1QP4A

Purine repressor-hypoxanthine-palindromic operator complex
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
338
structure length
338
Chain Sequence
TIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAAYFAEIIEAVEKNCFQKGYTLILGNAWNNLEKQRAYLSMMAQKRVDGLLVMCSEYPEPLLAMLEEYRHIPMVVMDWGEAKADFTDAVIDNAFEGGYMAGRYLIERGHREIGVIPGPLERNTGAGRLAGFMKAMEEAMIKVPESWIVQGDFEPESGYRAMQQILSQPHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEVHPRLIERRSVADGPFRDYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The role of lysine 55 in determining the specificity of the purine repressor for its operators through minor groove interactions.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription/dna
molecule keywords DNA (5'-D(*TP*AP*CP*GP*CP*AP*AP*TP*CP*GP*AP*TP*TP*GP*CP*GP*T
total genus 116
structure length 338
sequence length 338
ec nomenclature
pdb deposition date 1999-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00356 LacI Bacterial regulatory proteins, lacI family
A PF13377 Peripla_BP_3 Periplasmic binding protein-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 1qp4A01
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1qp4A03
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1qp4A02
1X57A 3OLYA 1KRWA 2FLKA 2PUDA 3OM0A 4JASB 2F8SA 1W9HA 3FGZA 2GBPA 1QPZA 2BNNA 4FB4A 4NCAA 1Z15A 1TJYA 4RK7A 4ZPJA 1Z25A 2FMIA 3N0XA 2QXYA 3GRCA 4RV5A 1PRVA 4RK4A 1DBWA 2EBYA 1ZZBA 3RVOA 5KI6A 3EQ2A 1BDIA 5BQ3A 4PE5B 1TVMA 1D2AA 1T34A 3HM9A 2ZAYA 3RVQA 3HCWA 2EWTA 4MR9A 1Z18A 5T7BA 1ISSA 3F73A 1DBPA 1EWTA 3TRBA 1ZH2A 3N0WA 3CLKA 4KQ9A 4ZYLA 3I42A 4Z4IA 1JFTA 4FE4A 3KCNA 5IUNC 4YR7A 3ROTA 3BREA 3IP7A 1AB6A 1YS6A 4MS3A 1JHZA 4NQRA 4RXUA 3HVRA 4X4GA 1RZRA 2IDMA 4FN3A 1DC7A 2WUSR 1PUXA 1U2QA 3A10A 3BRSA 4PEVA 4I8TA 3RVSA 2E4UA 3UUGA 5PNTA 2HJ9A 4PZ0A 1YS7A 2WRZA 3I5AA 5CNIA 4EVQA 2MSWA 3LKVA 1QQBA 1ZY2A 3JS5A 5TQ0B 2AXZA 3RZZA 4IILA 5KC9A 1ZZ6A 3OMXA 2FKAA 2GKGA 1Z17A 3OMWA 1FQWA 4RWEA 4TN5A 3URMA 1JFSA 1JH9A 4MR7A 2M1ZA 1NXPA 3L1PA 5DLEA 4J1WA 4H3HB 3ZHIA 1B00A 3RVPA 4EUKA 4TLMB 1E3OC 1LMB3 1WIZA 1E6KA 4HYEA 2KYRA 2OQRA 4HNRA 4PU7A 4LRQA 4EY3A 1DWKA 1ABEA 4Y42A 4X4IA 1SRRA 3JVDA 4WXMA 4X4EA 3MQ4A 3R0JA 5TPWA 2N9UA 5DGCA 2FMFA 1IC8A 2FN8A 3KHTA 2VUIB 4MRMB 1KMIY 3KYIB 3QWGA 1DRJA 4XLTA 1ZZ8A 2FEKA 4IWRA 1QNLA 4I6RA 2KEKA 2NZVG 1XHFA 3BD1A 2L17A 4G0MA 3CKMA 3C3MA 3KG2A 2CWDA 4L4UA 3GN5A 5C5CA 2RJNA 1DBQA 3E3MA 4PU4C 3LUAA 2YHAA 3QLVC 3DGEC 1FFSA 1S8NA 4W5OA 4F8JA 2ZWMA 2BJCA 1UXDA 2IU7A 3E61A 3P9YA 2PE5A 2ID7A 4OLAA 1BA2A 1EWVA 3F52A 2NT4A 4YG7B 2QZJA 3H1GA 1BAPA 2E4YA 2PKXA 2L18A 1EAYA 2R47A 4E7OA 3IVPA 2RGYA 1LCCA 1PNRA 4N0QA 3RQIA 3HK2A 4RK6A 1CQTA 5E3JA 4YARA 1FFWA 2D5VA 3KLNA 2JRLA 3S99A 2JVKA 1D1QA 1NXTA 1ZESA 4IMJB 4N03A 5CNKA 3O2JA 1U8TA 4N47A 1DCKA 4OG2A 4YLEA 3K9CA 3HO1A 1WH8A 2BNMA 1MVOA 5KWSA 3B7HA 3FFXA 3IDOA 1DG9A 4MGEA 4PU3C 3EAFA 4X4BA 5KQLA 3BILA 2O20A 3GBPA 1P6UA 2E4ZA 4NICA 3IPCA 2R1JL 1YK0A 3Q7SA 1VKRA 3FDFA 2FQWA 2H0AA 3OO0A 1K66A 4FE7A 1DCMA 5ED4A 2HPHA 4UHKA 2V0NA 1WH6A 3F6CA 4PYRA 2LYLA 1UTXA 1Y1LA 4MYRA 2FJRA 1LJLA 1H9CA 2PUCA 1TM2A 2FEWB 3HUTA 2WWVD 4ZMRA 1ADRA 1GLGA 2B5AA 3SCFA 3GBFA 2PUGA 4X4DA 1L1MA 2PLNA 2IVQA 3G85A 1POUA 3M6MD 3SG0A 4P98A 3JVIA 3BDNA 2LYQA 2GX6A 1B0NA 3RVJA 4DN6A 5JNWA 3GA5A 5B3JC 4MQFA 5TQ2A 5IEJA 1YK1A 1Z12A 2OENG 1ZITA 3HS3A 4IA8A 4Q6BA 4Z99A 3UKJA 