2AWIA

Structure of prgx y153c mutant
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
300
structure length
298
Chain Sequence
FKIGSVLKQIRQELNYHQIDLYSGIMSKSVYIKVEADSRPISVEELSKFSERLGVNFFEILNRAGMNSVNETGKEKLLISKIFTNPDLFDKNFQRIEPKRLTSLQYFSIYLGYISIAHHYNIEVPTFNKTITSDLKHLYDKRTTFFGIDCEIVSNLLNVLPYEEVSSIIKPMYPIVDSFGKDYDLTIQTVLKNALTISIMNRNLKEAQYYINQFEHLKTIKNISINGYYDLEINYLKQIYQFLTDKNIDSYLNAVNIINIFKIIGKEDIHRSLVEELTKISAKEKFTPPKEVTMYYEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of peptide sex pheromone receptor PrgX and PrgX/pheromone complexes and regulation of conjugation in Enterococcus faecalis.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Transcription
molecule keywords PrgX
total genus 111
structure length 298
sequence length 300
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2005-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2awiA01
1.25.40.400 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2awiA02
3F51A 2FJRA 4X4FA 2AXZA 1AU7A 3ZHMA 1WH8A 2LYRA 1OCTC 4YBAA 2IVBA 1ZZ7A 2PUFA 3ZKCA 2B5AA 5A7LA 2XSDC 1ZPQA 2R1JL 1RZSA 1R69A 1BDIA 2HSGA 2PE5A 1VPWA 3FYAA 1HF0A 3B7HA 4IWRA 2LYLA 1WETA 2IVQA 2JVLA 4Z5DA 1PRUA 4J1XA 3IVPA 2LYJA 4F8DA 2EF8A 2H8RA 1WH6A 2IU7A 4PU7A 1X57A 4PU3C 1EFAA 2O4AA 1WIZA 4X4EA 1LCDA 1O4XA 4I8TA 1ZZ8A 3RZZA 3D1NI 3FYMA 4GHJA 4Z5HA 2KEKA 1XWRA 1GT0C 1Y7YA 4I6RA 2CSFA 3VK0A 1Y9QA 4YG1A 2PUEA 1UXDA 1ZZCA 3OQNA 3ZHIA 1SQ8A 2AW6A 2BNNA 2IUOA 4IA8A 3LISA 2MEZA 1RIOA 2LYSA 2PPXA 3S8QA 3H5TA 2AWIA 4X4BA 3G7DA 4GQMA 3SCGA 1PERL 2PUGA 1PNRA 1CJGA 2PUDA 2OFYA 4X4CA 1JH9A 1ADRA 3JXDL 1QP0A 3L1PA 1QQAA 3GN5B 2AXUA 4JCYA 1ZUGA 2L8NA 3SCFA 4FBIA 4X4GA 1E3OC 1ZAYA 3UFDA 1JWLA 4Z58A 2KPJA 2GRMA 2KEJA 2PUBA 1PRVA 2WUSR 1R63A 3BDNA 1RPEL 3OP9A 1PRAA 1ZZBA 2AXVA 3KJXA 1LCCA 3CLCA 2AUWA 3OQMA 1JFTA 1ZVVA 1LLIA 4YG4A 4X4IA 4J1WA 2XIUA 2LYPA 4IVZA 1ZZ6A 3BD1A 3GBFA 3PXPA 3QYXA 2XJ3A 1CQTA 4O8BA 2WIUB 2O49A 3R1FA 1QP7A 2LYKA 2LCVA 3MLFA 1DW9A 3G5GA 2BNMA 4NDWA 3KZ3A 1UTXA 4YG7B 1OSLA 2IV1A 5K98B 1NERA 3OMTA 2CROA 1ZS4A 2O38A 2OR1L 3FMYA 3DNVB 2LYQA 3JXCL 2EWTA 4Z5CA 3HZIB 1YSEA 1NEQA 3F6WA 2A6CA 4X4HA 1QQBA 3JXBC 4Y42A 2ICTA 1JFSA 1RZRA 4I6TA 2KZ8A 2L49A 1LQCA 3QF3A 3SCHA 3OQOA 2PUAA 1DWKA 1IC8A 4FN3A 2BNOA 2GZUA 2IVGA 1QPZA 4YARA 2XI8A 3CROL 1S7EA 1L1MA 2MQKA 4PU4C 1BDHA 4JQDA 2EBYA 4I6UA 2D5VA 1QP4A 2GRLA 2ICPA 3F52A 2BJCA 4OB4A 4MCTA 4PU8A 3BS3A 3O9XA 3GN5A 3QQ6A 2PUCA 3CECA 1B0NA 2JCGA 3TRBA 4JCXA 3LFPA 1LMB3 1RZRD 2PIJA 2XCJA 1POUA 2KEIA 3QWGA 3U3WA 1ZZ9A 2R63A 4MCXA 4Z59A 2HINA 1UXCA 3EUSA 4X4DA 1X2LA 3KXAA
chains in the Genus database with same CATH superfamily
3NAWA 2FO1E 3ZPJA 3OXFA 2J08A 4FJYA 4J8FA 2A4ZA 2XSDC 3MYVA 1NW3A 1TEZA 1W3BA 3JCKC 4J6IA 3FYAA 2C2LA 3FUDA 3S7FA 2EF8A 4KBQA 1EFAA 1HS6A 1O4XA 3PNTB 5CBOA 3L9TA 1Y7YA 3SFZA 2BF0X 2DWZA 1IHBA 3VK0A 1OWPA 3D9OA 3ZVVA 4XIFA 3FH8A 3C3QA 3UM1A 3QOUA 4UWHA 4K5CA 3AS4A 2AVPA 3LISA 5DRYA 4UWKA 4BERA 5G04C 4G2VA 1PNRA 2J7WA 3V30A 3JUEA 4XKBA 3BQOA 3RO3A 1ZUGA 4UQXA 2KEJA 3LPZA 5HS0A 5EKQD 3CV0A 5D0QD 1JFTA 2PQRA 2OVFA 5G2NA 2JEKA 4NIKA 2XJ3A 1TN7A 4O8BA 3APDA 3BEEA 4M3OA 2WXRA 3AG4E 3U64A 3D9MA 3ZYLA 1H2TC 1OUVA 3PUKA 1AWCB 2XEVA 5ENTD 1OCCE 3MA5A 3VWSA 1QQBA 2H6IA 2X38A 2PXPA 5ARGA 3OQOA 1HZ4A 3URZA 2P9PG 4GCNA 3HYMB 1PY1A 1KZPA 1QPZA 3MZLB 1TN8A 4ATGA 1EYHA 4BX8A 2MOWA 5DTRA 2H6FA 3DSVA 1LD8A 5D2MC 1E7UA 2B6CA 3WXXA 3L82A 4JD2G 4J0UA 4YBAA 1ZZ7A 3EHMA 4DX7D 4E85A 4GTSA 2XCBA 3CLJA 2PXEA 3D9NA 2DZOA 3IVPA 3BU8A 2HO1A 2BUGA 2QZAA 3B7SA 4DRXE 4W9RA 1LCDA 3MEJA 4MRUA 5ENOD 3Q7AA 1H6OA 2X3MA 2HR2A 3ZHEA 3OQNA 4CYMD 4O1PA 3FULA 3AU4A 5EYPF 2PM7A 2PUDA 1E8XA 3AG2E 4FADA 5C2YA 4EKGA 1IXVA 2KCLA 3DBSA 3PVLA 3CK9A 4U8YD 3CHPA 2HM8A 3EU5A 2KATA 3E32A 1PRAA 3LS8A 1HXIA 1H6PA 4DJAA 5J08A 4J8SA 3LJ3A 2WVIA 1TN6A 3CIAA 4GPKA 1XNFA 3L6AA 4EBAG 2VSOE 3R09A 5FTPA 2O49A 2HCNA 4ANXA 2BNMA 3S7DA 3PE3A 3UUXA 4B94A 2MXDA 1HFAA 4Q96A 2GW1A 4Q2JA 1YSEA 5BV0A 3FU3A 3PEVB 2VGEA 3KSQA 4C0EA 3KS2A 1TNOA 4Y42A 4GZ5A 1TJCA 2KZ8A 2WXNA 3UINC 2EQXA 2V0PA 1IC8A 3ZHEB 3HDXA 3IEGA 4BSXA 2P9SG 3CHSA 2J4DA 4ATZD 3RRUA 3SFYA 2OCCE 2BJCA 4IULA 3OKZA 3CECA 5EX3A 3TFLA 2PUGA 4I43A 1ZZ9A 4LSZE 4MCXA 3DSUA 4X4DA 3KXAA 3PS6A 1OCTC 4NRHB 5BNWA 2YHEA 4O6FA 2EIJE 3LYAA 1WM5A 3ZIMA 4CT4A 2YNQA 4G8KA 3RO2A 3V2XA 5AIJA 4NURA 4J8EA 1WIZA 2XQ0A 5EDSA 3ZYMA 3RZZA 2ZIRA 3LVQE 1DULA 2GGFA 4GYOA 4DE9A 1UXDA 3UT4A 3NXHA 3Q9UC 3PEUB 3CVVA 2C0LA 2OEVA 4GMJA 4UUCA 4I2WA 3CK7A 3U9WA 5J90A 4EZIA 3NOCD 2AXUA 3W9GA 2F37A 3U66A 3ISMC 1NFIE 2AXVA 3FTVA 4G26A 2VSNA 1ZU2A 3ENEA 2WXPA 4UQYA 2J4BA 3NROA 2PXVA 1TNZA 1ZBPA 1INZA 4HNAD 2DIWA 3E4BA 3TG4A 1UTXA 2LAIA 2P9LG 4H7XA 5K98B 2O38A 1V54E 3O4ZA 4J8DA 3UIPC 5KJLA 3I5PA 3ZXPA 3ZFWA 4DLOA 2LLVA 1MJ0A 4DX6D 2ICTA 5HRYA 3S2AA 3KD7A 5CEDB 3SCHA 2LXLA 3QNKA 2XI8A 4DI4A 4JEHA 1JCQA 4L2YA 4EBAA 3CVPA 4D10C 1OY3D 3L08A 3TXMA 3SO8A 4XKCA 5DIZA 4KT6B 1MFQC 1KZOA 4B8AA 3T8MA 4XI0A 3TRBA 2IO3C 2RD0A 1RZRD 2KEIA 3V31A 1JCSA 3TJPA 4UWGA 3FP3A 5A7LA 1N9AA 1WDYA 1X5BA 2VEOA 1HQ1A 2BKKB 3ASFA 3JUIA 2JLBA 3JXJA 4GCOA 3D1NI 2FBNA 1OWOA 3MKQA 4JA7A 3SFXA 3G2TA 3E30A 2L0TB 3HXCA 3NZSA 3ZUVB 4EECA 1QQAA 3UKUG 3KEZA 2GRMA 2PUBA 1OT8A 3ZNGA 2WUSR 1ZZBA 2FO7A 3SHFA 1WAO1 3ASNE 4KVOA 3LDZA 3GW4A 1QP7A 2VTBA 5JHBA 3E37A 1H0AA 2V3CC 4O1OA 4YDWA 2PXTA 4U07A 2PQNA 3HG0D 4LNUD 3I3NA 4KXKB 3DSTA 3TWWA 5KWDA 4FU3A 2VGXB 4LUNU 3S7JA 4JQDA 4HLLA 1SQMA 4PH4B 3NZLA 5ANLA 5AENA 5DSXA 3F52A 1K1BA 4PU8A 1D8DA 2WXJA 1FVFA 2JCGA 4FLBA 2I1JA 3DSXA 1TJFA 4F3VA 3ZKCA 1HU3A 1FCHA 4PUCA 2FJRA 2AXZA 4HRMB 2GRPB 2R59A 4F53A 4LERA 3QOWA 2YHCA 1KT0A 5HQ8A 3UTMA 4ANWA 1H6KA 1E8YA 3G0TA 4GHJA 4AJWA 3AS8A 3TAXA 4J7WA 1A5EA 4AY5A 2ZGGA 3VTXA 1O5MA 1O1RA 4PS3A 4X8QA 1RIOA 3LY8A 4HRAA 1P5QA 1CJGA 4XZ4A 4I2ZA 3ZKJA 5JJTA 2L8NA 3SCFA 5IY5E 2NC9A 4N39A 5D0OD 3ASDA 2PL2A 1N52A 1OWLA 3P2BA 5FQ8A 4L23A 3SX0A 1LLIA 4AVXA 5A23A 3IV0A 3TGOA 3QYXA 3CQCB 3PE5A 3KZ3A 4BTAA 4DLQA 3QOXA 1K1AA 2OR1L 3RIBA 4H7YA 5KBAA 5A6CA 4X4HA 4O60A 1JFSA 4I6TA 1SW6A 2YINA 3R9MA 5GAHi 4CZ2D 2CHWA 3GZ1A 3FUNA 1NP7A 1Y6IA 4LNGA 4HB5A 2GRRB 4C0MA 4U95D 3QB2A 4ZFHA 4UQZA 3B7BA 3UM2A 1BI8B 4EHMA 4G11A 3TG5A 2Y69E 3LVRE 4L1BA 2PIJA 2DYSE 3SBSA 4XX5A 5ENQD 3SQVA 1N54A 3CHOA 5G05J 4URKA 2VTBB 4EPZA 1N0QA 3MX3A 2PNNA 1R69A 2CHZA 3K9IA 4ANUA 3MEKA 1ELWA 1UN8A 1NA3A 1BPOA 4PU7A 4HOQA 5JMND 1ZZ8A 3B7UX 4HFGA 4N2QA 4PDXA 3FEXA 1OWMA 