L17A 4JHRA 1YCSB 4N39A 3T8KA 3PEVB 3QB2A 2GRRB 4OAVB 1BDHA 1KZOA 5FZQA 2P58C 4EKGA 3UMVA 2OVFA 3ASFA 3SBTB 2BKKB 4NURA 3JQ0A 3QF3A 4GHJA 4G2VA 4DX1A 2OFYA 2XJ3A 3V2OA 5G05C 1L1MA 3AS5A 3TWXA 4A3VA 3B95A 3I3NA 4C9BB 4BFRA 2CHWA 2KEJA 4GMLA 3TELA 5KWDA 4AM9A 4A63B 4GU5A 1DW9A 4EHMA 3OQNA 3UT7A 3G5GA 1LF8A 2XGSA 5EYPF 3SNXA 3S7DA 1HH8A 2VTBB 4N2SA 3ZW3A 2DIWA 4CGWA 3ZHMA 5C1DA 4HS2A 2HO1A 1XWRA 1PY1A 4W9RA 4GTSA 2KEKA 2PXTA 2WXHA 3O9XA 2PUBA 4KMOA 4YBAA 1SVXA 2XPIA 2XIUA 3JXBC 2ETAA 1MX4A 3PZ1A 4JL0A 3IHVA 3KSLA 2MYOA 1ELWA 1NP7A 3G2VA 4BT8A 4GCOA 3VLDA 4DE8A 4PU8A 4LUNU 2A5UA 4MLPA 5DBKA 2LAIA 1RZRD 3HDXA 4XZ4A 4ME2A 5HRYA 3ZYQA 2FO1E 4TRQA 1S0PA 1TNOA 4BX9A 1ZZCA 2XZDG 2AW6A 1TR4A 3OXGA 3DSWA 2I2OA 2LSVA 3OXFA 2QYUA 2WMNA 1LCCA 2C2LA 4EK9A 2IVGA 3VK0A 5T3RA 3FU5A 2E2EA 1HQ1A 3PZ2A 4ILHB 4PU7A 2WXMA 4U8YD 1VPWA 3D9IA 5A23A 5EIBE 3SFYA 2R17C 3B7UX 5M72A 3BS3A 2F8YA 3CGHA 5JUWA 3DSXA 2XRZA 2H6GA 1LCDA 4CT0A 3CQCB 1N0RA 4GPKA 1PNRA 4CGVA 4UWLA 2IVBA 5G04C 2I1KA 1DULA 1HXIA 4NACA 4FJYA 4AY5A 4XKBA 2KATA 1QZ2A 4JEUA 4CZ2D 4EKIA 3SFXA 3FU3A 4TUUA 4DUIA 5DRYA 4ZHBA 4X8QA 2XQ0A 3HIZA 3LEWA 3PNTB 3TAXA 2WXIA 2PXQA 3SI5A 4GZ6A 2WPVA 2WIUB 1TN6A 5LX8A 4EZJA 1L5JA 4H7YA 2XXPA 5C2YA 1IQUA 3ASGA 4P29A 4AV7A 3RO3A 3GUUA 3HG0D 3PREA 3EHNA 4A1GA 3T9KA 2PXFA 4L23A 3UKUG 1RW2A 3KD7A 5EYLA 1JH9A 3EHQA 5JJTA 3NXHA 2FO7A 3LJ3A 3IVPA 3UM2A 1PAQA 1OWLA 5T8IA 5JJ7A 4OBMA 3KJXA 2PUDA 4WUYA 4JPSA 2I6HA 3ZYKA 1TJCA 2MXDA 1O1RA 4HRNA 3BU8A 2KCVA 2EQXA 1VDYA 2XZTG 3L08A 4EECA 5CERB 1QBQA 2GROB 5DRTA 2FULA 3N71A 5KNHD 4Z59A 3CK9A 1WM5A 4J1WA 2CG3A 3OTNA 3PRZA 2XHEA 3VTXA 3D1NI 4ER3A 5KJMA 4M7CA 4DK5A 2ZISA 2OCCE 2R02A 5G05J 4JZYA 1MX6A 3IBEA 1IQRA 2KZTA 2WXNA 2XS1A 2LAHA 5KJNA 1PERL 1N0QA 3CVPA 1U3CA 4BTBA 4AOFA 2L6BA 4IULA 4I9CA 2XEEA 2LLVA 2OEVA 2OR1L 3QWVA 3V2XA 1ZZ8A 1A17A 1DVPA 3D9PA 2PXVA 3BEEA 1S7EA 4CEMA 2VTBA 2XGMA 1U2ZA 1RPEL 3AG3E 3VTYA 4OAUC 3ZPXA 3AU4A 3L82A 2LYSA 3R9AB 1HZ4A 3NB2A 5T4YA 2OVBA 3FUFA 1UXCA 4Z5HA 4XI9A 2BNNA 3AG4E 4GYYA 1EDUA 2ODRD 3ZHIA 1H6KA 2X38A 3PS6A 1A5EA 3SFZA 1LMB3 5CBNA 2LYJA 3GW4A 3J5PA 3DEOA 2J07A 3L9TA 3MLFA 1MX2A 4IRUA 1TJFA 3QNKA 3T5VA 5AJLA 4I43A 3QDNA 4JCXA 5AYWD 1BLXB 4C0MA 3G0TA 2XSDC 3SF4A 3C3QA 1QNFA 3Q9NC 1AP7A 4LNBA 2P9SG 3PZDA 2L1PA 2V3CC 3LS8A 2VSYA 2HCNA 4X4EA 4I6RA 3TRBA 4WAFA 3D9LA 2IO3C 4A3TA 5FQ7A 2X6IA 2P9NG 3TXMA 3PUKA 3KSQA 4GYOA 5G04J 2HFZA 2J7WA 4C48B 2BNOA 3TWUA 2PXLA 4O1OA 4GMJA 5CECB 1DCQA 3CHSA 3EU5A 4HOSA 5ENQD 4JHJA 3C3RA 5BT1A 3MKQB 5HKPA 3IHYA 4FULA 2XCBA 3QWPA 3DPDA 1K8KG 3UIPC 2LYPA 2RKKA 2LXLA 4J8EA 1WH6A 5A7LA 2XS8A 3G2TA 3S7FA 3QQ6A 3RK6A 1Q2ZA 2V4LA 4ILIA 4PH4B 3FUDA 3LY8A 1O4XA 4U04A 3ULEG 5HI7A 3URZA 2PM6A 2KM4A 3TG4A 2O49A 1E8YA 3SCFA 2VGEA 4KVMA 3UM0A 4J7WA 4K0RA 3UT4A 3Q79A 2PUAA 3EUSA 4GTQA 3PUJA 1N94A 2WB2A 1ZUGA 3Q5MA 2VGXB 2P9LG 3BG1B 3DSTA 1NEQA 3CVWA 3NAWA 2DYRE 2CG2A 1LD8A 5LP0A 4TXPA 4HOQA 1TNZA 3IXEA 3MEKA 4HLEA 4DX7D 3FTSA 1Y9QA 4DPRA 3D9KA 3K9IA 4NIKA 4JQDA 2DCPA 2YNQA 4XIFA 5GAHi 4YDWA 2PXDA 1UW4B 3CVLA 4PUCA 4I1OB 1HF8A 3CV0A 4TV3A 4MKTA 3D9MA 4GQMA 2PNNA 5D2MC 1HU3A 3APCA 3MX3A 4HFGA 5EKQD 2JLBA 2LNMA 1V54E 1B0NA 3LVRE 2Y69E 1P5QA 3LQXA 4PS8A 3D9NA 4CYMD 4X4HA 4TXRA 4XX5A 5ENSD 4BX8A 3OQOA 3LKUA 1IXVA 1G3NB 4BEPA 3NBNB 3ML9A 1MJ0A 4GAAA 4F1PA 1H2VC 4OB4A 4LCTA 4G8KA 4I17A 4I6EA 4Z5CA 3SO8A 2HR2A 2KXPC 3FWVA 1ELRA 3FH7A 1OWNA 1SW6A 1XNFA 1WAO1 4DX5D 4C0EA 2GZUA 3D9OA 4DI3A 4I1AA 4CCAA 1QB2A 1EYHA 2P9KG 4ACKA 4I2WA 2J49A 2KC7A 3L1PA 4F53A 3GN5B 2PXPA 3L6AA 4Q96A 2V8SE 5B1BE 1PRUA 2YHEA 3CIAA 3FYAA 1ZBPA 3RSEG 2J4DA 3IV0A 5AN8A 3Q47B 2R2LA 1SA5A 3MJWA 4YDOA 1GW6A 3FTWA 3NROA 3GYZA 3C72A 4U0SA 4KXKB 2AVPA 3L22A 4A55A 4TXQA 3BDNA 4AY6A 5KNGA 4I2ZA 4X4GA 1NFIE 2X6JA 3SD5A 2HE0A 3EJNA 3FFLA 3QARA 3ZYLA 4IYPA 2LNIA 3UI2A 4RG9A 3ESLA 2LYRA 1PC2A 2Q7FA 5CMWA 1JUQA 1JWLA 1V55E 4L9PA 4F1SA 2WVIA 2LSUA 1TN7A 1E8ZA 4YDEA 3CVXA 1EF1C 5CCMA 2L6JA 4RQIA 4DJAA 4ATGA 4ANVA 2DWZA 5DTMA 3L13A 4YDYA 1MFQC 2XENA 3ZPJA 4J8YA 4CT4A 3ZIMA 2IU7A 2IUOA 2HSGA 5EX3A 3PZ3A 4LNGA 5CMYA 1OUVA 5GAGi 2PXKA 3RO2A 2IV1A 1B89A 3DSUA 3EHRA 3JYSA 4MRUA 1WIZA 3MKQA 1PRVA 4GPMA 5AAOA 3FUKA 4HNAD 1SZ9A 3R9MA 3PE4A 2DZNA 4UWGA 2EINE 3FU6A 4K5BA 3B7SA 3SBSA 4FP7A 3FYMA 4CDMA 1INZA 3HXDA 4ATZD 5AJDA 3CEQA 1TNYA 3RZZA 3C98A 1KPSB 1IYGA 3DRAA 1IKND 3ISMC 4K5AB 4BSXA 1FT2A 3PE3A 3FUEA 1OWOA 4FLHA 3ABLE 2QFCA 1YA0A 4M3OA 4GTVA 2VSXE 4RSYA 4JCYA 3W9FA 4BTAA 2VGXA 4ANWA 2UWJG 3CLJA 2V5QC 5G2NA 1NW3A 3LY7A 4YVQC 4G1TA 2UY1A 1QZXA 3TFLA 2ILRA 3ENEA 2WQHA 3H5TA 5BUZA 1ADRA 3ULYA 5ENTD 4FA6A 4GTPA 4AIFA 3RAUA 2Y3AA 5D66A 3FEYA 1ZAYA 1JCSA 3QWGA 3NOCD 2PL2A 3E30A 2HCSA 1K3ZD 4EZIA 1KT1A 3AG2E 3PXPA 3FUMA 1N4SA 2XPZA 4LNUD 1OCRE 5FWQA 1MZCA 4J6IA 4X4BA 4GTMA 3JXIA 3AS8A 2R5SA 2DZOA 3SZ7A 1TN8A 1U2VG 3FTYA 4IN3B 4DI4A 3CVVA 3LXUX 2IOLA 4I6UA 3TEPA 5FTPA 4ILGA 3EIQC 3CSTA 2ICPA 1MQSA 3FTVA 3LDZA 2BJCA 2D5VA 5D0OD 4F6RD 2X3MA 1UG3A 4N3BA 4UQZA 3CQGB 4N5QA 4YG4A 5ARFA 3U3WA 3CHMA 3OXLA 4G26A 2L0IA 2ZGDA 3UFDA 3LPZA 2NXPA 2ONDA 3LVQE 3ASDA 2PXEA 3LISA 4Q94A 2F8XK 3RIBA 2EIJE 3J5QB 1KZPA 5FIOA 2AWIA 3HXFA 3ZNGA 3B13A 1SQMA 4MCXA 5DTRA 2CHZA 3ZEFA 5FQ8A 1IC8A 2L9BA 3I5PA 1N4QA 1HX8A 4GZDA 4XE0A 2GRQB 5KBAA 5JHAA 4F8DA 4KYOB 2V0PA 2IFUA 2VSOE 3Q49B 2IOSA 4HRMB 2KPJA 5BPPA 1LLIA 2BF0X 4LSZE 4I6TA 4WNGA 5EN5D 2ZXWE 4FBIA 3QKYA 2HM8A 3C5RA 4J8FA 4ANXA 2BTDA 1EPUA 3NF1A 1IHBA 4JA7A 3BQOA 2V4HC 2FBNA 2QYJA 1CQTA 4J8DA 3E33A 3FU0A 1JFTA 3ZVVA 3TGOA 4F7AA 2JCGA 3KXAA 3AAAC 1ELKA 2BKGA 3CK7A 4JVSA 4B8AA 1LTXA 2JVLA 4FADA 3V79K 1OCTC 3DBSA 