1ZN2A 1E2BA 3MLFA 4JB0A 3C6QA 4MS1A 3BS3A 3EUSA 2KEIA 1D4ZA 2LPMA 4XFKA 2OR1L 2PUBA 5T3YA 1DCFA 4W5NA 5DCLA 3H5IA 4YP9A 3W9SA 1RPEL 2AYXA 1CJGA 2JVLA 3MYYA 2BNOA 2J48A 2H8RA 4WWHA 1Z2EA 2HQOA 4YGXB 1Y7YA 1SXIA 3Q7RA 2FSPA 4G86A 3HDGA 2PIJA 3TB6A 4OATA 5DTEA 3VNAA 3CZCA 3N53A 2WB4A 3D8UA 1R8JA 2IKSA 2KZ8A 1JF8A 3KZ3A 3QYXA 3H1EA 3I09A 4G0YA 2PL9A 1GUBA 1NXVA 4OBBA 3N75A 4RXMA 5FWYA 1MAVA 2PMCA 3A0RB 3MMNA 3QELB 4H60A 3DBIA 3IPAA 4JA2A 4KMRA 5DKFA 2HSGA 3HXMA 1QO0D 3OLVA 2CD7A 4GQMA 1OXBB 5B3JA 1W25A 3CROL 4G0QA 2LYPA 4KRFA 3Q7TA 1JDPA 3EDCA 1IIBA 1NEQA 1RXIA 2P4UA 3KKEA 3TO5A 1E6LA 3QX9A 4MLDA 1YMUA 5D2CA 4B09A 1PNTA 2O38A 4IRXA 4XXHA 2LP4Y 4HNSA 3LUGA 4Z4FA 1PRAA 3GBVA 1JFVA 2MEZA 3C97A 2PAFA 4D6YA 1YVUA 1DJMA 3G7DA 1BVHA 3O1HB 3KYJB 5TQJA 3SM9A 4YBAA 1USKA 3QQ6A 1YTUA 1NATA 1YMVA 3T95A 1QP0A 3LKBA 4KV7A 1JBEA 1NERA 1M5UA 1M2EA 4YO7A 1QKKA 2CHEA 3KJXA 4I6TA 4JAVC 3EJWA 2FMHA 4Z0NA 3CG0A 5JNVA 1JDNA 1ZUGA 1TLFA 4Z5HA 4YG4A 1OCTC 4KPYA 3CZ5A 2B4AA 4LDZA 2CSFA 2XI8A 5EWLB 1D1PA 7ABPA 1SXHA 4X4FA 4OB4A 1JL3A 1ZGGA 2LYJA 3NBMA 4H3KB 3ILHA 2NT3A 1ZZ7A 4W5RA 2EF8A 3CLCA 2LUOA 1ABFA 2QVCA 4IGAA 1Z13A 1ZAYA 2X7XA 4NV3A 1UDRA 4YRZA 1RXEA 2R25B 4MQFB 1QQAA 2GZUA 2QW1A 1ZVVA 1NXXA 3RVLA 2AYZA 1XWRA 5EWMB 4IF4A 4MQEA 3ZKCA 1QP7A 1YSEA 4RZSA 2LIVA 4HNQA 4MAAA 4Y9TA 3CG4A 3M9WA 5BRJA 3U3WA 3SCGA 3QEKA 1UXCA 1ZH4A 5KQGA 1RNLA 3MM4A 4QYMA 3F7NA 3QELA 2XCJA 2VUHB 3NHZA 4MR8A 2JCGA 4EGSA 3FMVA 4OTZA 5JNRA 3L6UA 3MA0A 3LFPA 3CECA 1DP4A 5KQMA 4TLLB 1Z26A 3CFYA 2LYSA 3T38A 4Z9AA 4ETIA 4N41A 1KRXA 4Z9BA 4RY0A 5TPZA 2QV0A 3HV2A 1A0OA 3KSMA 3O2QB 2E4VA 4O1HA 3IP5A 3FYAA 3H5VA 2XDYA 3D02A 3FFWA 1LBHA 2AXUA 2IVGA 2IPAB 3DGFC 2OFYA 3SQNA 2WJAA 2LCVA 1QP4A 1OXKB 1X2LA 2GRLA 3FMYA 1ZGZA 3LUJA 4Q6WA 2QSJA 3N8IA 4O1IA 3UFDA 3KLOA 2KPJA 4FBIA 4ETNA 2IUOA 2FEPA 1A2OA 3EQZA 4KVFA 4M88A 4Z58A 2QR3A 3VNBA 5ABPA 1ZZCA 3CS3A 1Z2DA 2F8TA 2R63A 1GT0C 1RIOA 1WETA 5IUJC 4LDAA 2R4QA 3H1FA 3LMKA 3O2SB 4MQEB 5JNUA 1MB0A 3LUKA 3F51A 3A0UA 3HDVA 3NNSA 3TX6A 2AW6A 3GL9A 4W5TA 4G0PA 3GWGA 2IPMA 4D6XA 3OM1A 1JX6A 1ZDMA 4I6UA 3RVNA 1L5ZA 4NDWA 5FWXB 3FYMA 3B2NA 2MYPA 9ABPA 3JTEA 1ZPQA 3IP9A 2FQXA 1ZS4A 5HKOA 1TMYA 2JBAB 3JPWA 4Z5CA 3R1FA 4F8DA 2R48A 3OQNA 1BDHA 4DQDA 4RK1A 3MIZA 3O1IC 4RDCA 1EWKA 3LUHA 1DC8A 3NNNA 4MPTA 2HINA 3CHYA 3LISA 5IEBA 3SY8A 5EWJB 5JNTA 2XSDC 1E6MA 2PL1A 3O1JC 1EFAA 1O4XA 3BRQA 3NHMA 1QO0A 3OLXA 5HQJA 5BR1A 3DNVB 2FQYA 3F6PA 1DZ3A 3LFTA 3MF4A 3H6HA 4JQDA 3I45A 3A3KA 3Q15C 3HSYA 2NZUG 4RY9A 3TD9A 1APBA 4MCXA 1RPJA 4LX8A 2FTKE 4DADA 2BGGA 2GRMA 1DW9A 2TMYA 4RKRA 5CNMA 1S7EA 5TPWB 1USIA 2FLWA 1SXGA 5TPZD 2O49A 3RVRA 3RVKA 2FXIA 4F06A 1OSLA 1LCDA 2AWIA 4MS4A 4ETMA 4KNYA 2E4XA 2ICTA 2A9OA 4MS4B 4QPJC 3JXBC 1PERL 4WXEA 2LYKA 2XJ3A 4EVRA 3GN5B 2GWRA 2MQKA 3CNBA 3GT7A 3HEBA 1GCGA 2A9PA 3N0RA 3OLWA 4D74A 5FBHA 4S05A 3RVMA 3DLHA 4Q7EA 3G1WA 4KK3A 4Z4HA 4UHJA 4J1XA 4O8BA 1NXSA 3LOPA 4MCTA 4RK5A 1USGA 3JPYA 4KQCA 4WZZA 5FWXA 1I3CA 2YHBA 4X4HA 4PICA 1PHRA 1R69A 3QLUC 5TE9A 4G0XA 1C4WA 2JVIA 1LQCA 1SQ8A 2ICPA 1M2FA 3H6GA 3PXPA 1JYFA 2E4WA 2VYCA 3QLUA 5CHYA 4N76A 3H75A 2WMYA 3C3KA 5CNJA 3G5GA 2QVGA 3CTPA 3OQOA 4LE2A 3SNKA 6CHYA 4W5QA 4EYQA 4Z59A 4YCSA 3GYBA 1DRKA 3Q41A 1CHNA 3O74A 2RJOA 4JB2A 2L8NA 2IOYA 1VPWA 5JNSA 5K98B 3H5WA 4MLCA 2FN9A 3ZHMA 4MS1B 5IBQA 2O4AA 1LBIA 1YIOA 4LZLA 5HSGA 4ZJPA 4LE1A 1K68A 2L49A 4MR8B 5KQPA 2I6FA 5JS1A 