2AWIA

Structure of prgx y153c mutant
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
300
structure length
298
Chain Sequence
FKIGSVLKQIRQELNYHQIDLYSGIMSKSVYIKVEADSRPISVEELSKFSERLGVNFFEILNRAGMNSVNETGKEKLLISKIFTNPDLFDKNFQRIEPKRLTSLQYFSIYLGYISIAHHYNIEVPTFNKTITSDLKHLYDKRTTFFGIDCEIVSNLLNVLPYEEVSSIIKPMYPIVDSFGKDYDLTIQTVLKNALTISIMNRNLKEAQYYINQFEHLKTIKNISINGYYDLEINYLKQIYQFLTDKNIDSYLNAVNIINIFKIIGKEDIHRSLVEELTKISAKEKFTPPKEVTMYYEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords PrgX
publication title Structure of peptide sex pheromone receptor PrgX and PrgX/pheromone complexes and regulation of conjugation in Enterococcus faecalis.
pubmed doi rcsb
source organism Enterococcus faecalis
total genus 111
structure length 298
sequence length 300
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2005-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2awiA01
1.25.40.400 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2awiA02
2AXVA 1JFTA 1CQTA 2PUCA 4JCYA 4MCXA 4YBAA 2AWIA 1BDIA 3JXCL 2PE5A 1PRAA 3QYXA 3UFDA 3FYMA 1UTXA 3G7DA 4YARA 4IWRA 1ADRA 3F6WA 4X4HA 2XSDC 5A7LA 3L1PA 1POUA 1JWLA 2PUBA 2B5AA 2OFYA 2IVGA 5K98B 4FN3A 3BD1A 1LMB3 2PIJA 2BJCA 4Z5CA 4PU7A 1LLIA 1ZVVA 4OB4A 3U3WA 3ZKCA 1JH9A 1ZZ8A 2HINA 3ZHIA 1Y7YA 3OQMA 1BDHA 3MLFA 4YG7B 1Y9QA 4PU4C 4MCTA 2JVLA 2KEIA 2LYQA 2CSFA 1B0NA 2L49A 3OP9A 3F51A 3QF3A 4YG1A 1DWKA 1WIZA 1XWRA 1RZSA 3ZHMA 1S7EA 1NERA 1AU7A 3GN5B 1PRUA 2IU7A 4GHJA 4NDWA 3OQOA 1ZZBA 3S8QA 1PERL 1QQAA 3KZ3A 3LISA 3HZIB 4Z5DA 2EBYA 2GZUA 4X4IA 3BS3A 4Z58A 3QWGA 2PUEA 2MQKA 1UXDA 1R63A 3QQ6A 3D1NI 2XI8A 1OCTC 1O4XA 3KXAA 1DW9A 3BDNA 1ZUGA 3SCHA 1ZS4A 2XIUA 1ZZ7A 2IVQA 3JXDL 1ZZCA 3SCGA 3O9XA 3R1FA 2PUGA 3IVPA 2D5VA 1LQCA 3KJXA 2BNNA 2XCJA 2R63A 3F52A 1IC8A 1X2LA 3B7HA 2BNMA 1EFAA 4J1WA 4IA8A 4X4CA 1PRVA 2IV1A 2PPXA 4I6RA 3DNVB 3LFPA 4Z5HA 2KEJA 1PNRA 4GQMA 2O49A 2O4AA 1LCCA 2L8NA 2KZ8A 4X4FA 1GT0C 2XJ3A 1RZRD 4X4DA 2IUOA 3OMTA 1ZAYA 1JFSA 4Y42A 1SQ8A 2LYPA 2PUDA 1YSEA 3FYAA 2JCGA 1ZPQA 4PU3C 3CECA 1LCDA 1RZRA 1RPEL 4F8DA 3CROL 4X4EA 3H5TA 1QP7A 4I8TA 1OSLA 1QP0A 1R69A 3TRBA 1QPZA 2AXZA 2LYLA 3CLCA 2R1JL 2GRLA 3JXBC 2GRMA 4J1XA 1ZZ9A 2IVBA 2H8RA 1ZZ6A 2ICPA 2WIUB 2CROA 4I6TA 1NEQA 2A6CA 2LCVA 2LYKA 3GBFA 3VK0A 4X4BA 2EWTA 3OQNA 1WETA 1QQBA 1X57A 4Z59A 1QP4A 1WH6A 2LYJA 2HSGA 3FMYA 2EF8A 2AUWA 2AW6A 3GN5A 1HF0A 2LYRA 1E3OC 2FJRA 2AXUA 2BNOA 2WUSR 2O38A 1UXCA 4X4GA 1CJGA 4YG4A 3G5GA 2LYSA 2PUAA 3PXPA 2KPJA 1WH8A 4JQDA 2MEZA 4FBIA 4JCXA 2OR1L 1L1MA 3EUSA 2PUFA 4I6UA 1VPWA 3SCFA 2KEKA 4IVZA 1RIOA 4O8BA 3RZZA 4PU8A 2ICTA
chains in the Genus database with same CATH superfamily
3JXJA 4MKTA 2IF4A 1DC2A 1N11A 4DI3A 4N5CA 3UM2A 4X4HA 2LLVA 5A7LA 2Y3AA 3KSQA 4J8FA 2OOEA 3BD1A 3OAWA 5G04J 2KATA 4HOSA 3U3WA 5JHAA 5KCMA 1UG3A 1Y7YA 3G2VA 3D9OA 4FLBA 1FCHA 2KEIA 1NZNA 3MGBA 2IQCA 1VDYA 1RZSA 4M3OA 5KNHD 4GHJA 5C2YA 1ELWA 4Z5DA 3L22A 1HE8A 3KXAA 3X2QE 3T9KA 4CGVA 4G1TA 3Q9UC 2A5EA 2WXNA 1FVFA 1IXVA 3Q9NC 3KAEA 3A9ZA 3I3NA 3PZ1A 1YCSB 2FO1E 4HQDA 4OYSA 3PZDA 2Q7FA 3QJZA 4WAFA 5KNGA 4E85A 3IXEA 4ILGA 1ZAYA 4HRNA 2AJAA 2J9QA 4I17A 2PUDA 2JCGA 1LCDA 1OCOE 2XEHA 3D9HA 5GAHi 3FH5A 4CEMA 1P5QA 4J1XA 5CECB 1XNFA 4DI4A 3LY9A 2NC9A 3GBFA 5LX8A 1QQBA 1QP4A 3LXUX 3ABME 4LERA 4HXIA 3AU5A 3MKQA 1K1BA 4G23A 2NSZA 2I2OA 2PUFA 3W9GA 2J09A 3RAUA 3ONKA 1D9SA 2MXDA 2IFUA 2ICTA 4AM9A 4CT4A 3EIJA 2E2EA 3IHVA 4C9BB 3PUJA 3AS5A 1FT1A 4K5CA 1PAQA 1E8XA 3FUJA 4J6IA 1OCZE 4TUUA 1N4SA 2X3MA 2JABA 4PU7A 4HB5A 3D9PA 3HXBA 1Z5SC 3LVRE 1XWRA 4ILHB 4NACA 2GRPB 4J8EA 4L23A 1UN8A 1MX4A 1QQAA 3AAAC 5AQ7A 4LNBA 3FEYA 1TN7A 4DX5D 4FJZA 2XI8A 3E4BA 2OVBA 4I6GA 4U96D 4K03A 2XZDG 5D0OD 2JQEA 1ZZCA 5HKPA 1KT0A 2DZOA 2LLWA 3ZU7B 1X2LA 2IY0C 4X4CA 3U64A 4I6RA 2P9SG 3T8KA 5AQBA 2WXQA 5CBOA 4BT9A 2HR2A 1LTXA 3HIZA 3UI2A 4X4DA 4EBAG 5CCLA 4APFA 3AG3E 5BW8C 2VSOE 2GRLA 4PH4B 4IN3B 4MRUA 3MA5A 4ZFHA 4QFVA 5KBAA 1SZAA 2V4LA 1IHGA 2PZIA 4FADA 1WH8A 2XZTG 2XPIA 3IBEA 3T5XA 4UQXA 2PM6A 4B8AA 4YVQC 5CBNA 4KVMA 2KCLA 4PS3A 4EZKA 1HQ1A 3L1PA 3L82A 2L9BA 3L08A 1NA0A 4PS7A 3DWLG 5CMWA 1LD8A 2BJCA 4N2SA 1U2ZA 3ISMC 2CFZA 3QB2A 3SFYA 1ZZ8A 3HXEA 3I4GA 4XKCA 2HCNA 3NOGD 4PU4C 3TG5A 2Y0BG 2GRQB 2ONDA 1JCSA 5ENQD 2DYRE 4Q69A 3OXGA 3FUEA 1TN6A 2R59A 4L2YA 5ITZF 2HO1A 3PREA 2IOLA 2NXPA 1HH8A 3SCGA 3GZSA 3ABKE 5EYLA 2LAIA 2P2CP 1V54E 3ZYMA 4J7WA 1LCCA 3RO3A 3ZRHA 2KBXA 2VJ8A 3NBNB 2PXPA 2V5QC 2RFMA 3O48A 4UI9J 2L1PA 4PDXA 4XIFA 2IU1A 3K9IA 2VGYA 1HO8A 4A3TA 3D9KA 4I6TA 2CROA 4TRQA 1N54A 2VYIA 3CHRA 1SW6A 3D9JA 3AG4E 2EIKE 3GN5A 3GZDC 1E3OC 2BUGA 1Z3YA 3CK7A 2YINA 3G2TA 4JHJA 2HYZA 3QDNA 4LCTA 1MQSA 3RO2A 4UWLA 2OEVA 4F1SA 2XRYA 2GRRB 3ASFA 4MCXA 2PM7A 4I9EA 5EDSA 4L1BA 3QWWA 2B5AA 4Y6WA 4QQIA 4FN3A 2R05A 1QYMA 2H6HA 3VLEA 1K1AA 3F51A 3C5RA 3TELA 2P9IG 4ILIA 2YNQA 4BTBA 3EHRA 1PERL 1HXIA 3L16A 2EINE 3LISA 4ER3A 1UXDA 3FDHA 2LUHA 4BERA 2RG8A 3SCHA 3EHMA 1S70B 3UWPA 3HYMB 3Q78A 3O9XA 4NIKA 4I9CA 5LFAA 3MJWA 1RW2A 3TXMA 2CHZA 2KEJA 4EZIA 4YVOA 5EX0A 3MX3A 3CVPA 3SR4A 3DM5A 4X4FA 1GT0C 2KZTA 2X6HA 4TXRA 1SQ8A 2WXOA 3ULEG 1RZRA 1RPEL 3HVEA 4I8TA 3H5TA 1H2UA 1OSLA 1QP0A 3E34A 3FU3A 1S63A 3R09A 4GTQA 2ICPA 4F3VA 1MFQC 2A6CA 5JUWA 1JWGA 2PXUA 3LJ3A 1BI8B 2PXFA 2YQ8A 3UIOC 3JCKC 3FUMA 2BKKB 4GA1A 3PE3A 2A5UA 1IQRA 4XI9A 2KCKA 5DTQA 4EQFA 3L9TA 1VPWA 2KEKA 4WUYA 1RIOA 4AY6A 2XXQA 3LDZA 2AWIA 2YHCA 4DE9A 3TXNA 4BWRA 4WWPA 5ENOD 1OWNA 4ANVA 5CERB 3BUAA 3LYAA 2DBAA 4ANUA 1OCRE 4PUCA 3SBSA 4U8HA 5LOZA 1BDHA 5EILA 5LP0A 3ZIMA 4B8CB 5KWDA 1AWCB 2XEVA 3ULQA 4A63B 3KZ3A 2XXPA 4FC8A 4CDRA 3AG1E 2WQ7A 3LJNA 3QWGA 2R17C 1N95A 5JHBA 1AP7A 1O4XA 3UM3A 3OTNA 3WG7E 4AP2A 4DJAA 3DBSA 5FZSA 2KM4A 4HOQA 3TJPA 1LQCA 4JL0A 4FA6A 3B7SA 5LCWC 4A1GA 2EIME 4DX7D 2IV1A 4Z5HA 1PNRA 5AJDA 5BV1A 3R7QA 3FUFA 3NDBB 4R7LA 3E30A 2BF0X 3NF1A 2PXEA 4LG6A 1JFSA 3GZ1A 3TG4A 5G04C 2J49A 3HXFA 2H6IA 3ASGA 3Q49B 4X4EA 2PNNA 4AEZC 2WMNA 3IV0A 2WIUB 4FU3A 2C0LA 2GRNB 1DCEA 2ZGGA 2UY1A 5ARGA 4K5AB 1HF0A 2AUWA 2KXPC 2KZTB 2FJRA 2PXQA 3HVEB 4G11A 3SD5A 3DSUA 3UT4A 3CVUA 3KSLA 1ZU2A 2RKKA 4JCXA 5BV0A 3BG0B 1UW4B 1KZPA 1LD7A 4GPMA 3RRUA 4I6UA 3APDA 3CVQA 5T4YA 3NQPA 2JEKA 2QC9A 3RU0A 4BESA 3M9LA 5DRYA 5HRYA 2P9NG 2LSVA 1IQUA 2IVGA 3SBTB 1QB2A 3MEKA 4O1PA 1OT8A 1SVXA 1TJCA 3SGHA 3UQ3A 4EHMA 2EILE 2F37A 2P9UG 2MYOA 2PQRA 4LSZE 3FTXA 1Y9QA 3A9YA 2XGSA 3ULYA 4B0ZA 2CHWA 3QF3A 5CEDB 1E8YA 3SZ7A 4I1MA 1PRUA 1ZZBA 