3FMYA 3EIJA 4B93B 4WNFA 1ZZ9A 2ZU6B 3JXDL 4FJZA 1UXDA 3B7BA 4U63A 3LJNA 2EWTA 5FQ4A 1OCCE 3NZLA 1D8DA 2JEKA 1TNBA 3CVNA 3UM3A 1FVHA 3ZUVB 5AIJA 5HS0A 1OCZE 3BUAA 3S7JA 4U07A 2X6FA 3DWLG 3CR3A 2AXUA 3OAWA 5BXOA 5JMND 2Y4TA 5AARA 2NYJA 2WXFA 2JABA 3S2AA 3RU0A 3S8QA 3MYVA 3JUIA 4QFVA 2P2CP 3RRNB 3UX4A 1QP0A 2QZAA 3FDHA 4KT6B 3NOGD 2RFAA 5EX0A 3APDA 1PRAA 1N4RA 2WXQA 2AXVA 2MEZA 1UN9A 2L0TB 2PZIA 1YMPA 4FHJA 1E90A 3DXKG 2IQCA 4JHKA 2H6FA 4ACLA 2P9IG 3I4RB 3VLEA 3HXEA 5JJ6A 4J1XA 2V5FA 4DRXE 3B7HA 3ZKCA 1Y7YA 3TL5A 3QOXA 4ANUA 3ASHA 4Z58A 3GZ2A 2PUFA 3ZXPA 4G23A 3QOWA 2H6IA 5FZRA 4OVUA 5A7DB 4DLQA 2MHKA 4UQXA 1WH8A 3ULQA 4GZCA 4JXTA 1UJKA 4GA1A 3APFA 5DSXA 1CJGA 1U3DA 2PXBA 4APOA 3UUXA 2R05A 2J8SD 2ZIRA 1S70B 1BDIA 2GW1A 1JWFA 3QC1A 2A4ZA 3KEZA 2LYQA 2XGOA 5CRUA 3FP3A 4BT9A 1SA4A 3QFIA 2LO6A 3E34A 2H8RA 1D8EA 4K03A 3UTMA 4X4FA 4Q69A 2VQ2A 1TEZA 2BNMA 3B7TA 1R63A 1H0AA 3UM1A 2JQEA 3V30A 2M4HA 2KBXA 3T5XA 4XEIG 3JCKC 4EZKA 4B0ZA 4I6GA 1Y6IA 1JFSA 1POUA 4AXHA 3AU5A 2AXZA 5ENPD 3TWSA 3U9WA 3PEUB 3MKRA 5KCMA 3F6WA 1Z3YA 2EIME 4HQDA 4CDNA 4I6JA 2ICTA 3D9HA 2IY0C 4O8BA 4LEUA 4L1BA 5H7PA 5CEAA 4R7LA 4HI8A 4FC8A 2KCKA 3UXGA 3ASOE 3RJVA 3ZFWA 5EDSA 4FU3A 1H6OA 3UPVA 4PDXA 2I9CA 4QQIA 1ZZBA 2FI7A 2PQNA 3WXXA 2R63A 3EDTB 4DLOA 4BESA 3FUHA 2AUWA 3BG0B 2IF4A 4GTTA 4JC8A 3OKZA 4J0UA 4HB5A 1WDYA 4TUMA 4B94A 3S7BA 2RFMA 5LCWC 4GTRA 2KCLA 4EQZA 3IEGA 3HVEB 3HZIB
chains in the Genus database with same CATH topology
2QY7A 1VDYA 3L08A 1X5BA 4BSXA 4EECA 3PE3A 3OQMA 3FUEA 1OWOA 4FLHA 3L54A 4HOTA 3TG5A 3FUNA 2FULA 3N71A 2XPYA 4Y6CA 2WUSR 3CK8A 4Z59A 2QFCA 2WQ6A 3CK9A 1YA0A 1WM5A 4J1WA 2CG3A 3OTNA 4M3OA 2VSXE 3PRZA 4RSYA 2XHEA 3VTXA 1MHQA 3D1NI 2PUCA 4JCYA 2KEIA 4F3VA 5KJMA 1E8WA 4DK5A 4L2YA 4O6FA 2A6CA 5G05J 4BTAA 5FQ6A 5K98B 4JZYA 2VGXA 1RIOA 3GZSA 3IBEA 1R69A 4ANWA 2UWJG 3BD1A 3CLJA 5LOZA 5G2NA 1H2TC 2VJ8A 1IQRA 2KZTA 4EQFA 2IU1A 2WXNA 4CGWA 2PM7A 2LAHA 3LY7A 5KJNA 1PERL 4YVQC 4RVBA 4G1TA 2UY1A 2J08A 1U3CA 2WXPA 3CVPA 2MOWA 4BTBA 4CRWA 4AOFA 2ILRA 3PDNA 3ENEA 2WQHA 3H5TA 4GZ3A 4IULA 4I9CA 5BUZA 3ZHEB 1ADRA 4H7XA 4Y6WA 3CVQA 3CLCA 1NA3A 4FA6A 4UQYA 1N52A 4AIFA 2OR1L 3QWWA 2Y3AA 3AS4A 3QWVA 4GA0A 2WXJA 1QQEA 3QK0A 5CHEE 2IJGX 3FEYA 1ZAYA 3TXNA 3QWGA 3U66A 1ZZ8A 2PL2A 3O4ZA 1A17A 4HOUA 1DVPA 4E85A 3D9PA 4JA9A 4PS7A 4IA8A 3BEEA 4IVZA 1S7EA 4U8HA 4CEMA 2VTBA 1KT1A 2XGMA 3CROL 1RPEL 3VTYA 3PXPA 3FUMA 4N3CA 4OVVA 3AU4A 2XPZA 3GZ1A 2LYSA 3R9AB 2J09A 5FWQA 5KJLA 3FULA 1HZ4A 3FUJA 4J6IA 4B8CB 2WXOA 3SCHA 4X4BA 4KVOA 2XI8A 2KZTB 1JPLA 5T4YA 1DWKA 4AJWA 5JHBA 3G7DA 2OVBA 3R1FA 5J90A 4JEHA 3FUFA 2CFUA 1UXCA 4Z5HA 4X4DA 1HFAA 3AS8A 4PS3A 3SHFA 2UY1B 2O4AA 2R5SA 4GA2A 4XI9A 2BNNA 2GRLA 4GYYA 2BUGA 1EDUA 5DIZA 3ZHIA 4E6HA 3SZ7A 3LFPA 4WNDA 5ENNA 3JXCL 1H6KA 2X38A 3CHOA 3FTYA 3HYMB 4IN3B 3MZLB 3PS6A 1RZRA 3SFZA 1LMB3 4DI4A 2LYJA 3CVVA 1LQCA 3LXUX 2IOLA 4I6UA 4B89A 3FHEA 2CHXA 1QQAA 2VGYA 3FH5A 4I9EA 3GW4A 3KAEA 5FTPA 4ILGA 4G11A 3R7RA 1WETA 4ABNA 4IWRA 1OSLA 4MS6A 2J07A 3EIQC 3CSTA 3MLFA 2HINA 4IRUA 2ICPA 1MQSA 2YINA 1TJFA 3FTVA 3LDZA 3QNKA 3T5VA 5AJLA 2IONA 2LYKA 2IVQA 5CCLA 2BJCA 3R7QA 3ML8A 2D5VA 4G24A 4YNDA 4I43A 3QDNA 3E4BA 2DBAA 4JCXA 2GRMA 2RD0A 5D0OD 4NRHB 5AYWD 4PU4C 2X3MA 4YVOA 1UG3A 4N3BA 2M63A 2XSDC 4UQZA 4C0MA 3SF4A 3CQGB 4YG4A 5ARFA 4I8TA 1QNFA 1WY6A 3U3WA 2PQRA 3CHMA 3OXLA 4G26A 4Y42A 2YHCA 3MV3B 3ZYMA 4V3IA 2L0IA 3FEXA 1E7VA 3PZDA 3QJZA 3LCAA 1NZNA 4APFA 3UFDA 3CKBA 1Z6TA 3LPZA 2NXPA 3LS8A 2ONDA 3I4GA 3LVQE 3ASDA 3ONKA 2WXKA 2VSYA 3LISA 4X4EA 2J4BA 4LERA 1GT0C 4N3AA 4I6RA 3TRBA 4Q94A 3RIBA 4AVXA 4WAFA 3FY4A 2XEVA 3D9LA 1AU7A 4A3TA 4NQ0A 5FQ7A 2X6IA 5LFAA 2AWIA 2NSZA 2PIJA 3TXMA 3ZRHA 1E96B 1NA0A 3B13A 3PUKA 4GYOA 3CHPA 4J8SA 2C0MA 5G04J 3NQPA 2R1JL 3RRUA 3P1UA 2BNOA 4X4CA 3FTXA 1SQMA 4MCXA 2CHZA 3ZEFA 5ANLA 1UTXA 5FQ8A 2CROA 2PE5A 1ZZ7A 4GMJA 1IC8A 1QPZA 2L9BA 3I5PA 3MCXA 4GYWA 3CHSA 5E75A 1HX8A 4GZDA 4RG6A 4HOSA 3B7RL 4XE0A 4JHJA 5BT1A 5BW8C 2J9QA 4MCTA 1KLXA 5AENA 3MKQB 4EZLA 5JHAA 4F8DA 4KYOB 3NZSA 2V0PA 4YARA 4HORA 2PPXA 2IFUA 3IHYA 4LRZA 4N5CA 1X2LA 1E3OC 2VSOE 3Q49B 4FULA 3UT8A 2XCBA 3KS2A 3QWPA 3DPDA 2IOSA 2LYPA 4J8EA 2KPJA 3CVYA 1WH6A 5A7LA 1HF0A 2CSFA 1LLIA 3G2UA 3QOUA 1FVFA 2BF0X 5BPPA 4WWNA 5E76A 1ZZ6A 1ZVVA 5A6CA 4I6TA 4WNGA 4U0ZA 4I1MA 4L7TA 3G2TA 3MA5A 1UN8A 3NZUA 4YG7B 4UWHA 2PUGA 1JWGA 3S7FA 4N2QA 2WXLA 3QQ6A 3PH0C 4DPRA 1XGWA 4EBAG 3CSFA 3PVLA 4UI9C 4FBIA 1QP7A 1OWPA 3QKYA 3RK6A 2V4LA 1E8XA 4ILIA 2EBYA 2HM8A 3FUDA 4PH4B 4GZ5A 5FT9A 4GB9A 1H19A 2LYLA 3LY8A 3G2WA 1O4XA 2NC9A 4J8FA 4U04A 4ANXA 3UQ3A 5HI7A 1N54A 3URZA 2BTDA 1EPUA 2PM6A 3NF1A 4HXIA 2WXRA 2KM4A 4JA7A 4KZCA 3TG4A 2GGFA 5BNWA 3QYXA 2OOEA 3CHRA 2R59A 2O49A 1ZPQA 3KZ3A 1E8YA 1CQTA 2FBNA 4J8DA 3SCFA 4JW1A 2X6KA 3ZXSA 3FU0A 3L17A 3O48A 4JHRA 1JFTA 4KVMA 4K0RA 4N39A 3LYAA 3UT4A 3PEVB 3ZVVA 3QB2A 1IHGA 3TGOA 4EBAA 1BDHA 2PUAA 4F7AA 5FZQA 5BV1A 3EUSA 2P58C 3PUJA 2JCGA 3U4TA 3KXAA 2WB2A 3L16A 1ELKA 3FTUA 3UMVA 2OVFA 3CK7A 3ZYLA 3ASFA 1ZUGA 5LCWJ 4JVSA 3Q5MA 4UWFA 4WWPA 3SBTB 2VGXB 4B8AA 4NURA 2I1JA 2JVLA 4FADA 4FN3A 1SQ8A 2WXGA 1NEQA 3BG1B 2VSNA 3JQ0A 1OCTC 3CVWA 3DBSA 3QF3A 4GHJA 3FMYA 2CG2A 3EIJA 4G2VA 4WNFA 5G55A 2OFYA 5LP0A 3HHMA 2XJ3A 4HOQA 1ZZ9A 2ZU6B 5G05C 1L1MA 3JXDL 4FJZA 1UXDA 2L8NA 3AS5A 4U63A 3MEKA 2EWTA 5FQ4A 3I3NA 4A3VA 4C9BB 3FTSA 1Y9QA 3T8MA 4BFRA 2JEKA 2CHWA 3CVNA 3D9KA 3K9IA 1FVHA 2KEJA 2OV8A 3FUIA 4WNEA 4WWOA 5AIJA 4GMLA 4JQDA 4XKCA 3S7JA 4U07A 4HLEA 2DCPA 1H2UA 2YNQA 3CHQA 5D0QD 4AM9A 4XIFA 4EPZA 2X6FA 4GU5A 3CR3A 2AXUA 3OAWA 3CVUA 1DW9A 2XRYA 4KZ0A 2Y4TA 1UW4B 3CVLA 