2AWIA

Structure of prgx y153c mutant
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
300
structure length
298
Chain Sequence
b'FKIGSVLKQIRQELNYHQIDLYSGIMSKSVYIKVEADSRPISVEELSKFSERLGVNFFEILNRAGMNSVNETGKEKLLISKIFTNPDLFDKNFQRIEPKRLTSLQYFSIYLGYISIAHHYNIEVPTFNKTITSDLKHLYDKRTTFFGIDCEIVSNLLNVLPYEEVSSIIKPMYPIVDSFGKDYDLTIQTVLKNALTISIMNRNLKEAQYYINQFEHLKTIKNISINGYYDLEINYLKQIYQFLTDKNIDSYLNAVNIINIFKIIGKEDIHRSLVEELTKISAKEKFTPPKEVTMYYEN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PrgX
publication title Structure of peptide sex pheromone receptor PrgX and PrgX/pheromone complexes and regulation of conjugation in Enterococcus faecalis.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Transcription
total genus 111
structure length 298
sequence length 300
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2005-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2awiA01
1.25.40.400 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2awiA02
1PRAA 4IVZA 2CSFA 4YARA 4YG4A 4Z5CA 2PUDA 2XIUA 1R69A 4X4HA 2PIJA 3IVPA 1ZAYA 3SCFA 1UTXA 1ZZ7A 2IV1A 4Z58A 1PRUA 1WH8A 2KZ8A 1CJGA 3R1FA 3CROL 3O9XA 2MEZA 1LLIA 1AU7A 2CROA 3OMTA 1QPZA 1RIOA 4GHJA 2WUSR 1S7EA 2IVGA 1BDIA 1DWKA 2KPJA 1WETA 1RZSA 2GRLA 1RZRA 3OQOA 1LCCA 4I6RA 2BJCA 3BD1A 2LYRA 4JQDA 2O49A 3FYAA 4X4GA 1ZZCA 4I6TA 2PUCA 1Y9QA 3JXCL 2PPXA 3VK0A 3FYMA 1ZPQA 3U3WA 4Z5HA 3CLCA 3QYXA 4MCXA 4X4IA 1RPEL 1JFTA 3G7DA 3H5TA 4GQMA 3OP9A 1Y7YA 1R63A 4IWRA 1DW9A 2LYJA 2XI8A 1LCDA 2AWIA 2GRMA 1ZVVA 2PUAA 1SQ8A 2O38A 1O4XA 4Y42A 2JCGA 1ADRA 3CECA 3LFPA 4OB4A 2L8NA 2LYKA 3KXAA 1L1MA 1JH9A 1POUA 2OFYA 3D1NI 4JCYA 1UXCA 3MLFA 4MCTA 3FMYA 2AXVA 1EFAA 2OR1L 2D5VA 3GBFA 2PUFA 2A6CA 4X4FA 4O8BA 2HINA 2LYSA 1CQTA 1ZZ9A 2AW6A 2L49A 2WIUB 3RZZA 4FBIA 4JCXA 2EF8A 4PU3C 2HSGA 4PU8A 1WIZA 5K98B 3HZIB 3SCHA 4FN3A 2PE5A 1OCTC 2BNOA 1PERL 2LYQA 2R63A 2MQKA 1ZUGA 3L1PA 4J1WA 4I6UA 2KEKA 3DNVB 3UFDA 1OSLA 3QF3A 4PU4C 4Z59A 3OQNA 4I8TA 1QP4A 2LYLA 1QP0A 1NERA 1LQCA 2FJRA 2LYPA 3PXPA 3QQ6A 1ZZ8A 3BDNA 3ZHMA 1UXDA 3ZKCA 3GN5A 2XCJA 3ZHIA 2BNNA 2ICTA 2IUOA 3JXDL 1PNRA 2PUEA 3S8QA 1WH6A 4PU7A 1HF0A 1GT0C 2PUGA 3BS3A 4X4CA 3EUSA 1X57A 4NDWA 5A7LA 1JWLA 3B7HA 3F52A 3JXBC 3OQMA 3KZ3A 2R1JL 1NEQA 1JFSA 1XWRA 3G5GA 2PUBA 4YG1A 2AUWA 2KEJA 4F8DA 2GZUA 1QP7A 1PRVA 1QQAA 2EBYA 2B5AA 1ZZBA 1VPWA 2EWTA 3KJXA 3LISA 2O4AA 2JVLA 2H8RA 4IA8A 1IC8A 3TRBA 2AXUA 1LMB3 3F6WA 3GN5B 1ZZ6A 1RZRD 4YBAA 4Z5DA 2BNMA 4X4EA 2XJ3A 3QWGA 2ICPA 4X4DA 2IVQA 2IU7A 2IVBA 2XSDC 4J1XA 1BDHA 2AXZA 2LCVA 3F51A 3SCGA 1ZS4A 4X4BA 4YG7B 1E3OC 1QQBA 1YSEA 1X2LA 2KEIA 1B0NA
chains in the Genus database with same CATH superfamily
4ACLA 4CZ2D 3ABKE 2PIJA 3ABLE 5ENNA 2VTBA 2XQ0A 3TWVA 1MZCA 3CR3A 5JHAA 2PXLA 2PXUA 2YHCA 3PZDA 4A3TA 1EDUA 2KZTB 4X4GA 1D8DA 1ZU2A 3ZN3A 3VTYA 3ZU7B 4C9BB 3FTXA 1OY3D 1OWNA 4I43A 4B93B 2P9SG 5T4YA 3SNXA 3IXEA 1WDYA 4N2SA 4F1SA 3JCKC 3AAAC 3HIZA 2HINA 4CRWA 3ZIMA 4HRMB 4G23A 4U0ZA 1UOHA 3FEYA 5LP0A 4BT9A 2BNOA 4CDMA 3HYMB 4GMLA 5ARGA 2LAHA 4KXKB 3UMVA 4Z59A 3APCA 1N94A 5KJKA 1UJKA 3E4BA 1IHBA 3R9MA 4JXTA 4HQDA 3TJPA 1S64A 4M3OA 2PXFA 4LEUA 4V3IA 1QQAA 3RAUA 2MOWA 2C0MA 4CDRA 2L9BA 3UPVA 2WXKA 4Q96A 1ELRA 3UXGA 1LMB3 4Z5DA 3ME5A 4HLEA 1V54E 2PQRA 5DRYA 2R2LA 2IU7A 3EUVA 4O60A 5G05C 3IBEA 1E3OC 2J4DA 2KEIA 1TNUA 4BSZB 3SCFA 1UTXA 4M7CA 1E8XA 4BX8A 3O9XA 3VLDA 1LLIA 3PE4A 1RIOA 3EHQA 1OCZE 2WUSR 2X3MA 4HNAD 2CHZA 2J07A 5FWQA 5A23A 2KBXA 1RZSA 2WQ6A 4JQDA 1EYHA 3LJNA 3ZYLA 3B7TA 3VK0A 2ODRD 1E7UA 3C3QA 4OVUA 2VTBB 1TEZA 3T8KA 4FU3A 1BLXB 3LVQE 5ENOD 3B7RL 2FO7A 4JHKA 2GRRB 3RKVA 3MLFA 3A9XA 2IY0C 4FJYA 3GBFA 2A6CA 3JUEA 3KD7A 4O8BA 3MCXA 2XXQA 2X38A 2WIUB 3GW4A 3Q75A 4I1AA 3D9OA 3DEPA 5G04J 2HSGA 4CGWA 5HQ8A 3LJ3A 4GU5A 1H19A 4OAVB 3FUJA 1TN6A 5KWDA 4FULA 4P29A 4U8YD 3LXUX 4N39A 5GAGi 5CMWA 4I17A 4UWKA 5KJMA 5FQ7A 3ZGQA 3SY2A 5FQ4A 2VSOE 5EYPF 3F52A 4U8HA 2Q7FA 3OQMA 2PM6A 4ER0A 4EECA 4MS6A 4TV3A 2XPZA 2V3CC 2BUGA 2FO1E 2KXPC 3BG0B 5G55A 4IA8A 4AXHA 3HVEA 2DWZA 3CIAA 4BTAA 1HE8A 4DX2A 4X4EA 2Y69E 3TWSA 4GTVA 2ICPA 2KCVA 5KBAA 3DM5A 4RVBA 1FT1A 4APOA 2LCVA 1RZ4A 1HU3A 2H6HA 4AIFA 4WAFA 4Z5CA 4XI9A 2XIUA 3CGHA 1DCQA 4QQIA 1EF1C 2WXGA 3MKQA 5B3SE 1TJCA 3U66A 2WXQA 3MX3A 1MX2A 1FVFA 1JCQA 2MRIA 3FP3A 5T3RA 5D66A 4J8EA 2R59A 3B95A 4MKTA 3JXCL 2YNQA 3FYMA 4XIFA 3CLCA 1OCOE 2PQNA 4IWRA 4GPMA 1X81A 2O38A 1O4XA 4I1MA 3AS8A 5FINA 5KCMA 3HDXA 1E8WA 4WUYA 3FHEA 1E8ZA 3SBTB 1BD8A 3C3OA 4AY6A 2AW6A 2WPVA 4XKCA 2Y3AA 3QC1A 3FUDA 2LO6A 3ESKA 3OQNA 1N95A 3D9MA 4KT6B 1TNOA 3B7UX 2XCBA 3C5RA 1FPPA 3LVRE 5CEDB 3CQGB 4J8DA 4U04A 1K1BA 2J4BA 2KATA 1OWMA 2GGFA 1BI7B 4X4CA 5EYLA 4DUIA 4BX9A 5ENRD 4CGVA 1VPWA 3KJXA 5IY5E 2UY1A 1RZRD 2F0YA 2GW1A 3DPDA 2IU1A 2JABA 3SX0A 3DSVA 3Q9UC 3ENEA 3ZRHA 2WXNA 2XXPA 4DLOA 4A1SA 1X2LA 4ZFHA 1PRAA 1L5JA 4L9PA 4KVOA 3FUIA 2IV1A 1FCHA 3IEGA 1PRUA 3UQ3A 4HORA 3AG4E 5DRTA 5CECB 2VSNA 1KZPA 1BDIA 1TN8A 5ANRA 2YHEA 2V8SE 1QBQA 4GTOA 3DSUA 4HI9A 2H6FA 2WXJA 4UQYA 5CERB 3FY4A 4CT0A 3OP9A 5FQ8A 4GTPA 2XI8A 3Q7AA 5M72A 2CHWA 1OWPA 3TGOA 4GYWA 3TAXA 2AJAA 2J09A 4LNGA 1O1TA 2LAIA 3S7DA 4PU3C 2BF0X 5DTRA 3FTVA 3FU5A 3FU3A 3EJNA 3MEKA 4L7TA 3JQ0A 3X2QE 3CHRA 4Y6WA 1UJJA 3ZHMA 4XZ4A 2XCJA 4ABNA 2A5UA 2X6KA 4U8VD 1SZAA 2DZNA 2KCKA 3SZ7A 3PZ2A 3Q78A 5AQBA 3DRAA 3E33A 4I1OB 2O4AA 2JVLA 5DT2A 3N71A 3TRBA 3F6WA 1HX8A 2BNMA 3B13A 4CEMA 3URZA 4EK9A 3L17A 1N11A 1B0NA 3CK7A 4WNEA 3BUAA 2B6CA 2F37A 4U7EB 1U2ZA 3EIJA 1PC2A 4F53A 2DYRE 2CROA 5JMND 5BNWA 3UT7A 2IF4A 1MYOA 1JWFA 4GZCA 5KNHD 4U0SA 3UKRG 3HXBA 3HXCA 4RQIA 1NL4A 4GQMA 4GA2A 2RFMA 3NROA 1LCDA 1ZVVA 2PXPA 5BW8C 2MXDA 3S7JA 1K8KG 1NP7A 3KXAA 4Z68A 3TEPA 3FTYA 2OR1L 4LNBA 3EU5A 2PUFA 3LDZA 1UN9A 3R7RA 2L49A 3UM1A 2OOEA 4HB5A 3PUKA 1KZOA 3ISMC 4J1WA 2KEKA 4LNUD 1OCRE 4L1BA 5B1AE 1LD8A 3MA5A 2FJRA 3NQPA 2LYPA 3G2TA 4F3VA 4UWGA 3KSLA 4F7AA 3SR4A 5E75A 4WWNA 4TUUA 3FH5A 1JWLA 2YINA 3EIQC 2V5FA 2LLWA 3LEWA 2P9KG 5DTQA 1O1SA 4KMOA 3R09A 2IJGX 2H8RA 2XCCA 3TG4A 5KJNA 2WXHA 2XGOA 2IVBA 5LFAA 3CSTA 4PH4B 3ZHEA 1QQBA 3E34A 2M63A 2PUDA 2L0TB 4JVSA 3Q49B 3CQCB 2GRPB 4N5QA 3PZ3A 3G2SA 3MZLB 3OMTA 3ZEFA 3E30A 1SQMA 4L23A 1VDYA 4AV7A 5KNGA 1S7EA 3OKZA 4AJWA 3ONLA 1ZB1A 1Z3YA 3OXFA 3VLFA 3FYAA 4PS3A 1Y9QA 2P58C 2X6HA 1ZPQA 1OUVA 3MKRA 2XZTG 4JEHA 1QYMA 1R63A 3K9IA 3DSWA 3ZXSA 3ZPXA 2WXFA 2KC7A 4E85A 4I9EA 1MX6A 4U96D 3CVUA 3J5PA 4GYYA 5ARFA 3D9JA 1Z5SC 2KCLA 1POUA 3T8MA 1H0AA 