3SZ7A 2J49A 3Q73A 4A3VA 3HXEA 4ILHB 2PXLA 3L13A 2IEJA 2V5QC 3CLCA 2LAHA 4B93B 4TUMA 2J7UA 4V3IA 4DUIA 4I6GA 5AYWD 1TNUA 1YCSB 2LCVA 4YG7B 2XGSA 1FT1A 2WXQA 5EX0A 4FC8A 4E6HA 2VGYA 4CT0A 5CRVA 3LQXA 1LQCA 5DTMA 3C5RA 1HG5A 4A1SA 2GZUA 3Q75A 2EBYA 4ACKA 4AM9A 4OYSA 4OB4A 5E76A 3QFIA 3DRAA 3GN5A 4WWNA 3QQ6A 1TR4A 1LMB3 5M72A 4RVBA 2KC7A 5DTQA 5LFAA 4L7TA 3FTWA 3ZN3A 3NZUA 3P1UA 2KZTB 2C0MA 1SZ9A 4Z5DA 5ITZF 4EK9A 1IHGA 3ZEFA 2KCKA 4OVVA 1OXJA 2IU7A 3CSTA 2HFZA 3MKQB 3CVYA 5CMYA 5LP0A 4ZHBA 4I6JA 4GZ3A 4KMOA 2AW6A 4HI8A 4UI9C 3RU0A 4HQDA 2LYSA 1PERL 3ASHA 4QFVA 1ADRA 2LNIA 2WXHA 2ETBA 2P2CP 2H6GA 3DSWA 3KAEA 4FA6A 2J8SD 2CFUA 1PRVA 4GU5A 1Y8MA 3TWXA 4OAUC 3U4TA 3FH7A 2FFHA 4YG4A 4X4IA 3R1FA 3ME5A 3MLFA 1WY6A 2F8YA 3FTXA 4BX9A 2KZTA 2MRIA 3DNVB 3L16A 5KNGA 4Z5CA 5BXUA 3UX4A 3D9LA 4LG6A 2R2LA 2Y4TA 3SGHA 2DZNA 1Z5SC 4WWOA 1N11A 1KT1A 1MYOA 4ER0A 3R9AB 4RG9A 4A1GA 2XCCA 4I1MA 3FTSA 4JPSA 5HKPA 2DVWA 3AS5A 4JHKA 4WNDA 1K3ZD 3CHRA 2PUCA 5BV1A 3EUVA 2P9IG 5CMWA 4JC8A 3U3WA 4Z59A 1X81A 1UJJA 4C9BB 4ME2A 1QBQA 2XRZA 3Q7FA 1S70B 1E7VA 5B1AE 3G2WA 2QC9A 3DXMG 3UKRG 1VPWA 3Q78A 4F8DA 2XEEA 2R03A 1NZNA 3CHQA 1HE8A 1DNPA 1LTXA 3G2SA 2VQ2A 3ZPXA 2OOEA 3TELA 5AN8A 4HLEA 2BNNA 3IBEA 3LCAA 4TXPA 1D9SA 2IONA 2RKKA 2OFYA 4X4CA 3JXDL 4N5QA 3QJZA 3RRNB 1N94A 2A5UA 4RG6A 1PAQA 3HXBA 4ER7A 2CG2A 4LCTA 1RPEL 5KJNA 1LCCA 2NXPA 4CEMA 4HVBA 1TYQG 3Q15A 2WMOA 2ZGDA 3BD1A 3IHYA 3ULQA 2M4HA 4RQIA 4JEUA 2WXKA 4HBDA 2E0IA 5JUWA 4ER3A 2IFUA 1IKND 3OXGA 3FU0A 2VYIA 4BETA 2RFAA 4ILIA 1K8KG 3Q49B 4WAFA 4N3BA 2XXAA 4G1TA 3TWSA 5C1DA 3CROL 1L1MA 1JWGA 5EIBE 4Y6CA 2P9UG 4CDNA 2X6JA 3PZ4A 1JPLA 5AQBA 3L17A 4CGVA 2XRYA 4FLHA 2I1KA 2IOLA 2WPVA 2EIME 3PH0C 2GRQB 5DT2A 2FI7A 2RFMA 1BDIA 3RRMB 2HSGA 4MBGA 2WM9A 4B89A 2WQ6A 2X6IA 4AY6A 2IVQA 5EYLA 3ONKA 4AP2A 3FTZA 2XXQA 4PU3C 1E90A 2DCPA 2L6JA 4Z5HA 1E8ZA 3E33A 4DI3A 4BSZB 1RZ4A 5ENRD 4DX2A 3OTNA 1ZZCA 3D9IA 2PXKA 3OXLA 1PC2A 5DBKA 4GQMA 2IQCA 1UG3A 1N4PA 4ER5A 3HVEA 2R5SA 3KSLA 4U0ZA 5JHAA 2XGMA 4J8YA 3N71A 4JB8P 2WXIA 4FP7A 3RKVA 4CRWA 5CEAA 4AIFA 2HCSA 4EQZA 4YNDA 1NERA 1ZS4A 4JW1A 4U0UA 3ULYA 4AEZC 3NQPA 3DM5A 1HO8A 3CHMA 3IKOB 1QYMA 3R7QA 2H6HA 4BTBA 1DCEA 4U8VD 3IHVA 5EILA 1LF8A 2IVGA 3LY7A 4L9PA 4F6RD 3AAAC 3EIQC 2Y3AA 1V55E 1Z3XA 4UWFA 4F1SA 2ICPA 4KYOB 4I1AA 2IO2C 4BT9A 2DYRE 4JCXA 3FTYA 2ONDA 3LFPA 3QWGA 3MGBA 4GAAA 3AG1E 4TXRA 3UM0A 3QK0A 3ZHMA 1AU7A 4GYYA 2LYRA 5BW8C 2PUFA 2JABA 3A9ZA 1ZPQA 1N4SA 1Z3YA 1AP7A 3FU5A 4IYPA 2XZDG 3LJNA 2WQ7A 5JJ6A 5BT1A 3FYMA 3FUMA 1XWRA 1Y9QA 2PUEA 3ZHIA 4IA8A 3QWPA 4XEIG 5FIOA 1QZXA 1FVHA 2I2OA 3DSSA 3PZ1A 1U2VG 4M7CA 3UT7A 2L1PA 3Q79A 1KPSB 4JCYA 4FBIA 2L6BA 3CVWA 5E75A 4ACLA 3ONLA 3OP9A 4AV7A 3ML8A 3FUHA 1ZVVA 3GZSA 1BD8A 3FHEA 4JHRA 4OVUA 5FWQA 2LYKA 1QB2A 3I4GA 2XXPA 3CQGB 3GZDA 2AJAA 4YVOA 3V79K 3QAQA 4TRQA 2Q7FA 3UM3A 4UWLA 3UPVA 2LSVA 2PXQA 4XE0A 1DWKA 5EIDA 4FN3A 4NACA 3LKUA 4YARA 1EPUA 5AARA 2NSZA 3Q4AB 4I6UA 2BTDA 3CKBA 5FQ4A 2GRLA 2WMNA 4GPMA 5G55A 3D9KA 4YDOA 2J09A 4FULA 2HINA 1UXCA 3EUSA 1RW2A 5AQ9A 3SNXA 2IVBA 2M63A 1RZSA 1SA5A 4WWPA 2KCVA 1U3CA 2JVLA 2H8RA 2UWJG 3D3MA 3S7BA 5LCWJ 3ASOE 3PRZA 3FWVA 3JQ0A 4I9EA 1FPPA 1LD7A 2Y0BG 1O1SA 3S8QA 3SCGA 2XPYA 4L2LA 4IN3B 3HHMA 5CCMA 3TWUA 2QY7A 2I6HA 3CVQA 2KPJA 2WQHA 3ESKA 2CG3A 2JQEA 4C48B 3J5QB 2LYPA 1KLXA 3AU5A 5BUZA 3PXPA 4GTTA 5A7DB 2ETAA 3Q47B 3F6QA 4LNBA 3VLEA 4A63B 2J07A 3EHNA 3HZIB 3C98A 4ANVA 4JZYA 3EDTB 1YA0A 2OV8A 3V2OA 3SF4A 2GROB 3QF3A 3NBNB 3CVUA 2V4HC 2VGXA 3CVXA 4HOUA 5FQ7A 4PS7A 1H2UA 2VSYA 1QP4A 1VDYA 3ZGQA 4F7AA 1OCOE 3FUFA 5D66A 4EQFA 4APFA 1DCQA 1S0PA 3B7TA 3EU9A 2XCJA 4ER6A 3APFA 3LEWA 2LXMA 1HF8A 3D9JA 4QQIA 3RSEG 3TL5A 5LCWC 2B5AA 1HH8A 3M9LA 1BLXB 3A9YA 2PXUA 4ABNA 3DWLG 1BU9A 3KL4A 1UJKA 4I8TA 4G8LA 4HS2A 3UMVA 2KEKA 4Z68A 2FULA 1OCRE 3Q5MA 5AQAA 5GAGi 2LNMA 1TNBA 2XHEA 2L0IA 1SQ8A 4TXQA 3ESLA 2PPXA 2BEDA 3KEAA 3EHRA 2F0YA 3DEOA 3GN5B 1JWFA 1ZAYA 3L22A 3FUKA 1E8WA 1R63A 4WNFA 4K5AB 1DVPA 3T9KA 3T5XA 3UI2A 1OCZE 3CGHA 3MV3B 4CDMA 5CCLA 5CRUA 2OVBA 2XPIA 2ETCA 1CQTA 5H7PA 3CVNA 4TUUA 5FQ6A 3MV2B 3FEYA 4I17A 4GMLA 3B13A 2J9QA 2IV1A 2CROA 4DE8A 2OEWA 2XEHA 2P9KG 4R7LA 1SA4A 4GTOA 2PXFA 3QKYA 2E2EA 3B95A 3HIZA 2CHXA 3SBTB 1RZRA 3GYZA 3DEPA 3AG3E 4JA9A 4DX1A 4I6EA 2P58C 4U0SA 4N2SA 2EINE 3CVLA 2R05A 3R7RA 5BXOA 5T3RA 4KZ0A 4WNGA 4GTRA 1X2LA 1D8EA 1U3DA 1MX2A 1S63A 3CEQA 3SY2A 5BPPA 2HYZA 4Q94A 1YYHA 2UY1A 4G25A 3MKRA 1A17A 1UN9A 2VJ8A 4IWRA 1WETA 4BEPA 3C3OA 4I1OB 5KNHD 1MQSA 4P29A 2F8XK 4X4EA 3AJIA 4MS6A 1GT0C 4I6RA 2CSFA 5FINA 2RG8A 2XS1A 5AQ7A 2V8SE 2GRNB 1JCRA 1EDUA 1DC2A 4U04A 4AXHA 3G7DA 3JQ1A 2LO6A 4TV3A 2R17C 2Y1LE 3L1PA 3ABKE 1MHQA 4X4GA 3I4RB 3Q9NC 2AUWA 5ENNA 2L9BA 3VLDA 3LY9A 1BI7B 3ULEG 2WXLA 1ZZ6A 3TWQA 1N0RA 4EZJA 4JHJA 4NDWA 3VTYA 4N3AA 4G23A 4B8CB 3RJVA 3JXCL 1H2VC 2EIKE 3BUAA 1NEQA 4U8HA 3MJWA 4BFRA 3JXBC 1XGWA 3ML9A 2QYUA 2L49A 4DX5D 3WG7E 4EZKA 3PZ2A 2PXDA 4DPRA 5FT9A 1FT2A 3ZW3A 2IF4A 1S7EA 5KJKA 4ILGA 3T5VA 2IU1A 3PNLB 2EILE 3QARA 3G2VA 4GTPA 1IYGA 5JA4D 2ZISA 2MYOA 4OAVB 3TEPA 2ILRA 2WXMA 3QWWA 4GA2A 2R63A 4AOFA 3DPYA 4GTMA 3SR4A 5FZQA 4DK5A 4FHKA 4YDEA 3JXIA 3GZ2A 2PM6A 3QWVA 1HF0A 3APCA 3CKCA 2LUHA 2X6KA 2LYJA 5AJDA 4GTQA 1WH6A 2ODRD 2DBAA 2O4AA 2WXOA 3L54A 4G24A 2YBDA 5CECB 4KVMA 1UW4B 2QYJA 5ARFA 2FEZA 3FUIA 4U63A 4FJZA 4GB9A 3GZCA 1YMPA 2V4LA 5B1BE 4HXIA 3TWTA 3UXGA 4MKTA 2HE0A 2XPZA 1JH9A 1L5JA 3SI5A 4HRLA 3FFLA 2ZU6B 1E96B 3KJXA 3OAWA 3PE4A 2KXPC 5G05C 5ENPD 3OQMA 2X6HA 3HRAA 2LLWA 4GYWA 1QNFA 3GBFA 3FUJA 4BWRA 3G5GA 3BG0B 3C3RA 5DRTA 1ZB1A 4APOA 3OMTA 1HX8A 3UT8A 1TNYA 4LEUA 4N5CA 5KJMA 1N4RA 2I9CA 3UIOC 5EN5D 4UI9J 3ZU7B 4HOSA 2BNOA 2XS8A 4YVQC 4Q69A 3C72A 3RAUA 3EJNA 2V5FA 4UI9K 3DXKG 4MCTA 5T4YA 3BS3A 1ELKA 3QC1A 4B0ZA 2ZXWE 4BT8A 3JYSA 1B0NA 1POUA 3FDHA 3F51A 3NB2A 3ZYKA 4X4FA 3FH5A 4FHJA 2R1JL 2PE5A 3UWPA 1HG2A 4J1XA 1QZ2A 5CERB 2VSXE 4GZ6A 3EHQA 2Y4UA 1NL4A 4NQ0A 4F1PA 1O1TA 4YG1A 5AAOA 5CBNA 3CK8A 3ASGA 3J5PA 2X6FA 4JVSA 2MEZA 4GZDA 3X2QE 4WNEA 2AWIA 3B7RL 5G04J 3CSFA 2PZIA 1QP0A 4JXTA 4HOTA 1NA0A 1JWLA 1UOHA 4WUYA 3PUJA 3EIJA 4HORA 5T8IA 2WXFA 3CR3A 3ABME 3IXEA 4OBMA 2XIUA 4RSYA 2XZTG 5FZSA 3G2UA 5LOZA 1DW9A 3FY4A 2B0OE 3OWQA 2LYQA 3NDBB 3F6WA 4PS8A 5HI7A 4LRZA 3QDNA 5KCMA 3E34A 2PUAA 1U2ZA 5CHEE 3T8KA 2XENA 4GMRA 1EF1C 4HRNA 2KBXA 3FU6A 3LXUX 5AJLA 4PU4C 1BDHA 4Y6WA 1SZAA 3VLFA 5ANRA 3SD5A 4GZCA 2LSUA 3O9XA 4K03A 3PZDA 3GUUA 1B89A 2KM4A 4CCAA 1WG0A 1OWNA 3TXNA 2WXGA 1WH8A 1Z6TA 1ELRA 4CDRA 1MX4A 4IRUA 4N3CA 5FJYA 1N4QA 2UY1B 2XGOA 3TWRA 1NI1A 3NOGD 3HXFA 2CFZA 3B7HA 1S64A 2LYLA 1PRUA 2MHKA 1IQUA 1X57A 2R02A 3FUEA 4K0RA 3ABLE 2NYJA 5JJ7A 3NF1A 3PDNA 1N95A 4EKIA 2IUOA 3UQ3A 2BKGA 4GA0A 3PZ3A 4XI9A 4GTVA 1Q2ZA 3H5TA 4X4BA 2IJGX 4MLPA 3O48A 1JUQA 3HVEB 4JL0A 4CGWA 1MZCA 4I9CA 2A5EA 1E3OC 3UFDA 4BY6A 4Z58A 3D9PA 5ENSD 4EZLA 3BDNA 4U96D 4WVLA 5LX8A 1IQRA 3ZYQA 4A3TA 3GZDC 3ZXSA 4J1WA 4IVZA 3RK6A 1SVXA 2WIUB 2FF4A 3PREA 3MCXA 1OSLA 4GA1A 4KZCA 3A9XA 3ZRHA 3FMYA 1MX6A 2EWTA 2IOSA 4A55A 4YDYA 2A6CA 1G3NB 1GW6A 3FTUA 1H19A 4K5BA 2PXBA 2YQ8A 2QFCA 2MQKA 3TWVA 4HI9A 3W9FA 2IY0C 4BESA 2D5VA 3BG1B 3DPDA 1QQEA 5FZRA 5B3SE 3HXDA 2WB2A 4U7EB 3D9HA 2P9NG 4RLYA