3OQNA 3UT7A 4PUCA 2XCCA 3G5GA 1HF8A 3CV0A 4I1OB 4TV3A 4MKTA 1LF8A 1ZU2A 2XGSA 3D9MA 3HVEA 4GQMA 3SNXA 2WXFA 1HH8A 3QAQA 3S7DA 2VTBB 4N2SA 1HU3A 2DIWA 3APCA 3S2AA 3ZW3A 3ZHMA 3MX3A 3RU0A 2XCJA 4HFGA 4AP2A 5EKQD 5C1DA 3S8QA 2JLBA 3MYVA 4HS2A 1B0NA 2HO1A 3JUIA 3LVRE 1XWRA 1PY1A 4G25A 4KBQA 4QFVA 3RRNB 4OYSA 3SGHA 3ONLA 4W9RA 1QP0A 1P5QA 3UX4A 4NDWA 2KEKA 3FDHA 4PS8A 2WXHA 4KT6B 3D9NA 4X4HA 3O9XA 2PUBA 2CFZA 4KMOA 3GN5A 4YBAA 2XPIA 5EX0A 1UJJA 4XI0A 3APDA 3PNLB 1PRAA 4XX5A 2WXQA 2AXVA 2MEZA 2XIUA 3JXBC 3OQOA 1UN9A 2L0TB 2PZIA 4JL0A 4ACKA 4BX8A 4X4IA 3LKUA 1E90A 4FHJA 1YSEA 3IHVA 2MQKA 3ZN3A 3G2SA 4AEZC 4U0UA 2IQCA 4JHKA 1ELWA 1NP7A 3ML9A 3G2VA 3TJPA 4ACLA 4BT8A 4GAAA 3I4RB 1H2VC 4GCOA 5JJ6A 3VLEA 3VLDA 4J1XA 4OB4A 4LCTA 4PU8A 2V5FA 5FZSA 4LUNU 2YQ8A 3B7HA 3ZKCA 1Y7YA 2A5UA 4I17A 4I6EA 4Z5CA 4MLPA 5DBKA 3TL5A 3CKCA 2HR2A 2LAIA 3FWVA 3ZHEA 3MGBA 3SCGA 4YG1A 1RZRD 3ASHA 3HDXA 4ANUA 1ELRA 4XZ4A 4ME2A 3FH7A 3ZYQA 4TRQA 1OWNA 1S0PA 1XNFA 4Z58A 1WAO1 2KCVA 3GZ2A 2PUFA 4G23A 4BX9A 4C0EA 2GZUA 3D9OA 4DI3A 3D3MA 3F52A 1ZZCA 2KZ8A 5FZRA 4I1AA 1HG5A 4CCAA 1Y8MA 4OVUA 5A7DB 4A1SA 2AW6A 1EYHA 4DLQA 1ZS4A 3OXGA 1Z3XA 2MHKA 4UQXA 1WH8A 2O38A 2I2OA 3ULQA 4GZCA 2LSVA 3OXFA 4I2WA 2J49A 2KC7A 3L1PA 4CDRA 2WMNA 4JXTA 1LCCA 2C2LA 1UJKA 2WQ7A 4GA1A 3APFA 2IVGA 3VK0A 1CJGA 5T3RA 1U3DA 3FU5A 3GN5B 3L6AA 2E2EA 4Q96A 4F53A 4ILHB 2V8SE 2EF8A 4PU7A 4APOA 1PRUA 2WXMA 2YHEA 3CIAA 3FYAA 1ZBPA 1VPWA 3D9IA 3UUXA 5A23A 2J4DA 5FJYA 2B5AA 2R17C 1RZSA 1SZAA 3B7UX 4UWKA 5M72A 3IV0A 3BS3A 3Q47B 1BDIA 3FH8A 3CGHA 2GW1A 1QQBA 1JWFA 3QC1A 5J08A 2XRZA 1QP4A 5ANRA 3MJWA 1LCDA 2FF4A 4CT0A 2A4ZA 3KEZA 1GW6A 2LYQA 2XGOA 3D9JA 3FTWA 3FTZA 3GYZA 3FP3A 3CQCB 4BT9A 4GPKA 1PNRA 4CGVA 4UWLA 4U0SA 2IVBA 5G04C 3P2BA 4KXKB 2LO6A 2I1KA 2AVPA 3L22A 4A55A 1HXIA 2H8RA 3ESKA 4K03A 4X4FA 3BDNA 5KJKA 4NACA 4AY6A 4FJYA 4I2ZA 4X4GA 2X6JA 3SD5A 2VQ2A 4Q69A 1NERA 1TEZA 4AY5A 1E7UA 4PU3C 3EJNA 3FFLA 1KT0A 3QARA 2BNMA 2LNIA 3B7TA 4GCNA 4IYPA 2KATA 4RG9A 4XKBA 1QZ2A 3ESLA 1R63A 2LYRA 3OP9A 1PC2A 4Z5DA 2Q7FA 4JEUA 3JQ1A 1H0AA 2RG8A 5CMWA 1JUQA 1JWLA 4URKA 1HE8A 5BV0A 3FU3A 4BY6A 1HO8A 2WMOA 1EFAA 4HVBA 4TUUA 4F1SA 3T5XA 2WVIA 4UI9K 1HS6A 2LSUA 2XQ0A 3HIZA 1E8ZA 3JCKC 3LEWA 3PNTB 3TAXA 2WXIA 4EZKA 3CVXA 2WM9A 1EF1C 4B0ZA 1BPOA 5CCMA 2L6JA 4I6GA 1Y6IA 3OMTA 1JFSA 1W3BA 4GZ6A 2WPVA 3SI5A 1DNPA 2WIUB 2C0LA 4ATGA 4ANVA 1POUA 4D10C 5LX8A 4AXHA 4EZJA 3AU5A 1FCHA 3IKOB 2L49A 3L13A 1OWMA 3ZPJA 3U64A 2HYZA 2AXZA 1L5JA 2FJRA 4H7YA 3U9WA 3PEUB 3MKRA 5C2YA 5KCMA 4CT4A 3F6WA 1Z3YA 3ZIMA 4CDNA 2IU7A 2FEZA 4I6JA 2ICTA 2IUOA 4O8BA 2HSGA 4LEUA 1X57A 4L1BA 3GBFA 5EX3A 4R7LA 1IQUA 3ASGA 5CMYA 4P29A 4FC8A 4AV7A 3Q15A 3RO3A 1OUVA 3PREA 2KCKA 2VYIA 3MV2B 3RO2A 2IV1A 2MRIA 3EHNA 3RJVA 3ZFWA 1B89A 5EDSA 4FU3A 4A1GA 3UPVA 4PDXA 4L2LA 2I9CA 3JYSA 3VLFA 2PUEA 4MRUA 4L23A 5HQ8A 1WIZA 1ZZBA 2X6HA 2FI7A 3MKQA 1PRVA 3ZGQA 3KD7A 2PQNA 1JH9A 3WXXA 3FUKA 5JJTA 1SZ9A 3F51A 2R63A 3EDTB 4DLOA 2FO7A 2LCVA 3LJ3A 2E0IA 4UI9J 3PE4A 3FUHA 4UWGA 2AUWA 3BG0B 3FU6A 2IF4A 3IVPA 2Y4UA 3B7SA 1PAQA 4JC8A 1OWLA 3SBSA 3Q4AB 4J0UA 3RKVA 5T8IA 4B94A 5JJ7A 3KJXA 3CECA 2PUDA 3S7BA 3LY9A 4WUYA 4BWRA 4JPSA 4FP7A 3FYMA 4CDMA 5LCWC 1INZA 5ARGA 2KCLA 3RRMB 2I6HA 1HG2A 4FHKA 3IEGA 5AJDA 3ZYKA 3DNVB 1TJCA 4DJAA 3CEQA 3EHMA 3HVEB 3RZZA 3C98A 3HZIB 1IYGA 4FLBA 2EQXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XJ3 A;  1QQB A;  4JCX A;  2GRM A;  1ZZ9 A;  4PU4 C;  1L1M A;  3JXD L;  1QP4 A;  3OQM A;  1UXD A;  2L8N A;  2XSD C;  1LCD A;  2EWT A;  4YG4 A;  4I8T A;  1Y9Q A;  2LYQ A;  2WUS R;  3U3W A;  2KEJ A;  4Z59 A;  4Y42 A;  4JQD A;  1PNR A;  4J1W A;  2IVB A;  3UFD A;  3D1N I;  2H8R A;  2PUC A;  2KEI A;  4JCY A;  4X4F A;  3BDN A;  2AXU A;  2A6C A;  3LIS A;  1DW9 A;  4X4G A;  4X4E A;  5K98 B;  1NER A;  4I6R A;  3TRB A;  1GT0 C;  4PU3 C;  1RIO A;  2BNM A;  1R69 A;  3OQN A;  3BD1 A;  1AU7 A;  1R63 A;  2LYR A;  3OP9 A;  4Z5D A;  3G5G A;  2AWI A;  2PIJ A;  1JWL A;  4GQM A;  2R1J L;  1PER L;  2BNO A;  4X4C A;  1EFA A;  4MCX A;  3ZHM A;  1UTX A;  2XCJ A;  2CRO A;  2PE5 A;  1ZZ7 A;  2BJC A;  3S8Q A;  1IC8 A;  1QPZ A;  3H5T A;  1B0N A;  1XWR A;  1QP0 A;  1ADR A;  4NDW A;  2KEK A;  3CLC A;  4MCT A;  3OMT A;  1JFS A;  4X4H A;  2WIU B;  3O9X A;  2OR1 L;  2PUB A;  1POU A;  3GN5 A;  4YBA A;  4F8D A;  4YAR A;  2PPX A;  1PRA A;  2L49 A;  1X2L A;  2AXV A;  2MEZ A;  2XIU A;  3JXB C;  3OQO A;  1E3O C;  1ZAY A;  2AXZ A;  2FJR A;  3QWG A;  4X4I A;  1YSE A;  1ZZ8 A;  2LYP A;  2KPJ A;  2MQK A;  1WH6 A;  5A7L A;  1HF0 A;  2CSF A;  1LLI A;  3F6W A;  2IU7 A;  2ICT A;  1ZZ6 A;  1ZVV A;  2IUO A;  4I6T A;  2HSG A;  4IA8 A;  4O8B A;  1X57 A;  4IVZ A;  3GBF A;  1S7E A;  4YG7 B;  2PUG A;  4J1X A;  4OB4 A;  3QQ6 A;  3CRO L;  1RPE L;  4PU8 A;  3PXP A;  3B7H A;  3ZKC A;  1Y7Y A;  2IV1 A;  4FBI A;  4Z5C A;  1QP7 A;  2LYS A;  2EBY A;  2LYL A;  3SCG A;  4YG1 A;  3SCH A;  4X4B A;  1RZR D;  1O4X A;  2XI8 A;  2PUE A;  1DWK A;  1WIZ A;  3G7D A;  1ZZB A;  3R1F A;  1PRV A;  4Z58 A;  1JH9 A;  3QYX A;  2PUF A;  1UXC A;  4Z5H A;  4X4D A;  2O49 A;  1ZPQ A;  2GZU A;  3KZ3 A;  1CQT A;  2O4A A;  3SCF A;  3F51 A;  2R63 A;  3F52 A;  2BNN A;  1ZZC A;  2GRL A;  1JFT A;  2KZ8 A;  2LCV A;  3ZHI A;  3LFP A;  2AW6 A;  2AUW A;  3JXC L;  1ZS4 A;  1BDH A;  3IVP A;  2PUA A;  1WH8 A;  2O38 A;  3EUS A;  1RZR A;  1LMB 3;  2JCG A;  2LYJ A;  3KXA A;  1LQC A;  3L1P A;  1LCC A;  4I6U A;  2IVG A;  3CEC A;  3KJX A;  3VK0 A;  1CJG A;  1QQA A;  2PUD A;  3GN5 B;  2D5V A;  1ZUG A;  2EF8 A;  3FYM A;  1WET A;  4PU7 A;  1PRU A;  2JVL A;  1OSL A;  4IWR A;  3FYA A;  4FN3 A;  1SQ8 A;  1NEQ A;  2HIN A;  3MLF A;  2ICP A;  1VPW A;  1OCT C;  3DNV B;  3QF3 A;  4GHJ A;  2B5A A;  3FMY A;  1RZS A;  2LYK A;  2IVQ A;  3RZZ A;  3HZI B;  2OFY A;  3BS3 A;  1BDI A; 