5EIBE 3Q7AA 3LS8A 3JXDL 4U8YD 2VGXB 2HCSA 1EPUA 3LEWA 3B7UX 4APOA 4LEUA 3I4RB 4O1OA 2KZ8A 4WWOA 3C3RA 3SF4A 1IYGA 2IUOA 2L0IA 1YSEA 3GW4A 5FZQA 3FTSA 4GCOA 3T8MA 1QP7A 3JXBC 2PL2A 4G8LA 1ZB1A 1PC2A 3LY7A 1ZZ9A 5JJ6A 4A3VA 1NEQA 4I1OB 3C72A 3CVYA 4RSYA 2EF8A 2AW6A 1JCQA 4EZJA 2ETCA 2WXLA 3NZUA 4U04A 4B89A 4I6EA 2XPZA 4G2VA 5BUZA 3ZXSA 2LYSA 1IHBA 4MLPA 2DYSE 4UWKA 1S0PA 3U66A 5KJNA 3RZZA 2UY1B 4RG9A 1JFTA 1OXJA 4JVSA 1NP7A 3JXCL 4GAAA 1U3CA 4UWGA 3GZDA 1N4RA 4GZ3A 4F6RD 2CG3A 1JH9A 3C3OA 3ZHIA 4H7YA 3QK0A 4XEIG 2FULA 4GTTA 4UQZA 1H6KA 1HZ4A 3OP9A 4U0SA 2ILRA 1N4PA 1Y6IA 4WNDA 2V8SE 4NDWA 3V2OA 3PEUB 4UWHA 2Y4UA 1HG5A 3LCAA 2IJGX 1BPOA 4TV3A 1TEZA 5A7DB 3B95A 5FQ8A 2D5VA 3ABLE 4LNUD 1EFAA 2Y4TA 3TWSA 4XE0A 3PZ4A 3EU5A 2ZISA 2OCCE 1EF1C 3TWQA 3FTZA 2J7UA 3FH8A 4ANXA 4Y42A 1QQEA 3Q73A 1ELKA 3UMVA 5G05J 4KVOA 5B1AE 3APCA 4NQ0A 2WXPA 2H8RA 5DSXA 1E7UA 3FEXA 2EWTA 1WETA 4GCNA 4Z59A 4GTRA 3FMYA 2MOWA 1DULA 3D9LA 4UWFA 3KD7A 3OXLA 4YDOA 2AXUA 2XS1A 2MRIA 3NAWA 3G5GA 3GZ2A 5AENA 3ZFWA 1X81A 4O8BA 2PUCA 4AVXA 3ASDA 5AAOA 4HFGA 2VSNA 5AYWD 2PUBA 1DCQA 2H6GA 2GW1A 4K5BA 5A6CA 3VLFA 3S7DA 4BTAA 4JW1A 1INZA 4JA7A 1H2VC 2VSXE 5M72A 5ENPD 5ANRA 2LYQA 4ATZD 5AN8A 4I43A 3SQVA 3D9NA 1N52A 3ME5A 3CV0A 1RZ4A 5KJKA 2GROB 3DEPA 3BU8A 4Q2JA 4HORA 1OCCE 3OQOA 3HZIB 5A23A 2PUEA 3MKQB 3IEGA 4G25A 1ZBPA 3TWWA 4OVUA 4Q96A 4FHKA 4IYPA 3DXMG 3Q5MA 3R1FA 2WVIA 3KEZA 3ZXPA 4HI8A 2BNNA 4ER6A 2WXMA 2PPXA 3O4ZA 5EIDA 3FH7A 4HNAD 1MHQA 1OWPA 3QARA 3TWTA 4AIFA 4CZ2D 3EIQC 4PU3C 4C0EA 1TNOA 4P29A 2AXZA 4C48B 4CGWA 3QOXA 3R7RA 2LYKA 3E33A 2PXLA 3PZ3A 4JHRA 1OY3D 3SFZA 1HX8A 2O38A 3CGHA 1W3BA 3DSXA 2WXRA 3EUSA 2WXHA 2XENA 4BEPA 1KPSB 1HS6A 3PNLB 3LKUA 1PRAA 3UFDA 3FYMA 2WB2A 4GPKA 4I2WA 2AVPA 3CKCA 5J90A 4HOUA 4AOFA 1YMPA 2FI7A 1WY6A 3RIBA 5DTRA 2XXAA 2X6JA 3CIAA 3ZHMA 3N71A 2J8SD 3DRAA 4U0UA 4CCAA 3CVLA 4LUNU 3BS3A 4U0ZA 3ASOE 2OV8A 4N2QA 1ZUGA 3CHQA 1H6OA 1BI7B 3MKRA 3NOCD 2PQNA 4N5QA 2R63A 2EIJE 3E32A 4YDWA 3TEPA 3PRZA 2YBDA 2J08A 3FWVA 3ZVVA 2V4HC 5CMYA 3BQOA 1H19A 2O49A 2XJ3A 2C2LA 4Q94A 1H0AA 4A55A 4U8VD 2HFZA 4EZLA 3KEAA 1UOHA 4DX2A 4UQYA 3ZYLA 2R02A 4BY6A 3LVQE 3CLCA 4FLHA 2R1JL 4WNFA 5ENRD 2IVBA 3ML8A 2WQ6A 2P9KG 4X4BA 2I9CA 1X57A 4BX9A 3CKBA 3TGOA 3RRNB 3PE4A 2WUSR 1CJGA 2J4DA 2XEEA 5BXOA 3PXPA 4U63A 2LSUA 1TJFA 3UT8A 1UN9A 1DVPA 1CQTA 4JCYA 4WNEA 3S7BA 4GA0A 4GZ5A 5D66A 2LNIA 3QYXA 5FT9A 1ADRA 3EU9A 4O6FA 2Y69E 2IOSA 3TWVA 4DX1A 1YYHA 3NB2A 3URZA 1O5MA 3UIPC 5E76A 4YG7B 3LY8A 2HM8A 3G0TA 3UT7A 5HQ8A 4YNDA 2I1KA 1WIZA 4DX6D 4CDMA 1NERA 2WM9A 3GN5B 2IU7A 1E8ZA 2FEZA 3J5PA 2GZUA 2MQKA 2FF4A 1OCTC 2VTBA 2X6FA 3V31A 3BDNA 4OVVA 3ZHEA 2IVQA 1WG0A 4HRAA 3Q75A 3QAQA 4WWNA 5KJMA 1PY1A 4AJWA 3E37A 3B7HA 3ZN3A 5DRTA 1A17A 5AJLA 1PRVA 3JUEA 4HVBA 5B3SE 3CSFA 4FP7A 2O4AA 2KC7A 3CEQA 1NA3A 4GU5A 1O1SA 4NRHB 2ODRD 1KLXA 2VSYA 5BXUA 3V2XA 4IRUA 3AS4A 2LYPA 3FYAA 2I6HA 5FQ6A 3FHEA 2R03A 2DIWA 4F8DA 4KMOA 5FJYA 5IY5E 3TRBA 3CHOA 2LYLA 5T3RA 4U95D 4KXKB 2IO3C 4BX8A 3OXFA 3JXIA 3VK0A 3MYVA 3PVLA 1MZCA 2OVFA 3OQNA 3SI5A 2HSGA 3PUKA 5FQ7A 4X4GA 4YG4A 4L9PA 3T5VA 2PUAA 2MEZA 1SQMA 1L1MA 4OAUC 3ESLA 4YG1A 2BKGA 3Q4AB 4YBAA 3U4TA 1UTXA 4YARA 1OWLA 1JWFA 2XSDC 1SA5A 2OFYA 4GTSA 2QYUA 5ENNA 2ETAA 1KZOA 3UM0A 3ASHA 4CT0A 5AARA 2JVLA 1L5JA 3ASNE 3FFLA 4U07A 2LO6A 3HRAA 1DWKA 4JZYA 3RSEG 5DTMA 4JEUA 3ZUVB 3VWSA 3FTVA 1LF8A 4PS8A 2WMOA 4BT8A 1R63A 4ABNA 3UTMA 4ACKA 2ZIRA 1DW9A 2XIUA 5HS0A 1WM5A 5GAGi 4XZ4A 3QWPA 4GYWA 4BSZB 3DPYA 4GZ6A 4DRXE 3S2AA 4KBQA 3C98A 3QNKA 2ZXWE 2F0YA 4AV7A 4G26A 3SY2A 1QBQA 4G24A 3OMTA 3S7FA 5C1DA 3AG2E 3WXXA 4BETA 3MEJA 2P9LG 1Z6TA 5G2NA 4AY5A 2J7WA 5AQ9A 1D8EA 2XCBA 3RJVA 3CHMA 3GUUA 2UWJG 2LCVA 1O1RA 4ZHBA 3TL5A 3VTXA 3QOUA 3Q79A 4K0RA 2LYRA 4RVBA 2QZAA 4WNGA 2IEJA 3CSTA 1Z3XA 4I1AA 3MV2B 3CVVA 3Q7FA 3Q47B 4N3AA 3CK8A 4ER5A 4HI9A 2FFHA 3PH0C 1MYOA 2DWZA 3SCFA 4TUMA 2WXJA 3PEVB 4N3CA 5DT2A 3V79K 3ML9A 4RG6A 5ENSD 3D9IA 1N0QA 3FUNA 2I1JA 1POUA 3JQ0A 1IKND 3P1UA 1LLIA 3ZKCA 3UKRG 5CRUA 5G05C 2J07A 2RD0A 4XI0A 3D3MA 3FP3A 2FO7A 3F6QA 4C0MA 2WQHA 5EX3A 1S7EA 1AU7A 5E75A 3FULA 5HI7A 4X4IA 1WAO1 2LAHA 3DSWA 4A1SA 1NI1A 5ARFA 3QWVA 3IVPA 2VQ2A 3EDTB 1N4QA 3CVNA 4GMJA 2BNMA 4HBDA 2L6JA 1H2TC 2WXIA 3JUIA 2L8NA 3G2UA 4HLLA 5FINA 1UJKA 3DXKG 3BEEA 2DZNA 5DBKA 4JXTA 1B89A 4RLYA 2PXVA 2QY7A 2LNMA 4WVLA 1OUVA 3RKVA 4I6JA 5CCMA 1NL4A 3NZSA 2XCCA 3VTYA 3C3QA 4Z68A 1N9AA 3SFXA 4GTVA 2XGOA 3AS8A 3CK9A 2X6KA 3L13A 2MHKA 4FBIA 4V3IA 4JD2G 5AIJA 2KCVA 2WPVA 4EQZA 3L17A 1JWLA 5K98B 1E90A 2IONA 4KT6B 1HG2A 3CQCB 1LMB3 1ELRA 3I5PA 1SA4A 4GB9A 4OB4A 3FUDA 4DUIA 4B93B 2OEWA 5AQAA 1TNYA 3MLFA 3MZLB 3FUHA 3EUVA 4AXHA 4EECA 3QOWA 1JPLA 2L0TB 2DCPA 3B7BA 3PNTB 3HXDA 5FZRA 3UINC 3FU5A 4EPZA 4Z58A 3TAXA 3ENEA 2L6BA 2B6CA 5CEAA 4UI9C 1QZXA 4TXQA 3KJXA 2P58C 3G2SA 3CR3A 3B13A 2M63A 3CVXA 4L2LA 4LRZA 3L54A 4MS6A 2V5FA 3SNXA 5ANLA 4GMLA 3NXHA 2F8XK 4X8QA 3L6AA 2NYJA 2CFUA 3PDNA 1ZPQA 1JCRA 1HF8A 3V30A 4NURA 5T8IA 1HFAA 1QPZA 1G3NB 4KYOB 1HU3A 3MCXA 4GYYA 3UX4A 3IKOB 4CRWA 1EDUA 3DSSA 2BNOA 1OWMA 3ZYQA 3RRMB 5JJTA 4BFRA 1TR4A 4JQDA 2OR1L 4XKBA 2HE0A 4UI9K 4PU8A 2QFCA 4FHJA 3P2BA 2PXBA 4IWRA 1QNFA 2VEOA 3U9WA 1TYQG 2FBNA 1YA0A 4DPRA 2PIJA 3HG0D 1ZVVA 1BU9A 3OQMA 3ZW3A 1XGWA 3TFLA 1DNPA 4MCTA 2CSFA 4J0UA 3DSTA 4F7AA 4ER7A 4E6HA 3TWRA 1V55E 1FVHA 4ME2A 1WDYA 1N94A 2M4HA 1SZ9A 3MV3B 1MX6A 4EBAA 3KL4A 5FIOA 2EBYA 3AU4A 5D2MC 3B7RL 2IO2C 4BSXA 2C0MA 1FT2A 3UUXA 2PXKA 3TWUA 1JUQA 4JPSA 2X6IA 2XCJA 4W9RA 4TXPA 4HLEA 2F8YA 3LFPA 4Y6CA 5JMND 4N3BA 4F1PA 3VLDA 3SX0A 1Q2ZA 3CVWA 3RK6A 1RZRD 4EKGA 3A9XA 1GW6A 4GTOA 4JB8P 2WXGA 2XPYA 5KJLA 1E8WA 3FY4A 3JQ1A 3CROL 4YDYA 4HOTA 1TNZA 2ZU6B 1K3ZD 5EKQD 3CHSA 1Y8MA 5BPPA 5FQ4A 4D10C 3R9MA 4M7CA 3QFIA 2CG2A 3UPVA 1BLXB 3CHPA 2LYJA 3OWQA 3PS6A 2VGEA 1O1TA 2R5SA 5H7PA 5G55A 1E96B 2Y1LE 1N0RA 2XRZA 3J5QB 2ZGDA 4JC8A 1BDIA 3DEOA 2PE5A 4YDEA 3AJIA 4JA9A 3LPZA 5EN5D 4DLQA 3G7DA 3F6WA 3EJNA 4J8YA 1U2VG 4EK9A 5JJ7A 1UJJA 3S7JA 1H6PA 4Z5CA 3ZNGA 5CRVA 2EQXA 3PZ2A 2HINA 4DK5A 3SO8A 4GTPA 1B0NA 2L49A 1NFIE 3G2WA 2QYJA 3ZKJA 3LQXA 4HRMB 1TNBA 3QQ6A 3NZLA 2B0OE 1BD8A 3NROA 1ZS4A 5ENTD 2PXTA 1FPPA 2PUGA 2E0IA 3DSVA 5D0QD 5J08A 3F52A 1IC8A 2XS8A 1TN8A 1X5BA 3FUKA 4JHKA 2A4ZA 3DNVB 1TNUA 3IHYA 4URKA 5JA4D 4GQMA 4XX5A 3FTUA 1U3DA 2WXKA 3OKZA 4J8SA 4GYOA 2JLBA 3PE5A 1QZ2A 2XGMA 4MBGA 4HRLA 3APFA 4ACLA 1R69A 3FU6A 1A5EA 4B94A 4GMRA 5FTPA 4RQIA 4GZCA 3ESKA 4L7TA 2BEDA 1WH6A 4J8DA 4N39A 4F53A 4HS2A 4DLOA 3ZEFA 3CQGB 4IULA 1UXCA 2LXMA 3FTYA 3W9FA 4LNGA 4OBMA 4GA2A 5BNWA 1KT1A 4IVZA 2AXVA 2XQ0A 2BTDA 1NW3A 5EYPF 5B1BE 2VGXA 4DE8A 3ZGQA 3D9MA 3R9AB 1E7VA 3JYSA 3KS2A 2P9PG 2J4BA 3EHNA 5FWQA 3ONLA 3ZPJA 2RFAA 2YHEA 2V0PA 3TWXA 3HXCA 2XHEA 1MJ0A 4O60A 3BG1B 4I2ZA 1D8DA 3S8QA 2DVWA 3GYZA 3UM1A 3B7TA 2ETBA 4JEHA 3D1NI 2LXLA 3FUIA 3SHFA 4EKIA 1ZZ7A 4FJYA 3HDXA 4H7XA 3EHQA 5CHEE 4J1WA 4IA8A 2GGFA 3CLJA 1EYHA 3UXGA 5DIZA 2H6FA 4UUCA 3FTWA 4U7EB 5BT1A 4CYMD 2R2LA 3CECA 3DPDA 4ATGA 4G8KA 3GZCA 3UKUG 4ER0A 2GRMA 2X38A 4FULA 4KZ0A 4KZCA 1ZZ6A 2PXDA 3ZYKA 4OAVB 2V3CC 2CHXA 3QC1A 3Q15A 4GZDA 2VTBB 4ANWA 1K8KG 3HHMA 1S64A 3ZHEB 4CDNA 3ZPXA 1OWOA 2KPJA 3QKYA 3FU0A 4GTMA 1MX2A 5LCWJ 2WXFA