chains in the Genus database with same CATH topology
4PUCA 2FJRA 2AXZA 1U3DA 3CEQA 3ZPJA 3OXFA 2R59A 2FI7A 2HYZA 2J08A 4FJYA 4F53A 5BPPA 4Q94A 4J8FA 2A4ZA 2XSDC 3MYVA 2UY1A 4G25A 4LERA 3MKRA 1TEZA 1BDIA 1W3BA 2HSGA 1A17A 1UN9A 3JCKC 3FYAA 2C2LA 2VJ8A 2WM9A 4IWRA 2X6IA 1WETA 2YHCA 2IVQA 3FUDA 4B89A 3ONKA 2WQ6A 4AY6A 3S7FA 2EF8A 1KT0A 4AP2A 4I1OB 3FTZA 5HQ8A 1MQSA 4KBQA 4ANWA 4P29A 4PU3C 1EFAA 1HS6A 1H6KA 4X4EA 1E90A 1O4XA 3PNTB 1E8YA 2DCPA 2L6JA 4MS6A 4GHJA 4Z5HA 1E8ZA 1GT0C 3AS8A 3TAXA 4AJWA 1Y7YA 3SFZA 2BF0X 4I6RA 3ZVVA 4DI3A 2CSFA 3VK0A 1OWPA 3D9OA 2RG8A 4XIFA 3VTXA 4AY5A 3FH8A 2V8SE 3QOUA 4UWHA 3OTNA 1ZZCA 3AS4A 2AVPA 1EDUA 4PS3A 3D9IA 3LISA 3OXLA 1RIOA 3LY8A 4UWKA 4U04A 1PC2A 5DBKA 4AXHA 5G04C 3G7DA 4GQMA 1P5QA 4G2VA 1PNRA 2IQCA 1UG3A 1CJGA 3JQ1A 4XZ4A 4I2ZA 4XKBA 2LO6A 4TV3A 2R17C 3HVEA 3RO3A 3L1PA 5JJTA 2R5SA 1MHQA 1ZUGA 2L8NA 3SCFA 4X4GA 4UQXA 3I4RB 2KEJA 2NC9A 4U0ZA 4N39A 3LPZA 5D0OD 5JHAA 2XGMA 3ASDA 2PL2A 3N71A 1N52A 2AUWA 1OWLA 3CV0A 3P2BA 5EKQD 5D0QD 1JFTA 2L9BA 2PQRA 4L23A 5ENNA 5FQ8A 3VLDA 3LY9A 1LLIA 2OVFA 2WXIA 4FP7A 4AVXA 5A23A 3IV0A 3TGOA 5G2NA 2JEKA 2WXLA 3RKVA 1ZZ6A 4CRWA 3QYXA 2XJ3A 3BEEA 4O8BA 3APDA 3CQCB 4M3OA 4AIFA 4EZJA 4JHJA 2WXRA 4NDWA 3KZ3A 4BTAA 4DLQA 3VTYA 4YNDA 3D9MA 3U64A 1NERA 4N3AA 3ZYLA 1ZS4A 1H2TC 4G23A 4JW1A 4U0UA 3RJVA 2OR1L 1OUVA 4B8CB 3RIBA 4H7YA 3PUKA 3JXCL 5A6CA 1H2VC 2XEVA 4AEZC 3NQPA 4U8HA 1NEQA 1HO8A 3MA5A 3CHMA 3IKOB 3MJWA 4X4HA 1QQBA 4BFRA 2X38A 3JXBC 3R7QA 1XGWA 3ML9A 1JFSA 5ARGA 4BTBA 4I6TA 2L49A 3OQOA 1HZ4A 4GCNA 3HYMB 3URZA 2YINA 1PY1A 3IHVA 4EZKA 1LF8A 4DPRA 5FT9A 3ZW3A 2IVGA 1QPZA 2CHWA 3LY7A 3MZLB 2IF4A 3GZ1A 3FUNA 1S7EA 1NP7A 1Y6IA 5KJKA 3EIQC 2Y3AA 4ILGA 4ATGA 4C0MA 3T5VA 1EYHA 2IU1A 3QB2A 4BX8A 1Z3XA 3PNLB 4UQZA 4UWFA 2MOWA 4F1SA 3QARA 2ICPA 3G2VA 4G11A 3TG5A 1IYGA 4KYOB 4I1AA 3LVRE 4BT9A 4L1BA 2ILRA 2WXMA 4JCXA 3FTYA 3QWWA 2ONDA 3LFPA 4J6IA 2PIJA 3SBSA 1E7UA 3QWGA 3MGBA 4GA2A 2R63A 4AOFA 4GAAA 3WXXA 4XX5A 4J0UA 5FZQA 3QK0A 4FHKA 3ZHMA 4DK5A 1AU7A 4GYYA 2LYRA 5BW8C 1N54A 4YBAA 3CHOA 5G05J 2PUFA 1ZZ7A 4URKA 2VTBB 3EHMA 4E85A 4EPZA 3GZ2A 3MX3A 1ZPQA 1Z3YA 2PM6A 1R69A 2CHZA 2XCBA 3CLJA 3QWVA 1HF0A 3APCA 3CKCA 3FU5A 3D9NA 3K9IA 4ANUA 2X6KA 3MEKA 3IVPA 2LYJA 2HO1A 1ELWA 2BUGA 4IYPA 5AJDA 1UN8A 1WH6A 1NA3A 2DBAA 1BPOA 4PU7A 2O4AA 3B7SA 4HOQA 3RRMB 2WXOA 3L54A 1LCDA 4G24A 4W9RA 2WQ7A 1ZZ8A 5JJ6A 5BT1A 3B7UX 4KVMA 3FYMA 4HFGA 3FUMA 4N2QA 1XWRA 1UW4B 4PDXA 4MRUA 5ARFA 1Y9QA 2PUEA 2FEZA 3FUIA 4U63A 2X3MA 4FJZA 2HR2A 3ZHEA 4GB9A 3OQNA 3ZHIA 4IA8A 2V4LA 3FEXA 3FULA 4HXIA 3QWPA 3AU4A 1OWMA 4MKTA 1FVHA 2J49A 3SZ7A 2XPZA 2I2OA 2PM7A 2PUDA 1E8XA 1JH9A 1L5JA 4A3VA 4FADA 3SI5A 4ILHB 3UT7A 3FFLA 5C2YA 2KCLA 3DBSA 4JCYA 2ZU6B 3PVLA 4FBIA 3CK9A 3L13A 3CVWA 3CHPA 2HM8A 2KATA 5E75A 4ACLA 1E96B 3ONLA 3OP9A 1PRAA 3CLCA 3KJXA 2LAHA 4AV7A 3OAWA 3PE4A 3LS8A 5G05C 1HXIA 3OQMA 3FUHA 3ML8A 1ZVVA 2X6HA 4DJAA 5J08A 4J8SA 3LJ3A 2WVIA 4V3IA 3CIAA 4GPKA 4GYWA 1XNFA 1QNFA 3L6AA 4I6GA 4EBAG 3GBFA 3FUJA 2VSOE 5FTPA 3FHEA 4JHRA 2O49A 4OVUA 5AYWD 5FWQA 2LYKA 4BWRA 2LCVA 4ANXA 3G5GA 2BNMA 4YG7B 3BG0B 2XGSA 3S7DA 3PE3A 3I4GA 3UUXA 4APOA 3OMTA 1HX8A 2WXQA 3UT8A 4B94A 3CQGB 5EX0A 4YVOA 4FC8A 1HFAA 4Q96A 4E6HA 2VGYA 3QAQA 4LEUA 4N5CA 2GW1A 2I9CA 4TRQA 1YSEA 4CT0A 5BV0A 5KJMA 2Q7FA 4UWLA 3UPVA 3FU3A 3PEVB 4C0EA 3KS2A 4Y42A 4GZ5A 1TJCA 4UI9J 2LSVA 2KZ8A 2WXNA 1LQCA 4XE0A 2EQXA 1DWKA 1IC8A 2V0PA 1HG5A 3ZHEB 3HDXA 4FN3A 3IEGA 2BNOA 4NACA 4A1SA 2GZUA 4BSXA 4HOSA 3LKUA 4YARA 1EPUA 4YVQC 4Q69A 3CHSA 2J4DA 2NSZA 3Q4AB 2EBYA 3RRUA 3EJNA 4ACKA 4I6UA 2BTDA 3CKBA 5FQ4A 4AM9A 2V5FA 2GRLA 4UI9K 4OYSA 2BJCA 4OB4A 4MCTA 5E76A 5T4YA 3BS3A 1ELKA 3QC1A 3GN5A 2WMNA 4IULA 4B0ZA 4WWNA 5G55A 3QQ6A 3D9KA 4BT8A 3CECA 3JYSA 1B0NA 5EX3A 2PUGA 1LMB3 5M72A 1POUA 4RVBA 2KC7A 1ZZ9A 4I43A 2J09A 3FDHA 4FULA 4MCXA 2HINA 1UXCA 3EUSA 4X4DA 5LFAA 3KXAA 3PS6A 3F51A 3ZYKA 4X4FA 3FH5A 3SNXA 1OCTC 4L7TA 4NRHB 5BNWA 2IVBA 4FHJA 2M63A 3FTWA 2YHEA 4O6FA 2R1JL 1RZSA 2PE5A 3LYAA 1WM5A 3NZUA 3P1UA 4WWPA 2KCVA 3ZN3A 3ZIMA 4CT4A 1U3CA 2KZTB 2C0MA 2JVLA 4Z5DA 1HG2A 4J1XA 1QZ2A 1SZ9A 2YNQA 3RO2A 2H8RA 1IHGA 3ZEFA 2UWJG 5AIJA 2KCKA 4OVVA 3D3MA 2VSXE 3S7BA 2IU7A 4GZ6A 4NURA 2Y4UA 4J8EA 3CSTA 1WIZA 2XQ0A 3MKQB 5EDSA 3ZYMA 3CVYA 3RZZA 5CMYA 4EBAA 4NQ0A 5LP0A 5LCWJ 3LVQE 4YG1A 3PRZA 3FWVA 3JQ0A 4I9EA 2GGFA 4GYOA 3CK8A 3ASGA 4I6JA 1UXDA 3UT4A 2X6FA 4GZ3A 4KMOA 2AW6A 3PEUB 4JVSA 4UI9C 3RU0A 2MEZA 3CVVA 4GZDA 2LYSA 2C0LA 3S8QA 4WNEA 2AWIA 1PERL 3ASHA 3SCGA 3B7RL 4GMJA 4QFVA 5G04J 1ADRA 2LNIA 2XPYA 3CSFA 3CK7A 4I2WA 4L2LA 3U9WA 5J90A 4IN3B 2PZIA 1QP0A 3HHMA 2WXHA 4JXTA 5CCMA 2AXUA 4HOTA 2QY7A 3KAEA 2I6HA 1NA0A 1JWLA 4FA6A 3CVQA 2KPJA 2CFUA 5FQ7A 1PRVA 4GU5A 4WUYA 3U66A 3PUJA 3EIJA 4HORA 2AXVA 3FTVA 2WXFA 2WQHA 3CR3A 5T8IA 1Y8MA 3ESKA 4G26A 2CG3A 3FH7A 2VSNA 1ZU2A 3U4TA 3ENEA 2WXPA 4YG4A 4X4IA 2J4BA 2XIUA 2LYPA 1KLXA 3AU5A 4RSYA 4UQYA 5BUZA 3PXPA 1ZBPA 1INZA 5FZSA 3R1FA 5A7DB 3MLFA 2DIWA 1DW9A 3E4BA 3G2UA 3FY4A 3Q47B 5LOZA 3TG4A 1WY6A 1UTXA 2LAIA 4H7XA 5K98B 3FTXA 4BX9A 3VLEA 2KZTA 2MRIA 2O38A 3O4ZA 2J07A 4J8DA 5KJLA 3DNVB 3L16A 2LYQA 4Z5CA 3I5PA 3UX4A 3ZFWA 4DLOA 3EHNA 3HZIB 3C98A 3D9LA 4ANVA 4DI4A 4JZYA 3F6WA 4PS8A 3EDTB 1YA0A 5HI7A 2OV8A 2Y4TA 4LRZA 3SGHA 2ICTA 3QDNA 5KCMA 4WWOA 3S2AA 3SF4A 3QF3A 1KT1A 3KD7A 3SCHA 2PUAA 5CHEE 3CVUA 2VGXA 3QNKA 1EF1C 2XI8A 3CVXA 4HOUA 3FU6A 3LXUX 4JEHA 4PU4C 1BDHA 4L2YA 5AJLA 3CVPA 4PS7A 4RG9A 3R9AB 4Y6WA 1SZAA 3VLFA 4A1GA 1H2UA 2VSYA 1QP4A 1VDYA 2XCCA 4I1MA 5ANRA 3SD5A 3ZGQA 4D10C 3L08A 3FTSA 4GZCA 3TXMA 4JPSA 4F7AA 3FUFA 4XKCA 5DIZA 4KT6B 2LSUA 3O9XA 3AS5A 4JHKA 4EQFA 4APFA 4WNDA 3T8MA 4B8AA 