#chains in the Genus database with same CATH topology
 3Q7F A;  3SY2 A;  3L54 A;  4HOT A;  1UOH A;  5AQ9 A;  2XPY A;  4Y6C A;  3CK8 A;  3HRA A;  2WQ6 A;  4F3V A;  4U8V D;  2PUC A;  2KEI A;  1TYQ G;  1E8W A;  4O6F A;  2A6C A;  5K98 B;  2Y0B G;  3GZS A;  3R09 A;  5LOZ A;  1H2T C;  2VJ8 A;  1FT1 A;  4EQF A;  2IU1 A;  2PM7 A;  4UUC A;  2WXP A;  2MOW A;  3PDN A;  3Q7A A;  4GZ3 A;  1YYH A;  4RLY A;  3ZHE B;  4H7X A;  4Y6W A;  4UQY A;  1N52 A;  2LLW A;  3C3O A;  3UIO C;  3ME5 A;  4ER6 A;  3AS4 A;  4GA0 A;  5CHE E;  1DCE A;  3TXN A;  3O4Z A;  4HOU A;  4BSZ B;  4IA8 A;  3GZD A;  4IVZ A;  5DTQ A;  2J09 A;  3FUL A;  2WXO A;  3SCH A;  4KVO A;  2XI8 A;  2KZT B;  1JPL A;  1DWK A;  3G7D A;  3R1F A;  3DSV A;  2VEO A;  2CFU A;  4X4D A;  4PS3 A;  2GRL A;  5DIZ A;  4E6H A;  1LD7 A;  5ENN A;  1O5M A;  4B89 A;  3FHE A;  3HXC A;  3KAE A;  3X2Q E;  3R7R A;  4ABN A;  1OSL A;  4MS6 A;  2ETC A;  5CCL A;  1OY3 D;  2ION A;  2YBD A;  4HI9 A;  4BET A;  3ML8 A;  3F6Q A;  4G24 A;  2GRP B;  2DBA A;  3E4B A;  2GRM A;  2RD0 A;  4PU4 C;  3Q75 A;  4YVO A;  4I8T A;  1WY6 A;  2PQR A;  4Y42 A;  2YHC A;  3ZYM A;  1NZN A;  1Z5S C;  3ONK A;  2WXK A;  4LER A;  4AVX A;  2XEV A;  4NQ0 A;  5LFA A;  3ZRH A;  1E96 B;  2IO2 C;  3CHP A;  2C0M A;  4J8S A;  5JA4 D;  4WVL A;  3NQP A;  3RRU A;  4X4C A;  3FTX A;  5ANL A;  2CRO A;  2PE5 A;  1ZZ7 A;  3MCX A;  1NL4 A;  4RG6 A;  4MCT A;  1KLX A;  4EZL A;  3NZS A;  4U95 D;  3KS2 A;  4DX6 D;  1N11 A;  3G2U A;  1FVF A;  5EID A;  5B1A E;  4WWN A;  5A6C A;  1ZZ6 A;  4U0Z A;  3NZU A;  2AJA A;  2PUG A;  1JWG A;  3PH0 C;  3CSF A;  3PVL A;  5AQ7 A;  4UI9 C;  1QP7 A;  5FT9 A;  5FIN A;  4GZ5 A;  3G2W A;  2H6H A;  4HXI A;  5BNW A;  3JUE A;  2OOE A;  3CHR A;  2R59 A;  3W9G A;  1ZPQ A;  3KZ3 A;  3ZXS A;  5ENO D;  2X6K A;  3O48 A;  3DXM G;  3LYA A;  1IHG A;  4EBA A;  5BV1 A;  3U4T A;  3L16 A;  3FTU A;  4UWF A;  4WWP A;  2I1J A;  4FN3 A;  1SQ8 A;  2WXG A;  3KEA A;  5B3S E;  2VSN A;  5G55 A;  3HHM A;  4HRA A;  2L8N A;  1FPP A;  5LCW J;  3T8M A;  2J7U A;  4HOR A;  4WWO A;  2OV8 A;  3FUI A;  1OT8 A;  4WNE A;  2A5E A;  4XKC A;  1H2U A;  3CHQ A;  5D0Q D;  4EPZ A;  3CVU A;  2F0Y A;  2XRY A;  4KZ0 A;  3TWV A;  1BI7 B;  2XCC A;  1ZU2 A;  3HVE A;  3EU9 A;  3QAQ A;  4AP2 A;  2XCJ A;  3MEJ A;  4KBQ A;  4G25 A;  2WQ7 A;  4HLL A;  3SGH A;  4OYS A;  2LXM A;  3ONL A;  4U7E B;  4NDW A;  3VWS A;  3KL4 A;  4Z68 A;  3UWP A;  3NDB B;  3SX0 A;  3SR4 A;  1H6P A;  5EIL A;  2CFZ A;  3GN5 A;  1UJJ A;  4XI0 A;  3PNL B;  4X4I A;  1YSE A;  2MQK A;  3ZN3 A;  3G2S A;  3GZC A;  4AEZ C;  4U0U A;  4LG6 A;  3TJP A;  1K1A A;  2P9P G;  3PZ4 A;  3WG7 E;  5FZS A;  2YQ8 A;  3RKV A;  1DC2 A;  3CKC A;  3ZHE A;  3MGB A;  3SCG A;  4YG1 A;  5AQA A;  1D9S A;  3D3M A;  3F52 A;  2KZ8 A;  1HG5 A;  1OCO E;  1Y8M A;  4A1S A;  1ZS4 A;  1Z3X A;  2O38 A;  4CDR A;  3ABM E;  5CED B;  1S63 A;  2EF8 A;  5ITZ F;  5FJY A;  2B5A A;  1RZS A;  1SZA A;  4UWK A;  3FH8 A;  1S64 A;  1QQB A;  5J08 A;  1QP4 A;  5ANR A;  2FF4 A;  1X81 A;  3D9J A;  3FTZ A;  3UIN C;  1JCQ A;  3P2B A;  3ESK A;  3TWR A;  5KJK A;  1NER A;  1E7U A;  4PU3 C;  1KT0 A;  4GMR A;  4GCN A;  3OP9 A;  4Z5D A;  3JQ1 A;  3M9L A;  2RG8 A;  3OWQ A;  4URK A;  1HE8 A;  5BV0 A;  4BY6 A;  1HO8 A;  2WMO A;  1EFA A;  4HVB A;  4UI9 K;  1HS6 A;  3V31 A;  3E32 A;  2XXA A;  2OEW A;  4MBG A;  2WM9 A;  1BPO A;  3OMT A;  1W3B A;  2P9U G;  1DNP A;  2C0L A;  3GZD C;  4JD2 G;  4D10 C;  1FCH A;  2R03 A;  3IKO B;  2L49 A;  1OWM A;  3U64 A;  2HYZ A;  2DYS E;  2FJR A;  1QYM A;  2FEZ A;  3A9X A;  4U96 D;  5ENR D;  1X57 A;  3GBF A;  3DPY A;  3Q15 A;  2VYI A;  3MV2 B;  2MRI A;  4HRL A;  2FFH A;  4L2L A;  3VLF A;  2PUE A;  5HQ8 A;  2X6H A;  3AG1 E;  3ZGQ A;  1N9A A;  3F51 A;  2LCV A;  1OXJ A;  2E0I A;  4UI9 J;  2BED A;  2Y4U A;  3Q4A B;  5CRV A;  1BU9 A;  3Q9U C;  3CEC A;  2B6C A;  3LY9 A;  4BWR A;  5ARG A;  3RRM B;  4FHK A;  1HG2 A;  3DSS A;  3DNV B;  3EHM A;  4FLB A;  2QY7 A;  3DEP A;  5DT2 A;  1X5B A;  4DX2 A;  3OQM A;  3TG5 A;  3Q78 A;  3FUN A;  3ZKJ A;  3TWQ A;  2WUS R;  1MYO A;  5CBO A;  3EUV A;  1MHQ A;  5BXU A;  2F37 A;  4L2Y A;  4ZFH A;  5FQ6 A;  1RIO A;  1R69 A;  1O1T A;  3BD1 A;  3ABK E;  4RVB A;  4CRW A;  4DE9 A;  2J08 A;  4G8L A;  1NI1 A;  3CVQ A;  3CLC A;  1NA3 A;  3TWT A;  3DM5 A;  1TNU A;  2EIK E;  3QWW A;  4K5C A;  2WXJ A;  1QQE A;  3QK0 A;  2IJG X;  4O60 A;  2QC9 A;  1O1S A;  3U66 A;  3JXJ A;  4E85 A;  4JA9 A;  4PS7 A;  1BD8 A;  4U8H A;  3SQV A;  3CRO L;  4N3C A;  4OVV A;  2PXU A;  1N95 A;  1N4P A;  3GZ1 A;  5KJL A;  3FUJ A;  4B8C B;  2DVW A;  4AJW A;  5IY5 E;  5JHB A;  1K1B A;  5J90 A;  4JEH A;  4GTO A;  1HFA A;  3SHF A;  2UY1 B;  2O4A A;  4GA2 A;  2BUG A;  3TWW A;  3AJI A;  3LFP A;  4WND A;  3JXC L;  3HYM B;  3CHO A;  3MZL B;  1ZB1 A;  1RZR A;  2B0O E;  3HXB A;  1LQC A;  3A9Z A;  2CHX A;  1QQA A;  1RZ4 A;  2VGY A;  3FH5 A;  4I9E A;  1JCR A;  4G11 A;  1WET A;  4IWR A;  2HIN A;  2YIN A;  2LYK A;  2IVQ A;  2GRN B;  3R7Q A;  3UKR G;  4YND A;  2ZGG A;  4NRH B;  4ER5 A;  4JB8 P;  2M63 A;  2Y1L E;  4ER7 A;  3ZU7 B;  3MV3 B;  4V3I A;  4BER A;  3FEX A;  1E7V A;  3QJZ A;  3LCA A;  4APF A;  2XXQ A;  3CKB A;  1WG0 A;  1Z6T A;  3I4G A;  4N3A A;  2J4B A;  1GT0 C;  1BI8 B;  3FY4 A;  4HBD A;  1AU7 A;  2NSZ A;  2PIJ A;  1NA0 A;  2R1J L;  3P1U A;  1UTX A;  1QPZ A;  