chains in the Genus database with same CATH topology
2KCVA 1HS6A 3PNLB 2WPVA 3LDZA 2AWIA 3L17A 3LKUA 4MKTA 2IF4A 2YHCA 3TXNA 1PRAA 3UFDA 4BWRA 3FYMA 4N5CA 4WWPA 4DI3A 1OWNA 2WB2A 4X4HA 1JWLA 4GPKA 5A7LA 4I2WA 2Y3AA 4ANVA 5K98B 1E90A 2IONA 2OOEA 4J8FA 4KT6B 3BD1A 1HG2A 2AVPA 3CQCB 3OAWA 1LMB3 1ELRA 3CKCA 3I5PA 5G04J 2KATA 4GB9A 4HOSA 3LYAA 2DBAA 5J90A 4ANUA 4OB4A 3U3WA 4HOUA 3FUDA 4PUCA 3SBSA 5JHAA 5KCMA 4AOFA 1UG3A 1Y7YA 4U8HA 5LOZA 2FI7A 3D9OA 1BDHA 3G2VA 4FLBA 3MLFA 1FCHA 3MZLB 3FUHA 3RJVA 1WY6A 3RIBA 2KEIA 1NZNA 5LP0A 2X6JA 3MGBA 2IQCA 3CIAA 3ZIMA 1VDYA 4B8CB 4AXHA 4EECA 1RZSA 3ZHMA 4M3OA 1JPLA 2XEVA 3N71A 2L0TB 3ULQA 2DCPA 4GHJA 5C2YA 5AIJA 3PNTB 4U0UA 3CVLA 1ELWA 4LUNU 5FZRA 3FU5A 3KZ3A 4FC8A 4CCAA 4Z5DA 4CDRA 4EPZA 2WQ7A 3BS3A 4Z58A 3QWGA 4U0ZA 3L22A 2OV8A 2R17C 1HE8A 4N2QA 5JHBA 1O4XA 3KXAA 3OTNA 4DJAA 1ZUGA 4AP2A 3TAXA 3CHQA 3ENEA 4CGVA 4CDNA 3DBSA 4G1TA 3MKRA 2WXNA 4UI9C 1FVFA 2PQNA 5FZSA 2KM4A 4HOQA 3KAEA 3TJPA 1LQCA 3KJXA 3I3NA 4JL0A 4FA6A 2R63A 2P58C 3G2SA 3B7SA 3CR3A 5LCWC 3B13A 4A1GA 3PRZA 2M63A 2IV1A 4OYSA 2J08A 3FWVA 3CVXA 4Z5HA 1PNRA 5AJDA 3ZVVA 3PZDA 5CMYA 2Q7FA 4L2LA 1H19A 3L54A 3QJZA 2O49A 4LRZA 3FUFA 4MS6A 3R7QA 2V5FA 4WAFA 5ANLA 4R7LA 3SNXA 4E85A 4GMLA 2XJ3A 2C2LA 4ILGA 2BF0X 4Q94A 1H0AA 3NF1A 4A55A 1ZAYA 3L6AA 1JFSA 2CFUA 3GZ1A 3TG4A 2J9QA 5G04C 4I17A 2J49A 2PUDA 4EZLA 2JCGA 3ASGA 1ZPQA 3PDNA 1LCDA 3Q49B 4UQYA 1HF8A 4NURA 5T8IA 3ZYLA 4X4EA 1HFAA 3LVQE 4BY6A 1QPZA 4AEZC 3FH5A 3CLCA 4KYOB 4FLHA 1HU3A 3MCXA 2R1JL 4GYYA 3UX4A 4WNFA 4CEMA 1P5QA 4J1XA 3IKOB 2WMNA 3IV0A 2IVBA 1XNFA 4CRWA 2WIUB 3ML8A 4FU3A 2C0LA 3LY9A 4DI4A 2WQ6A 2NC9A 2UY1A 5ARGA 4X4BA 3GBFA 2I9CA 5LX8A 1QQBA 1X57A 1QP4A 4BX9A 1HF0A 2AUWA 1EDUA 2KZTB 3LXUX 3CKBA 3TGOA 4LERA 2FJRA 3RRNB 2BNOA 3AU5A 3PE4A 2WUSR 4HXIA 1OWMA 3HVEB 4G11A 3MKQA 3RRMB 1CJGA 3SD5A 2J4DA 3UT4A 3ZYQA 4G23A 4BFRA 5JJTA 3CVUA 3PXPA 1ZU2A 2NSZA 4JQDA 4U63A 2LSUA 1TJFA 4JCXA 2I2OA 3UT8A 2OR1L 5BV0A 3BG0B 1UW4B 1UN9A 2PUFA 4XKBA 2J09A 3RRUA 4UI9K 4I6UA 3APDA 3CVQA 5T4YA 1DVPA 3ONKA 2IFUA 3NQPA 4PU8A 2ICTA 2JEKA 2QFCA 4FHJA 1CQTA 4JCYA 3RU0A 4AM9A 4WNEA 3P2BA 4CT4A 3EIJA 3S7BA 2E2EA 4GA0A 4GZ5A 3IHVA 4C9BB 2LSVA 2LNIA 3QYXA 3PUJA 4IWRA 3AS5A 5FT9A 1QNFA 1ADRA 3U9WA 1IQUA 2FBNA 1YA0A 4O6FA 2IVGA 1PAQA 1E8XA 3FUJA 3MEKA 3SBTB 4J6IA 4DPRA 2IOSA 4TUUA 2PIJA 2X3MA 4PU7A 1TJCA 1ZVVA 3SGHA 3URZA 3UQ3A 3OQMA 3ZW3A 1XGWA 2PQRA 5E76A 3FTXA 4YG7B 3LY8A 1Y9QA 1DNPA 3D9PA 4MCTA 2HM8A 2XGSA 2CSFA 4J0UA 3UT7A 5HQ8A 4B0ZA 2CHWA 3LVRE 3QF3A 4YNDA 4F7AA 2I1KA 1E8YA 1WIZA 1XWRA 4E6HA 4ILHB 4CDMA 3SZ7A 4NACA 1FVHA 4I1MA 4ME2A 1NERA 2WM9A 3GN5B 1PRUA 2IU7A 1UN8A 4J8EA 1SZ9A 1ZZBA 3MV3B 1QQAA 1E8ZA 2FEZA 4EBAA 2EBYA 2GZUA 3AU4A 3B7RL 3FEYA 2MQKA 4BSXA 4FJZA 2FF4A 2C0MA 2XI8A 1OCTC 3E4BA 2OVBA 2VTBA 2X6FA 4I6GA 3BDNA 3UUXA 4K03A 4OVVA 3ZHEA 5D0OD 2IVQA 3LS8A 3JXDL 1JUQA 1ZZCA 4JPSA 1KT0A 3QAQA 4WWNA 5KJMA 2X6IA 1PY1A 2XCJA 4W9RA 4AJWA 1X2LA 3B7HA 3ZN3A 2VGXB 1A17A 4HLEA 4X4CA 5AJLA 1PRVA 3U64A 1EPUA 4I6RA 4HVBA 3LFPA 3LEWA 3B7UX 4Y6CA 4APOA 3CSFA 4LEUA 4FP7A 2WXQA 3I4RB 2O4AA 2KC7A 4N3BA 4BT9A 2HR2A 3CEQA 1NA3A 3VLDA 2KZ8A 4GU5A 3HIZA 4NRHB 4WWOA 1RZRD 3RK6A 1GW6A 3CVWA 4X4DA 3SF4A 1IYGA 2IUOA 4EBAG 1KLXA 2VSYA 4APFA 5CCLA 2L0IA 4IRUA 2WXGA 2LYPA 2XPYA 1YSEA 3FYAA 2I6HA 3AS4A 3FTSA 3GW4A 5FQ6A 5FZQA 3FHEA 5BW8C 5KJLA 1E8WA 4GCOA 3FY4A 2DIWA 3JQ1A 4F8DA 3CROL 3T8MA 2VSOE 1QP7A 4KMOA 5FJYA 4HOTA 3TRBA 2ZU6B 3CHOA 2LYLA 5EKQD 3CHSA 2GRLA 3JXBC 2PL2A 4PH4B 5T3RA 1PC2A 1Y8MA 3LY7A 5BPPA 4KXKB 5FQ4A 1ZZ9A 4D10C 5JJ6A 4A3VA 1NEQA 4I1OB 3MA5A 3OXFA 4IN3B 3VK0A 3MYVA 4MRUA 4BX8A 3PVLA 3CVYA 2OVFA 3OQNA 2CG2A 4QFVA 3UPVA 3SI5A 3CHPA 2LYJA 2HSGA 3PUKA 4RSYA 2EF8A 2AW6A 1SZAA 4EZJA 2WXLA 3NZUA 2V4LA 3PS6A 4U04A 4B89A 5FQ7A 4I6EA 2XPZA 4G2VA 1IHGA 5BUZA 4X4GA 3ZXSA 4YG4A 2R5SA 3T5VA 2PZIA 2LYSA 2PUAA 4FADA 1WH8A 2MEZA 4MLPA 1SQMA 4UWKA 5G55A 1S0PA 1L1MA 3U66A 1E96B 2XPIA 3IBEA 3ESLA 3T5XA 5KJNA 4YG1A 3RZZA 2PM6A 2UY1B 4RG9A 1JFTA 4UQXA 2XRZA 3Q4AB 4JVSA 4JC8A 4B8AA 1NP7A 4YBAA 1BDIA 4YVQC 3JXCL 2PE5A 2KCLA 4GAAA 4KVMA 4JA9A 1U3CA 3LPZA 3U4TA 4PS3A 1UTXA 3G7DA 4YARA 1OWLA 1JWFA 4UWGA 4DLQA 3F6WA 2XSDC 3EJNA 4EZKA 3L1PA 2OFYA 2L9BA 3L08A 1NA0A 1UJJA 4PS7A 5JJ7A 3S7JA 5CMWA 4GZ3A 2BJCA 4N2SA 4Z5CA 5ENNA 2EQXA 2CFZA 3QB2A 2CG3A 1JH9A 1ZZ8A 2HINA 3ZHIA 3I4GA 4H7YA 3ASHA 3QK0A 4CT0A 2FULA 4DK5A 4XKCA 4UQZA 4PU4C 1H6KA 3TG5A 2JVLA 1L5JA 1B0NA 2L49A 3FFLA 1HZ4A 3OP9A 4U07A 4U0SA 2LO6A 2ONDA 2ILRA 1DWKA 3G2WA 4JZYA 1Y6IA 4JEUA 2V8SE 4WNDA 4NDWA 4Q69A 3FTVA 1LF8A 3PEUB 4UWHA 2Y4UA 1HG5A 4PS8A 2WMOA 3LCAA 3OXGA 2IJGX 3FUEA 4BT8A 1R63A 3QQ6A 2R59A 4ABNA 1BPOA 4L2YA 4ACKA 2HO1A 1DW9A 2IOLA 2NXPA 3PREA 4TV3A 1ZS4A 2XIUA 1TEZA 1HH8A 5A7DB 1WM5A 3SCGA 4XZ4A 3QWPA 2PUGA 2E0IA 4GYWA 5FQ8A 2D5VA 5D0QD 5J08A 3GZSA 4GZ6A 3F52A 1IC8A 3S2AA 1EFAA 2Y4TA 1X5BA 3FUKA 4JHKA 4KBQA 2A4ZA 2LAIA 3DNVB 3C98A 3QNKA 3IHYA 4XE0A 4URKA 3ZYMA 4GQMA 4XX5A 1EF1C 1LCCA 3FTUA 3RO3A 1U3DA 3ZRHA 4AV7A 4G26A 2WXKA 3FTZA 3FH8A 4G24A 4J8SA 3OMTA 3S7FA 4GYOA 2VJ8A 5C1DA 2JLBA 4ANXA 4Y42A 1QQEA 3WXXA 1QZ2A 1ELKA 3UMVA 2XGMA 3O48A 5G05J 4UI9J 3APFA 4ACLA 4KVOA 1R69A 4PDXA 3APCA 1Z6TA 3FU6A 4NQ0A 4XIFA 2IU1A 4B94A 5G2NA 3K9IA 2VGYA 1HO8A 5FTPA 4A3TA 2WXPA 2H8RA 4AY5A 4GZCA 3D9KA 4I6TA 2CROA 1E7UA 2XCBA 3CHMA 2UWJG 3ESKA 3FEXA 4L7TA 2LCVA 1N54A 4TRQA 2VYIA 3CHRA 2EWTA 1WETA 4GCNA 3TL5A 3QOUA 3VTXA 4Z59A 1WH6A 3FMYA 3D9JA 2MOWA 3GN5A 3D9LA 4K0RA 3KD7A 4UWFA 2LYRA 3OXLA 1E3OC 4J8DA 4RVBA 2BUGA 4N39A 4WNGA 4F53A 2AXUA 4HS2A 4DLOA 1Z3YA 3ZEFA 3CSTA 1Z3XA 2MRIA 3CQGB 3MV2B 4I1AA 3CK7A 4IULA 3CVVA 1UXCA 3Q47B 4N3AA 2YINA 