4MCTA 2WM9A 1HF8A 1LTXA 3AU5A 2MHKA 3RZZA 4NURA 1U2VG 4H7YA 5G04C 2CFUA 2X6IA 4OVVA 4B0ZA 4JW1A 1D9SA 3E32A 3FUMA 4FLBA 3PRZA 3QWWA 2IOSA 2I9CA 3CKCA 5A7LA 1H2VC 3Q4AB 3B7HA 4CCAA 2XZDG 4UWLA 3G5GA 1N4PA 3UI2A 2NC9A 4B94A 4K5BA 3CHMA 3RK6A 3PZ4A 4RSYA 4WNDA 5EKQD 1HO8A 1NZNA 4YNDA 5FZRA 3D9KA 4JB8P 3OTNA 3B7BA 3CLJA 1U3CA 4ATGA 3GZCA 4CDNA 3G0TA 3FH8A 2J9QA 1TN7A 4EQFA 1G3NB 4GHJA 2YBDA 3PDNA 4WWPA 1LF8A 2PXQA 2XEVA 4DX6D 1FVHA 2BJCA 2EIME 3VWSA 5FJYA 1YCSB 3ASGA 3ULYA 2VEOA 3LPZA 1H6PA 4GTSA 2FBNA 5BT1A 4WNFA 2PUAA 4JA7A 1QZXA 3ASDA 3C98A 5JJ7A 4Y42A 3TFLA 4EPZA 3JQ1A 4JCYA 4HRLA 4YDWA 1UXCA 3QOXA 1JPLA 2WMNA 2XRZA 2VGXA 2XGMA 4JPSA 4PU8A 3L6AA 2HO1A 4EBAG 1OCTC 1MHQA 1ZUGA 2ETBA 3UM3A 2RG8A 3OXGA 1QP4A 1PAQA 4GA0A 1QP0A 3PXPA 2F8YA 3CVNA 2IUOA 5AJDA 2L1PA 2PUGA 3EUSA 4RG9A 3L16A 3PE3A 3SO8A 3D9PA 2EWTA 1Q2ZA 4UWHA 3T9KA 1S0PA 4G11A 1LD7A 2A4ZA 1N4SA 2PXKA 4DX5D 4C0MA 3OWQA 2DIWA 2RKKA 4J6IA 4HRNA 3RSEG 4YG7B 1YSEA 3GUUA 5AN8A 4IVZA 2A5EA 3MEJA 2WQ7A 2HCSA 4ILGA 2LNIA 3LS8A 2WB2A 2P9PG 4FC8A 5ANLA 2P9UG 4IRUA 5AQ7A 3EHRA 4TUMA 4LRZA 5CBOA 1S70B 1DNPA 2AVPA 3ULQA 4AOFA 4B8CB 4X4IA 2IFUA 1RPEL 1JFTA 2HE0A 4GYOA 3NDBB 3CV0A 3HXFA 4DE8A 4JHRA 3QOWA 3FWVA 4GZ6A 3JXJA 4IYPA 2GROB 3WXXA 3BQOA 3APFA 2AXVA 5CCMA 1K3ZD 2VYIA 4XI0A 2D5VA 1IXVA 2LYSA 1CQTA 2ONDA 1HG2A 3CVVA 3ML8A 4EZJA 4I6UA 4TXQA 1HZ4A 1K1AA 3FFLA 3PE5A 3ZKJA 4PUCA 2CG2A 2NSZA 3FUFA 2VGXB 5CHEE 4TXRA 2HCNA 3PVLA 4DX1A 1XGWA 2R1JL 3QARA 3LQXA 3ML9A 4NACA 4AEZC 1QNFA 5GAHi 2XGSA 3M9LA 5BV0A 3A9ZA 3CVXA 4U63A 5AENA 3O48A 3APDA 3DBSA 5HKPA 3AS4A 4FHJA 2JEKA 3CVPA 2AXZA 3F51A 4HFGA 1ZS4A 4I9CA 5AQ9A 1SZ9A 4YG4A 4QFVA 1O1RA 2KZ8A 4MLPA 2PXBA 3LY9A 4JD2G 3PZ1A 2C0LA 1DVPA 2WXPA 5JHBA 1XNFA 3QFIA 2QYUA 3RRMB 3BD1A 1EPUA 3ASNE 3S7BA 3G7DA 2PM7A 4EBAA 1DW9A 3TXNA 3HVEB 3CKBA 3HXDA 1N0QA 2RFAA 2IOLA 2Y0BG 2L6BA 2XS8A 4GTRA 5FIOA 1OWOA 1EFAA 5T8IA 4YDYA 5J08A 3ZXPA 3LYAA 5BUZA 3ESLA 2I1JA 5CEAA 3KEZA 4WWOA 1Z6TA 3IHVA 1JWGA 4IULA 3SFYA 3MKQB 5LX8A 4PU4C 4HVBA 4N5CA 1D8EA 3PEVB 3PREA 1N9AA 3ZKCA 4R7LA 2PUEA 1IHGA 4GMJA 1WH6A 4G1TA 3KL4A 4ILIA 1X57A 3NZSA 4HOUA 1XWRA 3NZUA 4ACKA 4ER6A 3GZ2A 2XXAA 1W3BA 1IC8A 3UTMA 3U64A 1Z3XA 2XJ3A 2ZGGA 4HLLA 4LG6A 3GZDC 2R17C 4G24A 3DXMG 2VJ8A 4DLQA 4IN3B 2I2OA 4A63B 2EQXA 1H6KA 4D10C 3J5QB 1N4RA 1YMPA 3NB2A 4GAAA 4J8YA 2O49A 2Y4UA 2L6JA 1Y6IA 4MCXA 3RJVA 2R02A 5DSXA 3QK0A 2AWIA 2UY1B 2DVWA 2JCGA 1ADRA 4ANUA 3D9LA 5HS0A 3TG5A 3U9WA 4EQZA 2QZAA 2BTDA 2IONA 3MYVA 3AG3E 3ASFA 2LNMA 5EX0A 4BSXA 2X6JA 1TYQG 4L2YA 2EF8A 3QWVA 5B1BE 3KEAA 1B89A 3A9YA 3UFDA 3L1PA 2HM8A 4YDOA 2QC9A 3FTZA 3OXLA 2QY7A 4B8AA 3TWWA 5LCWJ 2XEHA 1SA4A 3JUIA 3NOCD 3PNTB 5ENQD 1OT8A 4G26A 4AM9A 3G2UA 3JYSA 3BG1B 3BS3A 5DTMA 5H7PA 4ER7A 2KZTA 1AP7A 2GRNB 1A17A 1E90A 3P2BA 2JQEA 1PRVA 2FI7A 4YVOA 2B5AA 1ZZBA 4BERA 4DK5A 3CK9A 3IHYA 2AXUA 3BU8A 3QWGA 1DCEA 3NXHA 4AP2A 4G8KA 4X4HA 1WY6A 1ZZ7A 3Q73A 1AU7A 4UQZA 3GZDA 1KT0A 1WETA 3ULEG 2ILRA 4DPRA 5EX3A 5ENPD 1HG5A 2EIKE 3PNLB 4GZ5A 3NBNB 3W9GA 3MJWA 1ZZCA 2LXLA 2PPXA 3TWXA 4A55A 4UI9C 1INZA 4Z5HA 4O1OA 3TWRA 5JA4D 2P2CP 4HS2A 4J7WA 3LCAA 3L22A 1KPSB 3ZUVB 1HQ1A 2WXRA 2GRMA 4HOSA 3SBSA 3CECA 2I6HA 4L2LA 2LYKA 4UUCA 4O6FA 1U3DA 1N54A 2DYSE 3GYZA 3AJIA 3PEUB 5AYWD 3QOUA 4DE9A 2IQCA 3NF1A 3RO2A 5CBNA 5C1DA 4U07A 3F6QA 3EU9A 2XPYA 2XS1A 4N2QA 1MJ0A 1OXJA 3FTSA 2R5SA 2E2EA 4Q69A 1TNBA 2LYLA 3JXIA 4HXIA 1NERA 2C2LA 4BESA 3QQ6A 3UM2A 2J7WA 3GZSA 2ICTA 2F8XK 4PU7A 1HF0A 2PXEA 1HS6A 4NDWA 4C48B 3PUJA 4EKGA 2P9IG 3DSXA 3FH7A 3VTXA 1JFSA 4OBMA 1TNZA 2AUWA 1NFIE 1NW3A 2V4HC 2CHXA 4YBAA 4JEUA 3SFXA 4KYOB 4X4DA 2IVQA 2NXPA 3HRAA 3FULA 5KJLA 3CVWA 4X4BA 4I2WA 4AY5A 3ASOE 4YG1A 1E7VA 1P5QA 1HXIA 2ETAA 4ATZD 4LUNU 4XX5A 4OYSA 3MV3B 2CFZA 2FEZA 1SVXA 2OCCE 3EHNA 3FEXA 2KPJA 5D2MC 4U95D 3NOGD 2E0IA 4BWRA 3WG7E 1IQUA 3SQVA 4GTMA 2NYJA 1SQ8A 5JUWA 3V31A 2LLVA 3V2OA 4LCTA 3Q7FA 2OFYA 4O1PA 5ENSD 2MYOA 2VGYA 3ZHEB 3U4TA 4K0RA 4UI9J 4TRQA 4N3BA 3AU4A 3HZIB 4ANVA 3D9IA 5JJTA 1H2TC 2MQKA 4JZYA 1OSLA 4E6HA 2KM4A 1V55E 3Q5MA 2ZISA 1LQCA 3DWLG 2XENA 5EIBE 3FUHA 4NQ0A 3L82A 3ZHIA 3MV2B 5AAOA 3S8QA 1IYGA 2PNNA 1BPOA 4I2ZA 4WNGA 4GTTA 3RRNB 3S7FA 3KZ3A 3I5PA 1RW2A 5CRVA 5DIZA 2KEJA 1JCSA 2J8SD 2EBYA 3QJZA 3NAWA 3V2XA 2YQ8A 2H6GA 5AQAA 2P9NG 4MRUA 3UM0A 3LKUA 2FULA 3D9NA 3TL5A 1BDHA 3CK8A 2QFCA 3QKYA 4YARA 1R69A 2PXDA 4C0EA 3FUNA 5CCLA 2P9LG 3PH0C 1CJGA 3ZYKA 1QPZA 4EKIA 5FQ6A 4A3VA 4FP7A 3C72A 2XPIA 3D9HA 4BY6A 2FF4A 4WVLA 3OQOA 2OV8A 3SFZA 3CVLA 4I6TA 3CSFA 4GTQA 4PS8A 1E8YA 2BKGA 3H5TA 3Q47B 4YDEA 4DJAA 1N0RA 3QNKA 4DRXE 3LFPA 3SGHA 3G2WA 3D1NI 1S63A 3FUEA 2ZXWE 4JA9A 2RD0A 4APFA 4ILHB 3KS2A 4EZLA 3LY8A 2R63A 2V4LA 4UI9K 2ETCA 3ZVVA 3KAEA 3UT8A 3T5VA 2DCPA 2BEDA 3PS6A 4JC8A 3AG2E 4G8LA 1ZZ8A 3UX4A 3ZNGA 1ELWA 4AVXA 2BNNA 2VQ2A 5EN5D 4TXPA 4HI8A 2GRQB 3V79K 3VLEA 2XRYA 1A5EA 2FFHA 1QP7A 3ASHA 2PXVA 5FTPA 2IO3C 3TWTA 3SD5A 2WVIA 2J08A 3CEQA 4G2VA 2WQHA 5G05J 3DSSA 3ZYQA 2QYJA 3RU0A 5HRYA 1DULA 3EDTB 5D0OD 3CVYA 1IQRA 3KSQA 1TJFA 3IVPA 4Z58A 4ZHBA 3FU0A 4BT8A 3R1FA 2MEZA 3SF4A 2H6IA 1QB2A 2B0OE 1TR4A 1MX4A 4FJZA 4EZKA 3W9FA 4FHKA 1DWKA 4ANXA 4UWFA 1LCCA 1RZRA 3MGBA 1JCRA 4DX7D 3LY7A 4LERA 3U3WA 4Y6CA 2BKKB 4KBQA 3BEEA 4GCOA 5AARA 3IV0A 2LYJA 2WXLA 5AJLA 2M4HA 2IEJA 2OVFA 1JH9A 4XKBA 3ABME 1WM5A 3FMYA 3ONKA 1ZBPA 4X4FA 1YA0A 2LSUA 2J7UA 5FZSA 4FADA 1ZZ9A 4JCXA 3RIBA 3SCHA 5BXUA 3C3RA 1PERL 3HG0D 4HOQA 4BFRA 5J90A 3I3NA 3DNVB 1SA5A 4I8TA 4NIKA 4RLYA 1TNYA 5LCWC 1MQSA 3O4ZA 3ZYMA 3BDNA 2PZIA 4J8FA 3GN5A 4ER3A 1PNRA 4H7XA 1E96B 4Q94A 1GT0C 4URKA 3QB2A 3FUKA 1KLXA 1Y8MA 1QZ2A 1NEQA 4J0UA 3AS5A 1DC2A 3FTUA 2EILE 4U0UA 3S2AA 1UN8A 3SHFA 5EDSA 3LISA 1WAO1 4B89A 4UQXA 4I6JA 3L9TA 3ZFWA 2J49A 1BU9A 4I6EA 4YVQC 5HI7A 4GZDA 2WXMA 4GPKA 2XSDC 4J1XA 2PXTA 3ZW3A 3SCGA 4Q2JA 3DPYA 5BXOA 4BTBA 4XE0A 3UT4A 2R03A 5A6CA 3CROL 2VSXE 3UKUG 4ME2A 2ZGDA 1N4QA 5AIJA 4J8SA 4KZ0A 4X8QA 4W9RA 4BEPA 2UWJG 3QAQA 4CT4A 2IVGA 2EIJE 1IKND 3TWUA 4CYMD 5G2NA 4F6RD 4I6RA 2LYRA 3SI5A 4GB9A 1H6OA 2V0PA 2HFZA 5EILA 3CHPA 4HBDA 1Y7YA 1H2UA 3Q79A 1KT1A 3QWPA 4OB4A 4XEIG 3TXMA 5C2YA 2PL2A 1QQEA 3CHQA 2JLBA 2LUHA 4FBIA 3CVQA 1HFAA 1WIZA 5K98B 2PE5A 3IKOB 1WG0A 2OVBA 2LYQA 3QF3A 4EZIA 4F1PA 2XEEA 4EHMA 4DI4A 2HR2A 2X6FA 3L13A 1AWCB 3GZ1A 3I4RB 5FT9A 3JXBC 4G25A 3FU6A 3TWQA 2VSYA 2PUBA 2CG3A 2WXIA 4F8DA 2GZUA 1O5MA 2LXMA 2OEVA 1N52A 1YYHA 3GN5B 2R05A 4LSZE 5BV1A 2ZIRA 3NZLA 5JJ6A 5DBKA 1GW6A 3D3MA 4FA6A 1NA0A 4FLHA 4I6GA 2CSFA 1ZAYA 4K5CA 3EHMA 1WH8A 1FT2A 2WMOA 3P1UA 2VGEA 2XHEA 4GZ3A 2Y4TA 3FTWA 1UG3A 4JHJA 3R9AB 3AG1E 4PS7A 2GRLA 4KVMA 3FDHA 3RRUA 2PUCA 5E76A 3I4GA 4MBGA 3QYXA 2V5QC 3UWPA 1BI8B 2DZOA 4PDXA 3R7QA 1SW6A 3CHSA 1PY1A 1UW4B 4K03A 2EINE 4N3AA 4KZCA 3CHOA 2L8NA 1L1MA 2HYZA 3HXEA 2DBAA 3DEOA 4A1GA 2ZU6B 2OEWA 5FZQA 4DI3A 5ITZF 4BETA 1NI1A 3Q15A 2LSVA 4FN3A 3DSTA 3UUXA 4GMRA 4ANWA 3UINC 4ER5A 3OAWA 1JUQA 4JL0A 3RO3A 1UXDA 1HH8A 5D0QD 1X5BA 3JXDL 4GCNA 3UIOC 3L08A 3E37A 3HHMA 4GA1A 1NA3A 2L0IA 1OCCE 4RG6A 4NRHB 5A7DB 2WXOA 4OAUC 3T5XA 5CRUA 3TELA 3L54A 5BPPA 3G2VA 5EIDA 1ZZ6A 2Y1LE 3QDNA 3V30A 2IO2C 5LOZA 4N3CA 3Q9NC 3ZPJA 3B7SA 4HOTA 4K5AB 1OWLA 1MFQC 1ELKA 3DXKG 3UIPC 4HRAA 5CMYA 2I1KA 5ENTD