4GYW A;  5E75 A;  2LUH A;  3B7R L;  3E37 A;  3PE5 A;  2J9Q A;  5BW8 C;  5AEN A;  2ETB A;  4YAR A;  2PPX A;  3A9Y A;  4LRZ A;  4N5C A;  1X2L A;  1E3O C;  3UT8 A;  2EIL E;  3CVY A;  1HF0 A;  2CSF A;  5AQB A;  3QOU A;  3ASN E;  5E76 A;  1ZVV A;  2IEJ A;  4O1P A;  4I1M A;  4L7T A;  3MA5 A;  1UN8 A;  4YG7 B;  4UWH A;  2XEH A;  4N2Q A;  4ER0 A;  2WXL A;  1XGW A;  4EBA G;  4Q2J A;  1OWP A;  1E8X A;  2EBY A;  4GB9 A;  1H19 A;  2LYL A;  2NC9 A;  3UQ3 A;  1AWC B;  1N54 A;  3Q73 A;  4KZC A;  2WXR A;  2GGF A;  3QYX A;  4JW1 A;  3L17 A;  4JHR A;  1YCS B;  4N39 A;  3T8K A;  3PEV B;  3QB2 A;  2GRR B;  4OAV B;  1BDH A;  1KZO A;  5FZQ A;  2P58 C;  4EKG A;  3UMV A;  2OVF A;  3ASF A;  3SBT B;  2BKK B;  4NUR A;  3JQ0 A;  3QF3 A;  4GHJ A;  4G2V A;  4DX1 A;  2OFY A;  2XJ3 A;  3V2O A;  5G05 C;  1L1M A;  3AS5 A;  3TWX A;  4A3V A;  3B95 A;  3I3N A;  4C9B B;  4BFR A;  2CHW A;  2KEJ A;  4GML A;  3TEL A;  5KWD A;  4AM9 A;  4A63 B;  4GU5 A;  1DW9 A;  4EHM A;  3OQN A;  3UT7 A;  3G5G A;  1LF8 A;  2XGS A;  5EYP F;  3SNX A;  3S7D A;  1HH8 A;  2VTB B;  4N2S A;  3ZW3 A;  2DIW A;  4CGW A;  3ZHM A;  5C1D A;  4HS2 A;  2HO1 A;  1XWR A;  1PY1 A;  4W9R A;  4GTS A;  2KEK A;  2PXT A;  2WXH A;  3O9X A;  2PUB A;  4KMO A;  4YBA A;  1SVX A;  2XPI A;  2XIU A;  3JXB C;  2ETA A;  1MX4 A;  3PZ1 A;  4JL0 A;  3IHV A;  3KSL A;  2MYO A;  1ELW A;  1NP7 A;  3G2V A;  4BT8 A;  4GCO A;  3VLD A;  4DE8 A;  4PU8 A;  4LUN U;  2A5U A;  4MLP A;  5DBK A;  2LAI A;  1RZR D;  3HDX A;  4XZ4 A;  4ME2 A;  5HRY A;  3ZYQ A;  2FO1 E;  4TRQ A;  1S0P A;  1TNO A;  4BX9 A;  1ZZC A;  2XZD G;  2AW6 A;  1TR4 A;  3OXG A;  3DSW A;  2I2O A;  2LSV A;  3OXF A;  2QYU A;  2WMN A;  1LCC A;  2C2L A;  4EK9 A;  2IVG A;  3VK0 A;  5T3R A;  3FU5 A;  2E2E A;  1HQ1 A;  3PZ2 A;  4ILH B;  4PU7 A;  2WXM A;  4U8Y D;  1VPW A;  3D9I A;  5A23 A;  5EIB E;  3SFY A;  2R17 C;  3B7U X;  5M72 A;  3BS3 A;  2F8Y A;  3CGH A;  5JUW A;  3DSX A;  2XRZ A;  2H6G A;  1LCD A;  4CT0 A;  3CQC B;  1N0R A;  4GPK A;  1PNR A;  4CGV A;  4UWL A;  2IVB A;  5G04 C;  2I1K A;  1DUL A;  1HXI A;  4NAC A;  4FJY A;  4AY5 A;  4XKB A;  2KAT A;  1QZ2 A;  4JEU A;  4CZ2 D;  4EKI A;  3SFX A;  3FU3 A;  4TUU A;  4DUI A;  5DRY A;  4ZHB A;  4X8Q A;  2XQ0 A;  3HIZ A;  3LEW A;  3PNT B;  3TAX A;  2WXI A;  2PXQ A;  3SI5 A;  4GZ6 A;  2WPV A;  2WIU B;  1TN6 A;  5LX8 A;  4EZJ A;  1L5J A;  4H7Y A;  2XXP A;  5C2Y A;  1IQU A;  3ASG A;  4P29 A;  4AV7 A;  3RO3 A;  3GUU A;  3HG0 D;  3PRE A;  3EHN A;  4A1G A;  3T9K A;  2PXF A;  4L23 A;  3UKU G;  1RW2 A;  3KD7 A;  5EYL A;  1JH9 A;  3EHQ A;  5JJT A;  3NXH A;  2FO7 A;  3LJ3 A;  3IVP A;  3UM2 A;  1PAQ A;  1OWL A;  5T8I A;  5JJ7 A;  4OBM A;  3KJX A;  2PUD A;  4WUY A;  4JPS A;  2I6H A;  3ZYK A;  1TJC A;  2MXD A;  1O1R A;  4HRN A;  3BU8 A;  2KCV A;  2EQX A;  1VDY A;  2XZT G;  3L08 A;  4EEC A;  5CER B;  1QBQ A;  2GRO B;  5DRT A;  2FUL A;  3N71 A;  5KNH D;  4Z59 A;  3CK9 A;  1WM5 A;  4J1W A;  2CG3 A;  3OTN A;  3PRZ A;  2XHE A;  3VTX A;  3D1N I;  4ER3 A;  5KJM A;  4M7C A;  4DK5 A;  2ZIS A;  2OCC E;  2R02 A;  5G05 J;  4JZY A;  1MX6 A;  3IBE A;  1IQR A;  2KZT A;  2WXN A;  2XS1 A;  2LAH A;  5KJN A;  1PER L;  1N0Q A;  3CVP A;  1U3C A;  4BTB A;  4AOF A;  2L6B A;  4IUL A;  4I9C A;  2XEE A;  2LLV A;  2OEV A;  2OR1 L;  3QWV A;  3V2X A;  1ZZ8 A;  1A17 A;  1DVP A;  3D9P A;  2PXV A;  3BEE A;  1S7E A;  4CEM A;  2VTB A;  2XGM A;  1U2Z A;  1RPE L;  3AG3 E;  3VTY A;  4OAU C;  3ZPX A;  3AU4 A;  3L82 A;  2LYS A;  3R9A B;  1HZ4 A;  3NB2 A;  5T4Y A;  2OVB A;  3FUF A;  1UXC A;  4Z5H A;  4XI9 A;  2BNN A;  3AG4 E;  4GYY A;  1EDU A;  2ODR D;  3ZHI A;  1H6K A;  2X38 A;  3PS6 A;  1A5E A;  3SFZ A;  1LMB 3;  5CBN A;  2LYJ A;  3GW4 A;  3J5P A;  3DEO A;  2J07 A;  3L9T A;  3MLF A;  1MX2 A;  4IRU A;  1TJF A;  3QNK A;  3T5V A;  5AJL A;  4I43 A;  3QDN A;  4JCX A;  5AYW D;  1BLX B;  4C0M A;  3G0T A;  2XSD C;  3SF4 A;  3C3Q A;  1QNF A;  3Q9N C;  1AP7 A;  4LNB A;  2P9S G;  3PZD A;  2L1P A;  2V3C C;  3LS8 A;  2VSY A;  2HCN A;  4X4E A;  4I6R A;  3TRB A;  4WAF A;  3D9L A;  2IO3 C;  4A3T A;  5FQ7 A;  2X6I A;  2P9N G;  3TXM A;  3PUK A;  3KSQ A;  4GYO A;  5G04 J;  2HFZ A;  2J7W A;  4C48 B;  2BNO A;  3TWU A;  2PXL A;  4O1O A;  4GMJ A;  5CEC B;  1DCQ A;  3CHS A;  3EU5 A;  4HOS A;  5ENQ D;  4JHJ A;  3C3R A;  5BT1 A;  3MKQ B;  5HKP A;  3IHY A;  4FUL A;  2XCB A;  3QWP A;  3DPD A;  1K8K G;  3UIP C;  2LYP A;  2RKK A;  2LXL A;  4J8E A;  1WH6 A;  5A7L A;  2XS8 A;  3G2T A;  3S7F A;  3QQ6 A;  3RK6 A;  1Q2Z A;  2V4L A;  4ILI A;  4PH4 B;  3FUD A;  3LY8 A;  1O4X A;  4U04 A;  3ULE G;  5HI7 A;  3URZ A;  2PM6 A;  2KM4 A;  3TG4 A;  2O49 A;  1E8Y A;  3SCF A;  2VGE A;  4KVM A;  3UM0 A;  4J7W A;  4K0R A;  3UT4 A;  3Q79 A;  2PUA A;  3EUS A;  4GTQ A;  3PUJ A;  1N94 A;  2WB2 A;  1ZUG A;  3Q5M A;  2VGX B;  2P9L G;  3BG1 B;  3DST A;  1NEQ A;  3CVW A;  3NAW A;  2DYR E;  2CG2 A;  1LD8 A;  5LP0 A;  4TXP A;  4HOQ A;  1TNZ A;  3IXE A;  3MEK A;  4HLE A;  4DX7 D;  3FTS A;  1Y9Q A;  4DPR A;  3D9K A;  3K9I A;  4NIK A;  4JQD A;  2DCP A;  2YNQ A;  4XIF A;  5GAH i;  4YDW A;  2PXD A;  1UW4 B;  3CVL A;  4PUC A;  4I1O B;  1HF8 A;  3CV0 A;  4TV3 A;  4MKT A;  3D9M A;  4GQM A;  2PNN A;  5D2M C;  1HU3 A;  3APC A;  3MX3 A;  4HFG A;  5EKQ D;  2JLB A;  2LNM A;  1V54 E;  1B0N A;  3LVR E;  2Y69 E;  1P5Q A;  3LQX A;  4PS8 A;  3D9N A;  4CYM D;  4X4H A;  4TXR A;  4XX5 A;  5ENS D;  4BX8 A;  3OQO A;  3LKU A;  1IXV A;  1G3N B;  4BEP A;  3NBN B;  3ML9 A;  1MJ0 A;  4GAA A;  4F1P A;  1H2V C;  4OB4 A;  4LCT A;  4G8K A;  4I17 A;  4I6E A;  4Z5C A;  