3G5GA 3G2TA 3FTYA 3GZ2A 3CK8A 4JHJA 5AENA 2HYZA 3ZFWA 4GA2A 3QDNA 3PH0C 5BNWA 4LCTA 1MQSA 3RO2A 3SCFA 4UWLA 1KT1A 4IVZA 2WXJA 4F1SA 4O8BA 2XRYA 3PEVB 4N3CA 3ASFA 2AXVA 2XQ0A 2PUCA 2BTDA 4AVXA 4MCXA 3ML9A 2VGXA 2PM7A 3ASDA 4I9EA 4RG6A 5EDSA 3D9IA 4L1BA 3ZGQA 4HFGA 2VSNA 3D9MA 3FUNA 3QWWA 5AYWD 2PUBA 2I1JA 1POUA 3R9AB 2B5AA 3JQ0A 2GW1A 4Y6WA 5A6CA 3VLFA 4FN3A 3P1UA 1E7VA 3JYSA 3S7DA 3KS2A 1LLIA 2J4BA 4BTAA 3EHNA 4JW1A 1INZA 3ZKCA 4JA7A 5FWQA 3ONLA 3ZPJA 1H2VC 5G05C 2YHEA 2VSXE 3VLEA 2J07A 5M72A 2RD0A 2V0PA 5ANRA 2LYQA 2XHEA 4XI0A 3D3MA 3FP3A 3F51A 4I43A 2FO7A 4C0MA 2WQHA 1N52A 3D9NA 3BG1B 3CV0A 4I2ZA 5EX3A 5KJKA 1S7EA 4ILIA 1AU7A 2YNQA 4BTBA 5E75A 4HORA 3OQOA 3S8QA 1PERL 1HXIA 3FULA 3L16A 3GYZA 3HZIB 3LISA 3B7TA 5HI7A 5A23A 4X4IA 1WAO1 2LAHA 2PUEA 1UXDA 4JEHA 3D1NI 4A1SA 3FDHA 3FUIA 3MKQB 3IEGA 4G25A 1ZBPA 3SHFA 2RG8A 3SCHA 5BV1A 4OVUA 1ZZ7A 3EHMA 4FJYA 3HYMB 5ARFA 4Q96A 3QWVA 4FHKA 4IYPA 3Q5MA 3O9XA 3R1FA 2WVIA 3IVPA 3KEZA 2VQ2A 3EDTB 3HDXA 4H7XA 4I9CA 2BNNA 5LFAA 5CHEE 3MJWA 3CVNA 2WXMA 4GMJA 2BNMA 2L6JA 4J1WA 4IA8A 2GGFA 3CLJA 2PPXA 1EYHA 3O4ZA 3TXMA 2CHZA 2KEJA 1H2TC 3FH7A 4YVOA 5DIZA 5EX0A 2WXIA 4L23A 3MX3A 3CVPA 1MHQA 3JUIA 2L8NA 3G2UA 4X4FA 1GT0C 1OWPA 3QARA 3FTWA 1UJKA 5BT1A 3BEEA 2KZTA 2X6HA 4AIFA 1SQ8A 5DBKA 2WXOA 3EIQC 4PU3C 4JXTA 3CECA 1RZRA 1RPEL 1B89A 3HVEA 3DPDA 2QY7A 4C0EA 4I8TA 3H5TA 1H2UA 1OSLA 1QP0A 4P29A 4ATGA 3FU3A 2AXZA 1OUVA 3RKVA 4I6JA 4CGWA 2GRMA 2X38A 4FULA 5CCMA 4KZ0A 4KZCA 1ZZ6A 2ICPA 4F3VA 3NZSA 2A6CA 3ZYKA 3R7RA 1JWGA 2LYKA 2XCCA 3LJ3A 2CHXA 3QC1A 3VTYA 3Q15A 4GZDA 2VTBB 4ANWA 4JHRA 2YQ8A 2XGOA 3AS8A 3CK9A 3HHMA 2X6KA 3L13A 1HX8A 3FUMA 3JCKC 2O38A 3CGHA 1W3BA 3SFZA 3ZHEB 4GA1A 1OWOA 3PE3A 2A5UA 2MHKA 2KPJA 2WXRA 1IQRA 3QKYA 4XI9A 2KCKA 4FBIA 3FU0A 4EQFA 3EUSA 4V3IA 1VPWA 2WXHA 2KEKA 4WUYA 1RIOA 4AY6A 5LCWJ 2WXFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AXV A;  1JFT A;  1CQT A;  2PUC A;  4JCY A;  4MCX A;  4YBA A;  2AWI A;  1BDI A;  3JXC L;  2PE5 A;  1PRA A;  3QYX A;  3UFD A;  3FYM A;  1UTX A;  3G7D A;  4YAR A;  4IWR A;  1ADR A;  3F6W A;  4X4H A;  2XSD C;  5A7L A;  3L1P A;  1POU A;  1JWL A;  2PUB A;  2B5A A;  2OFY A;  2IVG A;  5K98 B;  4FN3 A;  3BD1 A;  1LMB 3;  2PIJ A;  2BJC A;  4Z5C A;  4PU7 A;  1LLI A;  1ZVV A;  4OB4 A;  3U3W A;  3ZKC A;  1JH9 A;  1ZZ8 A;  2HIN A;  3ZHI A;  1Y7Y A;  3OQM A;  1BDH A;  3MLF A;  4YG7 B;  1Y9Q A;  4PU4 C;  4MCT A;  2JVL A;  2KEI A;  2LYQ A;  2CSF A;  1B0N A;  2L49 A;  3OP9 A;  3F51 A;  3QF3 A;  4YG1 A;  1DWK A;  1WIZ A;  1XWR A;  1RZS A;  3ZHM A;  1S7E A;  1NER A;  1AU7 A;  3GN5 B;  1PRU A;  2IU7 A;  4GHJ A;  4NDW A;  3OQO A;  1ZZB A;  3S8Q A;  1PER L;  1QQA A;  3KZ3 A;  3LIS A;  3HZI B;  4Z5D A;  2EBY A;  2GZU A;  4X4I A;  3BS3 A;  4Z58 A;  3QWG A;  2PUE A;  2MQK A;  1UXD A;  1R63 A;  3QQ6 A;  3D1N I;  2XI8 A;  1OCT C;  1O4X A;  3KXA A;  1DW9 A;  3BDN A;  1ZUG A;  3SCH A;  1ZS4 A;  2XIU A;  1ZZ7 A;  2IVQ A;  3JXD L;  1ZZC A;  3SCG A;  3O9X A;  3R1F A;  2PUG A;  3IVP A;  2D5V A;  1LQC A;  3KJX A;  2BNN A;  2XCJ A;  2R63 A;  3F52 A;  1IC8 A;  1X2L A;  3B7H A;  2BNM A;  1EFA A;  4J1W A;  4IA8 A;  4X4C A;  1PRV A;  2IV1 A;  2PPX A;  4I6R A;  3DNV B;  3LFP A;  4Z5H A;  2KEJ A;  1PNR A;  4GQM A;  2O49 A;  2O4A A;  1LCC A;  2L8N A;  2KZ8 A;  4X4F A;  1GT0 C;  2XJ3 A;  1RZR D;  4X4D A;  2IUO A;  3OMT A;  1ZAY A;  1JFS A;  4Y42 A;  1SQ8 A;  2LYP A;  2PUD A;  1YSE A;  3FYA A;  2JCG A;  1ZPQ A;  4PU3 C;  3CEC A;  1LCD A;  1RZR A;  1RPE L;  4F8D A;  3CRO L;  4X4E A;  3H5T A;  1QP7 A;  4I8T A;  1OSL A;  1QP0 A;  1R69 A;  3TRB A;  1QPZ A;  2AXZ A;  2LYL A;  3CLC A;  2R1J L;  2GRL A;  3JXB C;  2GRM A;  4J1X A;  1ZZ9 A;  2IVB A;  2H8R A;  1ZZ6 A;  2ICP A;  2WIU B;  2CRO A;  4I6T A;  1NEQ A;  2A6C A;  2LCV A;  2LYK A;  3GBF A;  3VK0 A;  4X4B A;  2EWT A;  3OQN A;  1WET A;  1QQB A;  1X57 A;  4Z59 A;  1QP4 A;  1WH6 A;  2LYJ A;  2HSG A;  3FMY A;  2EF8 A;  2AUW A;  2AW6 A;  3GN5 A;  1HF0 A;  2LYR A;  1E3O C;  2FJR A;  2AXU A;  2BNO A;  2WUS R;  2O38 A;  1UXC A;  4X4G A;  1CJG A;  4YG4 A;  3G5G A;  2LYS A;  2PUA A;  3PXP A;  2KPJ A;  1WH8 A;  4JQD A;  2MEZ A;  4FBI A;  4JCX A;  2OR1 L;  1L1M A;  3EUS A;  2PUF A;  4I6U A;  1VPW A;  3SCF A;  2KEK A;  4IVZ A;  1RIO A;  4O8B A;  3RZZ A;  4PU8 A;  2ICT A; 
#chains in the Genus database with same CATH topology
 3JXJ A;  4MKT A;  2IF4 A;  1DC2 A;  1N11 A;  4DI3 A;  4N5C A;  3UM2 A;  4X4H A;  2LLV A;  5A7L A;  2Y3A A;  3KSQ A;  4J8F A;  2OOE A;  3BD1 A;  3OAW A;  5G04 J;  2KAT A;  4HOS A;  3U3W A;  5JHA A;  5KCM A;  1UG3 A;  1Y7Y A;  3G2V A;  3D9O A;  4FLB A;  1FCH A;  2KEI A;  1NZN A;  3MGB A;  2IQC A;  1VDY A;  1RZS A;  4M3O A;  5KNH D;  4GHJ A;  5C2Y A;  1ELW A;  4Z5D A;  3L22 A;  1HE8 A;  3KXA A;  3X2Q E;  3T9K A;  4CGV A;  4G1T A;  3Q9U C;  2A5E A;  2WXN A;  1FVF A;  1IXV A;  3Q9N C;  3KAE A;  3A9Z A;  3I3N A;  3PZ1 A;  1YCS B;  2FO1 E;  4HQD A;  4OYS A;  3PZD A;  2Q7F A;  3QJZ A;  4WAF A;  5KNG A;  4E85 A;  3IXE A;  4ILG A;  1ZAY A;  4HRN A;  2AJA A;  2J9Q A;  4I17 A;  2PUD A;  2JCG A;  1LCD A;  1OCO E;  2XEH A;  3D9H A;  5GAH i;  3FH5 A;  4CEM A;  1P5Q A;  4J1X A;  5CEC B;  1XNF A;  4DI4 A;  3LY9 A;  2NC9 A;  3GBF A;  5LX8 A;  1QQB A;  1QP4 A;  3LXU X;  3ABM E;  4LER A;  4HXI A;  3AU5 A;  3MKQ A;  1K1B A;  4G23 A;  2NSZ A;  2I2O A;  2PUF A;  3W9G A;  2J09 A;  3RAU A;  3ONK A;  1D9S A;  2MXD A;  2IFU A;  2ICT A;  4AM9 A;  4CT4 A;  3EIJ A;  2E2E A;  3IHV A;  4C9B B;  3PUJ A;  3AS5 A;  1FT1 A;  4K5C A;  1PAQ A;  1E8X A;  3FUJ A;  4J6I A;  1OCZ E;  4TUU A;  1N4S A;  2X3M A;  2JAB A;  4PU7 A;  4HB5 A;  3D9P A;  3HXB A;  1Z5S C;  3LVR E;  1XWR A;  4ILH B;  4NAC A;  2GRP B;  4J8E A;  4L23 A;  1UN8 A;  1MX4 A;  1QQA A;  3AAA C;  5AQ7 A;  4LNB A;  3FEY A;  1TN7 A;  4DX5 D;  4FJZ A;  2XI8 A;  3E4B A;  2OVB A;  4I6G A;  4U96 D;  4K03 A;  2XZD G;  5D0O D;  2JQE A;  1ZZC A;  5HKP A;  1KT0 A;  2DZO A;  2LLW A;  3ZU7 B;  1X2L A;  2IY0 C;  4X4C A;  3U64 A;  4I6R A;  2P9S G;  3T8K A;  5AQB A;  2WXQ A;  5CBO A;  4BT9 A;  2HR2 A;  1LTX A;  3HIZ A;  3UI2 A;  4X4D A;  4EBA G;  5CCL A;  4APF A;  3AG3 E;  5BW8 C;  2VSO E;  2GRL A;  4PH4 B;  4IN3 B;  4MRU A;  3MA5 A;  4ZFH A;  4QFV A;  5KBA A;  1SZA A;  2V4L A;  1IHG A;  2PZI A;  4FAD A;  1WH8 A;  2XZT G;  2XPI A;  3IBE A;  3T5X A;  4UQX A;  2PM6 A;  4B8A A;  4YVQ C;  5CBN