chains in the Genus database with same CATH topology
3QKYA 4YARA 4YG4A 1SZ9A 4ACLA 4QFVA 1R69A 2PIJA 4C0EA 3FUNA 5CCLA 3PH0C 3EIJA 2KZ8A 1CJGA 1PC2A 4MLPA 3ZYKA 4F53A 5ENNA 2VTBA 2CROA 3LY9A 2XQ0A 1QPZA 5FQ6A 4A3VA 4FP7A 5BNWA 2XPIA 2IF4A 3UT7A 2C0LA 1DVPA 2WXPA 3CR3A 4BY6A 5JHAA 2FF4A 5JHBA 2YHCA 1JWFA 1XNFA 4GZCA 3PZDA 4U0SA 3OQOA 2OV8A 3SFZA 4A3TA 1EDUA 3RRMB 3BD1A 2KZTB 3CVLA 4X4GA 4I6TA 1ZU2A 1EPUA 3CSFA 3ZN3A 3S7BA 4PS8A 1E8YA 3G7DA 3VTYA 3H5TA 4GQMA 4C9BB 4GA2A 3Q47B 2PM7A 4EBAA 1DW9A 1LCDA 3FTXA 1ZVVA 5BW8C 3TXNA 3HVEB 4I43A 1OWNA 3CKBA 4DJAA 3QNKA 3S7JA 2IOLA 3LFPA 3SGHA 5T4YA 1NP7A 3G2WA 3KXAA 3SNXA 3D1NI 1OWOA 3FTYA 2OR1L 1EFAA 5T8IA 3FUEA 4JA9A 4F1SA 4N2SA 2PUFA 3JCKC 5J08A 2RD0A 3LDZA 3LYAA 3HIZA 3ESLA 2I1JA 1UN9A 2HINA 4XZ4A 3R7RA 4APFA 3ZIMA 4CRWA 4ILHB 3KEZA 2L49A 4G23A 4WWOA 3KS2A 4EZLA 1Z6TA 2OOEA 4U0ZA 3FEYA 1JWGA 3IHVA 4IULA 5LP0A 3LY8A 3PUKA 4BT9A 3MKQB 2BNOA 4CDMA 5LX8A 3HYMB 4GMLA 2R63A 2V4LA 4UI9K 4J1WA 2KEKA 2LAHA 4KXKB 3KAEA 5ARGA 3UMVA 3UT8A 3ZVVA 3T5VA 4PU4C 4Z59A 2DCPA 3APCA 4HVBA 4L1BA 5KJKA 4N5CA 3PEVB 3PS6A 4JC8A 3MA5A 2FJRA 1UJKA 2LYPA 3NQPA 3E4BA 3PREA 3G2TA 1ZZ8A 4F3VA 3UX4A 3ZKCA 1ELWA 4R7LA 2BNNA 2PUEA 1IHGA 2VQ2A 4UWGA 4GMJA 4AVXA 1WH6A 4F7AA 4JXTA 3TJPA 4G1TA 4ILIA 5E75A 4M3OA 4WWNA 4LEUA 4TUUA 1X57A 3FH5A 1JWLA 2YINA 3EIQC 2V5FA 3VLEA 2XRYA 3NZSA 4HOUA 4V3IA 1XWRA 3NZUA 4ACKA 1QP7A 1QQAA 3LEWA 3ASHA 3GZ2A 2MOWA 5FTPA 2C0MA 4CDRA 2L9BA 1W3BA 3UPVA 4KMOA 2WXKA 3SD5A 2IJGX 2H8RA 2WVIA 4Q96A 1ELRA 1IC8A 2XCCA 1LMB3 2J08A 3U64A 3CEQA 4Z5DA 1Z3XA 3TG4A 4HLEA 5KJNA 2XJ3A 4G2VA 2PQRA 2WQHA 2WXHA 5G05J 2XGOA 2IU7A 2IVBA 3ZYQA 5LFAA 3RU0A 5G05C 3IBEA 3CSTA 4PH4B 3ZHEA 1E3OC 1QQBA 2J4DA 3EDTB 5D0OD 2KEIA 2R17C 4G24A 2M63A 3CVYA 1IQRA 2PUDA 1TJFA 3IVPA 2L0TB 4JVSA 3SCFA 1UTXA 4Z58A 3CQCB 3Q49B 3FU0A 4BT8A 3R1FA 1E8XA 4BX8A 3O9XA 2MEZA 1LLIA 2VJ8A 3VLDA 3G2SA 3MZLB 3SF4A 4DLQA 3OMTA 3PE4A 3ZEFA 4IN3B 1RIOA 1SQMA 4L23A 1VDYA 4AV7A 2WUSR 2X3MA 2I2OA 4WNEA 2CHZA 2J07A 1S7EA 4FJZA 4EZKA 5FWQA 4FHKA 2EQXA 4AJWA 1DWKA 3ONLA 4ANXA 1H6KA 4D10C 5A23A 4UWFA 1RZSA 1LCCA 1RZRA 1Z3YA 3OXFA 2WQ6A 4GAAA 4JQDA 2O49A 3MGBA 1EYHA 3FYAA 2L6JA 2Y4UA 4PS3A 1Y6IA 3B7TA 3VLFA 1Y9QA 3ZYLA 3LY7A 3VK0A 4LERA 2P58C 2X6HA 1ZPQA 3U3WA 4Y6CA 1E7UA 1OUVA 3MKRA 4KBQA 4MCXA 4OVUA 3BEEA 4GCOA 2VTBB 1TEZA 4JEHA 3RJVA 4FU3A 1R63A 3QK0A 3K9IA 3IV0A 2LYJA 3ZXSA 2AWIA 2WXLA 2WXFA 2UY1B 5AJLA 3LVQE 2KC7A 2JCGA 4E85A 1ADRA 4I9EA 3D9LA 4ANUA 3TG5A 3CVUA 3U9WA 2BTDA 2OVFA 3B7RL 2FO7A 3D9JA 1JH9A 4GYYA 2KCLA 4JHKA 2IONA 1POUA 4XKBA 5ARFA 3RKVA 3T8MA 3MYVA 3MLFA 1H0AA 4MCTA 1WM5A 3FMYA 2WM9A 1HF8A 3ASFA 3ONKA 1ZBPA 4FJYA 3GBFA 2A6CA 4X4FA 3AU5A 1YA0A 3KD7A 4O8BA 3MCXA 5EX0A 2LSUA 2MHKA 2X38A 5FZSA 1ZZ9A 2X6JA 2WIUB 4BSXA 3RZZA 3GW4A 4L2YA 4NURA 4JCXA 4I1AA 2EF8A 3D9OA 5G04J 2HSGA 3QWVA 4H7YA 3RIBA 4CGWA 5HQ8A 5G04C 3SCHA 2CFUA 1PERL 1B89A 4HOQA 4BFRA 5J90A 3LJ3A 4GU5A 1H19A 3I3NA 3UFDA 3L1PA 3DNVB 2X6IA 2HM8A 4OVVA 3FUJA 4B0ZA 3FTZA 3OXLA 4FULA 2QY7A 4B8AA 4I8TA 5LCWJ 4P29A 3LXUX 3JUIA 3PNTB 4N39A 5LCWC 5CMWA 1MQSA 3O4ZA 4I17A 4JW1A 3BDNA 3ZYMA 2PZIA 3FUMA 4UWKA 4G26A 4J8FA 5FQ7A 3ZGQA 5KJMA 3GN5A 4AM9A 4FLBA 3G2UA 1PNRA 4H7XA 1E96B 3PRZA 5FQ4A 3JYSA 2VSOE 3QWWA 3BG1B 2IOSA 1GT0C 4Q94A 3BS3A 2I9CA 3CKCA 5A7LA 1H2VC 3Q4AB 3QB2A 4URKA 3B7HA 3F52A 2KZTA 3FUKA 4U8HA 2Q7FA 1KLXA 4CCAA 3OQMA 1Y8MA 1QZ2A 2PM6A 1NEQA 4UWLA 3G5GA 1A17A 1E90A 4J0UA 2NC9A 3AS5A 4B94A 3P2BA 4EECA 4MS6A 1PRVA 2FI7A 3FTUA 4YVOA 4TV3A 2XPZA 3CHMA 4U0UA 2B5AA 1ZZBA 1UN8A 2BUGA 3LISA 3RK6A 3BG0B 4RSYA 1WAO1 3S2AA 3SHFA 4B89A 4DK5A 4WNDA 5G55A 3CK9A 3IHYA 4IA8A 4UQXA 4I6JA 4AXHA 2AXUA 3HVEA 5EKQD 3ZFWA 1HO8A 3CIAA 5D0QD 1HE8A 1NZNA 2J49A 4BTAA 4X4EA 4YNDA 4I6EA 3QWGA 5FZRA 2ICPA 2KCVA 3D9KA 4YVQC 4GZDA 2WXMA 5HI7A 4GPKA 2XSDC 4J1XA 4RVBA 3ZW3A 4APOA 2LCVA 3SCGA 1HU3A 3OTNA 3CLJA 1U3CA 4AP2A 4AIFA 4WAFA 4ATGA 4Z5CA 4XI9A 4BTBA 2XIUA 4XE0A 3UT4A 4X4HA 4CDNA 5EDSA 1WY6A 1ZZ7A 5A6CA 3CGHA 3CROL 2VSXE 1EF1C 3FH8A 4ME2A 2WXGA 2J9QA 3MKQA 1AU7A 5AIJA 4J8SA 1TJCA 4KZ0A 4EQFA 3U66A 4GHJA 2WXQA 3MX3A 1FVFA 3PDNA 4W9RA 4UQZA 2UWJG 2MRIA 3QAQA 4CT4A 2IVGA 3FP3A 4WWPA 5T3RA 1KT0A 1WETA 1LF8A 2ILRA 4DPRA 2XEVA 4J8EA 5EX3A 2R59A 1FVHA 4I6RA 2BJCA 1HG5A 3PNLB 4GZ5A 2LYRA 4MKTA 5FJYA 3ASGA 3MJWA 1ZZCA 4GB9A 3SI5A 3LPZA 3JXCL 2PPXA 2YNQA 4A55A 3FYMA 4UI9C 1INZA 4XIFA 4Z5HA 3CLCA 4HS2A 2V0PA 3LCAA 3CHPA 3L22A 2FBNA 4FADA 5BT1A 1Y7YA 2PQNA 4WNFA 2WXRA 4IWRA 2PUAA 4JA7A 2GRMA 4HOSA 1H2UA 2O38A 1O4XA 3ASDA 4Y42A 3C98A 3AS8A 4I1MA 1KT1A 3SBSA 5JJ7A 3CECA 3QWPA 5KCMA 2I6HA 4L2LA 3HDXA 4OB4A 2LYKA 1E8WA 3JQ1A 4EPZA 4O6FA 3TXMA 4JCYA 1U3DA 1N54A 3GYZA 3PEUB 5AYWD 1UXCA 4WUYA 3FHEA 3QOUA 1E8ZA 5C2YA 2IQCA 1JPLA 2PL2A 3NF1A 1QQEA 2WMNA 3SBTB 3CHQA 2XRZA 2JLBA 3RO2A 5C1DA 2AW6A 4FBIA 2VGXA 2XGMA 4AY6A 3CVQA 4JPSA 4U07A 4PU8A 1HFAA 2XPYA 1WIZA 5K98B 2PE5A 2HO1A 3IKOB 3L6AA 1OCTC 4EBAG 4N2QA 2OVBA 2WPVA 2LYQA 4XKCA 2Y3AA 1MHQA 3FTSA 3QC1A 3FUDA 1ZUGA 2E2EA 2LO6A 2R5SA 3QF3A 2RG8A 3ESKA 3OQNA 3OXGA 4Q69A 3D9MA 4KT6B 1QP4A 2LYLA 1PAQA 4GA0A 1QP0A 1NERA 2C2LA 2XCBA 3B7UX 3LVRE 4HXIA 3PXPA 3CQGB 4J8DA 4U04A 3QQ6A 2J4BA 3CVNA 4DI4A 2HR2A 2X6FA 3L13A 3GZ1A 2KATA 3GZSA 2ICTA 2IUOA 1OWMA 5AJDA 2GGFA 4PU7A 1HF0A 2PUGA 3I4RB 4X4CA 5FT9A 1HS6A 3EUSA 4NDWA 4RG9A 3JXBC 3PUJA 4G25A 3FH7A 3VTXA 3FU6A 1JFSA 2VSYA 3L16A 3PE3A 2PUBA 2CG3A 2AUWA 2WXIA 4F8DA 2GZUA 4BX9A 3D9PA 4CGVA 1VPWA 2EWTA 3KJXA 1N52A 4UWHA 2CHXA 3GN5B 2UY1A 1RZRD 1S0PA 2GW1A 3DPDA 4YBAA 4G11A 5BV1A 4JEUA 2IU1A 2A4ZA 4KYOB 5JJ6A 4X4DA 2IVQA 4C0MA 2DIWA 2NXPA 4J6IA 3FULA 5DBKA 5KJLA 3ENEA 3ZRHA 1GW6A 3CVWA 