3SO8 A;  2HR2 A;  2KXP C;  3FWV A;  1ELR A;  3FH7 A;  1OWN A;  1SW6 A;  1XNF A;  1WAO 1;  4DX5 D;  4C0E A;  2GZU A;  3D9O A;  4DI3 A;  4I1A A;  4CCA A;  1QB2 A;  1EYH A;  2P9K G;  4ACK A;  4I2W A;  2J49 A;  2KC7 A;  3L1P A;  4F53 A;  3GN5 B;  2PXP A;  3L6A A;  4Q96 A;  2V8S E;  5B1B E;  1PRU A;  2YHE A;  3CIA A;  3FYA A;  1ZBP A;  3RSE G;  2J4D A;  3IV0 A;  5AN8 A;  3Q47 B;  2R2L A;  1SA5 A;  3MJW A;  4YDO A;  1GW6 A;  3FTW A;  3NRO A;  3GYZ A;  3C72 A;  4U0S A;  4KXK B;  2AVP A;  3L22 A;  4A55 A;  4TXQ A;  3BDN A;  4AY6 A;  5KNG A;  4I2Z A;  4X4G A;  1NFI E;  2X6J A;  3SD5 A;  2HE0 A;  3EJN A;  3FFL A;  3QAR A;  3ZYL A;  4IYP A;  2LNI A;  3UI2 A;  4RG9 A;  3ESL A;  2LYR A;  1PC2 A;  2Q7F A;  5CMW A;  1JUQ A;  1JWL A;  1V55 E;  4L9P A;  4F1S A;  2WVI A;  2LSU A;  1TN7 A;  1E8Z A;  4YDE A;  3CVX A;  1EF1 C;  5CCM A;  2L6J A;  4RQI A;  4DJA A;  4ATG A;  4ANV A;  2DWZ A;  5DTM A;  3L13 A;  4YDY A;  1MFQ C;  2XEN A;  3ZPJ A;  4J8Y A;  4CT4 A;  3ZIM A;  2IU7 A;  2IUO A;  2HSG A;  5EX3 A;  3PZ3 A;  4LNG A;  5CMY A;  1OUV A;  5GAG i;  2PXK A;  3RO2 A;  2IV1 A;  1B89 A;  3DSU A;  3EHR A;  3JYS A;  4MRU A;  1WIZ A;  3MKQ A;  1PRV A;  4GPM A;  5AAO A;  3FUK A;  4HNA D;  1SZ9 A;  3R9M A;  3PE4 A;  2DZN A;  4UWG A;  2EIN E;  3FU6 A;  4K5B A;  3B7S A;  3SBS A;  4FP7 A;  3FYM A;  4CDM A;  1INZ A;  3HXD A;  4ATZ D;  5AJD A;  3CEQ A;  1TNY A;  3RZZ A;  3C98 A;  1KPS B;  1IYG A;  3DRA A;  1IKN D;  3ISM C;  4K5A B;  4BSX A;  1FT2 A;  3PE3 A;  3FUE A;  1OWO A;  4FLH A;  3ABL E;  2QFC A;  1YA0 A;  4M3O A;  4GTV A;  2VSX E;  4RSY A;  4JCY A;  3W9F A;  4BTA A;  2VGX A;  4ANW A;  2UWJ G;  3CLJ A;  2V5Q C;  5G2N A;  1NW3 A;  3LY7 A;  4YVQ C;  4G1T A;  2UY1 A;  1QZX A;  3TFL A;  2ILR A;  3ENE A;  2WQH A;  3H5T A;  5BUZ A;  1ADR A;  3ULY A;  5ENT D;  4FA6 A;  4GTP A;  4AIF A;  3RAU A;  2Y3A A;  5D66 A;  3FEY A;  1ZAY A;  1JCS A;  3QWG A;  3NOC D;  2PL2 A;  3E30 A;  2HCS A;  1K3Z D;  4EZI A;  1KT1 A;  3AG2 E;  3PXP A;  3FUM A;  1N4S A;  2XPZ A;  4LNU D;  1OCR E;  5FWQ A;  1MZC A;  4J6I A;  4X4B A;  4GTM A;  3JXI A;  3AS8 A;  2R5S A;  2DZO A;  3SZ7 A;  1TN8 A;  1U2V G;  3FTY A;  4IN3 B;  4DI4 A;  3CVV A;  3LXU X;  2IOL A;  4I6U A;  3TEP A;  5FTP A;  4ILG A;  3EIQ C;  3CST A;  2ICP A;  1MQS A;  3FTV A;  3LDZ A;  2BJC A;  2D5V A;  5D0O D;  4F6R D;  2X3M A;  1UG3 A;  4N3B A;  4UQZ A;  3CQG B;  4N5Q A;  4YG4 A;  5ARF A;  3U3W A;  3CHM A;  3OXL A;  4G26 A;  2L0I A;  2ZGD A;  3UFD A;  3LPZ A;  2NXP A;  2OND A;  3LVQ E;  3ASD A;  2PXE A;  3LIS A;  4Q94 A;  2F8X K;  3RIB A;  2EIJ E;  3J5Q B;  1KZP A;  5FIO A;  2AWI A;  3HXF A;  3ZNG A;  3B13 A;  1SQM A;  4MCX A;  5DTR A;  2CHZ A;  3ZEF A;  5FQ8 A;  1IC8 A;  2L9B A;  3I5P A;  1N4Q A;  1HX8 A;  4GZD A;  4XE0 A;  2GRQ B;  5KBA A;  5JHA A;  4F8D A;  4KYO B;  2V0P A;  2IFU A;  2VSO E;  3Q49 B;  2IOS A;  4HRM B;  2KPJ A;  5BPP A;  1LLI A;  2BF0 X;  4LSZ E;  4I6T A;  4WNG A;  5EN5 D;  2ZXW E;  4FBI A;  3QKY A;  2HM8 A;  3C5R A;  4J8F A;  4ANX A;  2BTD A;  1EPU A;  3NF1 A;  1IHB A;  4JA7 A;  3BQO A;  2V4H C;  2FBN A;  2QYJ A;  1CQT A;  4J8D A;  3E33 A;  3FU0 A;  1JFT A;  3ZVV A;  3TGO A;  4F7A A;  2JCG A;  3KXA A;  3AAA C;  1ELK A;  2BKG A;  3CK7 A;  4JVS A;  4B8A A;  1LTX A;  2JVL A;  4FAD A;  3V79 K;  1OCT C;  3DBS A;  3FMY A;  3EIJ A;  4B93 B;  4WNF A;  1ZZ9 A;  2ZU6 B;  3JXD L;  4FJZ A;  1UXD A;  3B7B A;  4U63 A;  3LJN A;  2EWT A;  5FQ4 A;  1OCC E;  3NZL A;  1D8D A;  2JEK A;  1TNB A;  3CVN A;  3UM3 A;  1FVH A;  3ZUV B;  5AIJ A;  5HS0 A;  1OCZ E;  3BUA A;  3S7J A;  4U07 A;  2X6F A;  3DWL G;  3CR3 A;  2AXU A;  3OAW A;  5BXO A;  5JMN D;  2Y4T A;  5AAR A;  2NYJ A;  2WXF A;  2JAB A;  3S2A A;  3RU0 A;  3S8Q A;  3MYV A;  3JUI A;  4QFV A;  2P2C P;  3RRN B;  3UX4 A;  1QP0 A;  2QZA A;  3FDH A;  4KT6 B;  3NOG D;  2RFA A;  5EX0 A;  3APD A;  1PRA A;  1N4R A;  2WXQ A;  2AXV A;  2MEZ A;  1UN9 A;  2L0T B;  2PZI A;  1YMP A;  4FHJ A;  1E90 A;  3DXK G;  2IQC A;  4JHK A;  2H6F A;  4ACL A;  2P9I G;  3I4R B;  3VLE A;  3HXE A;  5JJ6 A;  4J1X A;  2V5F A;  4DRX E;  3B7H A;  3ZKC A;  1Y7Y A;  3TL5 A;  3QOX A;  4ANU A;  3ASH A;  4Z58 A;  3GZ2 A;  2PUF A;  3ZXP A;  4G23 A;  3QOW A;  2H6I A;  5FZR A;  4OVU A;  5A7D B;  4DLQ A;  2MHK A;  4UQX A;  1WH8 A;  3ULQ A;  4GZC A;  4JXT A;  1UJK A;  4GA1 A;  3APF A;  5DSX A;  1CJG A;  1U3D A;  2PXB A;  4APO A;  3UUX A;  2R05 A;  2J8S D;  2ZIR A;  1S70 B;  1BDI A;  2GW1 A;  1JWF A;  3QC1 A;  2A4Z A;  3KEZ A;  2LYQ A;  2XGO A;  5CRU A;  3FP3 A;  4BT9 A;  1SA4 A;  3QFI A;  2LO6 A;  3E34 A;  2H8R A;  1D8E A;  4K03 A;  3UTM A;  4X4F A;  4Q69 A;  2VQ2 A;  1TEZ A;  2BNM A;  3B7T A;  1R63 A;  1H0A A;  3UM1 A;  2JQE A;  3V30 A;  2M4H A;  2KBX A;  3T5X A;  4XEI G;  3JCK C;  4EZK A;  4B0Z A;  4I6G A;  1Y6I A;  1JFS A;  1POU A;  4AXH A;  3AU5 A;  2AXZ A;  5ENP D;  3TWS A;  3U9W A;  3PEU B;  3MKR A;  5KCM A;  3F6W A;  1Z3Y A;  2EIM E;  4HQD A;  4CDN A;  4I6J A;  2ICT A;  3D9H A;  2IY0 C;  4O8B A;  4LEU A;  4L1B A;  5H7P A;  5CEA A;  4R7L A;  4HI8 A;  4FC8 A;  2KCK A;  3UXG A;  3ASO E;  3RJV A;  3ZFW A;  5EDS A;  4FU3 A;  1H6O A;  3UPV A;  4PDX A;  2I9C A;  4QQI A;  1ZZB A;  2FI7 A;  2PQN A;  3WXX A;  2R63 A;  3EDT B;  4DLO A;  4BES A;  3FUH A;  2AUW A;  3BG0 B;  2IF4 A;  4GTT A;  4JC8 A;  3OKZ A;  4J0U A;  4HB5 A;  1WDY A;  4TUM A;  4B94 A;  3S7B A;  2RFM A;  5LCW C;  4GTR A;  2KCL A;  4EQZ A;  3IEG A;  3HVE B;  3HZI B; 
#chains in the Genus database with same CATH homology