A;  4KVM A;  2KCL A;  4PS3 A;  4EZK A;  1HQ1 A;  3L1P A;  3L82 A;  2L9B A;  3L08 A;  1NA0 A;  4PS7 A;  3DWL G;  5CMW A;  1LD8 A;  2BJC A;  4N2S A;  1U2Z A;  3ISM C;  2CFZ A;  3QB2 A;  3SFY A;  1ZZ8 A;  3HXE A;  3I4G A;  4XKC A;  2HCN A;  3NOG D;  4PU4 C;  3TG5 A;  2Y0B G;  2GRQ B;  2OND A;  1JCS A;  5ENQ D;  2DYR E;  4Q69 A;  3OXG A;  3FUE A;  1TN6 A;  2R59 A;  4L2Y A;  5ITZ F;  2HO1 A;  3PRE A;  2IOL A;  2NXP A;  1HH8 A;  3SCG A;  3GZS A;  3ABK E;  5EYL A;  2LAI A;  2P2C P;  1V54 E;  3ZYM A;  4J7W A;  1LCC A;  3RO3 A;  3ZRH A;  2KBX A;  2VJ8 A;  3NBN B;  2PXP A;  2V5Q C;  2RFM A;  3O48 A;  4UI9 J;  2L1P A;  4PDX A;  4XIF A;  2IU1 A;  3K9I A;  2VGY A;  1HO8 A;  4A3T A;  3D9K A;  4I6T A;  2CRO A;  4TRQ A;  1N54 A;  2VYI A;  3CHR A;  1SW6 A;  3D9J A;  3AG4 E;  2EIK E;  3GN5 A;  3GZD C;  1E3O C;  2BUG A;  1Z3Y A;  3CK7 A;  2YIN A;  3G2T A;  4JHJ A;  2HYZ A;  3QDN A;  4LCT A;  1MQS A;  3RO2 A;  4UWL A;  2OEV A;  4F1S A;  2XRY A;  2GRR B;  3ASF A;  4MCX A;  2PM7 A;  4I9E A;  5EDS A;  4L1B A;  3QWW A;  2B5A A;  4Y6W A;  4QQI A;  4FN3 A;  2R05 A;  1QYM A;  2H6H A;  3VLE A;  1K1A A;  3F51 A;  3C5R A;  3TEL A;  2P9I G;  4ILI A;  2YNQ A;  4BTB A;  3EHR A;  1PER L;  1HXI A;  3L16 A;  2EIN E;  3LIS A;  4ER3 A;  1UXD A;  3FDH A;  2LUH A;  4BER A;  2RG8 A;  3SCH A;  3EHM A;  1S70 B;  3UWP A;  3HYM B;  3Q78 A;  3O9X A;  4NIK A;  4I9C A;  5LFA A;  3MJW A;  1RW2 A;  3TXM A;  2CHZ A;  2KEJ A;  4EZI A;  4YVO A;  5EX0 A;  3MX3 A;  3CVP A;  3SR4 A;  3DM5 A;  4X4F A;  1GT0 C;  2KZT A;  2X6H A;  4TXR A;  1SQ8 A;  2WXO A;  3ULE G;  1RZR A;  1RPE L;  3HVE A;  4I8T A;  3H5T A;  1H2U A;  1OSL A;  1QP0 A;  3E34 A;  3FU3 A;  1S63 A;  3R09 A;  4GTQ A;  2ICP A;  4F3V A;  1MFQ C;  2A6C A;  5JUW A;  1JWG A;  2PXU A;  3LJ3 A;  1BI8 B;  2PXF A;  2YQ8 A;  3UIO C;  3JCK C;  3FUM A;  2BKK B;  4GA1 A;  3PE3 A;  2A5U A;  1IQR A;  4XI9 A;  2KCK A;  5DTQ A;  4EQF A;  3L9T A;  1VPW A;  2KEK A;  4WUY A;  1RIO A;  4AY6 A;  2XXQ A;  3LDZ A;  2AWI A;  2YHC A;  4DE9 A;  3TXN A;  4BWR A;  4WWP A;  5ENO D;  1OWN A;  4ANV A;  5CER B;  3BUA A;  3LYA A;  2DBA A;  4ANU A;  1OCR E;  4PUC A;  3SBS A;  4U8H A;  5LOZ A;  1BDH A;  5EIL A;  5LP0 A;  3ZIM A;  4B8C B;  5KWD A;  1AWC B;  2XEV A;  3ULQ A;  4A63 B;  3KZ3 A;  2XXP A;  4FC8 A;  4CDR A;  3AG1 E;  2WQ7 A;  3LJN A;  3QWG A;  2R17 C;  1N95 A;  5JHB A;  1AP7 A;  1O4X A;  3UM3 A;  3OTN A;  3WG7 E;  4AP2 A;  4DJA A;  3DBS A;  5FZS A;  2KM4 A;  4HOQ A;  3TJP A;  1LQC A;  4JL0 A;  4FA6 A;  3B7S A;  5LCW C;  4A1G A;  2EIM E;  4DX7 D;  2IV1 A;  4Z5H A;  1PNR A;  5AJD A;  5BV1 A;  3R7Q A;  3FUF A;  3NDB B;  4R7L A;  3E30 A;  2BF0 X;  3NF1 A;  2PXE A;  4LG6 A;  1JFS A;  3GZ1 A;  3TG4 A;  5G04 C;  2J49 A;  3HXF A;  2H6I A;  3ASG A;  3Q49 B;  4X4E A;  2PNN A;  4AEZ C;  2WMN A;  3IV0 A;  2WIU B;  4FU3 A;  2C0L A;  2GRN B;  1DCE A;  2ZGG A;  2UY1 A;  5ARG A;  4K5A B;  1HF0 A;  2AUW A;  2KXP C;  2KZT B;  2FJR A;  2PXQ A;  3HVE B;  4G11 A;  3SD5 A;  3DSU A;  3UT4 A;  3CVU A;  3KSL A;  1ZU2 A;  2RKK A;  4JCX A;  5BV0 A;  3BG0 B;  1UW4 B;  1KZP A;  1LD7 A;  4GPM A;  3RRU A;  4I6U A;  3APD A;  3CVQ A;  5T4Y A;  3NQP A;  2JEK A;  2QC9 A;  3RU0 A;  4BES A;  3M9L A;  5DRY A;  5HRY A;  2P9N G;  2LSV A;  1IQU A;  2IVG A;  3SBT B;  1QB2 A;  3MEK A;  4O1P A;  1OT8 A;  1SVX A;  1TJC A;  3SGH A;  3UQ3 A;  4EHM A;  2EIL E;  2F37 A;  2P9U G;  2MYO A;  2PQR A;  4LSZ E;  3FTX A;  1Y9Q A;  3A9Y A;  2XGS A;  3ULY A;  4B0Z A;  2CHW A;  3QF3 A;  5CED B;  1E8Y A;  3SZ7 A;  4I1M A;  1PRU A;  1ZZB A;  5EIB E;  3Q7A A;  3LS8 A;  3JXD L;  4U8Y D;  2VGX B;  2HCS A;  1EPU A;  3LEW A;  3B7U X;  4APO A;  4LEU A;  3I4R B;  4O1O A;  2KZ8 A;  4WWO A;  3C3R A;  3SF4 A;  1IYG A;  2IUO A;  2L0I A;  1YSE A;  3GW4 A;  5FZQ A;  3FTS A;  4GCO A;  3T8M A;  1QP7 A;  3JXB C;  2PL2 A;  4G8L A;  1ZB1 A;  1PC2 A;  3LY7 A;  1ZZ9 A;  5JJ6 A;  4A3V A;  1NEQ A;  4I1O B;  3C72 A;  3CVY A;  4RSY A;  2EF8 A;  2AW6 A;  1JCQ A;  4EZJ A;  2ETC A;  2WXL A;  3NZU A;  4U04 A;  4B89 A;  4I6E A;  2XPZ A;  4G2V A;  5BUZ A;  3ZXS A;  2LYS A;  1IHB A;  4MLP A;  2DYS E;  4UWK A;  1S0P A;  3U66 A;  5KJN A;  3RZZ A;  2UY1 B;  4RG9 A;  1JFT A;  1OXJ A;  4JVS A;  1NP7 A;  3JXC L;  4GAA A;  1U3C A;  4UWG A;  3GZD A;  1N4R A;  4GZ3 A;  4F6R D;  2CG3 A;  1JH9 A;  3C3O A;  3ZHI A;  4H7Y A;  3QK0 A;  4XEI G;  2FUL A;  4GTT A;  4UQZ A;  1H6K A;  1HZ4 A;  3OP9 A;  4U0S A;  2ILR A;  1N4P A;  1Y6I A;  4WND A;  2V8S E;  4NDW A;  3V2O A;  3PEU B;  4UWH A;  2Y4U A;  1HG5 A;  3LCA A;  2IJG X;  1BPO A;  4TV3 A;  1TEZ A;  5A7D B;  3B95 A;  5FQ8 A;  2D5V A;  3ABL E;  4LNU D;  1EFA A;  2Y4T A;  3TWS A;  4XE0 A;  3PZ4 A;  3EU5 A;  2ZIS A;  2OCC E;  1EF1 C;  3TWQ A;  3FTZ A;  2J7U A;  3FH8 A;  4ANX A;  4Y42 A;  1QQE A;  3Q73 A;  1ELK A;  3UMV A;  5G05 J;  4KVO A;  5B1A E;  3APC A;  4NQ0 A;  2WXP A;  2H8R A;  5DSX A;  1E7U A;  3FEX A;  2EWT A;  1WET A;  4GCN A;  4Z59 A;  4GTR A;  3FMY A;  2MOW A;  1DUL A;  3D9L A;  4UWF A;  3KD7 A;  3OXL A;  4YDO A;  2AXU A;  2XS1 A;  2MRI A;  3NAW A;  3G5G A;  3GZ2 A;  5AEN A;  3ZFW A;  1X81 A;  4O8B A;  2PUC A;  4AVX A;  3ASD A;  5AAO A;  4HFG A;  2VSN A;  5AYW D;  2PUB A;  1DCQ A;  2H6G A;  2GW1 A;  4K5B A;  5A6C A;  3VLF A;  3S7D A;  4BTA A;  4JW1 A;  1INZ A;  4JA7 A;  1H2V C;  2VSX E;  5M72 A;  5ENP D;  5ANR A;  2LYQ A;  4ATZ D;  5AN8 A;  4I43 A;  3SQV A;  3D9N A;  1N52 A;  3ME5 A;  3CV0 A;  1RZ4 A;  5KJK A;  2GRO B;  3DEP A;  3BU8 A;  4Q2J A;  4HOR A;  1OCC E;  3OQO A;  3HZI B;  5A23 A;  2PUE A;  3MKQ B;  3IEG A;  4G25 A;  1ZBP A;  3TWW A;  4OVU A;  4Q96 A;  4FHK A;  4IYP A;  3DXM G;  3Q5M A;  3R1F A;  2WVI A;  3KEZ A;  3ZXP A;  4HI8 A;  2BNN A;  4ER6 A;  2WXM A;  2PPX A;  3O4Z A;  5EID A;  3FH7 A;  4HNA D;  1MHQ A;  1OWP A;  3QAR A;  3TWT A;  4AIF A;  4CZ2 D;  3EIQ C;  4PU3 C;  4C0E A;  1TNO A;  4P29 A;  2AXZ A;  4C48 B;  4CGW A;  3QOX A;  3R7R A;  2LYK A;  3E33 A;  2PXL A;  3PZ3 A;  4JHR A;  1OY3 D;  3SFZ A;  1HX8 A;  2O38 A;  3CGH A;  1W3B A;  3DSX A;  2WXR A;  3EUS A;  2WXH A;  2XEN A;  4BEP A;  1KPS B;  1HS6 A;  3PNL B;  3LKU A;  1PRA A;  3UFD A;  3FYM A;  2WB2 A;  4GPK A;  4I2W A;  2AVP A;  3CKC A;  5J90 A;  4HOU A;  4AOF A;  1YMP A;  2FI7 A;  1WY6 A;  3RIB A;  5DTR A;  2XXA A;  2X6J A;  3CIA A;  3ZHM A;  3N71 A;  2J8S D;  3DRA A;  4U0U A;  4CCA A;  