3LUCA 3H5TA 3QF3A 4TMYA 4YG1A 1BDJA 2IPNA 2LBPA 4KREA 4Z4EA 4G97A 4GHJA 4RU1A 5GOTA 4F11A 3VK0A 4PU8A 1URPA 5BRAA 1CYEA 4XAQA 4KFCA 1FSPA 3JXDL 3LTEA 3OLZA 2DRIA 4GPAA 3DLBA 3TMYA 1JLKA 1PEAA 4Z5DA 2PJUA 3CU5A 1F51E 3LUFA 1JYEA 3OO1A 4ML3A 4MS3B 2MYTA 3EODA 4JOQA 3N6VA 3D1NI 1KGSA 3O75A 4XARA 2FW0A 2JB9A 4X4CA 3SCHA 1SD5A 4P1ZA 1LK0A 4LE0A 2HQBA 4EYGA 1U0SY 2QU7A 2W42A 1RZRD 5JS2A 4IVZA 3QX8A 2IV1A 1PEYA 3JY6A 4EYOA 1ISRA 4Z4GA 2MSLA 3LUDA 2WY2D 1D5WA 1ZZ9A 2KEJA 3BBLA 4EYKA 3S8QA 5TQ2B 2XIUA 5C5EA 2CHFA 4RXTA 5I4CA 4YWHA 4ZMSA 2JK1A 1HF0A 1MIHA 1U04A 1GCAA 4RSMA 4Z4CA 1NXWA 4WT7A 5IC5A 3JXCL 1P6QA 5HM6A 4MRMA 2AUWA 1ZHHA 2FMKA 3L49A 4QYWA 3IP6A 3KXAA 2WIUB 3OP9A 3O21A 5EWMA 3ROFA 1NTRA 2L2QA 1C0EA 4YV7A 3F6WA 1AU7A 3OMTA 2PUEA 1HEYA 1LLIA 2HQRA 3QEMA 4O5AA 1J56A 1XWWA 1RZSA 4E7PA 4OLBA 3ILYA 2Q5CA 1MB3A 2WJWA 2CROA 1L5YA 4L85A 5IUKC 4GNRA 5FWYB 3KS9A 4G0OA 2JVJA 4KZKA 5IULC 3OQMA 1A04A 4RK0A 1P8AA 3QK7A 2GI4A 3Q9SA 4RKQA 8ABPA 1LJUA 1NXOA 3CRNA 1PRUA 5A7LA 3RH0A 2L19A 2MYUA 4F3TA 1QMPA 2B1JA 5EWJA 1Y9QA 3EULA 4IMIB 5EWLA 5GQSA 4F12A 4JP1A 2M98A 1GUDA 3HUUA 3H5OA 2PPXA 2PUAA 1Z16A 2IYNA 4RS3A 1CEYA 1FFGA 2A9QA 5KC8A 1XHEA 5F64A 1F4VA 2RDMA 3QLTA 4QICA 4RY8A 4YS6A 1U2PA 3DZDA 3UK0A 1VRVA 4XASA 2MYNA 4N0PA 2VK2A 3GV0A 2IPLA 3O9XA 3EGCA 4MR7B 2P9HA 5IX8A 4MR9B 3C3WA 3H5LA 3HZIB 2FVYA 1VLZA 3FFTA 2ID9A 2MSKA 1P2FA 5FBKA 1JWLA 3K4HA 2IVBA 2AXVA 4NCBA 4WUTA 3QEMB 3M9XA 4EVSA 2PUFA 1M5TA 4JCXA 4KK4A 2JBAA 1EHCA 3HZHA 3KTOA 3NNDA 4G0ZA 4S04A 2NUBA 2H3HA 3T8YA 6ABPA 2A6CA 3HJFA 1AB5A 4JCYA 2A9RA 4CBVA 1R63A 3QLVA 3SAJA 2LYRA 5TQ0A 3T6KA 1NY5A
chains in the Genus database with same CATH superfamily
1X15A 2V1XA 5BN4A 3AY6A 3D3JA 2UUCB 3STUA 3JZAA 3SJZA 3GRFA 5ELLA 2CFTA 5KTRA 2FR0A 5AI4A 1H2AS 1ZXLA 4BNDB 1XTVA 2IYWA 4U1RA 2O8VA 1NWCA 1UOQA 1PP4A 4WCFC 5MGBA 2C8KA 4PG4A 3GNSA 3P9PA 2FMIA 4K9KA 1VB5A 1WXQA 3PHBE 1L0BA 2H2AA 4OHFA 3GEDA 5TGDA 3VVLA 3HO8A 4RV5A 6GPBA 1H42A 3MCUA 2X5NA 3PYMA 3E8XA 3EIOA 5HUJA 1VOTA 2ZSEA 2ERYA 2HHHB 1Z74A 1FTQA 1Y37A 2HCRA 4UCFA 3KAJA 2LGJA 2ZAYA 1JZSA 1KAHA 2ZLBA 3GMIA 3HE3A 1Z62A 5F9FA 3N0WA 4PLTA 2Q62A 4Y0NA 2AZXA 4KRXA 4UW9A 4O2BB 3BD6A 5LQSA 3AETA 4ZEMA 1UBUS 4IDOA 3EVBA 1UBEA 1F3LA 4TLDA 1MO3A 5FA5A 2OFFA 4G5SA 5EE1A 2ZT6A 5JXHA 1JE0A 4BNIA 1ISFA 4EVQA 2C9DA 3P9SA 2PD4A 2YRFA 1GTRA 2RI0A 4IILA 2XB6A 2VXYA 3RE1A 3R6LA 2V3WA 4R98A 4RL6A 4KI7A 1BHQ1 3LM8A 1JH9A 1I13A 2ADFA 3P0JA 1J1UA 3MTQA 2QT9A 4OHRA 4TLMB 2HSJA 3K9WA 4EUKA 3DL0A 1EEXB 1I0ZA 1OIWA 5L3ZA 1PKEA 3AHCA 3ESQA 4Q9DA 2H92A 2KYRA 5F12A 4R9VA 5B7PA 4JVNA 1DWKA 2GZMA 3O4JA 4G89A 5TPWA 1FX0A 3HNPA 3HR7A 3WK7A 3FOZA 1L7AA 1QK5A 2XODA 4S2UA 2AN3A 2CN1A 2QZ4A 4WGFA 5LWQA 2VUIB 3J81A 1NPTO 2NYUA 3E15A 5THQA 2GKSA 3VZCA 4CKEB 3BVPA 4L3VA 1GL6A 1PJZA 1Z6TA 3KIPA 3I1FA 4TMVA 2BKXA 2LXNA 4RTSA 4Q3AA 4B8ZA 1CIJA 3P52A 3RNLA 2WWHA 3R0VA 1XC7A 1HYQA 2C4TA 2F7SA 1VXRA 2I5PO 4V0QA 5KNDD 2C7OA 3MS4A 3U19A 2FFRA 2DH6A 3DKVA 4IYJA 4LDJA 4URUR 5EMMA 2HRZA 3R7WA 1D04A 2RGYA 2RIPA 2YDYA 3LK7A 2M32A 2I0FA 3QI7A 3RQIA 4OJNA 3WGUA 4Z7JA 2I1QA 2QI9C 3GLFB 1C1XB 3H9QA 3IVGA 4LGYA 3S99A 4DV1B 4EA9A 3HCOA 4U9HS 3PQ3A 3VX3A 4J0QA 4KO1S 3KO8A 4ZI5A 4GH5A 1DCKA 4QJ4A 3PCTA 4IEIA 2RGWA 1FPMA 1XZJA 2HAEA 3C3BA 3HY3A 3LQ4A 4F4IA 1NSTA 4RESA 1GADO 2XYGA 1PV2A 3PXDA 4HD8A 2O5CA 1W29A 3GFSA 3BH0A 3M6VA 2DT8A 1RHRA 2BFNA 4D8TA 4IG9A 2NXNA 4X65B 4DSNA 