3CHRA 4K03A 1S0PA 2PUCA 3B7TA 3PZDA 4XI0A 5BV1A 1B89A 3TRBA 2KM4A 2RD0A 1RZRD 2XCJA 2KEIA 3APFA 3LEWA 4JC8A 3U3WA 5CMWA 1HF8A 4Z59A 3D9JA 4CCAA 1UJJA 4C9BB 4ME2A 1OWNA 3TXNA 2WXGA 1WH8A 1Z6TA 1ELRA 4CDRA 2XRZA 4IRUA 4N3CA 3TJPA 5FJYA 3TL5A 5LCWC 1E7VA 2UY1B 2XGOA 4UWGA 2B5AA 3FP3A 5A7LA 3G2WA 1HH8A 1VPWA 1X5BA 3B7HA 2CFZA 2LYLA 1PRUA 4F8DA 2MHKA 4ABNA 3ASFA 3JUIA 1IQUA 2JLBA 1X57A 1UJKA 4I8TA 1NZNA 4GCOA 3CHQA 3D1NI 1DNPA 1HE8A 2FBNA 4HS2A 1OWOA 2KEKA 3MKQA 2FULA 4JA7A 3UMVA 3FUEA 4K0RA 3Q5MA 3G2TA 3G2SA 2VQ2A 2OOEA 5JJ7A 2XHEA 3NF1A 4HLEA 2L0IA 3PDNA 2L0TB 1SQ8A 2IUOA 2BNNA 3IBEA 3UQ3A 3LCAA 4GA0A 3ESLA 3NZSA 2PPXA 4XI9A 4MLPA 3H5TA 4X4BA 2IJGX 3O48A 1JUQA 2IONA 2OFYA 4X4CA 4EECA 1X2LA 3HVEB 4JL0A 3JXDL 4CGWA 4I9CA 1QQAA 3GN5B 1JWFA 3KEZA 3QJZA 3RRNB 1ZAYA 3L22A 1E3OC 2A5UA 3FUKA 3UFDA 4BY6A 4RG6A 4Z58A 1PAQA 2GRMA 2PUBA 1E8WA 2CG2A 3D9PA 4LCTA 2WUSR 1R63A 3BDNA 1RPEL 4WNFA 4EZLA 1ZZBA 1LCCA 1DVPA 2FO7A 5KJNA 2NXPA 3SHFA 3T5XA 5LX8A 4CEMA 1IQRA 3CGHA 3MV3B 4CDMA 4HVBA 5CCLA 3Q15A 3ZYQA 4A3TA 3ZXSA 2WMOA 4J1WA 1WAO1 4IVZA 2OVBA 2XPIA 3BD1A 3IHYA 1CQTA 4KVOA 3CVNA 3RK6A 2WIUB 2FF4A 3ULQA 3LDZA 3GW4A 1QP7A 4TUUA 3PREA 3MV2B 5FQ6A 5JHBA 2VTBA 3FEYA 1H0AA 4I17A 3MCXA 4GMLA 1OSLA 3B13A 2J9QA 4GA1A 2IV1A 4JEUA 2WXKA 2CROA 4KZCA 4U07A 2PQNA 2E0IA 3ZRHA 3FMYA 2EWTA 2IOSA 2IFUA 4R7LA 3OXGA 4A55A 2A6CA 3FU0A 2VYIA 3QKYA 3I3NA 2E2EA 4KXKB 3HIZA 4ILIA 1GW6A 2CHXA 1RZRA 3FTUA 3Q49B 3SBTB 4WAFA 4N3BA 3GYZA 4FU3A 4G1TA 1H19A 4JA9A 4I6EA 2YQ8A 2QFCA 5C1DA 3CROL 2P58C 2VGXB 4U0SA 1L1MA 2MQKA 1JWGA 4N2SA 4LUNU 3S7JA 4Y6CA 4JQDA 1SQMA 3CVLA 2D5VA 4PH4B 4CDNA 5ANLA 2X6JA 1JPLA 5AENA 3L17A 3R7RA 4CGVA 3F52A 2XRYA 4PU8A 3BG1B 3DPDA 4FLHA 5T3RA 2WXJA 4KZ0A 1FVFA 2I1KA 4WNGA 1QQEA 5FZRA 2JCGA 2WB2A 4FLBA 2I1JA 1TJFA 2IOLA 2WPVA 4F3VA 3ZKCA 1HU3A 3PH0C 1FCHA 3GZSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F51 A;  2FJR A;  4X4F A;  2AXZ A;  1AU7 A;  3ZHM A;  1WH8 A;  2LYR A;  1OCT C;  4YBA A;  2IVB A;  1ZZ7 A;  2PUF A;  3ZKC A;  2B5A A;  5A7L A;  2XSD C;  1ZPQ A;  2R1J L;  1RZS A;  1R69 A;  1BDI A;  2HSG A;  2PE5 A;  1VPW A;  3FYA A;  1HF0 A;  3B7H A;  4IWR A;  2LYL A;  1WET A;  2IVQ A;  2JVL A;  4Z5D A;  1PRU A;  4J1X A;  3IVP A;  2LYJ A;  4F8D A;  2EF8 A;  2H8R A;  1WH6 A;  2IU7 A;  4PU7 A;  1X57 A;  4PU3 C;  1EFA A;  2O4A A;  1WIZ A;  4X4E A;  1LCD A;  1O4X A;  4I8T A;  1ZZ8 A;  3RZZ A;  3D1N I;  3FYM A;  4GHJ A;  4Z5H A;  2KEK A;  1XWR A;  1GT0 C;  1Y7Y A;  4I6R A;  2CSF A;  3VK0 A;  1Y9Q A;  4YG1 A;  2PUE A;  1UXD A;  1ZZC A;  3OQN A;  3ZHI A;  1SQ8 A;  2AW6 A;  2BNN A;  2IUO A;  4IA8 A;  3LIS A;  2MEZ A;  1RIO A;  2LYS A;  2PPX A;  3S8Q A;  3H5T A;  2AWI A;  4X4B A;  3G7D A;  4GQM A;  3SCG A;  1PER L;  2PUG A;  1PNR A;  1CJG A;  2PUD A;  2OFY A;  4X4C A;  1JH9 A;  1ADR A;  3JXD L;  1QP0 A;  3L1P A;  1QQA A;  3GN5 B;  2AXU A;  4JCY A;  1ZUG A;  2L8N A;  3SCF A;  4FBI A;  4X4G A;  1E3O C;  1ZAY A;  3UFD A;  1JWL A;  4Z58 A;  2KPJ A;  2GRM A;  2KEJ A;  2PUB A;  1PRV A;  2WUS R;  1R63 A;  3BDN A;  1RPE L;  3OP9 A;  1PRA A;  1ZZB A;  2AXV A;  3KJX A;  1LCC A;  3CLC A;  2AUW A;  3OQM A;  1JFT A;  1ZVV A;  1LLI A;  4YG4 A;  4X4I A;  4J1W A;  2XIU A;  2LYP A;  4IVZ A;  1ZZ6 A;  3BD1 A;  3GBF A;  3PXP A;  3QYX A;  2XJ3 A;  1CQT A;  4O8B A;  2WIU B;  2O49 A;  3R1F A;  1QP7 A;  2LYK A;  2LCV A;  3MLF A;  1DW9 A;  3G5G A;  2BNM A;  4NDW A;  3KZ3 A;  1UTX A;  4YG7 B;  1OSL A;  2IV1 A;  5K98 B;  1NER A;  3OMT A;  2CRO A;  1ZS4 A;  2O38 A;  2OR1 L;  3FMY A;  3DNV B;  2LYQ A;  3JXC L;  2EWT A;  4Z5C A;  3HZI B;  1YSE A;  1NEQ A;  3F6W A;  2A6C A;  4X4H A;  1QQB A;  3JXB C;  4Y42 A;  2ICT A;  1JFS A;  1RZR A;  4I6T A;  2KZ8 A;  2L49 A;  1LQC A;  3QF3 A;  3SCH A;  3OQO A;  2PUA A;  1DWK A;  1IC8 A;  4FN3 A;  2BNO A;  2GZU A;  2IVG A;  1QPZ A;  4YAR A;  2XI8 A;  3CRO L;  1S7E A;  1L1M A;  2MQK A;  4PU4 C;  1BDH A;  4JQD A;  2EBY A;  4I6U A;  2D5V A;  1QP4 A;  2GRL A;  2ICP A;  3F52 A;  2BJC A;  4OB4 A;  4MCT A;  4PU8 A;  3BS3 A;  3O9X A;  3GN5 A;  3QQ6 A;  2PUC A;  3CEC A;  1B0N A;  2JCG A;  3TRB A;  4JCX A;  3LFP A;  1LMB 3;  1RZR D;  2PIJ A;  2XCJ A;  1POU A;  2KEI A;  3QWG A;  3U3W A;  1ZZ9 A;  2R63 A;  4MCX A;  4Z59 A;  2HIN A;  1UXC A;  3EUS A;  4X4D A;  1X2L A;  3KXA A; 
#chains in the Genus database with same CATH topology
 3NAW A;  2FO1 E;  3ZPJ A;  3OXF A;  2J08 A;  4FJY A;  4J8F A;  2A4Z A;  2XSD C;  3MYV A;  1NW3 A;  1TEZ A;  1W3B A;  3JCK C;  4J6I A;  3FYA A;  2C2L A;  3FUD A;  3S7F A;  2EF8 A;  4KBQ A;  1EFA A;  1HS6 A;  1O4X A;  3PNT B;  5CBO A;  3L9T A;  1Y7Y A;  3SFZ A;  2BF0 X;  2DWZ A;  1IHB A;  3VK0 A;  1OWP A;  3D9O A;  3ZVV A;  4XIF A;  3FH8 A;  3C3Q A;  3UM1 A;  3QOU A;  4UWH A;  4K5C A;  3AS4 A;  2AVP A;  3LIS A;  5DRY A;  4UWK A;  4BER A;  5G04 C;  4G2V A;  1PNR A;  2J7W A;  3V30 A;  3JUE A;  4XKB A;  3BQO A;  3RO3 A;  1ZUG A;  4UQX A;  2KEJ A;  3LPZ A;  5HS0 A;  5EKQ D;  3CV0 A;  5D0Q D;  1JFT A;  2PQR A;  2OVF A;  5G2N A;  2JEK A;  4NIK A;  2XJ3 A;  1TN7 A;  4O8B A;  3APD A;  3BEE A;  4M3O A;  2WXR A;  3AG4 E;  3U64 A;  3D9M A;  3ZYL A;  1H2T C;  1OUV A;  3PUK A;  1AWC B;  2XEV A;  5ENT D;  1OCC E;  3MA5 A;  3VWS A;  1QQB A;  2H6I A;  2X38 A;  2PXP A;  5ARG A;  3OQO A;  1HZ4 A;  3URZ A;  2P9P G;  4GCN A;  3HYM B;  1PY1 A;  1KZP A;  1QPZ A;  3MZL B;  1TN8 A;  4ATG A;  1EYH A;  4BX8 A;  2MOW A;  5DTR A;  2H6F A;  3DSV A;  1LD8 A;  5D2M C;  1E7U A;  2B6C A;  3WXX A;  3L82 A;  4JD2 G;  4J0U A;  4YBA A;  1ZZ7 A;  3EHM A;  4DX7 D;  4E85 A;  4GTS A;  2XCB A;  3CLJ A;  2PXE A;  3D9N A;  2DZO A;  3IVP A;  3BU8 A;  2HO1 A;  2BUG A;  2QZA A;  3B7S A;  4DRX E;  4W9R A;  1LCD A;  3MEJ A;  4MRU A;  5ENO D;  3Q7A A;  1H6O A;  2X3M A;  2HR2 A;  3ZHE A;  3OQN A;  4CYM D;  4O1P A;  3FUL A;  3AU4 A;  5EYP F;  2PM7 A;  2PUD A;  1E8X A;  3AG2 E;  4FAD A;  5C2Y A;  4EKG A;  1IXV A;  2KCL A;  3DBS A;  3PVL A;  3CK9 A;  4U8Y D;  3CHP A;  2HM8 A;  3EU5 A;  2KAT A;  3E32 A;  1PRA A;  3LS8 A;  1HXI A;  1H6P A;  4DJA A;  5J08 A;  4J8S A;  3LJ3 A;  2WVI A;  1TN6 A;  3CIA A;  4GPK A;  1XNF A;  3L6A A;  4EBA G;  2VSO E;  3R09 A;  5FTP A;  2O49 A;  2HCN A;  4ANX A;  2BNM A;  3S7D A;  3PE3 A;  3UUX A;  4B94 A;  2MXD A;  1HFA A;  4Q96 A;  2GW1 A;  4Q2J A;  1YSE A;  5BV0 A;  3FU3 A;  3PEV B;  2VGE A;  3KSQ A;  4C0E A;  3KS2 A;  1TNO