3CVL A;  4LUN U;  3BS3 A;  4U0Z A;  3ASO E;  2OV8 A;  4N2Q A;  1ZUG A;  3CHQ A;  1H6O A;  1BI7 B;  3MKR A;  3NOC D;  2PQN A;  4N5Q A;  2R63 A;  2EIJ E;  3E32 A;  4YDW A;  3TEP A;  3PRZ A;  2YBD A;  2J08 A;  3FWV A;  3ZVV A;  2V4H C;  5CMY A;  3BQO A;  1H19 A;  2O49 A;  2XJ3 A;  2C2L A;  4Q94 A;  1H0A A;  4A55 A;  4U8V D;  2HFZ A;  4EZL A;  3KEA A;  1UOH A;  4DX2 A;  4UQY A;  3ZYL A;  2R02 A;  4BY6 A;  3LVQ E;  3CLC A;  4FLH A;  2R1J L;  4WNF A;  5ENR D;  2IVB A;  3ML8 A;  2WQ6 A;  2P9K G;  4X4B A;  2I9C A;  1X57 A;  4BX9 A;  3CKB A;  3TGO A;  3RRN B;  3PE4 A;  2WUS R;  1CJG A;  2J4D A;  2XEE A;  5BXO A;  3PXP A;  4U63 A;  2LSU A;  1TJF A;  3UT8 A;  1UN9 A;  1DVP A;  1CQT A;  4JCY A;  4WNE A;  3S7B A;  4GA0 A;  4GZ5 A;  5D66 A;  2LNI A;  3QYX A;  5FT9 A;  1ADR A;  3EU9 A;  4O6F A;  2Y69 E;  2IOS A;  3TWV A;  4DX1 A;  1YYH A;  3NB2 A;  3URZ A;  1O5M A;  3UIP C;  5E76 A;  4YG7 B;  3LY8 A;  2HM8 A;  3G0T A;  3UT7 A;  5HQ8 A;  4YND A;  2I1K A;  1WIZ A;  4DX6 D;  4CDM A;  1NER A;  2WM9 A;  3GN5 B;  2IU7 A;  1E8Z A;  2FEZ A;  3J5P A;  2GZU A;  2MQK A;  2FF4 A;  1OCT C;  2VTB A;  2X6F A;  3V31 A;  3BDN A;  4OVV A;  3ZHE A;  2IVQ A;  1WG0 A;  4HRA A;  3Q75 A;  3QAQ A;  4WWN A;  5KJM A;  1PY1 A;  4AJW A;  3E37 A;  3B7H A;  3ZN3 A;  5DRT A;  1A17 A;  5AJL A;  1PRV A;  3JUE A;  4HVB A;  5B3S E;  3CSF A;  4FP7 A;  2O4A A;  2KC7 A;  3CEQ A;  1NA3 A;  4GU5 A;  1O1S A;  4NRH B;  2ODR D;  1KLX A;  2VSY A;  5BXU A;  3V2X A;  4IRU A;  3AS4 A;  2LYP A;  3FYA A;  2I6H A;  5FQ6 A;  3FHE A;  2R03 A;  2DIW A;  4F8D A;  4KMO A;  5FJY A;  5IY5 E;  3TRB A;  3CHO A;  2LYL A;  5T3R A;  4U95 D;  4KXK B;  2IO3 C;  4BX8 A;  3OXF A;  3JXI A;  3VK0 A;  3MYV A;  3PVL A;  1MZC A;  2OVF A;  3OQN A;  3SI5 A;  2HSG A;  3PUK A;  5FQ7 A;  4X4G A;  4YG4 A;  4L9P A;  3T5V A;  2PUA A;  2MEZ A;  1SQM A;  1L1M A;  4OAU C;  3ESL A;  4YG1 A;  2BKG A;  3Q4A B;  4YBA A;  3U4T A;  1UTX A;  4YAR A;  1OWL A;  1JWF A;  2XSD C;  1SA5 A;  2OFY A;  4GTS A;  2QYU A;  5ENN A;  2ETA A;  1KZO A;  3UM0 A;  3ASH A;  4CT0 A;  5AAR A;  2JVL A;  1L5J A;  3ASN E;  3FFL A;  4U07 A;  2LO6 A;  3HRA A;  1DWK A;  4JZY A;  3RSE G;  5DTM A;  4JEU A;  3ZUV B;  3VWS A;  3FTV A;  1LF8 A;  4PS8 A;  2WMO A;  4BT8 A;  1R63 A;  4ABN A;  3UTM A;  4ACK A;  2ZIR A;  1DW9 A;  2XIU A;  5HS0 A;  1WM5 A;  5GAG i;  4XZ4 A;  3QWP A;  4GYW A;  4BSZ B;  3DPY A;  4GZ6 A;  4DRX E;  3S2A A;  4KBQ A;  3C98 A;  3QNK A;  2ZXW E;  2F0Y A;  4AV7 A;  4G26 A;  3SY2 A;  1QBQ A;  4G24 A;  3OMT A;  3S7F A;  5C1D A;  3AG2 E;  3WXX A;  4BET A;  3MEJ A;  2P9L G;  1Z6T A;  5G2N A;  4AY5 A;  2J7W A;  5AQ9 A;  1D8E A;  2XCB A;  3RJV A;  3CHM A;  3GUU A;  2UWJ G;  2LCV A;  1O1R A;  4ZHB A;  3TL5 A;  3VTX A;  3QOU A;  3Q79 A;  4K0R A;  2LYR A;  4RVB A;  2QZA A;  4WNG A;  2IEJ A;  3CST A;  1Z3X A;  4I1A A;  3MV2 B;  3CVV A;  3Q7F A;  3Q47 B;  4N3A A;  3CK8 A;  4ER5 A;  4HI9 A;  2FFH A;  3PH0 C;  1MYO A;  2DWZ A;  3SCF A;  4TUM A;  2WXJ A;  3PEV B;  4N3C A;  5DT2 A;  3V79 K;  3ML9 A;  4RG6 A;  5ENS D;  3D9I A;  1N0Q A;  3FUN A;  2I1J A;  1POU A;  3JQ0 A;  1IKN D;  3P1U A;  1LLI A;  3ZKC A;  3UKR G;  5CRU A;  5G05 C;  2J07 A;  2RD0 A;  4XI0 A;  3D3M A;  3FP3 A;  2FO7 A;  3F6Q A;  4C0M A;  2WQH A;  5EX3 A;  1S7E A;  1AU7 A;  5E75 A;  3FUL A;  5HI7 A;  4X4I A;  1WAO 1;  2LAH A;  3DSW A;  4A1S A;  1NI1 A;  5ARF A;  3QWV A;  3IVP A;  2VQ2 A;  3EDT B;  1N4Q A;  3CVN A;  4GMJ A;  2BNM A;  4HBD A;  2L6J A;  1H2T C;  2WXI A;  3JUI A;  2L8N A;  3G2U A;  4HLL A;  5FIN A;  1UJK A;  3DXK G;  3BEE A;  2DZN A;  5DBK A;  4JXT A;  1B89 A;  4RLY A;  2PXV A;  2QY7 A;  2LNM A;  4WVL A;  1OUV A;  3RKV A;  4I6J A;  5CCM A;  1NL4 A;  3NZS A;  2XCC A;  3VTY A;  3C3Q A;  4Z68 A;  1N9A A;  3SFX A;  4GTV A;  2XGO A;  3AS8 A;  3CK9 A;  2X6K A;  3L13 A;  2MHK A;  4FBI A;  4V3I A;  4JD2 G;  5AIJ A;  2KCV A;  2WPV A;  4EQZ A;  3L17 A;  1JWL A;  5K98 B;  1E90 A;  2ION A;  4KT6 B;  1HG2 A;  3CQC B;  1LMB 3;  1ELR A;  3I5P A;  1SA4 A;  4GB9 A;  4OB4 A;  3FUD A;  4DUI A;  4B93 B;  2OEW A;  5AQA A;  1TNY A;  3MLF A;  3MZL B;  3FUH A;  3EUV A;  4AXH A;  4EEC A;  3QOW A;  1JPL A;  2L0T B;  2DCP A;  3B7B A;  3PNT B;  3HXD A;  5FZR A;  3UIN C;  3FU5 A;  4EPZ A;  4Z58 A;  3TAX A;  3ENE A;  2L6B A;  2B6C A;  5CEA A;  4UI9 C;  1QZX A;  4TXQ A;  3KJX A;  2P58 C;  3G2S A;  3CR3 A;  3B13 A;  2M63 A;  3CVX A;  4L2L A;  4LRZ A;  3L54 A;  4MS6 A;  2V5F A;  3SNX A;  5ANL A;  4GML A;  3NXH A;  2F8X K;  4X8Q A;  3L6A A;  2NYJ A;  2CFU A;  3PDN A;  1ZPQ A;  1JCR A;  1HF8 A;  3V30 A;  4NUR A;  5T8I A;  1HFA A;  1QPZ A;  1G3N B;  4KYO B;  1HU3 A;  3MCX A;  4GYY A;  3UX4 A;  3IKO B;  4CRW A;  1EDU A;  3DSS A;  2BNO A;  1OWM A;  3ZYQ A;  3RRM B;  5JJT A;  4BFR A;  1TR4 A;  4JQD A;  2OR1 L;  4XKB A;  2HE0 A;  4UI9 K;  4PU8 A;  2QFC A;  4FHJ A;  3P2B A;  2PXB A;  4IWR A;  1QNF A;  2VEO A;  3U9W A;  1TYQ G;  2FBN A;  1YA0 A;  4DPR A;  2PIJ A;  3HG0 D;  1ZVV A;  1BU9 A;  3OQM A;  3ZW3 A;  1XGW A;  3TFL A;  1DNP A;  4MCT A;  2CSF A;  4J0U A;  3DST A;  4F7A A;  4ER7 A;  4E6H A;  3TWR A;  1V55 E;  1FVH A;  4ME2 A;  1WDY A;  1N94 A;  2M4H A;  1SZ9 A;  3MV3 B;  1MX6 A;  4EBA A;  3KL4 A;  5FIO A;  2EBY A;  3AU4 A;  5D2M C;  3B7R L;  2IO2 C;  4BSX A;  2C0M A;  1FT2 A;  3UUX A;  2PXK A;  3TWU A;  1JUQ A;  4JPS A;  2X6I A;  2XCJ A;  4W9R A;  4TXP A;  4HLE A;  2F8Y A;  3LFP A;  4Y6C A;  5JMN D;  4N3B A;  4F1P A;  3VLD A;  3SX0 A;  1Q2Z A;  3CVW A;  3RK6 A;  1RZR D;  4EKG A;  3A9X A;  1GW6 A;  4GTO A;  4JB8 P;  2WXG A;  2XPY A;  5KJL A;  1E8W A;  3FY4 A;  3JQ1 A;  3CRO L;  4YDY A;  4HOT A;  1TNZ A;  2ZU6 B;  1K3Z D;  5EKQ D;  3CHS A;  1Y8M A;  5BPP A;  5FQ4 A;  4D10 C;  3R9M A;  4M7C A;  3QFI A;  2CG2 A;  3UPV A;  1BLX B;  3CHP A;  2LYJ A;  3OWQ A;  3PS6 A;  2VGE A;  1O1T A;  2R5S A;  5H7P A;  5G55 A;  1E96 B;  2Y1L E;  1N0R A;  2XRZ A;  3J5Q B;  2ZGD A;  4JC8 A;  1BDI A;  3DEO A;  2PE5 A;  4YDE A;  3AJI A;  4JA9 A;  3LPZ A;  5EN5 D;  4DLQ A;  3G7D A;  3F6W A;  3EJN A;  4J8Y A;  1U2V G;  4EK9 A;  5JJ7 A;  1UJJ A;  3S7J A;  1H6P A;  4Z5C A;  3ZNG A;  5CRV A;  2EQX A;  3PZ2 A;  2HIN A;  4DK5 A;  3SO8 A;  4GTP A;  1B0N A;  2L49 A;  1NFI E;  3G2W A;  2QYJ A;  3ZKJ A;  3LQX A;  4HRM B;  1TNB A;  3QQ6 A;  3NZL A;  2B0O E;  1BD8 A;  3NRO A;  1ZS4 A;  5ENT D;  2PXT A;  1FPP A;  2PUG A;  