4JIMA 3V7FA 1XEWY 1DAIA 1JEAA 1FQOA 3CH5A 3N74A 3P45A 5AKEA 4TUYF 3GAFA 1KJ8A 4NPAA 1GVNB 2WJPA 1DCMA 2FJUA 2HPHA 5GIPE 2AJTA 1G3MA 4WLNA 1H9CA 3RS9A 4JLWA 4BC0A 1DAEA 2WJJA 3ORFA 2D0DA 4OVKA 4CWAA 4UXJA 4CTNA 2BLNA 4MINA 2BH2A 3ELBA 1X1EA 4G9BA 4D41A 1U8EA 2PLNA 5KJFA 3OKZA 4PAGA 5EZQA 1Q19A 4H7KA 3PQ8A 4FMBB 4GMHA 4NHEA 4WJLA 3D4BA 3R7LA 2H0RA 5JALA 3SE7A 3G0BA 2BI7A 3K35A 3RVJA 4XVRA 3DJFA 4V24A 3OIUA 4DC9A 3DV0A 1R27A 1E0JA 2P35A 2W6NA 3HS3A 1VG9B 1F20A 3V8QA 5CG1A 2D4HA 1AQLA 5FLYA 3PPYA 4CG3A 1JS1X 1YH3A 3OICA 2IV7A 1N4DA 2X0FA 1D4ZA 1ODSA 3JARB 1GGKA 1EINA 5CM2Z 1V5IA 4E33A 4QG7A 1MTZA 3MUOA 2RAVA 4I50B 1RDFA 2UZAA 2QZPA 3KJIA 4H31A 1P18A 2D1QA 2VLIA 2WK1A 5ED0A 4HZUB 4WN9B 2BCEA 4B0OA 5JSZB 2CXXA 3C5VA 1LX7A 2IITA 3VUFA 5FO0A 3QWHA 2AQIA 1Y3DE 3D8UA 3UWDA 3HY4A 4FX2A 4OH1A 5LNK6 1YOBA 4G4SP 1EK6A 1KI1A 4WKBA 5AHWA 1RFLA 2PWZA 2JKZA 4KMRA 1TFRA 3MTIA 3E22A 4R05A 4CLHA 2PRYA 4FXOA 4QREA 4W82A 2HSZA 2OB1A 2VJMA 1QO0D 2X76A 1G8HA 1A8IA 2J3DA 3CB4A 1HLFA 4AJIA 2BY4A 2QIPA 2JJ2A 4M1SA 1V8FA 3WYGA 4AKIA 1W88A 3EDCA 5HS6A 5KTTA 1TMOA 5C0OE 5B58C 2CMKA 3GUVA 2XXJA 1X1DA 4ZEOA 2FPUA 3R24A 1YR6A 2P67A 4HAVA 5F3RA 4ZCPA 4NR0A 1X3SA 2XGOA 2Q6VA 4KB5A 5M2QA 2K2QB 1U2DC 4P5DA 1J0DA 5B1DA 1SUFA 2EW8A 3K3PA 1JNXX 2OUIA 1T8YA 1UH5A 4P80A 4TV8F 2CV0A 1KQOA 1XP5A 3K70B 1KSGA 1NATA 3T95A 1FL9A 2WKPA 1WP9A 1QX4A 1KP2A 1TI7A 2E1PA 3AP2A 3TSWA 4DBZA 5C18A 4WLFA 1DO8A 3D0KA 2XRFA 3PNVA 1QKKA 4DDHA 2CNNA 3E7XA 5AK0A 5FH9A 1O2DA 3SIPA 2DR2A 1IN1A 1P7VA 1GPKA 4W4TA 2NO6A 3BIXA 4WXHA 2ZXEA 1M2JA 2VDKB 4CIVA 3NBAA 3TW4A 2CJYA 4QM7A 2CXOA 4Y1EA 3AIIA 3IT3A 3N5CA 5CT4A 4NNPA 5EWLB 2G6BA 1QKIA 2A0WA 1VIMA 2NU6B 1PLLA 4GLFA 5TF4A 1KE2A 4YN3A 3BXPA 3R1IA 4TXMA 1NP7A 1UMDA 1R9JA 2I2XB 2BJVA 1SIWA 1QLWA 3EA0A 2A35A 3A3NA 5BVHA 4FT4A 1R0BA 1VSBA 4WOKA 3VV2A 4YRZA 1SUDA 2QW1A 1XKXA 1CNMA 2V0CA 1ODFA 1DLIA 4G67A 2XMCA 1TTPB 1KRHA 3LXUX 1SA0A 3B3AA 4RV9A 1Q16A 1SM4A 3OPVA 4XQ0A 3IA7A 2G5TA 1OFUX 1EMDA 4KLAA 4W1RA 1UXCA 3MLBA 3TTSA 5LSAA 1ZH4A 5ALYA 4NC9A 4H27A 5DMHA 3CF0A 1MFQC 2JLBA 3KZKA 3NHZA 1ZOLA 4MR8A 3RT1A 3IAM6 4MARA 1RAIA 4PX2A 3WLIA 2HPVA 3H9GA 1B73A 1BCSB 3CEAA 4YBRA 1NUAA 1CE8A 3VC2A 5KQMA 3X1JA 5ALHA 3I92A 4GRIA 5KJEA 1BE6A 4X54A 3PHHA 1UKCA 4JP3A 3ZOKA 4EJ0A 4O1HA 5T41A 3A9XA 2GNPA 4OREX 3L07A 4B6SA 2L0XA 3IUNA 3H9BA 2WJAA 2A1IA 3OURA 1W94A 1X2LA 1RI2A 4L8GA 4MW4A 3ZI0A 1ELOA 4K6MA 3D6AA 5AKJA 3D3NA 2F4VB 2PAAA 2ZZNA 3DE1X 1GILA 2A4KA 4UM5A 5FULA 4PPGA 2B61A 3R76A 3EQZA 3ZE2B 4GM0A 1W5SA 3VNBA 3K8YA 4W8OA 2XR1A 2VQFB 5ALOA 3QXXA 4CKCB 3B51X 3VJKA 2BKUA 3OFNA 4L9WA 5KYXB 4P81A 1VPLA 3A0UA 3C1AA 3NNSA 4X84A 2OGSA 1JIVA 5FFNA 1G19A 5FPQA 4UHDA 3W5VA 3SLRA 5JWHA 3KQHA 1EG2A 4PZLA 3H97A 5IDXA 3VZBA 2JGEA 2MSNA 1PSZA 3PPIA 4FYJA 1M1NB 3OPXA 3NHJA 3SVZA 4F1WA 3W3AD 2O8BB 4XWTA 1HQDA 4DCCA 2FX3A 4D9BA 1XTKA 4GC5A 3NLLA 4F3NA 2Q0HA 4WY5A 2VS1A 3ECCA 4PCLA 4BX3A 3S8EA 1ZK1A 2G36A 2NPIA 2Z3VA 4RDCA 5K2MA 5TDHA 5FOQA 1EWKA 1FUYB 3WISA 4CW7A 3PIDA 1RJ9B 1U31A 4L4ZA 1P2DA 2H2DA 1RLTA 1VGVA 1G20B 1TDJA 2AMFA 4PC3A 5LQAA 5BSHA 2XADA 1NPYA 2R7KA 3PDUA 3NFRA 4YREA 4CQJA 5MN4A 1T24A 3G0IA 4CE6A 2F9FA 1CQJA 1J42A 2WF5A 1OW3B 3EQ6A 5D51S 5J23A 2P65A 2QU8A 3ZTTA 4ZVKA 5TPWB 2OCGA 2OCAA 4AX8A 1SBIA 2BGKA 2AZ4A 2HQ1A 3F47A 5K99A 4AP9A 2E4XA 2A9OA 4UUAA 4Q4AB 1G5IA 2ZDGA 3ZGLA 2JHCA 2MQKA 2A9PA 2RK6A 3NIGB 1X1SA 4PPNA 5ES4B 2WPNA 