4X4BA 4I2WA 4YG7B 2WXNA 3D3MA 4DLOA 4AY5A 4A1SA 4FA6A 1YSEA 4YG1A 1X2LA 1E7VA 1NA0A 1PRAA 4IVZA 2CSFA 1P5QA 1L5JA 4FLHA 4I6GA 1HXIA 1ZAYA 5BUZA 4KVOA 2WQ7A 3FUIA 2IV1A 1FCHA 3IEGA 1PRUA 1WH8A 3EHMA 3UQ3A 4ILGA 2LNIA 3LS8A 2WB2A 4FC8A 2WMOA 4LUNU 5ANLA 4HORA 3P1UA 4XX5A 4OYSA 2VSNA 2XHEA 3MV3B 2Y4TA 4GZ3A 4IRUA 3FTWA 2CFZA 2FEZA 1UG3A 3EHNA 3FEXA 4JHJA 1BDIA 2KPJA 5ANRA 2YHEA 3R9AB 2V8SE 4PS7A 2GRLA 4KVMA 4UQYA 2WXJA 4LRZA 3FDHA 1DNPA 3RRUA 2E0IA 2PUCA 3FY4A 2AVPA 5E76A 3ULQA 4AOFA 3I4GA 4B8CB 3QYXA 4X4IA 2IFUA 4BWRA 1RPEL 1JFTA 1IQUA 4GYOA 4CT0A 4PDXA 3OP9A 3R7QA 3CV0A 5FQ8A 3CHSA 4JHRA 2XI8A 1PY1A 1UW4B 1SQ8A 4K03A 4N3AA 3FWVA 5M72A 4KZCA 4GZ6A 2CHWA 1OWPA 3CHOA 3TGOA 4IYPA 4GYWA 2L8NA 4LCTA 1L1MA 2HYZA 3TAXA 2OFYA 3WXXA 2DBAA 3APFA 2AXVA 5CCMA 2VGYA 2VYIA 4XI0A 2D5VA 2ZU6B 3ZHEB 2J09A 5FZQA 4A1GA 4DI3A 3U4TA 2LYSA 1CQTA 2ONDA 4K0RA 1HG2A 4UI9J 2LAIA 4TRQA 3S7DA 4N3BA 3AU4A 4PU3C 2LSVA 3Q15A 3ML8A 3CVVA 2BF0X 3HZIB 4FN3A 3D9IA 3UUXA 4ANVA 4EZJA 5JJTA 1H2TC 2MQKA 4JZYA 3FTVA 1OSLA 4I6UA 4E6HA 3FU5A 1HZ4A 2KM4A 3FFLA 3FU3A 3EJNA 3MEKA 4ANWA 4L7TA 3JQ0A 3Q5MA 1LQCA 3CHRA 3OAWA 1JUQA 4JL0A 4Y6WA 1UJJA 3FUHA 3ZHMA 4NQ0A 4PUCA 1UXDA 1HH8A 2CG2A 2NSZA 2XCJA 3ZHIA 1X5BA 3JXDL 2VGXB 3FUFA 3MV2B 4GCNA 3S8QA 3L08A 5CHEE 2A5UA 2X6KA 3HHMA 4ABNA 1IYGA 4GA1A 1BPOA 4I2ZA 1NA3A 1SZAA 2L0IA 4WNGA 2KCKA 4RG6A 3PVLA 4NRHB 1XGWA 5A7DB 3RRNB 3SZ7A 2WXOA 3S7FA 3KZ3A 2R1JL 3QARA 3T5XA 3I5PA 5DIZA 3ML9A 4NACA 2KEJA 1QNFA 4AEZC 2EBYA 2XGSA 3QJZA 5G2NA 5BV0A 4I1OB 3RO3A 4U63A 3CVXA 2YQ8A 3L54A 4MRUA 2O4AA 2JVLA 3N71A 5AENA 3O48A 5BPPA 3APDA 3TRBA 3G2VA 3LKUA 3F6WA 2FULA 1ZZ6A 1HX8A 3D9NA 3DBSA 3TL5A 3QDNA 3AS4A 4FHJA 2BNMA 5LOZA 4N3CA 3B13A 3ZPJA 2JEKA 3B7SA 4HOTA 3CVPA 4CEMA 1BDHA 2AXZA 3URZA 3F51A 4HFGA 1ZS4A 4I9CA 1OWLA 1ELKA 3CK8A 3L17A 5CMYA 2I1KA 1B0NA 3CK7A 2QFCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PRA A;  4IVZ A;  2CSF A;  4YAR A;  4YG4 A;  4Z5C A;  2PUD A;  2XIU A;  1R69 A;  4X4H A;  2PIJ A;  3IVP A;  1ZAY A;  3SCF A;  1UTX A;  1ZZ7 A;  2IV1 A;  4Z58 A;  1PRU A;  1WH8 A;  2KZ8 A;  1CJG A;  3R1F A;  3CRO L;  3O9X A;  2MEZ A;  1LLI A;  1AU7 A;  2CRO A;  3OMT A;  1QPZ A;  1RIO A;  4GHJ A;  2WUS R;  1S7E A;  2IVG A;  1BDI A;  1DWK A;  2KPJ A;  1WET A;  1RZS A;  2GRL A;  1RZR A;  3OQO A;  1LCC A;  4I6R A;  2BJC A;  3BD1 A;  2LYR A;  4JQD A;  2O49 A;  3FYA A;  4X4G A;  1ZZC A;  4I6T A;  2PUC A;  1Y9Q A;  3JXC L;  2PPX A;  3VK0 A;  3FYM A;  1ZPQ A;  3U3W A;  4Z5H A;  3CLC A;  3QYX A;  4MCX A;  4X4I A;  1RPE L;  1JFT A;  3G7D A;  3H5T A;  4GQM A;  3OP9 A;  1Y7Y A;  1R63 A;  4IWR A;  1DW9 A;  2LYJ A;  2XI8 A;  1LCD A;  2AWI A;  2GRM A;  1ZVV A;  2PUA A;  1SQ8 A;  2O38 A;  1O4X A;  4Y42 A;  2JCG A;  1ADR A;  3CEC A;  3LFP A;  4OB4 A;  2L8N A;  2LYK A;  3KXA A;  1L1M A;  1JH9 A;  1POU A;  2OFY A;  3D1N I;  4JCY A;  1UXC A;  3MLF A;  4MCT A;  3FMY A;  2AXV A;  1EFA A;  2OR1 L;  2D5V A;  3GBF A;  2PUF A;  2A6C A;  4X4F A;  4O8B A;  2HIN A;  2LYS A;  1CQT A;  1ZZ9 A;  2AW6 A;  2L49 A;  2WIU B;  3RZZ A;  4FBI A;  4JCX A;  2EF8 A;  4PU3 C;  2HSG A;  4PU8 A;  1WIZ A;  5K98 B;  3HZI B;  3SCH A;  4FN3 A;  2PE5 A;  1OCT C;  2BNO A;  1PER L;  2LYQ A;  2R63 A;  2MQK A;  1ZUG A;  3L1P A;  4J1W A;  4I6U A;  2KEK A;  3DNV B;  3UFD A;  1OSL A;  3QF3 A;  4PU4 C;  4Z59 A;  3OQN A;  4I8T A;  1QP4 A;  2LYL A;  1QP0 A;  1NER A;  1LQC A;  2FJR A;  2LYP A;  3PXP A;  3QQ6 A;  1ZZ8 A;  3BDN A;  3ZHM A;  1UXD A;  3ZKC A;  3GN5 A;  2XCJ A;  3ZHI A;  2BNN A;  2ICT A;  2IUO A;  3JXD L;  1PNR A;  2PUE A;  3S8Q A;  1WH6 A;  4PU7 A;  1HF0 A;  1GT0 C;  2PUG A;  3BS3 A;  4X4C A;  3EUS A;  1X57 A;  4NDW A;  5A7L A;  1JWL A;  3B7H A;  3F52 A;  3JXB C;  3OQM A;  3KZ3 A;  2R1J L;  1NEQ A;  1JFS A;  1XWR A;  3G5G A;  2PUB A;  4YG1 A;  2AUW A;  2KEJ A;  4F8D A;  2GZU A;  1QP7 A;  1PRV A;  1QQA A;  2EBY A;  2B5A A;  1ZZB A;  1VPW A;  2EWT A;  3KJX A;  3LIS A;  2O4A A;  2JVL A;  2H8R A;  4IA8 A;  1IC8 A;  3TRB A;  2AXU A;  1LMB 3;  3F6W A;  3GN5 B;  1ZZ6 A;  1RZR D;  4YBA A;  4Z5D A;  2BNM A;  4X4E A;  2XJ3 A;  3QWG A;  2ICP A;  4X4D A;  2IVQ A;  2IU7 A;  2IVB A;  2XSD C;  4J1X A;  1BDH A;  2AXZ A;  2LCV A;  3F51 A;  3SCG A;  1ZS4 A;  4X4B A;  4YG7 B;  1E3O C;  1QQB A;  1YSE A;  1X2L A;  2KEI A;  1B0N A; 
#chains in the Genus database with same CATH topology
 4ACL A;  4CZ2 D;  3ABK E;  2PIJ A;  3ABL E;  5ENN A;  2VTB A;  2XQ0 A;  3TWV A;  1MZC A;  3CR3 A;  5JHA A;  2PXL A;  2PXU A;  2YHC A;  3PZD A;  4A3T A;  1EDU A;  2KZT B;  4X4G A;  1D8D A;  1ZU2 A;  3ZN3 A;  3VTY A;  3ZU7 B;  4C9B B;  3FTX A;  1OY3 D;  1OWN A;  4I43 A;  4B93 B;  2P9S G;  5T4Y A;  3SNX A;  3IXE A;  1WDY A;  4N2S A;  4F1S A;  3JCK C;  3AAA C;  3HIZ A;  2HIN A;  4CRW A;  3ZIM A;  4HRM B;  4G23 A;  4U0Z A;  1UOH A;  3FEY A;  5LP0 A;  4BT9 A;  2BNO A;  4CDM A;  3HYM B;  4GML A;  5ARG A;  2LAH A;  4KXK B;  3UMV A;  4Z59 A;  3APC A;  1N94 A;  5KJK A;  1UJK A;  3E4B A;  1IHB A;  3R9M A;  4JXT A;  4HQD A;  3TJP A;  1S64 A;  4M3O A;  2PXF A;  4LEU A;  4V3I A;  1QQA A;  3RAU A;  2MOW A;  2C0M A;  4CDR A;  2L9B A;  3UPV A;  2WXK A;  4Q96 A;  1ELR A;  3UXG A;  1LMB 3;  4Z5D A;  3ME5 A;  4HLE A;  1V54 E;  2PQR A;  5DRY A;  2R2L A;  2IU7 A;  3EUV A;  4O60 A;  5G05 C;  3IBE A;  1E3O C;  2J4D A;  2KEI A;  1TNU A;  4BSZ B;  3SCF A;  1UTX A;  4M7C A;  1E8X A;  4BX8 A;  3O9X A;  3VLD A;  1LLI A;  3PE4 A;  1RIO A;  3EHQ A;  1OCZ E;  2WUS R;  2X3M A;  4HNA D;  2CHZ A;  2J07 A;  5FWQ A;  5A23 A;  2KBX A;  1RZS A;  2WQ6 A;  4JQD A;  1EYH A;  3LJN A;  3ZYL A;  3B7T A;  3VK0 A;  2ODR D;  1E7U A;  3C3Q A;  4OVU A;  2VTB B;  1TEZ A;  3T8K A;  4FU3 A;  1BLX B;  3LVQ E;  5ENO D;  3B7R L;  2FO7 A;  4JHK A;  2GRR B;  3RKV A;  3MLF A;  3A9X A;  2IY0 C;  4FJY A;  3GBF A;  2A6C A;  3JUE A;  3KD7 A;  4O8B A;  3MCX A;  2XXQ A;  2X38 A;  2WIU B;  3GW4 A;  3Q75 A;  4I1A A;  3D9O A;  3DEP A;  5G04 J;  2HSG A;  4CGW A;  5HQ8 A;  3LJ3 A;  4GU5 A;  1H19 A;  4OAV B;  3FUJ A;  1TN6 A;  5KWD A;  4FUL A;  4P29 A;  4U8Y D;  3LXU X;  4N39 A;  5GAG i;  5CMW A;  4I17 A;  4UWK A;  5KJM A;  5FQ7 A;  3ZGQ A;  3SY2 A;  5FQ4 A;  2VSO E;  5EYP F;  3F52 A;  4U8H A;  2Q7F A;  3OQM A;  2PM6 A;  4ER0 A;  4EEC A;  4MS6 A;  4TV3 A;  2XPZ A;  2V3C C;  2BUG A;  2FO1 E;  2KXP C;  3BG0 B;  5G55 A;  4IA8 A;  4AXH A;  3HVE A;  2DWZ A;  3CIA A;  