2E0I A;  3DSV A;  5D0Q D;  5J08 A;  3F52 A;  1IC8 A;  2XS8 A;  1TN8 A;  1X5B A;  3FUK A;  4JHK A;  2A4Z A;  3DNV B;  1TNU A;  3IHY A;  4URK A;  5JA4 D;  4GQM A;  4XX5 A;  3FTU A;  1U3D A;  2WXK A;  3OKZ A;  4J8S A;  4GYO A;  2JLB A;  3PE5 A;  1QZ2 A;  2XGM A;  4MBG A;  4HRL A;  3APF A;  4ACL A;  1R69 A;  3FU6 A;  1A5E A;  4B94 A;  4GMR A;  5FTP A;  4RQI A;  4GZC A;  3ESK A;  4L7T A;  2BED A;  1WH6 A;  4J8D A;  4N39 A;  4F53 A;  4HS2 A;  4DLO A;  3ZEF A;  3CQG B;  4IUL A;  1UXC A;  2LXM A;  3FTY A;  3W9F A;  4LNG A;  4OBM A;  4GA2 A;  5BNW A;  1KT1 A;  4IVZ A;  2AXV A;  2XQ0 A;  2BTD A;  1NW3 A;  5EYP F;  5B1B E;  2VGX A;  4DE8 A;  3ZGQ A;  3D9M A;  3R9A B;  1E7V A;  3JYS A;  3KS2 A;  2P9P G;  2J4B A;  3EHN A;  5FWQ A;  3ONL A;  3ZPJ A;  2RFA A;  2YHE A;  2V0P A;  3TWX A;  3HXC A;  2XHE A;  1MJ0 A;  4O60 A;  3BG1 B;  4I2Z A;  1D8D A;  3S8Q A;  2DVW A;  3GYZ A;  3UM1 A;  3B7T A;  2ETB A;  4JEH A;  3D1N I;  2LXL A;  3FUI A;  3SHF A;  4EKI A;  1ZZ7 A;  4FJY A;  3HDX A;  4H7X A;  3EHQ A;  5CHE E;  4J1W A;  4IA8 A;  2GGF A;  3CLJ A;  1EYH A;  3UXG A;  5DIZ A;  2H6F A;  4UUC A;  3FTW A;  4U7E B;  5BT1 A;  4CYM D;  2R2L A;  3CEC A;  3DPD A;  4ATG A;  4G8K A;  3GZC A;  3UKU G;  4ER0 A;  2GRM A;  2X38 A;  4FUL A;  4KZ0 A;  4KZC A;  1ZZ6 A;  2PXD A;  3ZYK A;  4OAV B;  2V3C C;  2CHX A;  3QC1 A;  3Q15 A;  4GZD A;  2VTB B;  4ANW A;  1K8K G;  3HHM A;  1S64 A;  3ZHE B;  4CDN A;  3ZPX A;  1OWO A;  2KPJ A;  3QKY A;  3FU0 A;  4GTM A;  1MX2 A;  5LCW J;  2WXF A; 
#chains in the Genus database with same CATH homology
 2KCV A;  1HS6 A;  3PNL B;  2WPV A;  3LDZ A;  2AWI A;  3L17 A;  3LKU A;  4MKT A;  2IF4 A;  2YHC A;  3TXN A;  1PRA A;  3UFD A;  4BWR A;  3FYM A;  4N5C A;  4WWP A;  4DI3 A;  1OWN A;  2WB2 A;  4X4H A;  1JWL A;  4GPK A;  5A7L A;  4I2W A;  2Y3A A;  4ANV A;  5K98 B;  1E90 A;  2ION A;  2OOE A;  4J8F A;  4KT6 B;  3BD1 A;  1HG2 A;  2AVP A;  3CQC B;  3OAW A;  1LMB 3;  1ELR A;  3CKC A;  3I5P A;  5G04 J;  2KAT A;  4GB9 A;  4HOS A;  3LYA A;  2DBA A;  5J90 A;  4ANU A;  4OB4 A;  3U3W A;  4HOU A;  3FUD A;  4PUC A;  3SBS A;  5JHA A;  5KCM A;  4AOF A;  1UG3 A;  1Y7Y A;  4U8H A;  5LOZ A;  2FI7 A;  3D9O A;  1BDH A;  3G2V A;  4FLB A;  3MLF A;  1FCH A;  3MZL B;  3FUH A;  3RJV A;  1WY6 A;  3RIB A;  2KEI A;  1NZN A;  5LP0 A;  2X6J A;  3MGB A;  2IQC A;  3CIA A;  3ZIM A;  1VDY A;  4B8C B;  4AXH A;  4EEC A;  1RZS A;  3ZHM A;  4M3O A;  1JPL A;  2XEV A;  3N71 A;  2L0T B;  3ULQ A;  2DCP A;  4GHJ A;  5C2Y A;  5AIJ A;  3PNT B;  4U0U A;  3CVL A;  1ELW A;  4LUN U;  5FZR A;  3FU5 A;  3KZ3 A;  4FC8 A;  4CCA A;  4Z5D A;  4CDR A;  4EPZ A;  2WQ7 A;  3BS3 A;  4Z58 A;  3QWG A;  4U0Z A;  3L22 A;  2OV8 A;  2R17 C;  1HE8 A;  4N2Q A;  5JHB A;  1O4X A;  3KXA A;  3OTN A;  4DJA A;  1ZUG A;  4AP2 A;  3TAX A;  3CHQ A;  3ENE A;  4CGV A;  4CDN A;  3DBS A;  4G1T A;  3MKR A;  2WXN A;  4UI9 C;  1FVF A;  2PQN A;  5FZS A;  2KM4 A;  4HOQ A;  3KAE A;  3TJP A;  1LQC A;  3KJX A;  3I3N A;  4JL0 A;  4FA6 A;  2R63 A;  2P58 C;  3G2S A;  3B7S A;  3CR3 A;  5LCW C;  3B13 A;  4A1G A;  3PRZ A;  2M63 A;  2IV1 A;  4OYS A;  2J08 A;  3FWV A;  3CVX A;  4Z5H A;  1PNR A;  5AJD A;  3ZVV A;  3PZD A;  5CMY A;  2Q7F A;  4L2L A;  1H19 A;  3L54 A;  3QJZ A;  2O49 A;  4LRZ A;  3FUF A;  4MS6 A;  3R7Q A;  2V5F A;  4WAF A;  5ANL A;  4R7L A;  3SNX A;  4E85 A;  4GML A;  2XJ3 A;  2C2L A;  4ILG A;  2BF0 X;  4Q94 A;  1H0A A;  3NF1 A;  4A55 A;  1ZAY A;  3L6A A;  1JFS A;  2CFU A;  3GZ1 A;  3TG4 A;  2J9Q A;  5G04 C;  4I17 A;  2J49 A;  2PUD A;  4EZL A;  2JCG A;  3ASG A;  1ZPQ A;  3PDN A;  1LCD A;  3Q49 B;  4UQY A;  1HF8 A;  4NUR A;  5T8I A;  3ZYL A;  4X4E A;  1HFA A;  3LVQ E;  4BY6 A;  1QPZ A;  4AEZ C;  3FH5 A;  3CLC A;  4KYO B;  4FLH A;  1HU3 A;  3MCX A;  2R1J L;  4GYY A;  3UX4 A;  4WNF A;  4CEM A;  1P5Q A;  4J1X A;  3IKO B;  2WMN A;  3IV0 A;  2IVB A;  1XNF A;  4CRW A;  2WIU B;  3ML8 A;  4FU3 A;  2C0L A;  3LY9 A;  4DI4 A;  2WQ6 A;  2NC9 A;  2UY1 A;  5ARG A;  4X4B A;  3GBF A;  2I9C A;  5LX8 A;  1QQB A;  1X57 A;  1QP4 A;  4BX9 A;  1HF0 A;  2AUW A;  1EDU A;  2KZT B;  3LXU X;  3CKB A;  3TGO A;  4LER A;  2FJR A;  3RRN B;  2BNO A;  3AU5 A;  3PE4 A;  2WUS R;  4HXI A;  1OWM A;  3HVE B;  4G11 A;  3MKQ A;  3RRM B;  1CJG A;  3SD5 A;  2J4D A;  3UT4 A;  3ZYQ A;  4G23 A;  4BFR A;  5JJT A;  3CVU A;  3PXP A;  1ZU2 A;  2NSZ A;  4JQD A;  4U63 A;  2LSU A;  1TJF A;  4JCX A;  2I2O A;  3UT8 A;  2OR1 L;  5BV0 A;  3BG0 B;  1UW4 B;  1UN9 A;  2PUF A;  4XKB A;  2J09 A;  3RRU A;  4UI9 K;  4I6U A;  3APD A;  3CVQ A;  5T4Y A;  1DVP A;  3ONK A;  2IFU A;  3NQP A;  4PU8 A;  2ICT A;  2JEK A;  2QFC A;  4FHJ A;  1CQT A;  4JCY A;  3RU0 A;  4AM9 A;  4WNE A;  3P2B A;  4CT4 A;  3EIJ A;  3S7B A;  2E2E A;  4GA0 A;  4GZ5 A;  3IHV A;  4C9B B;  2LSV A;  2LNI A;  3QYX A;  3PUJ A;  4IWR A;  3AS5 A;  5FT9 A;  1QNF A;  1ADR A;  3U9W A;  1IQU A;  2FBN A;  1YA0 A;  4O6F A;  2IVG A;  1PAQ A;  1E8X A;  3FUJ A;  3MEK A;  3SBT B;  4J6I A;  4DPR A;  2IOS A;  4TUU A;  2PIJ A;  2X3M A;  4PU7 A;  1TJC A;  1ZVV A;  3SGH A;  3URZ A;  3UQ3 A;  3OQM A;  3ZW3 A;  1XGW A;  2PQR A;  5E76 A;  3FTX A;  4YG7 B;  3LY8 A;  1Y9Q A;  1DNP A;  3D9P A;  4MCT A;  2HM8 A;  2XGS A;  2CSF A;  4J0U A;  3UT7 A;  5HQ8 A;  4B0Z A;  2CHW A;  3LVR E;  3QF3 A;  4YND A;  4F7A A;  2I1K A;  1E8Y A;  1WIZ A;  1XWR A;  4E6H A;  4ILH B;  4CDM A;  3SZ7 A;  4NAC A;  1FVH A;  4I1M A;  4ME2 A;  1NER A;  2WM9 A;  3GN5 B;  1PRU A;  2IU7 A;  1UN8 A;  4J8E A;  1SZ9 A;  1ZZB A;  3MV3 B;  1QQA A;  1E8Z A;  2FEZ A;  4EBA A;  2EBY A;  2GZU A;  3AU4 A;  3B7R L;  3FEY A;  2MQK A;  4BSX A;  4FJZ A;  2FF4 A;  2C0M A;  2XI8 A;  1OCT C;  3E4B A;  2OVB A;  2VTB A;  2X6F A;  4I6G A;  3BDN A;  3UUX A;  4K03 A;  4OVV A;  3ZHE A;  5D0O D;  2IVQ A;  3LS8 A;  3JXD L;  1JUQ A;  1ZZC A;  4JPS A;  1KT0 A;  3QAQ A;  4WWN A;  5KJM A;  2X6I A;  1PY1 A;  2XCJ A;  4W9R A;  4AJW A;  1X2L A;  3B7H A;  3ZN3 A;  2VGX B;  1A17 A;  4HLE A;  4X4C A;  5AJL A;  1PRV A;  3U64 A;  1EPU A;  4I6R A;  4HVB A;  3LFP A;  3LEW A;  3B7U X;  4Y6C A;  4APO A;  3CSF A;  4LEU A;  4FP7 A;  2WXQ A;  3I4R B;  2O4A A;  2KC7 A;  4N3B A;  4BT9 A;  2HR2 A;  3CEQ A;  1NA3 A;  3VLD A;  2KZ8 A;  4GU5 A;  3HIZ A;  4NRH B;  4WWO A;  1RZR D;  3RK6 A;  1GW6 A;  3CVW A;  4X4D A;  3SF4 A;  1IYG A;  2IUO A;  4EBA G;  1KLX A;  2VSY A;  4APF A;  5CCL A;  2L0I A;  