4M46A 1XDSA 1IU9A 2ZSAA 3GVIA 3B6ZA 3SOPA 3JQAD 1FDSA 4HZUA 2W2XA 3RJ5A 2ZULA 2JBWA 1F8YA 2JVIA 3TSYA 4NATA 1NUUA 4BS9A 4EJMA 1NQAO 1IHYA 5KYYA 4IQ8A 2R6ZA 1MHTA 3W1EA 2E4WA 1V8ZA 3NWOA 3QLUA 1PL8A 1FEZA 2HRRA 1OWPA 4DNPA 2ZI7A 3OOYA 4W5QA 5EMNA 3N7AA 4QQRA 3TKLA 3GYBA 4BGEA 2IC5A 4HNTA 1EVZA 1FRVA 1CHNA 2YFQA 1RM3A 5F78A 4CTKA 1P19A 1U1EA 4EJ2A 4RD1A 2OCLA 4WBSA 5DTJA 4DRZA 3OT4A 4QFDA 3DOJA 4ZI7F 1QOZA 1T3LA 2QN3A 3K20A 4YIHA 4ZJPA 2NTEA 5CVTA 4HQOA 4MR8B 2DY0A 3C3AA 3TZ6A 1LNSA 5FEMA 3SNHA 1JJVA 3A06A 1P81A 2YYAA 3IQWA 3E9NA 1UBGA 2QPAA 3OAAD 2C2OA 3H2KA 4BGDA 4YJHA 5FPKA 3M1LA 3P9ZA 3BWBA 2ISSD 4ZO7A 4D2IA 4EKYA 2XQGA 1UBKS 3AR6A 1W76A 1XAIA 4B6QA 1IY9A 4IV8A 3QQPA 1EK2A 3QVJA 1ZL0A 4CGYA 4ZKEA 1Y33E 5AK4A 1YQ9A 3G9UA 5DI9A 2GZDA 3PF9A 4O4IA 3D6NB 4RPGA 3DTVA 3TCKA 2VWGA 3VHXB 3JQCA 4YROA 5H3LA 1X92A 3DG9A 3ZIAA 3EXG2 4P22A 3KEQA 4EYGA 3FPAA 1XZCA 5IS2A 2E6KA 5AJTA 1MX1A 4KAJA 1KNXA 5JYDA 2OHGA 3S1AA 3ZHBA 4RJLA 4Z4GA 4HAOA 4C0QC 2GUGA 1TT7A 4B73A 5D5HA 1TQ4A 4YAJA 1XVUA 3RC2A 2VPXA 2OC4A 3RRYA 1ADFA 4P31A 1MIHA 1FFXB 1YXMA 4W9NC 5DRTA 4GIBA 1VL8A 4MQ5A 4WT7A 1RWVA 2JFBA 3PGKA 9LDBA 1MA3A 5F21A 2OHVA 3FPFA 5SYMA 4UTNA 1P4JA 2KBEA 1L6RA 2Q4DA 3COSA 1N6PA 1K5GA 4MUXA 4DQXA 4WA8A 3HP1A 3ROFA 1N34B 4UBIA 1WMDA 2Q7XA 1YACA 4D6PA 4EMBA 3NORA 1UBCA 3L40A 1LK7A 3OMTA 2VDLB 4KXQA 3R4VA 4M0UA 3MEJA 2HQRA 4YCDA 3EXHC 1A72A 3RSQA 4AZ3A 3OH8A 5D3QA 3D1LA 3OP1A 1TJ5A 1VECA 5JY1A 4OI4A 3N8GA 4U5QA 4GNRA 1H66A 3Q87B 4QYIA 1GTSA 1D9ZA 2DFDA 2OBFA 4D0RA 4ARSA 2XNSA 3O26A 4HYQA 3N8DA 3A7EA 1ZQ1A 2VVTA 2GI4A 3B1FA 4V0KA 2HY7A 3VGJA 4RKQA 4EPWA 4PSUA 1GQQA 4E88A 3AILA 3V9PA 1V4NA 3NCTA 3WMWA 1J22A 1Y9QA 3KUUA 4ZVPA 3FWPA 5CT5A 1HPLA 4OI2A 4YRIA 1JAZA 2D5AA 1MHPA 2YJZA 5CB0A 5HIMA 1RSZA 4HSGA 1Z5VA 2I1WA 4EP1A 3FPSA 1G98A 3SR4A 4IDQA 1EVQA 1U0HC 2XJ4A 5ALGA 5J1SB 1CQJB 2QNRA 4YS6A 3K32A 1J0BA 5AJYA 2J6CA 3GDHA 5TMDA 1WCV1 5F1PA 3UK0A 4CM1A 5JD4A 2OCDA 2Z56A 1T2VA 2HW8A 4JBHA 5HYVA 1Z5UA 2AOVA 1ZHFA 3PRJA 3UB3A 3HO6A 4Q7JB 3UK6A 5FBKA 3FBWA 3MUEA 2FA9A 3IEIA 1RU3A 3R2JA 1PGPA 1B0UA 3RWMB 3MB8A 1M1YE 2SICE 3GU3A 4EPYA 2ZM6B 5DW0A 2QUKA 1YNOA 4L9AA 3VR6D 1AMNA 2CNLA 3T8YA 2G0TA 5IT9A 1VB3A 3LX8A 4GOJA 1NVAA 4WKGA 4WLEA 4UJ5A 3H19A 1D2NA 1JSRA 1UMBA 3MJTA 2NAPA 2GO7A 1NUSA 3LC7O 1A5TA 1PWHA 2G9VA 2WMDA 4LHEA 4M98A 4PLPA 4WFJA 1NY5A 4F2DA 5ADWA 4HWTA 4AVYA 4HZIA 1I32A 1R50A 1CB0A 2B4QA 1NVEA 4NFLA 4RZXA 3WB1A 4KH0A 1I3KA 3HG7A 2NUAA 3W5BA 1POWA 3VAZA 2JLRA 5ARCA 1EZ4A 2P9JA 5KJCA 5KX5F 2PSDA 5LZ2A 1CEEA 3X1KA 1CP3A 2VA8A 3DP9A 3TUJC 4D9CA 4UNIA 4CUKA 3RM3A 2QNIA 2ZBEA 2L1PA 5D3KA 4TVSA 3IH5A 1ISHA 1FZQA 1GAEO 3F5DA 3HVJA 3VM6A 4OGWA 2MWMA 1YU6A 2NQTA 2V03A 1GAJA 3TW0A 3OIVA 4TYWA 2AH5A 2EWTA 1D6JA 5CVVA 3SF0A 1L8QA 1JQ3A 1L8OA 4EKEA 4DSOA 2AWOA 4HAZA 4PYIA 1JEQA 1SOVA 2XTJA 5IJAA 4QLOA 4Z4IA 1IUNA 2O8FA 1MABB 1P29A 1CG6A 1LPNA 2NTVA 2W37A 3UB4A 5BPFA 4D7AA 5J4LA 1LTKA 1K97A 1LF5A 2AXQA 3ST7A 4A91A 1L7XA 1L8XA 3Q3VA 4LJYA 4P84A 1XDDA 4PEVA 1L7QA 4TMKA 3A7DA 2ZAIA 3R0ZA 4JJ6A 1U0TA 2CL5A 2P90A 1ZY2A 4O4IF 4BE9A 3CZMA 2YFHA 1FCJA 2ESRA 3M4ZA 4LVNA 4BVKA 4M76B 5I9SA 3M6LA 3IHLA 2VHWA 5DE3A 5B7NA 3NOQA 1GG5A 3FVVA 3QTBA 1EM8A 1XA0A 3CBGA 4MPPA 5T8KC 3THXB 3UGKA 3SXUA 4KX5A 2A1TR 2VP0A 2IS1A 2VOEA 1V7QA 1OKKA 2F1JA 1G7TA 1EM6A 3NWPA 2GEDA 1YCHA 3VBCA 4M1QA 3KQLA 2NNLD 4OJQA 4DDMA 5E3IA 4CDMA 5KKCA 1YBMA 4R2JA 1KVTA 5BRNA 