4BTA A;  1HE8 A;  4DX2 A;  4X4E A;  2Y69 E;  3TWS A;  4GTV A;  2ICP A;  2KCV A;  5KBA A;  3DM5 A;  4RVB A;  1FT1 A;  4APO A;  2LCV A;  1RZ4 A;  1HU3 A;  2H6H A;  4AIF A;  4WAF A;  4Z5C A;  4XI9 A;  2XIU A;  3CGH A;  1DCQ A;  4QQI A;  1EF1 C;  2WXG A;  3MKQ A;  5B3S E;  1TJC A;  3U66 A;  2WXQ A;  3MX3 A;  1MX2 A;  1FVF A;  1JCQ A;  2MRI A;  3FP3 A;  5T3R A;  5D66 A;  4J8E A;  2R59 A;  3B95 A;  4MKT A;  3JXC L;  2YNQ A;  3FYM A;  4XIF A;  3CLC A;  1OCO E;  2PQN A;  4IWR A;  4GPM A;  1X81 A;  2O38 A;  1O4X A;  4I1M A;  3AS8 A;  5FIN A;  5KCM A;  3HDX A;  1E8W A;  4WUY A;  3FHE A;  1E8Z A;  3SBT B;  1BD8 A;  3C3O A;  4AY6 A;  2AW6 A;  2WPV A;  4XKC A;  2Y3A A;  3QC1 A;  3FUD A;  2LO6 A;  3ESK A;  3OQN A;  1N95 A;  3D9M A;  4KT6 B;  1TNO A;  3B7U X;  2XCB A;  3C5R A;  1FPP A;  3LVR E;  5CED B;  3CQG B;  4J8D A;  4U04 A;  1K1B A;  2J4B A;  2KAT A;  1OWM A;  2GGF A;  1BI7 B;  4X4C A;  5EYL A;  4DUI A;  4BX9 A;  5ENR D;  4CGV A;  1VPW A;  3KJX A;  5IY5 E;  2UY1 A;  1RZR D;  2F0Y A;  2GW1 A;  3DPD A;  2IU1 A;  2JAB A;  3SX0 A;  3DSV A;  3Q9U C;  3ENE A;  3ZRH A;  2WXN A;  2XXP A;  4DLO A;  4A1S A;  1X2L A;  4ZFH A;  1PRA A;  1L5J A;  4L9P A;  4KVO A;  3FUI A;  2IV1 A;  1FCH A;  3IEG A;  1PRU A;  3UQ3 A;  4HOR A;  3AG4 E;  5DRT A;  5CEC B;  2VSN A;  1KZP A;  1BDI A;  1TN8 A;  5ANR A;  2YHE A;  2V8S E;  1QBQ A;  4GTO A;  3DSU A;  4HI9 A;  2H6F A;  2WXJ A;  4UQY A;  5CER B;  3FY4 A;  4CT0 A;  3OP9 A;  5FQ8 A;  4GTP A;  2XI8 A;  3Q7A A;  5M72 A;  2CHW A;  1OWP A;  3TGO A;  4GYW A;  3TAX A;  2AJA A;  2J09 A;  4LNG A;  1O1T A;  2LAI A;  3S7D A;  4PU3 C;  2BF0 X;  5DTR A;  3FTV A;  3FU5 A;  3FU3 A;  3EJN A;  3MEK A;  4L7T A;  3JQ0 A;  3X2Q E;  3CHR A;  4Y6W A;  1UJJ A;  3ZHM A;  4XZ4 A;  2XCJ A;  4ABN A;  2A5U A;  2X6K A;  4U8V D;  1SZA A;  2DZN A;  2KCK A;  3SZ7 A;  3PZ2 A;  3Q78 A;  5AQB A;  3DRA A;  3E33 A;  4I1O B;  2O4A A;  2JVL A;  5DT2 A;  3N71 A;  3TRB A;  3F6W A;  1HX8 A;  2BNM A;  3B13 A;  4CEM A;  3URZ A;  4EK9 A;  3L17 A;  1N11 A;  1B0N A;  3CK7 A;  4WNE A;  3BUA A;  2B6C A;  2F37 A;  4U7E B;  1U2Z A;  3EIJ A;  1PC2 A;  4F53 A;  2DYR E;  2CRO A;  5JMN D;  5BNW A;  3UT7 A;  2IF4 A;  1MYO A;  1JWF A;  4GZC A;  5KNH D;  4U0S A;  3UKR G;  3HXB A;  3HXC A;  4RQI A;  1NL4 A;  4GQM A;  4GA2 A;  2RFM A;  3NRO A;  1LCD A;  1ZVV A;  2PXP A;  5BW8 C;  2MXD A;  3S7J A;  1K8K G;  1NP7 A;  3KXA A;  4Z68 A;  3TEP A;  3FTY A;  2OR1 L;  4LNB A;  3EU5 A;  2PUF A;  3LDZ A;  1UN9 A;  3R7R A;  2L49 A;  3UM1 A;  2OOE A;  4HB5 A;  3PUK A;  1KZO A;  3ISM C;  4J1W A;  2KEK A;  4LNU D;  1OCR E;  4L1B A;  5B1A E;  1LD8 A;  3MA5 A;  2FJR A;  3NQP A;  2LYP A;  3G2T A;  4F3V A;  4UWG A;  3KSL A;  4F7A A;  3SR4 A;  5E75 A;  4WWN A;  4TUU A;  3FH5 A;  1JWL A;  2YIN A;  3EIQ C;  2V5F A;  2LLW A;  3LEW A;  2P9K G;  5DTQ A;  1O1S A;  4KMO A;  3R09 A;  2IJG X;  2H8R A;  2XCC A;  3TG4 A;  5KJN A;  2WXH A;  2XGO A;  2IVB A;  5LFA A;  3CST A;  4PH4 B;  3ZHE A;  1QQB A;  3E34 A;  2M63 A;  2PUD A;  2L0T B;  4JVS A;  3Q49 B;  3CQC B;  2GRP B;  4N5Q A;  3PZ3 A;  3G2S A;  3MZL B;  3OMT A;  3ZEF A;  3E30 A;  1SQM A;  4L23 A;  1VDY A;  4AV7 A;  5KNG A;  1S7E A;  3OKZ A;  4AJW A;  3ONL A;  1ZB1 A;  1Z3Y A;  3OXF A;  3VLF A;  3FYA A;  4PS3 A;  1Y9Q A;  2P58 C;  2X6H A;  1ZPQ A;  1OUV A;  3MKR A;  2XZT G;  4JEH A;  1QYM A;  1R63 A;  3K9I A;  3DSW A;  3ZXS A;  3ZPX A;  2WXF A;  2KC7 A;  4E85 A;  4I9E A;  1MX6 A;  4U96 D;  3CVU A;  3J5P A;  4GYY A;  5ARF A;  3D9J A;  1Z5S C;  2KCL A;  1POU A;  3T8M A;  1H0A A;  4MCT A;  2WM9 A;  1HF8 A;  1LTX A;  3AU5 A;  2MHK A;  3RZZ A;  4NUR A;  1U2V G;  4H7Y A;  5G04 C;  2CFU A;  2X6I A;  4OVV A;  4B0Z A;  4JW1 A;  1D9S A;  3E32 A;  3FUM A;  4FLB A;  3PRZ A;  3QWW A;  2IOS A;  2I9C A;  3CKC A;  5A7L A;  1H2V C;  3Q4A B;  3B7H A;  4CCA A;  2XZD G;  4UWL A;  3G5G A;  1N4P A;  3UI2 A;  2NC9 A;  4B94 A;  4K5B A;  3CHM A;  3RK6 A;  3PZ4 A;  4RSY A;  4WND A;  5EKQ D;  1HO8 A;  1NZN A;  4YND A;  5FZR A;  3D9K A;  4JB8 P;  3OTN A;  3B7B A;  3CLJ A;  1U3C A;  4ATG A;  3GZC A;  4CDN A;  3G0T A;  3FH8 A;  2J9Q A;  1TN7 A;  4EQF A;  1G3N B;  4GHJ A;  2YBD A;  3PDN A;  4WWP A;  1LF8 A;  2PXQ A;  2XEV A;  4DX6 D;  1FVH A;  2BJC A;  2EIM E;  3VWS A;  5FJY A;  1YCS B;  3ASG A;  3ULY A;  2VEO A;  3LPZ A;  1H6P A;  4GTS A;  2FBN A;  5BT1 A;  4WNF A;  2PUA A;  4JA7 A;  1QZX A;  3ASD A;  3C98 A;  5JJ7 A;  4Y42 A;  3TFL A;  4EPZ A;  3JQ1 A;  4JCY A;  4HRL A;  4YDW A;  1UXC A;  3QOX A;  1JPL A;  2WMN A;  2XRZ A;  2VGX A;  2XGM A;  4JPS A;  4PU8 A;  3L6A A;  2HO1 A;  4EBA G;  1OCT C;  1MHQ A;  1ZUG A;  2ETB A;  3UM3 A;  2RG8 A;  3OXG A;  1QP4 A;  1PAQ A;  4GA0 A;  1QP0 A;  3PXP A;  2F8Y A;  3CVN A;  2IUO A;  5AJD A;  2L1P A;  2PUG A;  3EUS A;  4RG9 A;  3L16 A;  3PE3 A;  3SO8 A;  3D9P A;  2EWT A;  1Q2Z A;  4UWH A;  3T9K A;  1S0P A;  4G11 A;  1LD7 A;  2A4Z A;  1N4S A;  2PXK A;  4DX5 D;  4C0M A;  3OWQ A;  2DIW A;  2RKK A;  4J6I A;  4HRN A;  3RSE G;  4YG7 B;  1YSE A;  3GUU A;  5AN8 A;  4IVZ A;  2A5E A;  3MEJ A;  2WQ7 A;  2HCS A;  4ILG A;  2LNI A;  3LS8 A;  2WB2 A;  2P9P G;  4FC8 A;  5ANL A;  2P9U G;  4IRU A;  5AQ7 A;  3EHR A;  4TUM A;  4LRZ A;  5CBO A;  1S70 B;  1DNP A;  2AVP A;  3ULQ A;  4AOF A;  4B8C B;  4X4I A;  2IFU A;  1RPE L;  1JFT A;  2HE0 A;  4GYO A;  3NDB B;  3CV0 A;  3HXF A;  4DE8 A;  4JHR A;  3QOW A;  3FWV A;  4GZ6 A;  3JXJ A;  4IYP A;  2GRO B;  3WXX A;  3BQO A;  3APF A;  2AXV A;  5CCM A;  1K3Z D;  2VYI A;  4XI0 A;  2D5V A;  1IXV A;  2LYS A;  1CQT A;  2OND A;  1HG2 A;  3CVV A;  3ML8 A;  4EZJ A;  4I6U A;  4TXQ A;  1HZ4 A;  1K1A A;  3FFL A;  3PE5 A;  3ZKJ A;  4PUC A;  2CG2 A;  2NSZ A;  3FUF A;  2VGX B;  5CHE E;  4TXR A;  2HCN A;  3PVL A;  4DX1 A;  1XGW A;  2R1J L;  3QAR A;  3LQX A;  3ML9 A;  4NAC A;  4AEZ C;  1QNF A;  5GAH i;  2XGS A;  3M9L A;  5BV0 A;  3A9Z A;  3CVX A;  4U63 A;  5AEN A;  3O48 A;  3APD A;  3DBS A;  5HKP A;  3AS4 A;  4FHJ A;  2JEK A;  3CVP A;  2AXZ A;  3F51 A;  4HFG A;  1ZS4 A;  4I9C A;  5AQ9 A;  1SZ9 A;  4YG4 A;  4QFV A;  1O1R A;  2KZ8 A;  4MLP A;  2PXB A;  3LY9 A;  4JD2 G;  3PZ1 A;  2C0L A;  1DVP A;  2WXP A;  5JHB A;  1XNF A;  3QFI A;  2QYU A;  3RRM B;  3BD1 A;  1EPU A;  3ASN E;  3S7B A;  3G7D A;  2PM7 A;  4EBA A;  1DW9 A;  3TXN A;  3HVE B;  3CKB A;  3HXD A;  1N0Q A;  2RFA A;  2IOL A;  2Y0B G;  2L6B A;  2XS8 A;  