4IRU A;  2WXG A;  2LYP A;  2XPY A;  1YSE A;  3FYA A;  2I6H A;  3AS4 A;  3FTS A;  3GW4 A;  5FQ6 A;  5FZQ A;  3FHE A;  5BW8 C;  5KJL A;  1E8W A;  4GCO A;  3FY4 A;  2DIW A;  3JQ1 A;  4F8D A;  3CRO L;  3T8M A;  2VSO E;  1QP7 A;  4KMO A;  5FJY A;  4HOT A;  3TRB A;  2ZU6 B;  3CHO A;  2LYL A;  5EKQ D;  3CHS A;  2GRL A;  3JXB C;  2PL2 A;  4PH4 B;  5T3R A;  1PC2 A;  1Y8M A;  3LY7 A;  5BPP A;  4KXK B;  5FQ4 A;  1ZZ9 A;  4D10 C;  5JJ6 A;  4A3V A;  1NEQ A;  4I1O B;  3MA5 A;  3OXF A;  4IN3 B;  3VK0 A;  3MYV A;  4MRU A;  4BX8 A;  3PVL A;  3CVY A;  2OVF A;  3OQN A;  2CG2 A;  4QFV A;  3UPV A;  3SI5 A;  3CHP A;  2LYJ A;  2HSG A;  3PUK A;  4RSY A;  2EF8 A;  2AW6 A;  1SZA A;  4EZJ A;  2WXL A;  3NZU A;  2V4L A;  3PS6 A;  4U04 A;  4B89 A;  5FQ7 A;  4I6E A;  2XPZ A;  4G2V A;  1IHG A;  5BUZ A;  4X4G A;  3ZXS A;  4YG4 A;  2R5S A;  3T5V A;  2PZI A;  2LYS A;  2PUA A;  4FAD A;  1WH8 A;  2MEZ A;  4MLP A;  1SQM A;  4UWK A;  5G55 A;  1S0P A;  1L1M A;  3U66 A;  1E96 B;  2XPI A;  3IBE A;  3ESL A;  3T5X A;  5KJN A;  4YG1 A;  3RZZ A;  2PM6 A;  2UY1 B;  4RG9 A;  1JFT A;  4UQX A;  2XRZ A;  3Q4A B;  4JVS A;  4JC8 A;  4B8A A;  1NP7 A;  4YBA A;  1BDI A;  4YVQ C;  3JXC L;  2PE5 A;  2KCL A;  4GAA A;  4KVM A;  4JA9 A;  1U3C A;  3LPZ A;  3U4T A;  4PS3 A;  1UTX A;  3G7D A;  4YAR A;  1OWL A;  1JWF A;  4UWG A;  4DLQ A;  3F6W A;  2XSD C;  3EJN A;  4EZK A;  3L1P A;  2OFY A;  2L9B A;  3L08 A;  1NA0 A;  1UJJ A;  4PS7 A;  5JJ7 A;  3S7J A;  5CMW A;  4GZ3 A;  2BJC A;  4N2S A;  4Z5C A;  5ENN A;  2EQX A;  2CFZ A;  3QB2 A;  2CG3 A;  1JH9 A;  1ZZ8 A;  2HIN A;  3ZHI A;  3I4G A;  4H7Y A;  3ASH A;  3QK0 A;  4CT0 A;  2FUL A;  4DK5 A;  4XKC A;  4UQZ A;  4PU4 C;  1H6K A;  3TG5 A;  2JVL A;  1L5J A;  1B0N A;  2L49 A;  3FFL A;  1HZ4 A;  3OP9 A;  4U07 A;  4U0S A;  2LO6 A;  2OND A;  2ILR A;  1DWK A;  3G2W A;  4JZY A;  1Y6I A;  4JEU A;  2V8S E;  4WND A;  4NDW A;  4Q69 A;  3FTV A;  1LF8 A;  3PEU B;  4UWH A;  2Y4U A;  1HG5 A;  4PS8 A;  2WMO A;  3LCA A;  3OXG A;  2IJG X;  3FUE A;  4BT8 A;  1R63 A;  3QQ6 A;  2R59 A;  4ABN A;  1BPO A;  4L2Y A;  4ACK A;  2HO1 A;  1DW9 A;  2IOL A;  2NXP A;  3PRE A;  4TV3 A;  1ZS4 A;  2XIU A;  1TEZ A;  1HH8 A;  5A7D B;  1WM5 A;  3SCG A;  4XZ4 A;  3QWP A;  2PUG A;  2E0I A;  4GYW A;  5FQ8 A;  2D5V A;  5D0Q D;  5J08 A;  3GZS A;  4GZ6 A;  3F52 A;  1IC8 A;  3S2A A;  1EFA A;  2Y4T A;  1X5B A;  3FUK A;  4JHK A;  4KBQ A;  2A4Z A;  2LAI A;  3DNV B;  3C98 A;  3QNK A;  3IHY A;  4XE0 A;  4URK A;  3ZYM A;  4GQM A;  4XX5 A;  1EF1 C;  1LCC A;  3FTU A;  3RO3 A;  1U3D A;  3ZRH A;  4AV7 A;  4G26 A;  2WXK A;  3FTZ A;  3FH8 A;  4G24 A;  4J8S A;  3OMT A;  3S7F A;  4GYO A;  2VJ8 A;  5C1D A;  2JLB A;  4ANX A;  4Y42 A;  1QQE A;  3WXX A;  1QZ2 A;  1ELK A;  3UMV A;  2XGM A;  3O48 A;  5G05 J;  4UI9 J;  3APF A;  4ACL A;  4KVO A;  1R69 A;  4PDX A;  3APC A;  1Z6T A;  3FU6 A;  4NQ0 A;  4XIF A;  2IU1 A;  4B94 A;  5G2N A;  3K9I A;  2VGY A;  1HO8 A;  5FTP A;  4A3T A;  2WXP A;  2H8R A;  4AY5 A;  4GZC A;  3D9K A;  4I6T A;  2CRO A;  1E7U A;  2XCB A;  3CHM A;  2UWJ G;  3ESK A;  3FEX A;  4L7T A;  2LCV A;  1N54 A;  4TRQ A;  2VYI A;  3CHR A;  2EWT A;  1WET A;  4GCN A;  3TL5 A;  3QOU A;  3VTX A;  4Z59 A;  1WH6 A;  3FMY A;  3D9J A;  2MOW A;  3GN5 A;  3D9L A;  4K0R A;  3KD7 A;  4UWF A;  2LYR A;  3OXL A;  1E3O C;  4J8D A;  4RVB A;  2BUG A;  4N39 A;  4WNG A;  4F53 A;  2AXU A;  4HS2 A;  4DLO A;  1Z3Y A;  3ZEF A;  3CST A;  1Z3X A;  2MRI A;  3CQG B;  3MV2 B;  4I1A A;  3CK7 A;  4IUL A;  3CVV A;  1UXC A;  3Q47 B;  4N3A A;  2YIN A;  3G5G A;  3G2T A;  3FTY A;  3GZ2 A;  3CK8 A;  4JHJ A;  5AEN A;  2HYZ A;  3ZFW A;  4GA2 A;  3QDN A;  3PH0 C;  5BNW A;  4LCT A;  1MQS A;  3RO2 A;  3SCF A;  4UWL A;  1KT1 A;  4IVZ A;  2WXJ A;  4F1S A;  4O8B A;  2XRY A;  3PEV B;  4N3C A;  3ASF A;  2AXV A;  2XQ0 A;  2PUC A;  2BTD A;  4AVX A;  4MCX A;  3ML9 A;  2VGX A;  2PM7 A;  3ASD A;  4I9E A;  4RG6 A;  5EDS A;  3D9I A;  4L1B A;  3ZGQ A;  4HFG A;  2VSN A;  3D9M A;  3FUN A;  3QWW A;  5AYW D;  2PUB A;  2I1J A;  1POU A;  3R9A B;  2B5A A;  3JQ0 A;  2GW1 A;  4Y6W A;  5A6C A;  3VLF A;  4FN3 A;  3P1U A;  1E7V A;  3JYS A;  3S7D A;  3KS2 A;  1LLI A;  2J4B A;  4BTA A;  3EHN A;  4JW1 A;  1INZ A;  3ZKC A;  4JA7 A;  5FWQ A;  3ONL A;  3ZPJ A;  1H2V C;  5G05 C;  2YHE A;  2VSX E;  3VLE A;  2J07 A;  5M72 A;  2RD0 A;  2V0P A;  5ANR A;  2LYQ A;  2XHE A;  4XI0 A;  3D3M A;  3FP3 A;  3F51 A;  4I43 A;  2FO7 A;  4C0M A;  2WQH A;  1N52 A;  3D9N A;  3BG1 B;  3CV0 A;  4I2Z A;  5EX3 A;  5KJK A;  1S7E A;  4ILI A;  1AU7 A;  2YNQ A;  4BTB A;  5E75 A;  4HOR A;  3OQO A;  3S8Q A;  1PER L;  1HXI A;  3FUL A;  3L16 A;  3GYZ A;  3HZI B;  3LIS A;  3B7T A;  5HI7 A;  5A23 A;  4X4I A;  1WAO 1;  2LAH A;  2PUE A;  1UXD A;  4JEH A;  3D1N I;  4A1S A;  3FDH A;  3FUI A;  3MKQ B;  3IEG A;  4G25 A;  1ZBP A;  3SHF A;  2RG8 A;  3SCH A;  5BV1 A;  4OVU A;  1ZZ7 A;  3EHM A;  4FJY A;  3HYM B;  5ARF A;  4Q96 A;  3QWV A;  4FHK A;  4IYP A;  3Q5M A;  3O9X A;  3R1F A;  2WVI A;  3IVP A;  3KEZ A;  2VQ2 A;  3EDT B;  3HDX A;  4H7X A;  4I9C A;  2BNN A;  5LFA A;  5CHE E;  3MJW A;  3CVN A;  2WXM A;  4GMJ A;  2BNM A;  2L6J A;  4J1W A;  4IA8 A;  2GGF A;  3CLJ A;  2PPX A;  1EYH A;  3O4Z A;  3TXM A;  2CHZ A;  2KEJ A;  1H2T C;  3FH7 A;  4YVO A;  5DIZ A;  5EX0 A;  2WXI A;  4L23 A;  3MX3 A;  3CVP A;  1MHQ A;  3JUI A;  2L8N A;  3G2U A;  4X4F A;  1GT0 C;  1OWP A;  3QAR A;  3FTW A;  1UJK A;  5BT1 A;  3BEE A;  2KZT A;  2X6H A;  4AIF A;  1SQ8 A;  5DBK A;  2WXO A;  3EIQ C;  4PU3 C;  4JXT A;  3CEC A;  1RZR A;  1RPE L;  1B89 A;  3HVE A;  3DPD A;  2QY7 A;  4C0E A;  4I8T A;  3H5T A;  1H2U A;  1OSL A;  1QP0 A;  4P29 A;  4ATG A;  3FU3 A;  2AXZ A;  1OUV A;  3RKV A;  4I6J A;  4CGW A;  2GRM A;  2X38 A;  4FUL A;  5CCM A;  4KZ0 A;  4KZC A;  1ZZ6 A;  2ICP A;  4F3V A;  3NZS A;  2A6C A;  3ZYK A;  3R7R A;  1JWG A;  2LYK A;  2XCC A;  3LJ3 A;  2CHX A;  3QC1 A;  3VTY A;  3Q15 A;  4GZD A;  2VTB B;  4ANW A;  4JHR A;  2YQ8 A;  2XGO A;  3AS8 A;  3CK9 A;  3HHM A;  2X6K A;  3L13 A;  1HX8 A;  3FUM A;  3JCK C;  2O38 A;  3CGH A;  1W3B A;  3SFZ A;  3ZHE B;  4GA1 A;  1OWO A;  3PE3 A;  2A5U A;  2MHK A;  2KPJ A;  2WXR A;  1IQR A;  3QKY A;  4XI9 A;  2KCK A;  4FBI A;  3FU0 A;  4EQF A;  3EUS A;  4V3I A;  1VPW A;  2WXH A;  2KEK A;  4WUY A;  1RIO A;  4AY6 A;  5LCW J;  2WXF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...