1QG0A 2EZ8A 4Q4HA 5DGTA 3OZTA 2GPSA 2HU5A 5ER6A 3W4JA 5BVGB 1DCTA 3BMCA 1P75A 2ZRPA 4G0MA 1L7NA 3KXLA 2CWDA 1LSOA 5KOJA 4IFTA 4IWYA 4UEQA 5J40A 1NVBA 1V7PC 4EKIA 2MMCA 3F6RA 5FX2A 4YDHB 1NXQA 2I7CA 4F5EA 5KQPA 1RLJA 4WW0A 4EUSA 4A15A 3LT5A 3HHPA 1AQNA 3DE2X 2JDIA 3ZCVA 2Q5QA 5JASA 4WUVA 1JG1A 3ENVA 4EHJA 2B99A 4BZPA 2P2DA 1DBSA 4MVCA 1UIRA 4MNTA 4RK6A 2V4MA 4U2CA 4FYKA 5CW1A 1FFWA 1SCUA 2EFHB 3TZCA 3WMEA 4QWMA 2GJ8A 2HFKA 1AO3A 3N2GA 3O5AA 1GZUA 4BU1A 4R2KA 5IM5A 3T9AA 2XLCA 2X6QA 4I6GA 2B7CA 4RPJA 1P5ZB 1V7ZA 1OVMA 4CEHB 1Z0KA 3KJZA 2D1TA 4PU3C 1YJBA 2AKYA 4IDGA 3CZ4A 5GM1A 4WA7A 4Q1EA 3V1TC 3VYUB 3BK1A 4OYRA 4KXVA 2G9RA 1QG6A 5IK2A 4CKBB 4RDHA 3CX7A 2FSSA 3HH8A 1VKRA 2DLNA 3L4EA 2XYQA 1HDXA 1Z8DA 3EC1A 3T1NA 3HKCB 4IIDA 2XTNA 1OZHA 1V9LA 4BNFA 1UFOA 3BGIA 4QTZA 1BE0A 4OBEA 2I2BA 1JP7A 2ZI3A 4RPIA 4EYSA 1NYRA 1XZNA 2B9VA 4YMHA 5CD1A 1ZIYA 2DB3A 2FJRA 2WM3A 3D4PA 4Q1AA 4U2GA 3E1SA 4B2IA 1AT1A 1Y3FE 5AVZA 1ADRA 1GLGA 1Y7IA 3CO0S 3PDJA 4X4DA 3FDZB 1H85A 1LSSA 4GBMA 3SG0A 2PMEA 3HU3A 1A76A 4YLYA 1VHLA 4YJ2B 1OZ0A 1KOGA 1EFHA 1Z12A 1FS4A 2PX8A 2K87A 4Z99A 1RHJA 4DJJA 5A6SA 5CDUA 3W5CA 3VWSA 1JZQA 1XD9A 1E2BA 2HSDA 4Y2HA 4BMXA 1UUFA 4KQ6A 1Q1QA 3NVDA 2BKLA 4P3OA 2XRYA 4NE2A 1EUDA 1PAUA 4YP9A 1RPEL 2ST1A 5ALJA 4M86A 1R37A 3D54D 4JXKA 4PFSA 4G1BA 1FVFA 3TLXA 3EMBA 5T4BA 2IS2A 5E6SB 1GQOA 4YJFA 3JX9A 4RIIA 3IPYA 4JA0A 3VNAA 1IY8A 3K15A 4EA7A 2FPWA 4LOKA 4L74A 1XNQB 3HR8A 2A2ZA 3WK4A 2UVPA 3GY0A 1XZKA 2BISA 5B57C 1GGVA 3U39A 4KL8S 5AK5A 3ZE1B 3TXXA 1XZMA 4RTKA 1ENZA 2HBYA 3H4VA 3LWZA 3ECAA 2J7WA 4GVXA 4JLNA 1M2WA 1OXBB 3OSUA 2P30A 2PUWA 2KWIA 3OWXA 2RGAA 4RMJA 2FPPB 4FYHA 5IJ9A 4G9GA 1NEQA 2WV7A 3TECE 2OBBA 3CVWA 2CCGA 2JL1A 2JGDA 3D64A 4LC9A 1LJ8A 4GE0A 3F2VA 2F55A 4TZ6A 2H11A 5FTLA 1V41E 2RARA 1V6SA 4OHZA 1JDTA 1QIHA 1RADA 1SWWA 1ZOSA 2FMXA 3C14C 4DIUA 1NLUA 3PQ2A 2X9VA 5EY5B 1LPSA 3IVAA 3ODGA 4CQNA 4AF8A 4FFMA 4LXIA 1XX6A 1XOIA 4PLFA 1ZOOA 1YTUA 3TAXA 4B76A 2HL6A 2V5UA 1GZ5A 4IVNA 3I01M 3CRZA 4N8DA 3P0HA 4FNOA 4TKLA 1M2EA 1EH5A 1ENOA 3M1IA 4EB6A 4ZZ3A 5B58T 1J2JA 2WZCA 1TLFA 1IZ8A 2YFYA 3L06A 4BV9A 2ZYRA 2AJLI 3HA7A 5AW0A 3WXMA 1KJJA 2IRWA 2CSFA 3AI2A 3GG2A 3I2HA 4M1OA 2FHSA 4PQEA 1ISMA 1F48A 3URKA 1KEWA 4D9FA 4DLXA 4UUQA 1K3TA 2GF2A 3JAWB 3F6BX 1SG6A 4DZTA 2UUOA 4NJMA 5G41A 1J2RA 3QVWA 1AUVA 3P9KA 3SQLA 2O14A 1CQXA 5C32A 3N1UA 1UBLS 3ZWQA 3ZU3A 1ZVVA 3EZ2A 3I05A 4EVIA 2OP1A 1SEPA 4CRWB 3SHQA 3C7KA 3ZWYA 3OSZA 4IXMA 4KQ1A 3AIKA 1KC3A 1CR1A 1Y3CE 3M9WA 2YIMA 3PC8A 3U17A 4DFDA 3NWBA 4QELA 1V95A 5DBHX 3U3MA 5H5JA 4B79A 1NF3A 1T26A 1O89A 2EQBA 4M7OA 4KBGA 1IXYA 1OA1A 1JH8A 1JR2A 1JDJA 1GU0A 2QR2A 3EHEA 1DEXA 3U31A 3TX2A 5C4IA 3QBEA 2AMLA 4AKGA 1IEVA 2B98A 2CZGA 2FSHA 2J41A 2QQEA 5JQGA 1ISJA 3K71B 4GGPA 4OL0A 2EX1A 2AR0A 2AN1A 1Z26A 4QYSA 5GTDA 5I7SA 4Z9AA 3FM9A 4Q7KA 1BKSB 1SU7A 2R85A 4U4AA 3VDQA 3W5DA 1D2MA 1G0OA 1NV9A 3EOZA 4E4YA 1ZVQA 2A0KA 2DQKA 5L8VA 1LSJA 3SHFA 2AFHB 4C3ZA 4Q18A 2BKVA 2PFGA 4RACA 5DLPA 3RC1A 3WWEA 2OFYA 2GPNA 2GM5A 3PXUA 3WGQA 1QU2A 3O3OB 2FEAA 2VXBA 4OQDA 1PFYA 4QOEA 2IYPA 4UFPA 4F93B 4ZTZB 4LVUA 4PYKA 4URWR 2R66A 3BJMA 2IUOA 2YJGA 5BMVF 5CITA 1SOAA 2XUFA 1Z83A 3TMAA 3BD9A 1ZZCA 4FMCB 2XKAA 3CGWA 2F8TA 1I1QB 2EGUA 1KYWA 1S9DA 3VKVA 1EUZA 1TJ4A 4MQEB 4B5KA 4QXOA 2IOFK 3G68A 4X8OA 3GRRA 1C9EA 4KACA 4IICA 2ZYIA 1H22A 2YFKA 1QORA 2ZPAA 3D2LA 2P7IA 3GWGA 2IPMA 4O4HF 3DE3X 4MUBA 2JAWA 