A;  4Y42 A;  4GZ5 A;  1TJC A;  2KZ8 A;  2WXN A;  3UIN C;  2EQX A;  2V0P A;  1IC8 A;  3ZHE B;  3HDX A;  3IEG A;  4BSX A;  2P9S G;  3CHS A;  2J4D A;  4ATZ D;  3RRU A;  3SFY A;  2OCC E;  2BJC A;  4IUL A;  3OKZ A;  3CEC A;  5EX3 A;  3TFL A;  2PUG A;  4I43 A;  1ZZ9 A;  4LSZ E;  4MCX A;  3DSU A;  4X4D A;  3KXA A;  3PS6 A;  1OCT C;  4NRH B;  5BNW A;  2YHE A;  4O6F A;  2EIJ E;  3LYA A;  1WM5 A;  3ZIM A;  4CT4 A;  2YNQ A;  4G8K A;  3RO2 A;  3V2X A;  5AIJ A;  4NUR A;  4J8E A;  1WIZ A;  2XQ0 A;  5EDS A;  3ZYM A;  3RZZ A;  2ZIR A;  3LVQ E;  1DUL A;  2GGF A;  4GYO A;  4DE9 A;  1UXD A;  3UT4 A;  3NXH A;  3Q9U C;  3PEU B;  3CVV A;  2C0L A;  2OEV A;  4GMJ A;  4UUC A;  4I2W A;  3CK7 A;  3U9W A;  5J90 A;  4EZI A;  3NOC D;  2AXU A;  3W9G A;  2F37 A;  3U66 A;  3ISM C;  1NFI E;  2AXV A;  3FTV A;  4G26 A;  2VSN A;  1ZU2 A;  3ENE A;  2WXP A;  4UQY A;  2J4B A;  3NRO A;  2PXV A;  1TNZ A;  1ZBP A;  1INZ A;  4HNA D;  2DIW A;  3E4B A;  3TG4 A;  1UTX A;  2LAI A;  2P9L G;  4H7X A;  5K98 B;  2O38 A;  1V54 E;  3O4Z A;  4J8D A;  3UIP C;  5KJL A;  3I5P A;  3ZXP A;  3ZFW A;  4DLO A;  2LLV A;  1MJ0 A;  4DX6 D;  2ICT A;  5HRY A;  3S2A A;  3KD7 A;  5CED B;  3SCH A;  2LXL A;  3QNK A;  2XI8 A;  4DI4 A;  4JEH A;  1JCQ A;  4L2Y A;  4EBA A;  3CVP A;  4D10 C;  1OY3 D;  3L08 A;  3TXM A;  3SO8 A;  4XKC A;  5DIZ A;  4KT6 B;  1MFQ C;  1KZO A;  4B8A A;  3T8M A;  4XI0 A;  3TRB A;  2IO3 C;  2RD0 A;  1RZR D;  2KEI A;  3V31 A;  1JCS A;  3TJP A;  4UWG A;  3FP3 A;  5A7L A;  1N9A A;  1WDY A;  1X5B A;  2VEO A;  1HQ1 A;  2BKK B;  3ASF A;  3JUI A;  2JLB A;  3JXJ A;  4GCO A;  3D1N I;  2FBN A;  1OWO A;  3MKQ A;  4JA7 A;  3SFX A;  3G2T A;  3E30 A;  2L0T B;  3HXC A;  3NZS A;  3ZUV B;  4EEC A;  1QQA A;  3UKU G;  3KEZ A;  2GRM A;  2PUB A;  1OT8 A;  3ZNG A;  2WUS R;  1ZZB A;  2FO7 A;  3SHF A;  1WAO 1;  3ASN E;  4KVO A;  3LDZ A;  3GW4 A;  1QP7 A;  2VTB A;  5JHB A;  3E37 A;  1H0A A;  2V3C C;  4O1O A;  4YDW A;  2PXT A;  4U07 A;  2PQN A;  3HG0 D;  4LNU D;  3I3N A;  4KXK B;  3DST A;  3TWW A;  5KWD A;  4FU3 A;  2VGX B;  4LUN U;  3S7J A;  4JQD A;  4HLL A;  1SQM A;  4PH4 B;  3NZL A;  5ANL A;  5AEN A;  5DSX A;  3F52 A;  1K1B A;  4PU8 A;  1D8D A;  2WXJ A;  1FVF A;  2JCG A;  4FLB A;  2I1J A;  3DSX A;  1TJF A;  4F3V A;  3ZKC A;  1HU3 A;  1FCH A;  4PUC A;  2FJR A;  2AXZ A;  4HRM B;  2GRP B;  2R59 A;  4F53 A;  4LER A;  3QOW A;  2YHC A;  1KT0 A;  5HQ8 A;  3UTM A;  4ANW A;  1H6K A;  1E8Y A;  3G0T A;  4GHJ A;  4AJW A;  3AS8 A;  3TAX A;  4J7W A;  1A5E A;  4AY5 A;  2ZGG A;  3VTX A;  1O5M A;  1O1R A;  4PS3 A;  4X8Q A;  1RIO A;  3LY8 A;  4HRA A;  1P5Q A;  1CJG A;  4XZ4 A;  4I2Z A;  3ZKJ A;  5JJT A;  2L8N A;  3SCF A;  5IY5 E;  2NC9 A;  4N39 A;  5D0O D;  3ASD A;  2PL2 A;  1N52 A;  1OWL A;  3P2B A;  5FQ8 A;  4L23 A;  3SX0 A;  1LLI A;  4AVX A;  5A23 A;  3IV0 A;  3TGO A;  3QYX A;  3CQC B;  3PE5 A;  3KZ3 A;  4BTA A;  4DLQ A;  3QOX A;  1K1A A;  2OR1 L;  3RIB A;  4H7Y A;  5KBA A;  5A6C A;  4X4H A;  4O60 A;  1JFS A;  4I6T A;  1SW6 A;  2YIN A;  3R9M A;  5GAH i;  4CZ2 D;  2CHW A;  3GZ1 A;  3FUN A;  1NP7 A;  1Y6I A;  4LNG A;  4HB5 A;  2GRR B;  4C0M A;  4U95 D;  3QB2 A;  4ZFH A;  4UQZ A;  3B7B A;  3UM2 A;  1BI8 B;  4EHM A;  4G11 A;  3TG5 A;  2Y69 E;  3LVR E;  4L1B A;  2PIJ A;  2DYS E;  3SBS A;  4XX5 A;  5ENQ D;  3SQV A;  1N54 A;  3CHO A;  5G05 J;  4URK A;  2VTB B;  4EPZ A;  1N0Q A;  3MX3 A;  2PNN A;  1R69 A;  2CHZ A;  3K9I A;  4ANU A;  3MEK A;  1ELW A;  1UN8 A;  1NA3 A;  1BPO A;  4PU7 A;  4HOQ A;  5JMN D;  1ZZ8 A;  3B7U X;  4HFG A;  4N2Q A;  4PDX A;  3FEX A;  1OWM A;  3SZ7 A;  2J49 A;  3Q73 A;  4A3V A;  3HXE A;  4ILH B;  2PXL A;  3L13 A;  2IEJ A;  2V5Q C;  3CLC A;  2LAH A;  4B93 B;  4TUM A;  2J7U A;  4V3I A;  4DUI A;  4I6G A;  5AYW D;  1TNU A;  1YCS B;  2LCV A;  4YG7 B;  2XGS A;  1FT1 A;  2WXQ A;  5EX0 A;  4FC8 A;  4E6H A;  2VGY A;  4CT0 A;  5CRV A;  3LQX A;  1LQC A;  5DTM A;  3C5R A;  1HG5 A;  4A1S A;  2GZU A;  3Q75 A;  2EBY A;  4ACK A;  4AM9 A;  4OYS A;  4OB4 A;  5E76 A;  3QFI A;  3DRA A;  3GN5 A;  4WWN A;  3QQ6 A;  1TR4 A;  1LMB 3;  5M72 A;  4RVB A;  2KC7 A;  5DTQ A;  5LFA A;  4L7T A;  3FTW A;  3ZN3 A;  3NZU A;  3P1U A;  2KZT B;  2C0M A;  1SZ9 A;  4Z5D A;  5ITZ F;  4EK9 A;  1IHG A;  3ZEF A;  2KCK A;  4OVV A;  1OXJ A;  2IU7 A;  3CST A;  2HFZ A;  3MKQ B;  3CVY A;  5CMY A;  5LP0 A;  4ZHB A;  4I6J A;  4GZ3 A;  4KMO A;  2AW6 A;  4HI8 A;  4UI9 C;  3RU0 A;  4HQD A;  2LYS A;  1PER L;  3ASH A;  4QFV A;  1ADR A;  2LNI A;  2WXH A;  2ETB A;  2P2C P;  2H6G A;  3DSW A;  3KAE A;  4FA6 A;  2J8S D;  2CFU A;  1PRV A;  4GU5 A;  1Y8M A;  3TWX A;  4OAU C;  3U4T A;  3FH7 A;  2FFH A;  4YG4 A;  4X4I A;  3R1F A;  3ME5 A;  3MLF A;  1WY6 A;  2F8Y A;  3FTX A;  4BX9 A;  2KZT A;  2MRI A;  3DNV B;  3L16 A;  5KNG A;  4Z5C A;  5BXU A;  3UX4 A;  3D9L A;  4LG6 A;  2R2L A;  2Y4T A;  3SGH A;  2DZN A;  1Z5S C;  4WWO A;  1N11 A;  1KT1 A;  1MYO A;  4ER0 A;  3R9A B;  4RG9 A;  4A1G A;  2XCC A;  4I1M A;  3FTS A;  4JPS A;  5HKP A;  2DVW A;  3AS5 A;  4JHK A;  4WND A;  1K3Z D;  3CHR A;  2PUC A;  5BV1 A;  3EUV A;  2P9I G;  5CMW A;  4JC8 A;  3U3W A;  4Z59 A;  1X81 A;  1UJJ A;  4C9B B;  4ME2 A;  1QBQ A;  2XRZ A;  3Q7F A;  1S70 B;  1E7V A;  5B1A E;  3G2W A;  2QC9 A;  3DXM G;  3UKR G;  1VPW A;  3Q78 A;  4F8D A;  2XEE A;  2R03 A;  1NZN A;  3CHQ A;  1HE8 A;  1DNP A;  1LTX A;  3G2S A;  2VQ2 A;  3ZPX A;  2OOE A;  3TEL A;  5AN8 A;  4HLE A;  2BNN A;  3IBE A;  3LCA A;  4TXP A;  1D9S A;  2ION A;  2RKK A;  2OFY A;  4X4C A;  3JXD L;  4N5Q A;  3QJZ A;  3RRN B;  1N94 A;  2A5U A;  4RG6 A;  1PAQ A;  3HXB A;  4ER7 A;  2CG2 A;  4LCT A;  1RPE L;  5KJN A;  1LCC A;  2NXP A;  4CEM A;  4HVB A;  1TYQ G;  3Q15 A;  2WMO A;  2ZGD A;  3BD1 A;  3IHY A;  3ULQ A;  2M4H A;  4RQI A;  4JEU A;  2WXK A;  4HBD A;  2E0I A;  5JUW A;  4ER3 A;  2IFU A;  1IKN D;  3OXG A;  3FU0 A;  2VYI A;  4BET A;  2RFA A;  4ILI A;  1K8K G;  3Q49 B;  4WAF A;  4N3B A;  2XXA A;  4G1T A;  3TWS A;  5C1D A;  3CRO L;  1L1M A;  1JWG A;  5EIB E;  4Y6C A;  2P9U G;  4CDN A;  2X6J A;  3PZ4 A;  1JPL A;  5AQB A;  3L17 A;  4CGV A;  2XRY A;  4FLH A;  2I1K A;  2IOL A;  2WPV A;  2EIM E;  3PH0 C;  2GRQ B;  5DT2 A;  2FI7 A;  2RFM A;  1BDI A;  3RRM B;  2HSG A;  4MBG A;  2WM9 A;  4B89 A;  2WQ6 A;  2X6I A;  4AY6 A;  2IVQ A;  5EYL A;  3ONK A;  4AP2 A;  3FTZ A;  2XXQ A;  4PU3 C;  1E90 A;  2DCP A;  2L6J A;  4Z5H A;  1E8Z