 2QY7 A;  1VDY A;  3L08 A;  1X5B A;  4BSX A;  4EEC A;  3PE3 A;  3OQM A;  3FUE A;  1OWO A;  4FLH A;  3L54 A;  4HOT A;  3TG5 A;  3FUN A;  2FUL A;  3N71 A;  2XPY A;  4Y6C A;  2WUS R;  3CK8 A;  4Z59 A;  2QFC A;  2WQ6 A;  3CK9 A;  1YA0 A;  1WM5 A;  4J1W A;  2CG3 A;  3OTN A;  4M3O A;  2VSX E;  3PRZ A;  4RSY A;  2XHE A;  3VTX A;  1MHQ A;  3D1N I;  2PUC A;  4JCY A;  2KEI A;  4F3V A;  5KJM A;  1E8W A;  4DK5 A;  4L2Y A;  4O6F A;  2A6C A;  5G05 J;  4BTA A;  5FQ6 A;  5K98 B;  4JZY A;  2VGX A;  1RIO A;  3GZS A;  3IBE A;  1R69 A;  4ANW A;  2UWJ G;  3BD1 A;  3CLJ A;  5LOZ A;  5G2N A;  1H2T C;  2VJ8 A;  1IQR A;  2KZT A;  4EQF A;  2IU1 A;  2WXN A;  4CGW A;  2PM7 A;  2LAH A;  3LY7 A;  5KJN A;  1PER L;  4YVQ C;  4RVB A;  4G1T A;  2UY1 A;  2J08 A;  1U3C A;  2WXP A;  3CVP A;  2MOW A;  4BTB A;  4CRW A;  4AOF A;  2ILR A;  3PDN A;  3ENE A;  2WQH A;  3H5T A;  4GZ3 A;  4IUL A;  4I9C A;  5BUZ A;  3ZHE B;  1ADR A;  4H7X A;  4Y6W A;  3CVQ A;  3CLC A;  1NA3 A;  4FA6 A;  4UQY A;  1N52 A;  4AIF A;  2OR1 L;  3QWW A;  2Y3A A;  3AS4 A;  3QWV A;  4GA0 A;  2WXJ A;  1QQE A;  3QK0 A;  5CHE E;  2IJG X;  3FEY A;  1ZAY A;  3TXN A;  3QWG A;  3U66 A;  1ZZ8 A;  2PL2 A;  3O4Z A;  1A17 A;  4HOU A;  1DVP A;  4E85 A;  3D9P A;  4JA9 A;  4PS7 A;  4IA8 A;  3BEE A;  4IVZ A;  1S7E A;  4U8H A;  4CEM A;  2VTB A;  1KT1 A;  2XGM A;  3CRO L;  1RPE L;  3VTY A;  3PXP A;  3FUM A;  4N3C A;  4OVV A;  3AU4 A;  2XPZ A;  3GZ1 A;  2LYS A;  3R9A B;  2J09 A;  5FWQ A;  5KJL A;  3FUL A;  1HZ4 A;  3FUJ A;  4J6I A;  4B8C B;  2WXO A;  3SCH A;  4X4B A;  4KVO A;  2XI8 A;  2KZT B;  1JPL A;  5T4Y A;  1DWK A;  4AJW A;  5JHB A;  3G7D A;  2OVB A;  3R1F A;  5J90 A;  4JEH A;  3FUF A;  2CFU A;  1UXC A;  4Z5H A;  4X4D A;  1HFA A;  3AS8 A;  4PS3 A;  3SHF A;  2UY1 B;  2O4A A;  2R5S A;  4GA2 A;  4XI9 A;  2BNN A;  2GRL A;  4GYY A;  2BUG A;  1EDU A;  5DIZ A;  3ZHI A;  4E6H A;  3SZ7 A;  3LFP A;  4WND A;  5ENN A;  3JXC L;  1H6K A;  2X38 A;  3CHO A;  3FTY A;  3HYM B;  4IN3 B;  3MZL B;  3PS6 A;  1RZR A;  3SFZ A;  1LMB 3;  4DI4 A;  2LYJ A;  3CVV A;  1LQC A;  3LXU X;  2IOL A;  4I6U A;  4B89 A;  3FHE A;  2CHX A;  1QQA A;  2VGY A;  3FH5 A;  4I9E A;  3GW4 A;  3KAE A;  5FTP A;  4ILG A;  4G11 A;  3R7R A;  1WET A;  4ABN A;  4IWR A;  1OSL A;  4MS6 A;  2J07 A;  3EIQ C;  3CST A;  3MLF A;  2HIN A;  4IRU A;  2ICP A;  1MQS A;  2YIN A;  1TJF A;  3FTV A;  3LDZ A;  3QNK A;  3T5V A;  5AJL A;  2ION A;  2LYK A;  2IVQ A;  5CCL A;  2BJC A;  3R7Q A;  3ML8 A;  2D5V A;  4G24 A;  4YND A;  4I43 A;  3QDN A;  3E4B A;  2DBA A;  4JCX A;  2GRM A;  2RD0 A;  5D0O D;  4NRH B;  5AYW D;  4PU4 C;  2X3M A;  4YVO A;  1UG3 A;  4N3B A;  2M63 A;  2XSD C;  4UQZ A;  4C0M A;  3SF4 A;  3CQG B;  4YG4 A;  5ARF A;  4I8T A;  1QNF A;  1WY6 A;  3U3W A;  2PQR A;  3CHM A;  3OXL A;  4G26 A;  4Y42 A;  2YHC A;  3MV3 B;  3ZYM A;  4V3I A;  2L0I A;  3FEX A;  1E7V A;  3PZD A;  3QJZ A;  3LCA A;  1NZN A;  4APF A;  3UFD A;  3CKB A;  1Z6T A;  3LPZ A;  2NXP A;  3LS8 A;  2OND A;  3I4G A;  3LVQ E;  3ASD A;  3ONK A;  2WXK A;  2VSY A;  3LIS A;  4X4E A;  2J4B A;  4LER A;  1GT0 C;  4N3A A;  4I6R A;  3TRB A;  4Q94 A;  3RIB A;  4AVX A;  4WAF A;  3FY4 A;  2XEV A;  3D9L A;  1AU7 A;  4A3T A;  4NQ0 A;  5FQ7 A;  2X6I A;  5LFA A;  2AWI A;  2NSZ A;  2PIJ A;  3TXM A;  3ZRH A;  1E96 B;  1NA0 A;  3B13 A;  3PUK A;  4GYO A;  3CHP A;  4J8S A;  2C0M A;  5G04 J;  3NQP A;  2R1J L;  3RRU A;  3P1U A;  2BNO A;  4X4C A;  3FTX A;  1SQM A;  4MCX A;  2CHZ A;  3ZEF A;  5ANL A;  1UTX A;  5FQ8 A;  2CRO A;  2PE5 A;  1ZZ7 A;  4GMJ A;  1IC8 A;  1QPZ A;  2L9B A;  3I5P A;  3MCX A;  4GYW A;  3CHS A;  5E75 A;  1HX8 A;  4GZD A;  4RG6 A;  4HOS A;  3B7R L;  4XE0 A;  4JHJ A;  5BT1 A;  5BW8 C;  2J9Q A;  4MCT A;  1KLX A;  5AEN A;  3MKQ B;  4EZL A;  5JHA A;  4F8D A;  4KYO B;  3NZS A;  2V0P A;  4YAR A;  4HOR A;  2PPX A;  2IFU A;  3IHY A;  4LRZ A;  4N5C A;  1X2L A;  1E3O C;  2VSO E;  3Q49 B;  4FUL A;  3UT8 A;  2XCB A;  3KS2 A;  3QWP A;  3DPD A;  2IOS A;  2LYP A;  4J8E A;  2KPJ A;  3CVY A;  1WH6 A;  5A7L A;  1HF0 A;  2CSF A;  1LLI A;  3G2U A;  3QOU A;  1FVF A;  2BF0 X;  5BPP A;  4WWN A;  5E76 A;  1ZZ6 A;  1ZVV A;  5A6C A;  4I6T A;  4WNG A;  4U0Z A;  4I1M A;  4L7T A;  3G2T A;  3MA5 A;  1UN8 A;  3NZU A;  4YG7 B;  4UWH A;  2PUG A;  1JWG A;  3S7F A;  4N2Q A;  2WXL A;  3QQ6 A;  3PH0 C;  4DPR A;  1XGW A;  4EBA G;  3CSF A;  3PVL A;  4UI9 C;  4FBI A;  1QP7 A;  1OWP A;  3QKY A;  3RK6 A;  2V4L A;  1E8X A;  4ILI A;  2EBY A;  2HM8 A;  3FUD A;  4PH4 B;  4GZ5 A;  5FT9 A;  4GB9 A;  1H19 A;  2LYL A;  3LY8 A;  3G2W A;  1O4X A;  2NC9 A;  4J8F A;  4U04 A;  4ANX A;  3UQ3 A;  5HI7 A;  1N54 A;  3URZ A;  2BTD A;  1EPU A;  2PM6 A;  3NF1 A;  4HXI A;  2WXR A;  2KM4 A;  4JA7 A;  4KZC A;  3TG4 A;  2GGF A;  5BNW A;  3QYX A;  2OOE A;  3CHR A;  2R59 A;  2O49 A;  1ZPQ A;  3KZ3 A;  1E8Y A;  1CQT A;  2FBN A;  4J8D A;  3SCF A;  4JW1 A;  2X6K A;  3ZXS A;  3FU0 A;  3L17 A;  3O48 A;  4JHR A;  1JFT A;  4KVM A;  4K0R A;  4N39 A;  3LYA A;  3UT4 A;  3PEV B;  3ZVV A;  3QB2 A;  1IHG A;  3TGO A;  4EBA A;  1BDH A;  2PUA A;  4F7A A;  5FZQ A;  5BV1 A;  3EUS A;  2P58 C;  3PUJ A;  2JCG A;  3U4T A;  3KXA A;  2WB2 A;  3L16 A;  1ELK A;  3FTU A;  3UMV A;  2OVF A;  3CK7 A;  3ZYL A;  3ASF A;  1ZUG A;  5LCW J;  4JVS A;  3Q5M A;  4UWF A;  4WWP A;  3SBT B;  2VGX B;  4B8A A;  4NUR A;  2I1J A;  2JVL A;  4FAD A;  4FN3 A;  1SQ8 A;  2WXG A;  1NEQ A;  3BG1 B;  2VSN A;  3JQ0 A;  1OCT C;  3CVW A;  3DBS A;  3QF3 A;  4GHJ A;  3FMY A;  2CG2 A;  3EIJ A;  4G2V A;  4WNF A;  5G55 A;  2OFY A;  5LP0 A;  3HHM A;  2XJ3 A;  4HOQ A;  1ZZ9 A;  2ZU6 B;  5G05 