4I6UA 4O4LA 3QEJA 4NRDA 4EYEA 4J3NA 2XXPA 3DZKA 4GAEA 3S2YA 4RWZA 4ENRA 2DQ4A 3JD0A 2B1IA 1BE1A 1IE3A 3HMKA 3OEHA 5LBIA 3RSOA 4BOYA 1AHHA 1M7HA 1V1JA 2N1MA 2XDQA 3FMPB 4KG7A 3OZIA 2A9KA 5KYYB 1YKFA 4BBZA 2PVCA 3A11A 1JA9A 5DX8A 1U7DA 4A26A 4P7BA 1A9YA 3PC4A 3OUZA 4BBPA 3Q2IA 4GR9A 4XYBA 1VKNA 4ZODA 1XNRB 2GEVA 4FU0A 2FN4A 4DUGD 4BMDA 2VTKA 5LQRA 4CIXA 3L8HA 4A3SA 5JY6A 3A4MA 2A0UA 1F2VA 2JAUA 4JUIA 2WNIA 4JDUA 1C1XA 5TJHA 3RC9A 2ECQA 2JH8A 4MVJG 5E8RA 4ZK6A 2R5WA 4MCXA 1KBOA 3VR2D 4V2IA 2RHHA 4LX8A 5CB4B 1DELA 2HMUA 3CCCA 5CB4A 3FTFA 4QXRA 1UPAA 2B4TO 2PXKA 1OH6A 4PF1A 2G8NA 3HXPA 2G83A 4YMIA 1V5GA 3GFVA 3RVKA 4F06A 1F7VA 4QVGA 4RCVA 1TVKB 4NBRA 1E1RA 4QPJC 1YL6A 2J5QA 2D8MA 1R0RE 4AJKA 1GQSA 2C59A 1VHDA 2EJCA 4HQFA 2GWRA 3TOVA 5DGIA 3Q88A 2B7BA 1CKEA 2VCYA 4D74A 5A02A 5AVRA 1W4CA 3WRWA 3BGVA 3AUKA 4KK3A 4C06A 1NM5C 2V6IA 4OM7A 3U7QA 4J1XA 1N3BA 2Y77A 3NHKA 4UQLA 4RK5A 3LHFA 2EIHA 2D59A 5CFZA 5TE9A 1RRGA 2IGTA 1ZICA 4JKYA 2PL3A 4LGCA 2C5BA 4F4DA 2BEUB 5JAHA 1C7RA 3EIUA 2XOXA 2X0DA 1CJVC 5CHYA 1Q0HA 3C3KA 3CTPA 3PUHA 1WUJS 5A3SA 3IV7A 1D0SA 4DCNA 1V6AA 3EJ6A 4X1KA 5C51B 5JCZA 2C3PA 5HS4A 2IHUA 4RKWA 4URXR 1K6MA 2FYTA 2RJOA 4P4GA 1H2WA 2FN9A 2OECA 3S2ZA 4DIBA 4QZVA 3VKFA 1KL7A 3TINA 1GG8A 3N9IA 3HTXA 4ALKA 1WHTB 4MYCA 1EA5A 4GXQA 1Y8AA 1UXJA 3I9NA 3OWOA 1WP4A 4B82A 2VWPA 1X80A 1O95D 2O50A 2DE0X 1A98A 4F11A 3UJBA 4DV6B 1NRIA 3LWDA 2YICA 2J30A 1QIEA 3TMYA 2EF0A 4Z5DA 1ND6A 2OXRA 5INTA 4ZHQF 4HWPA 3ONWA 2J9FB 2WHPB 2INGX 1LKZA 4L8YA 3FSGD 1GGEA 4FMCF 4GR5A 2V97A 1QVWA 2HQBA 2ZJ1A 5GGYA 1E1RD 1RQGA 2NN3C 3EGEA 3K2IA 4IL5A 5DBGA 4ITVA 1Y0BA 4ZU6X 5FOXA 4UPVA 1PEYA 2XMGA 4BJ6A 5AT1A 1OIVA 4RTJA 2VKTA 2WY2D 2Z43A 2R1VB 1X7YB 4GI7A 3QM1A 1TJ3A 5DNEA 2WKQA 4N4AA 1GCOA 3NBFA 4BNDA 4LZPA 1GL9B 4AG6A 1HF0A 1Z5OA 1FC0A 3AR8A 1NOIA 4PZUA 4QOIA 1NG9A 3ZJVA 2W2QA 3IIJA 4YRLA 2CUKA 1NW6A 3QG1A 3JXCL 1A8SA 4LK2A 3LQYA 4RVGA 2ONJA 1JLHA 3HABA 4P82A 4QULA 3RG2A 4YUWA 5HM6A 3RIHA 2QMOA 3BB1A 1ZIDA 4RA6B 4NU5A 3Q9UA 1NR1A 4EHKA 1FIUA 3IESA 5EWMA 2VQSA 1M75A 2PHZA 4M8LA 2NU8B 2GJ9A 2I3DA 2VK8A 3CPJB 3CTMA 1XTJA 4HMQA 5B12A 3FA2A 5BR7A 1GKIA 5M5BA 1J49A 2JJQA 3COWA 3DLTA 3SSAA 1L1RA 4I1SA 4R6XA 3W2IA 2LLWA 4N0EA 1U02A 3HCBA 2O3RA 3U3OA 3WY9A 1THZA 1V5FA 5SZJA 3PNYA 3TLJA 3X2SA 2M1XA 5BV0A 1E0SA 3HBMA 4NKRA 5JEDA 2A3NA 2G7MC 3F67A 3P2IA 5FWNA 2VHUA 1UBFA 3BL5A 1T3GA 1W88B 1UK6A 1IK6A 3NYWA 2EDCA 5AYVA 1BKYA 1E1CA 2WF7A 4GZ3A 3R20A 3VDXA 5AXAA 2NPOA 4ZCMA 1E9FA 4QJ5A 5ALFA 2OT3B 3KJFA 1Z6PA 2PWBA 3LDHA 1JDBB 4B3DA 1JDBC 3TIGA 4JBGA 3GB9A 1CUUA 2H65A 4NJOA 4ZQIA 2R62A 3L7JA 3NCHA 3TRDA 3LVQE 3V7WA 2UYGA 4L57A 5KCZA 1XHEA 4BNVA 3Q12A 3SQWA 1F4VA 3GVPA 1OGIA 4HK4A 1RIFA 3SBEA 4GMGA 1RAAA 3EIWA 4D9GA 1KOLA 2G5CA 1N6NA 2D7DA 3TNJA 3VNVA 4X20A 3AJEA 1NVVR 2AOUB 2X4DA 4B6RA 5K3OA 2QRHA 3BMNA 5LQDA 2XEXA 1FUIA 3PFIA 5K3SA 4DANA 3FPHA 2WWRA 4AZVA 3ICPA 3EXEA 4OQFA 1Q6ZA 1ZJZA 4UCWA 5J2TB 6REQB 4O29A 4I55F 3VNRA 1Y5RA 3NHRA 1HLDA 4YDRA 3ZU4A 3JR7A 5L53A 3R6TA 2GOYA 1V43A 2X8JA 2IUTA 3V3TA 1SC4A 2RGNC 3HA3A 3MJHA 2NXJA 2PXXA 1C3XA 4TVKA 2XMRA 5CXQA 1E1LA 1G8GA 2P8JA 2B1GA 1R4NB 5KYNA 1T4GA 4E5DA 1J8MF 1LXCA 1FSSA 2ZVDA 3MB5A 1G8JA 4P58A 2P77A 2HTFA 4EF5A 2EFGA 4ZHQB 4OQNA 2LNMA 4RLSA 3O82A 1GJRA 3MGKA 2I03A 1RVV1 4DA8A 4HF7A 2H1LA 5AOVA 2YJNA 2GK6A 1J4AA 1JR6A 4UBOA 2WEKA 3V8EA 3ZK8A 3R9XB 4PE5B 1O9HA 2BBWA 1CNEA 2XYVA 2O57A 4YXWA 