A;  3E33 A;  4DI3 A;  4BSZ B;  1RZ4 A;  5ENR D;  4DX2 A;  3OTN A;  1ZZC A;  3D9I A;  2PXK A;  3OXL A;  1PC2 A;  5DBK A;  4GQM A;  2IQC A;  1UG3 A;  1N4P A;  4ER5 A;  3HVE A;  2R5S A;  3KSL A;  4U0Z A;  5JHA A;  2XGM A;  4J8Y A;  3N71 A;  4JB8 P;  2WXI A;  4FP7 A;  3RKV A;  4CRW A;  5CEA A;  4AIF A;  2HCS A;  4EQZ A;  4YND A;  1NER A;  1ZS4 A;  4JW1 A;  4U0U A;  3ULY A;  4AEZ C;  3NQP A;  3DM5 A;  1HO8 A;  3CHM A;  3IKO B;  1QYM A;  3R7Q A;  2H6H A;  4BTB A;  1DCE A;  4U8V D;  3IHV A;  5EIL A;  1LF8 A;  2IVG A;  3LY7 A;  4L9P A;  4F6R D;  3AAA C;  3EIQ C;  2Y3A A;  1V55 E;  1Z3X A;  4UWF A;  4F1S A;  2ICP A;  4KYO B;  4I1A A;  2IO2 C;  4BT9 A;  2DYR E;  4JCX A;  3FTY A;  2OND A;  3LFP A;  3QWG A;  3MGB A;  4GAA A;  3AG1 E;  4TXR A;  3UM0 A;  3QK0 A;  3ZHM A;  1AU7 A;  4GYY A;  2LYR A;  5BW8 C;  2PUF A;  2JAB A;  3A9Z A;  1ZPQ A;  1N4S A;  1Z3Y A;  1AP7 A;  3FU5 A;  4IYP A;  2XZD G;  3LJN A;  2WQ7 A;  5JJ6 A;  5BT1 A;  3FYM A;  3FUM A;  1XWR A;  1Y9Q A;  2PUE A;  3ZHI A;  4IA8 A;  3QWP A;  4XEI G;  5FIO A;  1QZX A;  1FVH A;  2I2O A;  3DSS A;  3PZ1 A;  1U2V G;  4M7C A;  3UT7 A;  2L1P A;  3Q79 A;  1KPS B;  4JCY A;  4FBI A;  2L6B A;  3CVW A;  5E75 A;  4ACL A;  3ONL A;  3OP9 A;  4AV7 A;  3ML8 A;  3FUH A;  1ZVV A;  3GZS A;  1BD8 A;  3FHE A;  4JHR A;  4OVU A;  5FWQ A;  2LYK A;  1QB2 A;  3I4G A;  2XXP A;  3CQG B;  3GZD A;  2AJA A;  4YVO A;  3V79 K;  3QAQ A;  4TRQ A;  2Q7F A;  3UM3 A;  4UWL A;  3UPV A;  2LSV A;  2PXQ A;  4XE0 A;  1DWK A;  5EID A;  4FN3 A;  4NAC A;  3LKU A;  4YAR A;  1EPU A;  5AAR A;  2NSZ A;  3Q4A B;  4I6U A;  2BTD A;  3CKB A;  5FQ4 A;  2GRL A;  2WMN A;  4GPM A;  5G55 A;  3D9K A;  4YDO A;  2J09 A;  4FUL A;  2HIN A;  1UXC A;  3EUS A;  1RW2 A;  5AQ9 A;  3SNX A;  2IVB A;  2M63 A;  1RZS A;  1SA5 A;  4WWP A;  2KCV A;  1U3C A;  2JVL A;  2H8R A;  2UWJ G;  3D3M A;  3S7B A;  5LCW J;  3ASO E;  3PRZ A;  3FWV A;  3JQ0 A;  4I9E A;  1FPP A;  1LD7 A;  2Y0B G;  1O1S A;  3S8Q A;  3SCG A;  2XPY A;  4L2L A;  4IN3 B;  3HHM A;  5CCM A;  3TWU A;  2QY7 A;  2I6H A;  3CVQ A;  2KPJ A;  2WQH A;  3ESK A;  2CG3 A;  2JQE A;  4C48 B;  3J5Q B;  2LYP A;  1KLX A;  3AU5 A;  5BUZ A;  3PXP A;  4GTT A;  5A7D B;  2ETA A;  3Q47 B;  3F6Q A;  4LNB A;  3VLE A;  4A63 B;  2J07 A;  3EHN A;  3HZI B;  3C98 A;  4ANV A;  4JZY A;  3EDT B;  1YA0 A;  2OV8 A;  3V2O A;  3SF4 A;  2GRO B;  3QF3 A;  3NBN B;  3CVU A;  2V4H C;  2VGX A;  3CVX A;  4HOU A;  5FQ7 A;  4PS7 A;  1H2U A;  2VSY A;  1QP4 A;  1VDY A;  3ZGQ A;  4F7A A;  1OCO E;  3FUF A;  5D66 A;  4EQF A;  4APF A;  1DCQ A;  1S0P A;  3B7T A;  3EU9 A;  2XCJ A;  4ER6 A;  3APF A;  3LEW A;  2LXM A;  1HF8 A;  3D9J A;  4QQI A;  3RSE G;  3TL5 A;  5LCW C;  2B5A A;  1HH8 A;  3M9L A;  1BLX B;  3A9Y A;  2PXU A;  4ABN A;  3DWL G;  1BU9 A;  3KL4 A;  1UJK A;  4I8T A;  4G8L A;  4HS2 A;  3UMV A;  2KEK A;  4Z68 A;  2FUL A;  1OCR E;  3Q5M A;  5AQA A;  5GAG i;  2LNM A;  1TNB A;  2XHE A;  2L0I A;  1SQ8 A;  4TXQ A;  3ESL A;  2PPX A;  2BED A;  3KEA A;  3EHR A;  2F0Y A;  3DEO A;  3GN5 B;  1JWF A;  1ZAY A;  3L22 A;  3FUK A;  1E8W A;  1R63 A;  4WNF A;  4K5A B;  1DVP A;  3T9K A;  3T5X A;  3UI2 A;  1OCZ E;  3CGH A;  3MV3 B;  4CDM A;  5CCL A;  5CRU A;  2OVB A;  2XPI A;  2ETC A;  1CQT A;  5H7P A;  3CVN A;  4TUU A;  5FQ6 A;  3MV2 B;  3FEY A;  4I17 A;  4GML A;  3B13 A;  2J9Q A;  2IV1 A;  2CRO A;  4DE8 A;  2OEW A;  2XEH A;  2P9K G;  4R7L A;  1SA4 A;  4GTO A;  2PXF A;  3QKY A;  2E2E A;  3B95 A;  3HIZ A;  2CHX A;  3SBT B;  1RZR A;  3GYZ A;  3DEP A;  3AG3 E;  4JA9 A;  4DX1 A;  4I6E A;  2P58 C;  4U0S A;  4N2S A;  2EIN E;  3CVL A;  2R05 A;  3R7R A;  5BXO A;  5T3R A;  4KZ0 A;  4WNG A;  4GTR A;  1X2L A;  1D8E A;  1U3D A;  1MX2 A;  1S63 A;  3CEQ A;  3SY2 A;  5BPP A;  2HYZ A;  4Q94 A;  1YYH A;  2UY1 A;  4G25 A;  3MKR A;  1A17 A;  1UN9 A;  2VJ8 A;  4IWR A;  1WET A;  4BEP A;  3C3O A;  4I1O B;  5KNH D;  1MQS A;  4P29 A;  2F8X K;  4X4E A;  3AJI A;  4MS6 A;  1GT0 C;  4I6R A;  2CSF A;  5FIN A;  2RG8 A;  2XS1 A;  5AQ7 A;  2V8S E;  2GRN B;  1JCR A;  1EDU A;  1DC2 A;  4U04 A;  4AXH A;  3G7D A;  3JQ1 A;  2LO6 A;  4TV3 A;  2R17 C;  2Y1L E;  3L1P A;  3ABK E;  1MHQ A;  4X4G A;  3I4R B;  3Q9N C;  2AUW A;  5ENN A;  2L9B A;  3VLD A;  3LY9 A;  1BI7 B;  3ULE G;  2WXL A;  1ZZ6 A;  3TWQ A;  1N0R A;  4EZJ A;  4JHJ A;  4NDW A;  3VTY A;  4N3A A;  4G23 A;  4B8C B;  3RJV A;  3JXC L;  1H2V C;  2EIK E;  3BUA A;  1NEQ A;  4U8H A;  3MJW A;  4BFR A;  3JXB C;  1XGW A;  3ML9 A;  2QYU A;  2L49 A;  4DX5 D;  3WG7 E;  4EZK A;  3PZ2 A;  2PXD A;  4DPR A;  5FT9 A;  1FT2 A;  3ZW3 A;  2IF4 A;  1S7E A;  5KJK A;  4ILG A;  3T5V A;  2IU1 A;  3PNL B;  2EIL E;  3QAR A;  3G2V A;  4GTP A;  1IYG A;  5JA4 D;  2ZIS A;  2MYO A;  4OAV B;  3TEP A;  2ILR A;  2WXM A;  3QWW A;  4GA2 A;  2R63 A;  4AOF A;  3DPY A;  4GTM A;  3SR4 A;  5FZQ A;  4DK5 A;  4FHK A;  4YDE A;  3JXI A;  3GZ2 A;  2PM6 A;  3QWV A;  1HF0 A;  3APC A;  3CKC A;  2LUH A;  2X6K A;  2LYJ A;  5AJD A;  4GTQ A;  1WH6 A;  2ODR D;  2DBA A;  2O4A A;  2WXO A;  3L54 A;  4G24 A;  2YBD A;  5CEC B;  4KVM A;  1UW4 B;  2QYJ A;  5ARF A;  2FEZ A;  3FUI A;  4U63 A;  4FJZ A;  4GB9 A;  3GZC A;  1YMP A;  2V4L A;  5B1B E;  4HXI A;  3TWT A;  3UXG A;  4MKT A;  2HE0 A;  2XPZ A;  1JH9 A;  1L5J A;  3SI5 A;  4HRL A;  3FFL A;  2ZU6 B;  1E96 B;  3KJX A;  3OAW A;  3PE4 A;  2KXP C;  5G05 C;  5ENP D;  3OQM A;  2X6H A;  3HRA A;  2LLW A;  4GYW A;  1QNF A;  3GBF A;  3FUJ A;  4BWR A;  3G5G A;  3BG0 B;  3C3R A;  5DRT A;  1ZB1 A;  4APO A;  3OMT A;  1HX8 A;  3UT8 A;  1TNY A;  4LEU A;  4N5C A;  5KJM A;  1N4R A;  2I9C A;  3UIO C;  5EN5 D;  4UI9 J;  3ZU7 B;  4HOS A;  2BNO A;  2XS8 A;  4YVQ C;  4Q69 A;  3C72 A;  3RAU A;  3EJN A;  2V5F A;  4UI9 K;  3DXK G;  4MCT A;  5T4Y A;  3BS3 A;  1ELK A;  3QC1 A;  4B0Z A;  2ZXW E;  4BT8 A;  3JYS A;  1B0N A;  1POU A;  3FDH A;  3F51 A;  3NB2 A;  3ZYK A;  4X4F A;  3FH5 A;  4FHJ A;  2R1J L;  2PE5 A;  3UWP A;  1HG2 A;  4J1X A;  1QZ2 A;  5CER B;  2VSX E;  4GZ6 A;  3EHQ A;  2Y4U A;  1NL4 A;  4NQ0 A;  4F1P A;  1O1T A;  4YG1 A;  5AAO A;  5CBN A;  3CK8 A;  3ASG A;  3J5P A;  2X6F A;  4JVS A;  2MEZ A;  4GZD A;  3X2Q E;  4WNE A;  2AWI A;  3B7R L;  5G04 J;  3CSF A;  2PZI A;  1QP0 A;  4JXT A;  4HOT A;  1NA0 A;  1JWL A;  1UOH A;  4WUY A;  3PUJ A;  3EIJ A;  4HOR A;  5T8I A;  2WXF A;  3CR3 A;  3ABM E;  3IXE A;  4OBM A;  2XIU A;  4RSY A;  2XZT G;  