4GTR A;  5FIO A;  1OWO A;  1EFA A;  5T8I A;  4YDY A;  5J08 A;  3ZXP A;  3LYA A;  5BUZ A;  3ESL A;  2I1J A;  5CEA A;  3KEZ A;  4WWO A;  1Z6T A;  3IHV A;  1JWG A;  4IUL A;  3SFY A;  3MKQ B;  5LX8 A;  4PU4 C;  4HVB A;  4N5C A;  1D8E A;  3PEV B;  3PRE A;  1N9A A;  3ZKC A;  4R7L A;  2PUE A;  1IHG A;  4GMJ A;  1WH6 A;  4G1T A;  3KL4 A;  4ILI A;  1X57 A;  3NZS A;  4HOU A;  1XWR A;  3NZU A;  4ACK A;  4ER6 A;  3GZ2 A;  2XXA A;  1W3B A;  1IC8 A;  3UTM A;  3U64 A;  1Z3X A;  2XJ3 A;  2ZGG A;  4HLL A;  4LG6 A;  3GZD C;  2R17 C;  4G24 A;  3DXM G;  2VJ8 A;  4DLQ A;  4IN3 B;  2I2O A;  4A63 B;  2EQX A;  1H6K A;  4D10 C;  3J5Q B;  1N4R A;  1YMP A;  3NB2 A;  4GAA A;  4J8Y A;  2O49 A;  2Y4U A;  2L6J A;  1Y6I A;  4MCX A;  3RJV A;  2R02 A;  5DSX A;  3QK0 A;  2AWI A;  2UY1 B;  2DVW A;  2JCG A;  1ADR A;  4ANU A;  3D9L A;  5HS0 A;  3TG5 A;  3U9W A;  4EQZ A;  2QZA A;  2BTD A;  2ION A;  3MYV A;  3AG3 E;  3ASF A;  2LNM A;  5EX0 A;  4BSX A;  2X6J A;  1TYQ G;  4L2Y A;  2EF8 A;  3QWV A;  5B1B E;  3KEA A;  1B89 A;  3A9Y A;  3UFD A;  3L1P A;  2HM8 A;  4YDO A;  2QC9 A;  3FTZ A;  3OXL A;  2QY7 A;  4B8A A;  3TWW A;  5LCW J;  2XEH A;  1SA4 A;  3JUI A;  3NOC D;  3PNT B;  5ENQ D;  1OT8 A;  4G26 A;  4AM9 A;  3G2U A;  3JYS A;  3BG1 B;  3BS3 A;  5DTM A;  5H7P A;  4ER7 A;  2KZT A;  1AP7 A;  2GRN B;  1A17 A;  1E90 A;  3P2B A;  2JQE A;  1PRV A;  2FI7 A;  4YVO A;  2B5A A;  1ZZB A;  4BER A;  4DK5 A;  3CK9 A;  3IHY A;  2AXU A;  3BU8 A;  3QWG A;  1DCE A;  3NXH A;  4AP2 A;  4G8K A;  4X4H A;  1WY6 A;  1ZZ7 A;  3Q73 A;  1AU7 A;  4UQZ A;  3GZD A;  1KT0 A;  1WET A;  3ULE G;  2ILR A;  4DPR A;  5EX3 A;  5ENP D;  1HG5 A;  2EIK E;  3PNL B;  4GZ5 A;  3NBN B;  3W9G A;  3MJW A;  1ZZC A;  2LXL A;  2PPX A;  3TWX A;  4A55 A;  4UI9 C;  1INZ A;  4Z5H A;  4O1O A;  3TWR A;  5JA4 D;  2P2C P;  4HS2 A;  4J7W A;  3LCA A;  3L22 A;  1KPS B;  3ZUV B;  1HQ1 A;  2WXR A;  2GRM A;  4HOS A;  3SBS A;  3CEC A;  2I6H A;  4L2L A;  2LYK A;  4UUC A;  4O6F A;  1U3D A;  1N54 A;  2DYS E;  3GYZ A;  3AJI A;  3PEU B;  5AYW D;  3QOU A;  4DE9 A;  2IQC A;  3NF1 A;  3RO2 A;  5CBN A;  5C1D A;  4U07 A;  3F6Q A;  3EU9 A;  2XPY A;  2XS1 A;  4N2Q A;  1MJ0 A;  1OXJ A;  3FTS A;  2R5S A;  2E2E A;  4Q69 A;  1TNB A;  2LYL A;  3JXI A;  4HXI A;  1NER A;  2C2L A;  4BES A;  3QQ6 A;  3UM2 A;  2J7W A;  3GZS A;  2ICT A;  2F8X K;  4PU7 A;  1HF0 A;  2PXE A;  1HS6 A;  4NDW A;  4C48 B;  3PUJ A;  4EKG A;  2P9I G;  3DSX A;  3FH7 A;  3VTX A;  1JFS A;  4OBM A;  1TNZ A;  2AUW A;  1NFI E;  1NW3 A;  2V4H C;  2CHX A;  4YBA A;  4JEU A;  3SFX A;  4KYO B;  4X4D A;  2IVQ A;  2NXP A;  3HRA A;  3FUL A;  5KJL A;  3CVW A;  4X4B A;  4I2W A;  4AY5 A;  3ASO E;  4YG1 A;  1E7V A;  1P5Q A;  1HXI A;  2ETA A;  4ATZ D;  4LUN U;  4XX5 A;  4OYS A;  3MV3 B;  2CFZ A;  2FEZ A;  1SVX A;  2OCC E;  3EHN A;  3FEX A;  2KPJ A;  5D2M C;  4U95 D;  3NOG D;  2E0I A;  4BWR A;  3WG7 E;  1IQU A;  3SQV A;  4GTM A;  2NYJ A;  1SQ8 A;  5JUW A;  3V31 A;  2LLV A;  3V2O A;  4LCT A;  3Q7F A;  2OFY A;  4O1P A;  5ENS D;  2MYO A;  2VGY A;  3ZHE B;  3U4T A;  4K0R A;  4UI9 J;  4TRQ A;  4N3B A;  3AU4 A;  3HZI B;  4ANV A;  3D9I A;  5JJT A;  1H2T C;  2MQK A;  4JZY A;  1OSL A;  4E6H A;  2KM4 A;  1V55 E;  3Q5M A;  2ZIS A;  1LQC A;  3DWL G;  2XEN A;  5EIB E;  3FUH A;  4NQ0 A;  3L82 A;  3ZHI A;  3MV2 B;  5AAO A;  3S8Q A;  1IYG A;  2PNN A;  1BPO A;  4I2Z A;  4WNG A;  4GTT A;  3RRN B;  3S7F A;  3KZ3 A;  3I5P A;  1RW2 A;  5CRV A;  5DIZ A;  2KEJ A;  1JCS A;  2J8S D;  2EBY A;  3QJZ A;  3NAW A;  3V2X A;  2YQ8 A;  2H6G A;  5AQA A;  2P9N G;  4MRU A;  3UM0 A;  3LKU A;  2FUL A;  3D9N A;  3TL5 A;  1BDH A;  3CK8 A;  2QFC A;  3QKY A;  4YAR A;  1R69 A;  2PXD A;  4C0E A;  3FUN A;  5CCL A;  2P9L G;  3PH0 C;  1CJG A;  3ZYK A;  1QPZ A;  4EKI A;  5FQ6 A;  4A3V A;  4FP7 A;  3C72 A;  2XPI A;  3D9H A;  4BY6 A;  2FF4 A;  4WVL A;  3OQO A;  2OV8 A;  3SFZ A;  3CVL A;  4I6T A;  3CSF A;  4GTQ A;  4PS8 A;  1E8Y A;  2BKG A;  3H5T A;  3Q47 B;  4YDE A;  4DJA A;  1N0R A;  3QNK A;  4DRX E;  3LFP A;  3SGH A;  3G2W A;  3D1N I;  1S63 A;  3FUE A;  2ZXW E;  4JA9 A;  2RD0 A;  4APF A;  4ILH B;  3KS2 A;  4EZL A;  3LY8 A;  2R63 A;  2V4L A;  4UI9 K;  2ETC A;  3ZVV A;  3KAE A;  3UT8 A;  3T5V A;  2DCP A;  2BED A;  3PS6 A;  4JC8 A;  3AG2 E;  4G8L A;  1ZZ8 A;  3UX4 A;  3ZNG A;  1ELW A;  4AVX A;  2BNN A;  2VQ2 A;  5EN5 D;  4TXP A;  4HI8 A;  2GRQ B;  3V79 K;  3VLE A;  2XRY A;  1A5E A;  2FFH A;  1QP7 A;  3ASH A;  2PXV A;  5FTP A;  2IO3 C;  3TWT A;  3SD5 A;  2WVI A;  2J08 A;  3CEQ A;  4G2V A;  2WQH A;  5G05 J;  3DSS A;  3ZYQ A;  2QYJ A;  3RU0 A;  5HRY A;  1DUL A;  3EDT B;  5D0O D;  3CVY A;  1IQR A;  3KSQ A;  1TJF A;  3IVP A;  4Z58 A;  4ZHB A;  3FU0 A;  4BT8 A;  3R1F A;  2MEZ A;  3SF4 A;  2H6I A;  1QB2 A;  2B0O E;  1TR4 A;  1MX4 A;  4FJZ A;  4EZK A;  3W9F A;  4FHK A;  1DWK A;  4ANX A;  4UWF A;  1LCC A;  1RZR A;  3MGB A;  1JCR A;  4DX7 D;  3LY7 A;  4LER A;  3U3W A;  4Y6C A;  2BKK B;  4KBQ A;  3BEE A;  4GCO A;  5AAR A;  3IV0 A;  2LYJ A;  2WXL A;  5AJL A;  2M4H A;  2IEJ A;  2OVF A;  1JH9 A;  4XKB A;  3ABM E;  1WM5 A;  3FMY A;  3ONK A;  1ZBP A;  4X4F A;  1YA0 A;  2LSU A;  2J7U A;  5FZS A;  4FAD A;  1ZZ9 A;  4JCX A;  3RIB A;  3SCH A;  5BXU A;  3C3R A;  1PER L;  3HG0 D;  4HOQ A;  4BFR A;  5J90 A;  3I3N A;  3DNV B;  1SA5 A;  4I8T A;  4NIK A;  4RLY A;  1TNY A;  5LCW C;  1MQS A;  3O4Z A;  3ZYM A;  3BDN A;  2PZI A;  4J8F A;  3GN5 A;  4ER3 A;  1PNR A;  4H7X A;  1E96 B;  4Q94 A;  1GT0 C;  4URK A;  3QB2 A;  3FUK A;  1KLX A;  1Y8M A;  1QZ2 A;  1NEQ A;  4J0U A;  3AS5 A;  1DC2 A;  3FTU A;  2EIL E;  4U0U A;  3S2A A;  1UN8 A;  3SHF A;  5EDS A;  3LIS A;  1WAO 1;  4B89 A;  4UQX A;  4I6J A;  3L9T A;  3ZFW A;  2J49 A;  1BU9 A;  4I6E A;  4YVQ C;  5HI7 A;  4GZD A;  2WXM A;  4GPK A;  2XSD C;  4J1X A;  2PXT A;  3ZW3 A;  3SCG A;  4Q2J A;  3DPY A;  5BXO A;  4BTB A;  4XE0 A;  3UT4 A;  2R03 A;  5A6C A;  3CRO L;  2VSX E;  3UKU G;  4ME2 A;  2ZGD A;  1N4Q A;  5AIJ A;  4J8S A;  4KZ0 A;  4X8Q A;  4W9R A;  4BEP A;  2UWJ G;  3QAQ A;  4CT4 A;  2IVG A;  2EIJ E;  1IKN D;  3TWU A;  4CYM D;  5G2N A;  4F6R D;  4I6R A;  2LYR A;  3SI5 A;  4GB9 A;  1H6O A;  2V0P A;  2HFZ A;  5EIL A;  3CHP A;  4HBD A;  1Y7Y A;  1H2U A;  3Q79 A;  1KT1 A;  3QWP A;  4OB4 A;  4XEI G;  3TXM A;  5C2Y A;  2PL2 A;  1QQE A;  3CHQ A;  2JLB A;  2LUH A;  4FBI A;  3CVQ A;  1HFA A;  1WIZ A;  5K98 B;  