C;  1L1M A;  3JXD L;  4FJZ A;  1UXD A;  2L8N A;  3AS5 A;  4U63 A;  3MEK A;  2EWT A;  5FQ4 A;  3I3N A;  4A3V A;  4C9B B;  3FTS A;  1Y9Q A;  3T8M A;  4BFR A;  2JEK A;  2CHW A;  3CVN A;  3D9K A;  3K9I A;  1FVH A;  2KEJ A;  2OV8 A;  3FUI A;  4WNE A;  4WWO A;  5AIJ A;  4GML A;  4JQD A;  4XKC A;  3S7J A;  4U07 A;  4HLE A;  2DCP A;  1H2U A;  2YNQ A;  3CHQ A;  5D0Q D;  4AM9 A;  4XIF A;  4EPZ A;  2X6F A;  4GU5 A;  3CR3 A;  2AXU A;  3OAW A;  3CVU A;  1DW9 A;  2XRY A;  4KZ0 A;  2Y4T A;  1UW4 B;  3CVL A;  3OQN A;  3UT7 A;  4PUC A;  2XCC A;  3G5G A;  1HF8 A;  3CV0 A;  4I1O B;  4TV3 A;  4MKT A;  1LF8 A;  1ZU2 A;  2XGS A;  3D9M A;  3HVE A;  4GQM A;  3SNX A;  2WXF A;  1HH8 A;  3QAQ A;  3S7D A;  2VTB B;  4N2S A;  1HU3 A;  2DIW A;  3APC A;  3S2A A;  3ZW3 A;  3ZHM A;  3MX3 A;  3RU0 A;  2XCJ A;  4HFG A;  4AP2 A;  5EKQ D;  5C1D A;  3S8Q A;  2JLB A;  3MYV A;  4HS2 A;  1B0N A;  2HO1 A;  3JUI A;  3LVR E;  1XWR A;  1PY1 A;  4G25 A;  4KBQ A;  4QFV A;  3RRN B;  4OYS A;  3SGH A;  3ONL A;  4W9R A;  1QP0 A;  1P5Q A;  3UX4 A;  4NDW A;  2KEK A;  3FDH A;  4PS8 A;  2WXH A;  4KT6 B;  3D9N A;  4X4H A;  3O9X A;  2PUB A;  2CFZ A;  4KMO A;  3GN5 A;  4YBA A;  2XPI A;  5EX0 A;  1UJJ A;  4XI0 A;  3APD A;  3PNL B;  1PRA A;  4XX5 A;  2WXQ A;  2AXV A;  2MEZ A;  2XIU A;  3JXB C;  3OQO A;  1UN9 A;  2L0T B;  2PZI A;  4JL0 A;  4ACK A;  4BX8 A;  4X4I A;  3LKU A;  1E90 A;  4FHJ A;  1YSE A;  3IHV A;  2MQK A;  3ZN3 A;  3G2S A;  4AEZ C;  4U0U A;  2IQC A;  4JHK A;  1ELW A;  1NP7 A;  3ML9 A;  3G2V A;  3TJP A;  4ACL A;  4BT8 A;  4GAA A;  3I4R B;  1H2V C;  4GCO A;  5JJ6 A;  3VLE A;  3VLD A;  4J1X A;  4OB4 A;  4LCT A;  4PU8 A;  2V5F A;  5FZS A;  4LUN U;  2YQ8 A;  3B7H A;  3ZKC A;  1Y7Y A;  2A5U A;  4I17 A;  4I6E A;  4Z5C A;  4MLP A;  5DBK A;  3TL5 A;  3CKC A;  2HR2 A;  2LAI A;  3FWV A;  3ZHE A;  3MGB A;  3SCG A;  4YG1 A;  1RZR D;  3ASH A;  3HDX A;  4ANU A;  1ELR A;  4XZ4 A;  4ME2 A;  3FH7 A;  3ZYQ A;  4TRQ A;  1OWN A;  1S0P A;  1XNF A;  4Z58 A;  1WAO 1;  2KCV A;  3GZ2 A;  2PUF A;  4G23 A;  4BX9 A;  4C0E A;  2GZU A;  3D9O A;  4DI3 A;  3D3M A;  3F52 A;  1ZZC A;  2KZ8 A;  5FZR A;  4I1A A;  1HG5 A;  4CCA A;  1Y8M A;  4OVU A;  5A7D B;  4A1S A;  2AW6 A;  1EYH A;  4DLQ A;  1ZS4 A;  3OXG A;  1Z3X A;  2MHK A;  4UQX A;  1WH8 A;  2O38 A;  2I2O A;  3ULQ A;  4GZC A;  2LSV A;  3OXF A;  4I2W A;  2J49 A;  2KC7 A;  3L1P A;  4CDR A;  2WMN A;  4JXT A;  1LCC A;  2C2L A;  1UJK A;  2WQ7 A;  4GA1 A;  3APF A;  2IVG A;  3VK0 A;  1CJG A;  5T3R A;  1U3D A;  3FU5 A;  3GN5 B;  3L6A A;  2E2E A;  4Q96 A;  4F53 A;  4ILH B;  2V8S E;  2EF8 A;  4PU7 A;  4APO A;  1PRU A;  2WXM A;  2YHE A;  3CIA A;  3FYA A;  1ZBP A;  1VPW A;  3D9I A;  3UUX A;  5A23 A;  2J4D A;  5FJY A;  2B5A A;  2R17 C;  1RZS A;  1SZA A;  3B7U X;  4UWK A;  5M72 A;  3IV0 A;  3BS3 A;  3Q47 B;  1BDI A;  3FH8 A;  3CGH A;  2GW1 A;  1QQB A;  1JWF A;  3QC1 A;  5J08 A;  2XRZ A;  1QP4 A;  5ANR A;  3MJW A;  1LCD A;  2FF4 A;  4CT0 A;  2A4Z A;  3KEZ A;  1GW6 A;  2LYQ A;  2XGO A;  3D9J A;  3FTW A;  3FTZ A;  3GYZ A;  3FP3 A;  3CQC B;  4BT9 A;  4GPK A;  1PNR A;  4CGV A;  4UWL A;  4U0S A;  2IVB A;  5G04 C;  3P2B A;  4KXK B;  2LO6 A;  2I1K A;  2AVP A;  3L22 A;  4A55 A;  1HXI A;  2H8R A;  3ESK A;  4K03 A;  4X4F A;  3BDN A;  5KJK A;  4NAC A;  4AY6 A;  4FJY A;  4I2Z A;  4X4G A;  2X6J A;  3SD5 A;  2VQ2 A;  4Q69 A;  1NER A;  1TEZ A;  4AY5 A;  1E7U A;  4PU3 C;  3EJN A;  3FFL A;  1KT0 A;  3QAR A;  2BNM A;  2LNI A;  3B7T A;  4GCN A;  4IYP A;  2KAT A;  4RG9 A;  4XKB A;  1QZ2 A;  3ESL A;  1R63 A;  2LYR A;  3OP9 A;  1PC2 A;  4Z5D A;  2Q7F A;  4JEU A;  3JQ1 A;  1H0A A;  2RG8 A;  5CMW A;  1JUQ A;  1JWL A;  4URK A;  1HE8 A;  5BV0 A;  3FU3 A;  4BY6 A;  1HO8 A;  2WMO A;  1EFA A;  4HVB A;  4TUU A;  4F1S A;  3T5X A;  2WVI A;  4UI9 K;  1HS6 A;  2LSU A;  2XQ0 A;  3HIZ A;  1E8Z A;  3JCK C;  3LEW A;  3PNT B;  3TAX A;  2WXI A;  4EZK A;  3CVX A;  2WM9 A;  1EF1 C;  4B0Z A;  1BPO A;  5CCM A;  2L6J A;  4I6G A;  1Y6I A;  3OMT A;  1JFS A;  1W3B A;  4GZ6 A;  2WPV A;  3SI5 A;  1DNP A;  2WIU B;  2C0L A;  4ATG A;  4ANV A;  1POU A;  4D10 C;  5LX8 A;  4AXH A;  4EZJ A;  3AU5 A;  1FCH A;  3IKO B;  2L49 A;  3L13 A;  1OWM A;  3ZPJ A;  3U64 A;  2HYZ A;  2AXZ A;  1L5J A;  2FJR A;  4H7Y A;  3U9W A;  3PEU B;  3MKR A;  5C2Y A;  5KCM A;  4CT4 A;  3F6W A;  1Z3Y A;  3ZIM A;  4CDN A;  2IU7 A;  2FEZ A;  4I6J A;  2ICT A;  2IUO A;  4O8B A;  2HSG A;  4LEU A;  1X57 A;  4L1B A;  3GBF A;  5EX3 A;  4R7L A;  1IQU A;  3ASG A;  5CMY A;  4P29 A;  4FC8 A;  4AV7 A;  3Q15 A;  3RO3 A;  1OUV A;  3PRE A;  2KCK A;  2VYI A;  3MV2 B;  3RO2 A;  2IV1 A;  2MRI A;  3EHN A;  3RJV A;  3ZFW A;  1B89 A;  5EDS A;  4FU3 A;  4A1G A;  3UPV A;  4PDX A;  4L2L A;  2I9C A;  3JYS A;  3VLF A;  2PUE A;  4MRU A;  4L23 A;  5HQ8 A;  1WIZ A;  1ZZB A;  2X6H A;  2FI7 A;  3MKQ A;  1PRV A;  3ZGQ A;  3KD7 A;  2PQN A;  1JH9 A;  3WXX A;  3FUK A;  5JJT A;  1SZ9 A;  3F51 A;  2R63 A;  3EDT B;  4DLO A;  2FO7 A;  2LCV A;  3LJ3 A;  2E0I A;  4UI9 J;  3PE4 A;  3FUH A;  4UWG A;  2AUW A;  3BG0 B;  3FU6 A;  2IF4 A;  3IVP A;  2Y4U A;  3B7S A;  1PAQ A;  4JC8 A;  1OWL A;  3SBS A;  3Q4A B;  4J0U A;  3RKV A;  5T8I A;  4B94 A;  5JJ7 A;  3KJX A;  3CEC A;  2PUD A;  3S7B A;  3LY9 A;  4WUY A;  4BWR A;  4JPS A;  4FP7 A;  3FYM A;  4CDM A;  5LCW C;  1INZ A;  5ARG A;  2KCL A;  3RRM B;  2I6H A;  1HG2 A;  4FHK A;  3IEG A;  5AJD A;  3ZYK A;  3DNV B;  1TJC A;  4DJA A;  3CEQ A;  3EHM A;  3HVE B;  3RZZ A;  3C98 A;  3HZI B;  1IYG A;  4FLB A;  2EQX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...