5FZS A;  3G2U A;  5LOZ A;  1DW9 A;  3FY4 A;  2B0O E;  3OWQ A;  2LYQ A;  3NDB B;  3F6W A;  4PS8 A;  5HI7 A;  4LRZ A;  3QDN A;  5KCM A;  3E34 A;  2PUA A;  1U2Z A;  5CHE E;  3T8K A;  2XEN A;  4GMR A;  1EF1 C;  4HRN A;  2KBX A;  3FU6 A;  3LXU X;  5AJL A;  4PU4 C;  1BDH A;  4Y6W A;  1SZA A;  3VLF A;  5ANR A;  3SD5 A;  4GZC A;  2LSU A;  3O9X A;  4K03 A;  3PZD A;  3GUU A;  1B89 A;  2KM4 A;  4CCA A;  1WG0 A;  1OWN A;  3TXN A;  2WXG A;  1WH8 A;  1Z6T A;  1ELR A;  4CDR A;  1MX4 A;  4IRU A;  4N3C A;  5FJY A;  1N4Q A;  2UY1 B;  2XGO A;  3TWR A;  1NI1 A;  3NOG D;  3HXF A;  2CFZ A;  3B7H A;  1S64 A;  2LYL A;  1PRU A;  2MHK A;  1IQU A;  1X57 A;  2R02 A;  3FUE A;  4K0R A;  3ABL E;  2NYJ A;  5JJ7 A;  3NF1 A;  3PDN A;  1N95 A;  4EKI A;  2IUO A;  3UQ3 A;  2BKG A;  4GA0 A;  3PZ3 A;  4XI9 A;  4GTV A;  1Q2Z A;  3H5T A;  4X4B A;  2IJG X;  4MLP A;  3O48 A;  1JUQ A;  3HVE B;  4JL0 A;  4CGW A;  1MZC A;  4I9C A;  2A5E A;  1E3O C;  3UFD A;  4BY6 A;  4Z58 A;  3D9P A;  5ENS D;  4EZL A;  3BDN A;  4U96 D;  4WVL A;  5LX8 A;  1IQR A;  3ZYQ A;  4A3T A;  3GZD C;  3ZXS A;  4J1W A;  4IVZ A;  3RK6 A;  1SVX A;  2WIU B;  2FF4 A;  3PRE A;  3MCX A;  1OSL A;  4GA1 A;  4KZC A;  3A9X A;  3ZRH A;  3FMY A;  1MX6 A;  2EWT A;  2IOS A;  4A55 A;  4YDY A;  2A6C A;  1G3N B;  1GW6 A;  3FTU A;  1H19 A;  4K5B A;  2PXB A;  2YQ8 A;  2QFC A;  2MQK A;  3TWV A;  4HI9 A;  3W9F A;  2IY0 C;  4BES A;  2D5V A;  3BG1 B;  3DPD A;  1QQE A;  5FZR A;  5B3S E;  3HXD A;  2WB2 A;  4U7E B;  3D9H A;  2P9N G;  4RLY A; 
#chains in the Genus database with same CATH homology
 4PUC A;  2FJR A;  2AXZ A;  1U3D A;  3CEQ A;  3ZPJ A;  3OXF A;  2R59 A;  2FI7 A;  2HYZ A;  2J08 A;  4FJY A;  4F53 A;  5BPP A;  4Q94 A;  4J8F A;  2A4Z A;  2XSD C;  3MYV A;  2UY1 A;  4G25 A;  4LER A;  3MKR A;  1TEZ A;  1BDI A;  1W3B A;  2HSG A;  1A17 A;  1UN9 A;  3JCK C;  3FYA A;  2C2L A;  2VJ8 A;  2WM9 A;  4IWR A;  2X6I A;  1WET A;  2YHC A;  2IVQ A;  3FUD A;  4B89 A;  3ONK A;  2WQ6 A;  4AY6 A;  3S7F A;  2EF8 A;  1KT0 A;  4AP2 A;  4I1O B;  3FTZ A;  5HQ8 A;  1MQS A;  4KBQ A;  4ANW A;  4P29 A;  4PU3 C;  1EFA A;  1HS6 A;  1H6K A;  4X4E A;  1E90 A;  1O4X A;  3PNT B;  1E8Y A;  2DCP A;  2L6J A;  4MS6 A;  4GHJ A;  4Z5H A;  1E8Z A;  1GT0 C;  3AS8 A;  3TAX A;  4AJW A;  1Y7Y A;  3SFZ A;  2BF0 X;  4I6R A;  3ZVV A;  4DI3 A;  2CSF A;  3VK0 A;  1OWP A;  3D9O A;  2RG8 A;  4XIF A;  3VTX A;  4AY5 A;  3FH8 A;  2V8S E;  3QOU A;  4UWH A;  3OTN A;  1ZZC A;  3AS4 A;  2AVP A;  1EDU A;  4PS3 A;  3D9I A;  3LIS A;  3OXL A;  1RIO A;  3LY8 A;  4UWK A;  4U04 A;  1PC2 A;  5DBK A;  4AXH A;  5G04 C;  3G7D A;  4GQM A;  1P5Q A;  4G2V A;  1PNR A;  2IQC A;  1UG3 A;  1CJG A;  3JQ1 A;  4XZ4 A;  4I2Z A;  4XKB A;  2LO6 A;  4TV3 A;  2R17 C;  3HVE A;  3RO3 A;  3L1P A;  5JJT A;  2R5S A;  1MHQ A;  1ZUG A;  2L8N A;  3SCF A;  4X4G A;  4UQX A;  3I4R B;  2KEJ A;  2NC9 A;  4U0Z A;  4N39 A;  3LPZ A;  5D0O D;  5JHA A;  2XGM A;  3ASD A;  2PL2 A;  3N71 A;  1N52 A;  2AUW A;  1OWL A;  3CV0 A;  3P2B A;  5EKQ D;  5D0Q D;  1JFT A;  2L9B A;  2PQR A;  4L23 A;  5ENN A;  5FQ8 A;  3VLD A;  3LY9 A;  1LLI A;  2OVF A;  2WXI A;  4FP7 A;  4AVX A;  5A23 A;  3IV0 A;  3TGO A;  5G2N A;  2JEK A;  2WXL A;  3RKV A;  1ZZ6 A;  4CRW A;  3QYX A;  2XJ3 A;  3BEE A;  4O8B A;  3APD A;  3CQC B;  4M3O A;  4AIF A;  4EZJ A;  4JHJ A;  2WXR A;  4NDW A;  3KZ3 A;  4BTA A;  4DLQ A;  3VTY A;  4YND A;  3D9M A;  3U64 A;  1NER A;  4N3A A;  3ZYL A;  1ZS4 A;  1H2T C;  4G23 A;  4JW1 A;  4U0U A;  3RJV A;  2OR1 L;  1OUV A;  4B8C B;  3RIB A;  4H7Y A;  3PUK A;  3JXC L;  5A6C A;  1H2V C;  2XEV A;  4AEZ C;  3NQP A;  4U8H A;  1NEQ A;  1HO8 A;  3MA5 A;  3CHM A;  3IKO B;  3MJW A;  4X4H A;  1QQB A;  4BFR A;  2X38 A;  3JXB C;  3R7Q A;  1XGW A;  3ML9 A;  1JFS A;  5ARG A;  4BTB A;  4I6T A;  2L49 A;  3OQO A;  1HZ4 A;  4GCN A;  3HYM B;  3URZ A;  2YIN A;  1PY1 A;  3IHV A;  4EZK A;  1LF8 A;  4DPR A;  5FT9 A;  3ZW3 A;  2IVG A;  1QPZ A;  2CHW A;  3LY7 A;  3MZL B;  2IF4 A;  3GZ1 A;  3FUN A;  1S7E A;  1NP7 A;  1Y6I A;  5KJK A;  3EIQ C;  2Y3A A;  4ILG A;  4ATG A;  4C0M A;  3T5V A;  1EYH A;  2IU1 A;  3QB2 A;  4BX8 A;  1Z3X A;  3PNL B;  4UQZ A;  4UWF A;  2MOW A;  4F1S A;  3QAR A;  2ICP A;  3G2V A;  4G11 A;  3TG5 A;  1IYG A;  4KYO B;  4I1A A;  3LVR E;  4BT9 A;  4L1B A;  2ILR A;  2WXM A;  4JCX A;  3FTY A;  3QWW A;  2OND A;  3LFP A;  4J6I A;  2PIJ A;  3SBS A;  1E7U A;  3QWG A;  3MGB A;  4GA2 A;  2R63 A;  4AOF A;  4GAA A;  3WXX A;  4XX5 A;  4J0U A;  5FZQ A;  3QK0 A;  4FHK A;  3ZHM A;  4DK5 A;  1AU7 A;  4GYY A;  2LYR A;  5BW8 C;  1N54 A;  4YBA A;  3CHO A;  5G05 J;  2PUF A;  1ZZ7 A;  4URK A;  2VTB B;  3EHM A;  4E85 A;  4EPZ A;  3GZ2 A;  3MX3 A;  1ZPQ A;  1Z3Y A;  2PM6 A;  1R69 A;  2CHZ A;  2XCB A;  3CLJ A;  3QWV A;  1HF0 A;  3APC A;  3CKC A;  3FU5 A;  3D9N A;  3K9I A;  4ANU A;  2X6K A;  3MEK A;  3IVP A;  2LYJ A;  2HO1 A;  1ELW A;  2BUG A;  4IYP A;  5AJD A;  1UN8 A;  1WH6 A;  1NA3 A;  2DBA A;  1BPO A;  4PU7 A;  2O4A A;  3B7S A;  4HOQ A;  3RRM B;  2WXO A;  3L54 A;  1LCD A;  4G24 A;  4W9R A;  2WQ7 A;  1ZZ8 A;  5JJ6 A;  5BT1 A;  3B7U X;  4KVM A;  3FYM A;  4HFG A;  3FUM A;  4N2Q A;  1XWR A;  1UW4 B;  4PDX A;  4MRU A;  5ARF A;  1Y9Q A;  2PUE A;  2FEZ A;  3FUI A;  4U63 A;  2X3M A;  4FJZ A;  2HR2 A;  3ZHE A;  4GB9 A;  3OQN A;  3ZHI A;  4IA8 A;  2V4L A;  3FEX A;  3FUL A;  4HXI A;  3QWP A;  3AU4 A;  1OWM A;  4MKT A;  1FVH A;  2J49 A;  3SZ7 A;  2XPZ A;  2I2O A;  2PM7 A;  2PUD A;  1E8X A;  1JH9 A;  1L5J A;  4A3V A;  4FAD A;  3SI5 A;  4ILH B;  3UT7 A;  3FFL A;  5C2Y A;  2KCL A;  3DBS A;  4JCY A;  2ZU6 B;  3PVL A;  4FBI A;  3CK9 A;  3L13 A;  3CVW A;  3CHP A;  2HM8 A;  2KAT A;  5E75 A;  4ACL A;  1E96 B;  3ONL A;  3OP9 A;  1PRA A;  3CLC A;  3KJX A;  2LAH A;  4AV7 A;  3OAW A;  3PE4 A;  3LS8 A;  5G05 C;  1HXI A;  3OQM A;  3FUH A;  3ML8 A;  1ZVV A;  2X6H A;  4DJA A;  5J08 A;  4J8S A;  3LJ3 A;  2WVI A;  4V3I A;  3CIA A;  4GPK A;  4GYW A;  1XNF A;  1QNF A;  3L6A A;  4I6G A;  4EBA G;  3GBF A;  3FUJ A;  2VSO E;  5FTP A;  3FHE A;  4JHR A;  2O49 A;  4OVU A;  5AYW D;  5FWQ A;  2LYK A;  4BWR A;  2LCV A;  4ANX A;  3G5G A;  2BNM A;  4YG7 B;  3BG0 B;  2XGS A;  3S7D A;  3PE3 A;  3I4G A;  3UUX A;  4APO A;  3OMT A;  1HX8 A;  2WXQ A;  3UT8 A;  4B94 A;  3CQG B;  5EX0 A;  4YVO A;  4FC8 A;  1HFA A;  4Q96 A;  4E6H A;  2VGY A;  3QAQ A;  4LEU A;  4N5C A;  2GW1 A;  2I9C A;  