2PE5 A;  3IKO B;  1WG0 A;  2OVB A;  2LYQ A;  3QF3 A;  4EZI A;  4F1P A;  2XEE A;  4EHM A;  4DI4 A;  2HR2 A;  2X6F A;  3L13 A;  1AWC B;  3GZ1 A;  3I4R B;  5FT9 A;  3JXB C;  4G25 A;  3FU6 A;  3TWQ A;  2VSY A;  2PUB A;  2CG3 A;  2WXI A;  4F8D A;  2GZU A;  1O5M A;  2LXM A;  2OEV A;  1N52 A;  1YYH A;  3GN5 B;  2R05 A;  4LSZ E;  5BV1 A;  2ZIR A;  3NZL A;  5JJ6 A;  5DBK A;  1GW6 A;  3D3M A;  4FA6 A;  1NA0 A;  4FLH A;  4I6G A;  2CSF A;  1ZAY A;  4K5C A;  3EHM A;  1WH8 A;  1FT2 A;  2WMO A;  3P1U A;  2VGE A;  2XHE A;  4GZ3 A;  2Y4T A;  3FTW A;  1UG3 A;  4JHJ A;  3R9A B;  3AG1 E;  4PS7 A;  2GRL A;  4KVM A;  3FDH A;  3RRU A;  2PUC A;  5E76 A;  3I4G A;  4MBG A;  3QYX A;  2V5Q C;  3UWP A;  1BI8 B;  2DZO A;  4PDX A;  3R7Q A;  1SW6 A;  3CHS A;  1PY1 A;  1UW4 B;  4K03 A;  2EIN E;  4N3A A;  4KZC A;  3CHO A;  2L8N A;  1L1M A;  2HYZ A;  3HXE A;  2DBA A;  3DEO A;  4A1G A;  2ZU6 B;  2OEW A;  5FZQ A;  4DI3 A;  5ITZ F;  4BET A;  1NI1 A;  3Q15 A;  2LSV A;  4FN3 A;  3DST A;  3UUX A;  4GMR A;  4ANW A;  3UIN C;  4ER5 A;  3OAW A;  1JUQ A;  4JL0 A;  3RO3 A;  1UXD A;  1HH8 A;  5D0Q D;  1X5B A;  3JXD L;  4GCN A;  3UIO C;  3L08 A;  3E37 A;  3HHM A;  4GA1 A;  1NA3 A;  2L0I A;  1OCC E;  4RG6 A;  4NRH B;  5A7D B;  2WXO A;  4OAU C;  3T5X A;  5CRU A;  3TEL A;  3L54 A;  5BPP A;  3G2V A;  5EID A;  1ZZ6 A;  2Y1L E;  3QDN A;  3V30 A;  2IO2 C;  5LOZ A;  4N3C A;  3Q9N C;  3ZPJ A;  3B7S A;  4HOT A;  4K5A B;  1OWL A;  1MFQ C;  1ELK A;  3DXK G;  3UIP C;  4HRA A;  5CMY A;  2I1K A;  5ENT D; 
#chains in the Genus database with same CATH homology
 3QKY A;  4YAR A;  4YG4 A;  1SZ9 A;  4ACL A;  4QFV A;  1R69 A;  2PIJ A;  4C0E A;  3FUN A;  5CCL A;  3PH0 C;  3EIJ A;  2KZ8 A;  1CJG A;  1PC2 A;  4MLP A;  3ZYK A;  4F53 A;  5ENN A;  2VTB A;  2CRO A;  3LY9 A;  2XQ0 A;  1QPZ A;  5FQ6 A;  4A3V A;  4FP7 A;  5BNW A;  2XPI A;  2IF4 A;  3UT7 A;  2C0L A;  1DVP A;  2WXP A;  3CR3 A;  4BY6 A;  5JHA A;  2FF4 A;  5JHB A;  2YHC A;  1JWF A;  1XNF A;  4GZC A;  3PZD A;  4U0S A;  3OQO A;  2OV8 A;  3SFZ A;  4A3T A;  1EDU A;  3RRM B;  3BD1 A;  2KZT B;  3CVL A;  4X4G A;  4I6T A;  1ZU2 A;  1EPU A;  3CSF A;  3ZN3 A;  3S7B A;  4PS8 A;  1E8Y A;  3G7D A;  3VTY A;  3H5T A;  4GQM A;  4C9B B;  4GA2 A;  3Q47 B;  2PM7 A;  4EBA A;  1DW9 A;  1LCD A;  3FTX A;  1ZVV A;  5BW8 C;  3TXN A;  3HVE B;  4I43 A;  1OWN A;  3CKB A;  4DJA A;  3QNK A;  3S7J A;  2IOL A;  3LFP A;  3SGH A;  5T4Y A;  1NP7 A;  3G2W A;  3KXA A;  3SNX A;  3D1N I;  1OWO A;  3FTY A;  2OR1 L;  1EFA A;  5T8I A;  3FUE A;  4JA9 A;  4F1S A;  4N2S A;  2PUF A;  3JCK C;  5J08 A;  2RD0 A;  3LDZ A;  3LYA A;  3HIZ A;  3ESL A;  2I1J A;  1UN9 A;  2HIN A;  4XZ4 A;  3R7R A;  4APF A;  3ZIM A;  4CRW A;  4ILH B;  3KEZ A;  2L49 A;  4G23 A;  4WWO A;  3KS2 A;  4EZL A;  1Z6T A;  2OOE A;  4U0Z A;  3FEY A;  1JWG A;  3IHV A;  4IUL A;  5LP0 A;  3LY8 A;  3PUK A;  4BT9 A;  3MKQ B;  2BNO A;  4CDM A;  5LX8 A;  3HYM B;  4GML A;  2R63 A;  2V4L A;  4UI9 K;  4J1W A;  2KEK A;  2LAH A;  4KXK B;  3KAE A;  5ARG A;  3UMV A;  3UT8 A;  3ZVV A;  3T5V A;  4PU4 C;  4Z59 A;  2DCP A;  3APC A;  4HVB A;  4L1B A;  5KJK A;  4N5C A;  3PEV B;  3PS6 A;  4JC8 A;  3MA5 A;  2FJR A;  1UJK A;  2LYP A;  3NQP A;  3E4B A;  3PRE A;  3G2T A;  1ZZ8 A;  4F3V A;  3UX4 A;  3ZKC A;  1ELW A;  4R7L A;  2BNN A;  2PUE A;  1IHG A;  2VQ2 A;  4UWG A;  4GMJ A;  4AVX A;  1WH6 A;  4F7A A;  4JXT A;  3TJP A;  4G1T A;  4ILI A;  5E75 A;  4M3O A;  4WWN A;  4LEU A;  4TUU A;  1X57 A;  3FH5 A;  1JWL A;  2YIN A;  3EIQ C;  2V5F A;  3VLE A;  2XRY A;  3NZS A;  4HOU A;  4V3I A;  1XWR A;  3NZU A;  4ACK A;  1QP7 A;  1QQA A;  3LEW A;  3ASH A;  3GZ2 A;  2MOW A;  5FTP A;  2C0M A;  4CDR A;  2L9B A;  1W3B A;  3UPV A;  4KMO A;  2WXK A;  3SD5 A;  2IJG X;  2H8R A;  2WVI A;  4Q96 A;  1ELR A;  1IC8 A;  2XCC A;  1LMB 3;  2J08 A;  3U64 A;  3CEQ A;  4Z5D A;  1Z3X A;  3TG4 A;  4HLE A;  5KJN A;  2XJ3 A;  4G2V A;  2PQR A;  2WQH A;  2WXH A;  5G05 J;  2XGO A;  2IU7 A;  2IVB A;  3ZYQ A;  5LFA A;  3RU0 A;  5G05 C;  3IBE A;  3CST A;  4PH4 B;  3ZHE A;  1E3O C;  1QQB A;  2J4D A;  3EDT B;  5D0O D;  2KEI A;  2R17 C;  4G24 A;  2M63 A;  3CVY A;  1IQR A;  2PUD A;  1TJF A;  3IVP A;  2L0T B;  4JVS A;  3SCF A;  1UTX A;  4Z58 A;  3CQC B;  3Q49 B;  3FU0 A;  4BT8 A;  3R1F A;  1E8X A;  4BX8 A;  3O9X A;  2MEZ A;  1LLI A;  2VJ8 A;  3VLD A;  3G2S A;  3MZL B;  3SF4 A;  4DLQ A;  3OMT A;  3PE4 A;  3ZEF A;  4IN3 B;  1RIO A;  1SQM A;  4L23 A;  1VDY A;  4AV7 A;  2WUS R;  2X3M A;  2I2O A;  4WNE A;  2CHZ A;  2J07 A;  1S7E A;  4FJZ A;  4EZK A;  5FWQ A;  4FHK A;  2EQX A;  4AJW A;  1DWK A;  3ONL A;  4ANX A;  1H6K A;  4D10 C;  5A23 A;  4UWF A;  1RZS A;  1LCC A;  1RZR A;  1Z3Y A;  3OXF A;  2WQ6 A;  4GAA A;  4JQD A;  2O49 A;  3MGB A;  1EYH A;  3FYA A;  2L6J A;  2Y4U A;  4PS3 A;  1Y6I A;  3B7T A;  3VLF A;  1Y9Q A;  3ZYL A;  3LY7 A;  3VK0 A;  4LER A;  2P58 C;  2X6H A;  1ZPQ A;  3U3W A;  4Y6C A;  1E7U A;  1OUV A;  3MKR A;  4KBQ A;  4MCX A;  4OVU A;  3BEE A;  4GCO A;  2VTB B;  1TEZ A;  4JEH A;  3RJV A;  4FU3 A;  1R63 A;  3QK0 A;  3K9I A;  3IV0 A;  2LYJ A;  3ZXS A;  2AWI A;  2WXL A;  2WXF A;  2UY1 B;  5AJL A;  3LVQ E;  2KC7 A;  2JCG A;  4E85 A;  1ADR A;  4I9E A;  3D9L A;  4ANU A;  3TG5 A;  3CVU A;  3U9W A;  2BTD A;  2OVF A;  3B7R L;  2FO7 A;  3D9J A;  1JH9 A;  4GYY A;  2KCL A;  4JHK A;  2ION A;  1POU A;  4XKB A;  5ARF A;  3RKV A;  3T8M A;  3MYV A;  3MLF A;  1H0A A;  4MCT A;  1WM5 A;  3FMY A;  2WM9 A;  1HF8 A;  3ASF A;  3ONK A;  1ZBP A;  4FJY A;  3GBF A;  2A6C A;  4X4F A;  3AU5 A;  1YA0 A;  3KD7 A;  4O8B A;  3MCX A;  5EX0 A;  2LSU A;  2MHK A;  2X38 A;  5FZS A;  1ZZ9 A;  2X6J A;  2WIU B;  4BSX A;  3RZZ A;  3GW4 A;  4L2Y A;  4NUR A;  4JCX A;  4I1A A;  2EF8 A;  3D9O A;  5G04 J;  2HSG A;  3QWV A;  4H7Y A;  3RIB A;  4CGW A;  5HQ8 A;  5G04 C;  3SCH A;  2CFU A;  1PER L;  1B89 A;  4HOQ A;  4BFR A;  5J90 A;  3LJ3 A;  4GU5 A;  1H19 A;  3I3N A;  3UFD A;  3L1P A;  3DNV B;  2X6I A;  2HM8 A;  4OVV A;  3FUJ A;  4B0Z A;  3FTZ A;  3OXL A;  4FUL A;  2QY7 A;  4B8A A;  4I8T A;  5LCW J;  4P29 A;  3LXU X;  3JUI A;  3PNT B;  4N39 A;  5LCW C;  5CMW A;  1MQS A;  3O4Z A;  4I17 A;  4JW1 A;  3BDN A;  3ZYM A;  2PZI A;  3FUM A;  4UWK A;  4G26 A;  4J8F A;  5FQ7 A;  3ZGQ A;  5KJM A;  3GN5 A;  4AM9 A;  4FLB A;  3G2U A;  1PNR A;  4H7X A;  1E96 B;  3PRZ A;  5FQ4 A;  3JYS A;  2VSO E;  3QWW A;  3BG1 B;  2IOS