4TRQ A;  1YSE A;  4CT0 A;  5BV0 A;  5KJM A;  2Q7F A;  4UWL A;  3UPV A;  3FU3 A;  3PEV B;  4C0E A;  3KS2 A;  4Y42 A;  4GZ5 A;  1TJC A;  4UI9 J;  2LSV A;  2KZ8 A;  2WXN A;  1LQC A;  4XE0 A;  2EQX A;  1DWK A;  1IC8 A;  2V0P A;  1HG5 A;  3ZHE B;  3HDX A;  4FN3 A;  3IEG A;  2BNO A;  4NAC A;  4A1S A;  2GZU A;  4BSX A;  4HOS A;  3LKU A;  4YAR A;  1EPU A;  4YVQ C;  4Q69 A;  3CHS A;  2J4D A;  2NSZ A;  3Q4A B;  2EBY A;  3RRU A;  3EJN A;  4ACK A;  4I6U A;  2BTD A;  3CKB A;  5FQ4 A;  4AM9 A;  2V5F A;  2GRL A;  4UI9 K;  4OYS A;  2BJC A;  4OB4 A;  4MCT A;  5E76 A;  5T4Y A;  3BS3 A;  1ELK A;  3QC1 A;  3GN5 A;  2WMN A;  4IUL A;  4B0Z A;  4WWN A;  5G55 A;  3QQ6 A;  3D9K A;  4BT8 A;  3CEC A;  3JYS A;  1B0N A;  5EX3 A;  2PUG A;  1LMB 3;  5M72 A;  1POU A;  4RVB A;  2KC7 A;  1ZZ9 A;  4I43 A;  2J09 A;  3FDH A;  4FUL A;  4MCX A;  2HIN A;  1UXC A;  3EUS A;  4X4D A;  5LFA A;  3KXA A;  3PS6 A;  3F51 A;  3ZYK A;  4X4F A;  3FH5 A;  3SNX A;  1OCT C;  4L7T A;  4NRH B;  5BNW A;  2IVB A;  4FHJ A;  2M63 A;  3FTW A;  2YHE A;  4O6F A;  2R1J L;  1RZS A;  2PE5 A;  3LYA A;  1WM5 A;  3NZU A;  3P1U A;  4WWP A;  2KCV A;  3ZN3 A;  3ZIM A;  4CT4 A;  1U3C A;  2KZT B;  2C0M A;  2JVL A;  4Z5D A;  1HG2 A;  4J1X A;  1QZ2 A;  1SZ9 A;  2YNQ A;  3RO2 A;  2H8R A;  1IHG A;  3ZEF A;  2UWJ G;  5AIJ A;  2KCK A;  4OVV A;  3D3M A;  2VSX E;  3S7B A;  2IU7 A;  4GZ6 A;  4NUR A;  2Y4U A;  4J8E A;  3CST A;  1WIZ A;  2XQ0 A;  3MKQ B;  5EDS A;  3ZYM A;  3CVY A;  3RZZ A;  5CMY A;  4EBA A;  4NQ0 A;  5LP0 A;  5LCW J;  3LVQ E;  4YG1 A;  3PRZ A;  3FWV A;  3JQ0 A;  4I9E A;  2GGF A;  4GYO A;  3CK8 A;  3ASG A;  4I6J A;  1UXD A;  3UT4 A;  2X6F A;  4GZ3 A;  4KMO A;  2AW6 A;  3PEU B;  4JVS A;  4UI9 C;  3RU0 A;  2MEZ A;  3CVV A;  4GZD A;  2LYS A;  2C0L A;  3S8Q A;  4WNE A;  2AWI A;  1PER L;  3ASH A;  3SCG A;  3B7R L;  4GMJ A;  4QFV A;  5G04 J;  1ADR A;  2LNI A;  2XPY A;  3CSF A;  3CK7 A;  4I2W A;  4L2L A;  3U9W A;  5J90 A;  4IN3 B;  2PZI A;  1QP0 A;  3HHM A;  2WXH A;  4JXT A;  5CCM A;  2AXU A;  4HOT A;  2QY7 A;  3KAE A;  2I6H A;  1NA0 A;  1JWL A;  4FA6 A;  3CVQ A;  2KPJ A;  2CFU A;  5FQ7 A;  1PRV A;  4GU5 A;  4WUY A;  3U66 A;  3PUJ A;  3EIJ A;  4HOR A;  2AXV A;  3FTV A;  2WXF A;  2WQH A;  3CR3 A;  5T8I A;  1Y8M A;  3ESK A;  4G26 A;  2CG3 A;  3FH7 A;  2VSN A;  1ZU2 A;  3U4T A;  3ENE A;  2WXP A;  4YG4 A;  4X4I A;  2J4B A;  2XIU A;  2LYP A;  1KLX A;  3AU5 A;  4RSY A;  4UQY A;  5BUZ A;  3PXP A;  1ZBP A;  1INZ A;  5FZS A;  3R1F A;  5A7D B;  3MLF A;  2DIW A;  1DW9 A;  3E4B A;  3G2U A;  3FY4 A;  3Q47 B;  5LOZ A;  3TG4 A;  1WY6 A;  1UTX A;  2LAI A;  4H7X A;  5K98 B;  3FTX A;  4BX9 A;  3VLE A;  2KZT A;  2MRI A;  2O38 A;  3O4Z A;  2J07 A;  4J8D A;  5KJL A;  3DNV B;  3L16 A;  2LYQ A;  4Z5C A;  3I5P A;  3UX4 A;  3ZFW A;  4DLO A;  3EHN A;  3HZI B;  3C98 A;  3D9L A;  4ANV A;  4DI4 A;  4JZY A;  3F6W A;  4PS8 A;  3EDT B;  1YA0 A;  5HI7 A;  2OV8 A;  2Y4T A;  4LRZ A;  3SGH A;  2ICT A;  3QDN A;  5KCM A;  4WWO A;  3S2A A;  3SF4 A;  3QF3 A;  1KT1 A;  3KD7 A;  3SCH A;  2PUA A;  5CHE E;  3CVU A;  2VGX A;  3QNK A;  1EF1 C;  2XI8 A;  3CVX A;  4HOU A;  3FU6 A;  3LXU X;  4JEH A;  4PU4 C;  1BDH A;  4L2Y A;  5AJL A;  3CVP A;  4PS7 A;  4RG9 A;  3R9A B;  4Y6W A;  1SZA A;  3VLF A;  4A1G A;  1H2U A;  2VSY A;  1QP4 A;  1VDY A;  2XCC A;  4I1M A;  5ANR A;  3SD5 A;  3ZGQ A;  4D10 C;  3L08 A;  3FTS A;  4GZC A;  3TXM A;  4JPS A;  4F7A A;  3FUF A;  4XKC A;  5DIZ A;  4KT6 B;  2LSU A;  3O9X A;  3AS5 A;  4JHK A;  4EQF A;  4APF A;  4WND A;  3T8M A;  4B8A A;  3CHR A;  4K03 A;  1S0P A;  2PUC A;  3B7T A;  3PZD A;  4XI0 A;  5BV1 A;  1B89 A;  3TRB A;  2KM4 A;  2RD0 A;  1RZR D;  2XCJ A;  2KEI A;  3APF A;  3LEW A;  4JC8 A;  3U3W A;  5CMW A;  1HF8 A;  4Z59 A;  3D9J A;  4CCA A;  1UJJ A;  4C9B B;  4ME2 A;  1OWN A;  3TXN A;  2WXG A;  1WH8 A;  1Z6T A;  1ELR A;  4CDR A;  2XRZ A;  4IRU A;  4N3C A;  3TJP A;  5FJY A;  3TL5 A;  5LCW C;  1E7V A;  2UY1 B;  2XGO A;  4UWG A;  2B5A A;  3FP3 A;  5A7L A;  3G2W A;  1HH8 A;  1VPW A;  1X5B A;  3B7H A;  2CFZ A;  2LYL A;  1PRU A;  4F8D A;  2MHK A;  4ABN A;  3ASF A;  3JUI A;  1IQU A;  2JLB A;  1X57 A;  1UJK A;  4I8T A;  1NZN A;  4GCO A;  3CHQ A;  3D1N I;  1DNP A;  1HE8 A;  2FBN A;  4HS2 A;  1OWO A;  2KEK A;  3MKQ A;  2FUL A;  4JA7 A;  3UMV A;  3FUE A;  4K0R A;  3Q5M A;  3G2T A;  3G2S A;  2VQ2 A;  2OOE A;  5JJ7 A;  2XHE A;  3NF1 A;  4HLE A;  2L0I A;  3PDN A;  2L0T B;  1SQ8 A;  2IUO A;  2BNN A;  3IBE A;  3UQ3 A;  3LCA A;  4GA0 A;  3ESL A;  3NZS A;  2PPX A;  4XI9 A;  4MLP A;  3H5T A;  4X4B A;  2IJG X;  3O48 A;  1JUQ A;  2ION A;  2OFY A;  4X4C A;  4EEC A;  1X2L A;  3HVE B;  4JL0 A;  3JXD L;  4CGW A;  4I9C A;  1QQA A;  3GN5 B;  1JWF A;  3KEZ A;  3QJZ A;  3RRN B;  1ZAY A;  3L22 A;  1E3O C;  2A5U A;  3FUK A;  3UFD A;  4BY6 A;  4RG6 A;  4Z58 A;  1PAQ A;  2GRM A;  2PUB A;  1E8W A;  2CG2 A;  3D9P A;  4LCT A;  2WUS R;  1R63 A;  3BDN A;  1RPE L;  4WNF A;  4EZL A;  1ZZB A;  1LCC A;  1DVP A;  2FO7 A;  5KJN A;  2NXP A;  3SHF A;  3T5X A;  5LX8 A;  4CEM A;  1IQR A;  3CGH A;  3MV3 B;  4CDM A;  4HVB A;  5CCL A;  3Q15 A;  3ZYQ A;  4A3T A;  3ZXS A;  2WMO A;  4J1W A;  1WAO 1;  4IVZ A;  2OVB A;  2XPI A;  3BD1 A;  3IHY A;  1CQT A;  4KVO A;  3CVN A;  3RK6 A;  2WIU B;  2FF4 A;  3ULQ A;  3LDZ A;  3GW4 A;  1QP7 A;  4TUU A;  3PRE A;  3MV2 B;  5FQ6 A;  5JHB A;  2VTB A;  3FEY A;  1H0A A;  4I17 A;  3MCX A;  4GML A;  1OSL A;  3B13 A;  2J9Q A;  4GA1 A;  2IV1 A;  4JEU A;  2WXK A;  2CRO A;  4KZC A;  4U07 A;  2PQN A;  2E0I A;  3ZRH A;  3FMY A;  2EWT A;  2IOS A;  2IFU A;  4R7L A;  3OXG A;  4A55 A;  2A6C A;  3FU0 A;  2VYI A;  3QKY A;  3I3N A;  2E2E A;  4KXK B;  3HIZ A;  4ILI A;  1GW6 A;  2CHX A;  1RZR A;  3FTU A;  3Q49 B;  3SBT B;  4WAF A;  4N3B A;  3GYZ A;  4FU3 A;  4G1T A;  1H19 A;  4JA9 A;  4I6E A;  2YQ8 A;  2QFC A;  5C1D A;  3CRO L;  2P58 C;  2VGX B;  4U0S A;  1L1M A;  2MQK A;  1JWG A;  4N2S A;  4LUN U;  3S7J A;  4Y6C A;  4JQD A;  1SQM A;  3CVL A;  2D5V A;  4PH4 B;  4CDN A;  5ANL A;  2X6J A;  1JPL A;  5AEN A;  3L17 A;  3R7R A;  4CGV A;  3F52 A;  2XRY A;  4PU8 A;  3BG1 B;  3DPD A;  4FLH A;  5T3R A;  2WXJ A;  4KZ0 A;  1FVF A;  2I1K A;  4WNG A;  1QQE A;  5FZR A;  2JCG A;  2WB2 A;  4FLB A;  2I1J A;  1TJF A;  2IOL A;  2WPV A;  4F3V A;  3ZKC A;  1HU3 A;  3PH0 C;  1FCH A;  3GZS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...