A;  1GT0 C;  4Q94 A;  3BS3 A;  2I9C A;  3CKC A;  5A7L A;  1H2V C;  3Q4A B;  3QB2 A;  4URK A;  3B7H A;  3F52 A;  2KZT A;  3FUK A;  4U8H A;  2Q7F A;  1KLX A;  4CCA A;  3OQM A;  1Y8M A;  1QZ2 A;  2PM6 A;  1NEQ A;  4UWL A;  3G5G A;  1A17 A;  1E90 A;  4J0U A;  2NC9 A;  3AS5 A;  4B94 A;  3P2B A;  4EEC A;  4MS6 A;  1PRV A;  2FI7 A;  3FTU A;  4YVO A;  4TV3 A;  2XPZ A;  3CHM A;  4U0U A;  2B5A A;  1ZZB A;  1UN8 A;  2BUG A;  3LIS A;  3RK6 A;  3BG0 B;  4RSY A;  1WAO 1;  3S2A A;  3SHF A;  4B89 A;  4DK5 A;  4WND A;  5G55 A;  3CK9 A;  3IHY A;  4IA8 A;  4UQX A;  4I6J A;  4AXH A;  2AXU A;  3HVE A;  5EKQ D;  3ZFW A;  1HO8 A;  3CIA A;  5D0Q D;  1HE8 A;  1NZN A;  2J49 A;  4BTA A;  4X4E A;  4YND A;  4I6E A;  3QWG A;  5FZR A;  2ICP A;  2KCV A;  3D9K A;  4YVQ C;  4GZD A;  2WXM A;  5HI7 A;  4GPK A;  2XSD C;  4J1X A;  4RVB A;  3ZW3 A;  4APO A;  2LCV A;  3SCG A;  1HU3 A;  3OTN A;  3CLJ A;  1U3C A;  4AP2 A;  4AIF A;  4WAF A;  4ATG A;  4Z5C A;  4XI9 A;  4BTB A;  2XIU A;  4XE0 A;  3UT4 A;  4X4H A;  4CDN A;  5EDS A;  1WY6 A;  1ZZ7 A;  5A6C A;  3CGH A;  3CRO L;  2VSX E;  1EF1 C;  3FH8 A;  4ME2 A;  2WXG A;  2J9Q A;  3MKQ A;  1AU7 A;  5AIJ A;  4J8S A;  1TJC A;  4KZ0 A;  4EQF A;  3U66 A;  4GHJ A;  2WXQ A;  3MX3 A;  1FVF A;  3PDN A;  4W9R A;  4UQZ A;  2UWJ G;  2MRI A;  3QAQ A;  4CT4 A;  2IVG A;  3FP3 A;  4WWP A;  5T3R A;  1KT0 A;  1WET A;  1LF8 A;  2ILR A;  4DPR A;  2XEV A;  4J8E A;  5EX3 A;  2R59 A;  1FVH A;  4I6R A;  2BJC A;  1HG5 A;  3PNL B;  4GZ5 A;  2LYR A;  4MKT A;  5FJY A;  3ASG A;  3MJW A;  1ZZC A;  4GB9 A;  3SI5 A;  3LPZ A;  3JXC L;  2PPX A;  2YNQ A;  4A55 A;  3FYM A;  4UI9 C;  1INZ A;  4XIF A;  4Z5H A;  3CLC A;  4HS2 A;  2V0P A;  3LCA A;  3CHP A;  3L22 A;  2FBN A;  4FAD A;  5BT1 A;  1Y7Y A;  2PQN A;  4WNF A;  2WXR A;  4IWR A;  2PUA A;  4JA7 A;  2GRM A;  4HOS A;  1H2U A;  2O38 A;  1O4X A;  3ASD A;  4Y42 A;  3C98 A;  3AS8 A;  4I1M A;  1KT1 A;  3SBS A;  5JJ7 A;  3CEC A;  3QWP A;  5KCM A;  2I6H A;  4L2L A;  3HDX A;  4OB4 A;  2LYK A;  1E8W A;  3JQ1 A;  4EPZ A;  4O6F A;  3TXM A;  4JCY A;  1U3D A;  1N54 A;  3GYZ A;  3PEU B;  5AYW D;  1UXC A;  4WUY A;  3FHE A;  3QOU A;  1E8Z A;  5C2Y A;  2IQC A;  1JPL A;  2PL2 A;  3NF1 A;  1QQE A;  2WMN A;  3SBT B;  3CHQ A;  2XRZ A;  2JLB A;  3RO2 A;  5C1D A;  2AW6 A;  4FBI A;  2VGX A;  2XGM A;  4AY6 A;  3CVQ A;  4JPS A;  4U07 A;  4PU8 A;  1HFA A;  2XPY A;  1WIZ A;  5K98 B;  2PE5 A;  2HO1 A;  3IKO B;  3L6A A;  1OCT C;  4EBA G;  4N2Q A;  2OVB A;  2WPV A;  2LYQ A;  4XKC A;  2Y3A A;  1MHQ A;  3FTS A;  3QC1 A;  3FUD A;  1ZUG A;  2E2E A;  2LO6 A;  2R5S A;  3QF3 A;  2RG8 A;  3ESK A;  3OQN A;  3OXG A;  4Q69 A;  3D9M A;  4KT6 B;  1QP4 A;  2LYL A;  1PAQ A;  4GA0 A;  1QP0 A;  1NER A;  2C2L A;  2XCB A;  3B7U X;  3LVR E;  4HXI A;  3PXP A;  3CQG B;  4J8D A;  4U04 A;  3QQ6 A;  2J4B A;  3CVN A;  4DI4 A;  2HR2 A;  2X6F A;  3L13 A;  3GZ1 A;  2KAT A;  3GZS A;  2ICT A;  2IUO A;  1OWM A;  5AJD A;  2GGF A;  4PU7 A;  1HF0 A;  2PUG A;  3I4R B;  4X4C A;  5FT9 A;  1HS6 A;  3EUS A;  4NDW A;  4RG9 A;  3JXB C;  3PUJ A;  4G25 A;  3FH7 A;  3VTX A;  3FU6 A;  1JFS A;  2VSY A;  3L16 A;  3PE3 A;  2PUB A;  2CG3 A;  2AUW A;  2WXI A;  4F8D A;  2GZU A;  4BX9 A;  3D9P A;  4CGV A;  1VPW A;  2EWT A;  3KJX A;  1N52 A;  4UWH A;  2CHX A;  3GN5 B;  2UY1 A;  1RZR D;  1S0P A;  2GW1 A;  3DPD A;  4YBA A;  4G11 A;  5BV1 A;  4JEU A;  2IU1 A;  2A4Z A;  4KYO B;  5JJ6 A;  4X4D A;  2IVQ A;  4C0M A;  2DIW A;  2NXP A;  4J6I A;  3FUL A;  5DBK A;  5KJL A;  3ENE A;  3ZRH A;  1GW6 A;  3CVW A;  4X4B A;  4I2W A;  4YG7 B;  2WXN A;  3D3M A;  4DLO A;  4AY5 A;  4A1S A;  4FA6 A;  1YSE A;  4YG1 A;  1X2L A;  1E7V A;  1NA0 A;  1PRA A;  4IVZ A;  2CSF A;  1P5Q A;  1L5J A;  4FLH A;  4I6G A;  1HXI A;  1ZAY A;  5BUZ A;  4KVO A;  2WQ7 A;  3FUI A;  2IV1 A;  1FCH A;  3IEG A;  1PRU A;  1WH8 A;  3EHM A;  3UQ3 A;  4ILG A;  2LNI A;  3LS8 A;  2WB2 A;  4FC8 A;  2WMO A;  4LUN U;  5ANL A;  4HOR A;  3P1U A;  4XX5 A;  4OYS A;  2VSN A;  2XHE A;  3MV3 B;  2Y4T A;  4GZ3 A;  4IRU A;  3FTW A;  2CFZ A;  2FEZ A;  1UG3 A;  3EHN A;  3FEX A;  4JHJ A;  1BDI A;  2KPJ A;  5ANR A;  2YHE A;  3R9A B;  2V8S E;  4PS7 A;  2GRL A;  4KVM A;  4UQY A;  2WXJ A;  4LRZ A;  3FDH A;  1DNP A;  3RRU A;  2E0I A;  2PUC A;  3FY4 A;  2AVP A;  5E76 A;  3ULQ A;  4AOF A;  3I4G A;  4B8C B;  3QYX A;  4X4I A;  2IFU A;  4BWR A;  1RPE L;  1JFT A;  1IQU A;  4GYO A;  4CT0 A;  4PDX A;  3OP9 A;  3R7Q A;  3CV0 A;  5FQ8 A;  3CHS A;  4JHR A;  2XI8 A;  1PY1 A;  1UW4 B;  1SQ8 A;  4K03 A;  4N3A A;  3FWV A;  5M72 A;  4KZC A;  4GZ6 A;  2CHW A;  1OWP A;  3CHO A;  3TGO A;  4IYP A;  4GYW A;  2L8N A;  4LCT A;  1L1M A;  2HYZ A;  3TAX A;  2OFY A;  3WXX A;  2DBA A;  3APF A;  2AXV A;  5CCM A;  2VGY A;  2VYI A;  4XI0 A;  2D5V A;  2ZU6 B;  3ZHE B;  2J09 A;  5FZQ A;  4A1G A;  4DI3 A;  3U4T A;  2LYS A;  1CQT A;  2OND A;  4K0R A;  1HG2 A;  4UI9 J;  2LAI A;  4TRQ A;  3S7D A;  4N3B A;  3AU4 A;  4PU3 C;  2LSV A;  3Q15 A;  3ML8 A;  3CVV A;  2BF0 X;  3HZI B;  4FN3 A;  3D9I A;  3UUX A;  4ANV A;  4EZJ A;  5JJT A;  1H2T C;  2MQK A;  4JZY A;  3FTV A;  1OSL A;  4I6U A;  4E6H A;  3FU5 A;  1HZ4 A;  2KM4 A;  3FFL A;  3FU3 A;  3EJN A;  3MEK A;  4ANW A;  4L7T A;  3JQ0 A;  3Q5M A;  1LQC A;  3CHR A;  3OAW A;  1JUQ A;  4JL0 A;  4Y6W A;  1UJJ A;  3FUH A;  3ZHM A;  4NQ0 A;  4PUC A;  1UXD A;  1HH8 A;  2CG2 A;  2NSZ A;  2XCJ A;  3ZHI A;  1X5B A;  3JXD L;  2VGX B;  3FUF A;  3MV2 B;  4GCN A;  3S8Q A;  3L08 A;  5CHE E;  2A5U A;  2X6K A;  3HHM A;  4ABN A;  1IYG A;  4GA1 A;  1BPO A;  4I2Z A;  1NA3 A;  1SZA A;  2L0I A;  4WNG A;  2KCK A;  4RG6 A;  3PVL A;  4NRH B;  1XGW A;  5A7D B;  3RRN B;  3SZ7 A;  2WXO A;  3S7F A;  3KZ3 A;  2R1J L;  3QAR A;  3T5X A;  3I5P A;  5DIZ A;  3ML9 A;  4NAC A;  2KEJ A;  1QNF A;  4AEZ C;  2EBY A;  2XGS A;  3QJZ A;  5G2N A;  5BV0 A;  4I1O B;  3RO3 A;  4U63 A;  3CVX A;  2YQ8 A;  3L54 A;  4MRU A;  2O4A A;  2JVL A;  3N71 A;  5AEN A;  3O48 A;  5BPP A;  3APD A;  3TRB A;  3G2V A;  3LKU A;  3F6W A;  2FUL A;  1ZZ6 A;  1HX8 A;  3D9N A;  3DBS A;  3TL5 A;  3QDN A;  3AS4 A;  4FHJ A;  2BNM A;  5LOZ A;  4N3C A;  3B13 A;  3ZPJ A;  2JEK A;  3B7S A;  4HOT A;  3CVP A;  4CEM A;  1BDH A;  2AXZ A;  3URZ A;  3F51 A;  4HFG A;  1ZS4 A;  4I9C A;  1OWL A;  1ELK A;  3CK8 A;  3L17 A;  5CMY A;  2I1K A;  1B0N A;  3CK7 A;  2QFC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...