4MR9A 1EGAA 2D1YA 3WLLA 4C5BA 4PN3A 4GT1A 3PGMA 1FLNA 1S2IA 4CMJA 3OOWA 1JQKA 2REOA 4EOGA 5BR4A 5A9SA 2O0KA 3TJMA 4ZVRA 2W6PA 3C85A 1G38A 1JQDA 2VUTA 2Q8QA 3WWYA 5IWAB 3HVRA 2GN8A 3OA2A 1PEKE 1IN5A 2IDMA 3N86A 3O3NB 4G4JA 4JLOA 4DV3B 4MCJA 5BO5A 1LGYA 5BUSA 2Y0PA 1H5UA 3S44A 2PGOA 1Q20A 3WLMA 1NFRA 1V96A 3X0DA 1NR5A 4NBSA 1CE8B 4FWTA 4EZIA 2AG8A 4RSGA 3TR5A 2GKGA 5AKKA 3L7CA 3ITKA 1JFSA 2C31A 2QVYX 4G5HA 3F6SA 4GZMA 3ZXYA 4M6WA 1N2ZA 1JTVA 1PJBA 3RU7A 5TMEA 4TLBA 1B4DA 1USUA 1KVUA 1E3OC 4ZEXA 5JEEA 2DXIA 5CEEA 3GZCA 5CFOA 5J2UF 1N77A 1VCMA 2Y66A 2PXUA 1GTZA 3CBQA 3DL7A 4YP1A 3D7MA 3DMFA 4MV7A 2XT9A 1L4NA 1QAOA 3N7UA 1TU4A 4BTEA 3ACBA 1CULC 4LOLA 5FL7D 3C5HA 3OAAA 2W8BA 2IEBA 2J6BA 5I9MA 2J08A 4GEKA 1SUSA 1IC8A 1GRNA 2XKKA 4ZU1X 1KQNA 3ZJYA 2Q8PA 2M6RA 4AJPA 3UYKA 3AVYA 1L5GB 1H93A 2X19A 2KEKA 3KWFA 1Q3TA 2J4FA 3I5YA 2L17A 4F5ZA 1NVDA 2WWGA 3I9V1 4JUAA 3D0QA 1RXWA 2O3SA 4OXNA 5ENDA 3EPHA 3GLIB 3KR2A 3QLVC 4E94A 4G26A 3L6BA 4JNCA 5JR3A 1JB9A 3QNUA 5JADA 2QA5A 4D98A 3AZPA 2QTNA 1OZFA 4MCAA 2EGGA 5DBFA 1LTQA 4CXMA 4J0DA 2HO4A 2VDPB 2D1FA 2ZPTX 4YG7B 2YNMA 3LAWA 1J33A 3JVVA 2P68A 3LF1A 3NHFA 3Q3EA 2QLMA 5IAOA 3ESXA 2WAYA 2JFNA 2Q6KA 2C42A 4FOSA 5DHAA 4RGYA 4ZTBA 2X4LA 2BEKA 2VR1A 3E03A 4GPIB 4N0QA 5EZ6B 4HDSA 3H9UA 3A36A 1X38A 5E3JA 2JRLA 3RVDA 4U0JA 5JD3A 1WV1A 3O2JA 4AZ3B 1PGNA 4KP7A 1IPEA 1Q84A 1Y8QA 2C9ZA 3ITDA 3K9CA 3KDAA 5AXBA 4AKTA 2BHRA 2HREA 4L4SA 4URZR 5J2TF 1NKSA 5KWSA 1RR6A 4Q3OA 3ADKA 3C3YA 1AHNA 3LF2A 4UFNA 1PL6A 4WEQA 5FLKA 3OCVA 1E3JA 1RRKA 3SCZA 1XPOA 2I91A 3VU0A 5DV9A 1QIDA 4DDVA 1EG7A 4YMTA 5KVQA 1GCUA 1DARA 1EGQA 3DAOA 3PE4A 4L27A 2L69A 5MHTA 3KD2A 4ITRC 3G9QA 1VG1A 4NEGA 2UYOA 3WWPA 2I9KA 4YRGA 1XN4A 2HNKA 4QTUB 1GL3A 3IE1A 3G0TA 2LCFA 3FHLA 4UE6A 4GYJA 2CUNA 4BO1A 3F1LA 2PUCA 1K5DA 2O1EA 3QE4A 4P33A 4X00A 3LXMA 3K96A 2HM7A 3SCFA 1D4AA 4C2TA 5KOIA 3NTLA 3JVIA 4ZVMA 3VFDA 2ZCVA 4CF5A 4KO3S 3JQ7B 2OCYC 3E5HA 4B3TB 2FZGA 4EG4A 3UNXA 3AUFA 1E9AA 2WIGA 2XUKA 2PKEA 2R5FA 2B8JA 1BX0A 3EGXA 3UKJA 3CLUC 2PV0A 1RYZA 2W2LD 1VPEA 2XF8A 2QG9A 3MC1A 3PS9A 4PSKA 3E1GA 1XJCA 3FKSA 2ACKA 4RF5A 2HIAA 3VUEA 1H6BA 1G7CA 1EZ1A 1P5JA 2BR4A 2F90A 3DMRA 4FWBA 5GONF 1AQ6A 2M6KA 3LK6A 3O9MA 3I32A 3AEUB 2FDXA 2WSBA 3PHJA 2XYHA 4HWRA 4K9RA 5LP6C 2Z58A 3IIEA 1E2UA 4RE5A 4UREA 3KQNA 3ZY3A 1B7GO 3G89A 4K3VA 5C8VA 1NFFA 4QGSA 1N2SA 3RT7A 1JR4A 2F8LA 1KFKB 2A0YA 3ZV3A 2HCJB 4M8NE 4AXBA 2DFNA 1FS6A 2V0GA 3KZ3A 1II8B 3UGTA 3ZLTA 1WVIA 4JJ7A 2C20A 3FOWA 2HCBA 3IPAA 3PWZA 4KLZA 1WB9A 3FDJA 4PG5A 1YE8A 5E38A 1R0KA 3I01A 3PG5A 5G4LA 2GFIA 3AUAA 2VIIA 1JR3E 121PA 2AMVA 5LD2B 1EVJA 3AL3A 2ID4A 4GLJA 4EABA 4MLDA 4JXZA 3RIYA 4ZI3A 2JG3A 4XXHA 1PT5A 2LP4Y 3GFRA 1N2BA 4JUFA 3IKMB 3G82C 3C97A 2I7VA 1HK7A 1ZM4A 4U02A 1AQIA 2H48A 4G1UC 2OV4A 3V42A 4M9SA 2OZPA 3ZD8A 5CYGA 2RGBA 2H57A 3A9TA 2EKBA 2WQ7A 4INJA 1F6BA 3IBTA 3ELDA 1DPGA 3T0IA 3WMGA 3B53X 4F3CA 5TNXA 4CPDA 1I2CA 3PJRA 5BNTA 5CURA 4EF6A 2K2WA 5FUXA 1Z4KA 2JCBA 2W2KA 4GOXA 4CIYA 1CDEA 2J3QA 4BEJA 4RX1A 3H11A 3THRA 5DTIA 3VR4D 3CG0A 3FLMA 3TIXB 2A14A 4DHEA 1X7YA 1U28C 3BRWA 1OCTC 5K4HA 1IZ0A 1A4UA 1CZRA 1W4AA 3U16A 3LOQA 4V3BA 1JIUA 3O8CA 4TTAA 3VC7A 1K5PA 3ILXA 3RK1A 1M0EA 3RHTA 3T5CA 2P6RA 3ZGZA 3GLGB 3N2KA 3CJTA 3PUWA 1OI2A 1QXSA 5FNZA 1LBSA 2JCYA 1KE1A 3SJAA 5AJVB 4CKWA 1LX6A 4LF4B 2BYTA 4X45A 1R8QA 2AN5A 2FUKA 5HA5A 4AROA 3JQEA 3UK2A 1EP3B 1PLJA 1QYRA 4HGZA 5DFAA 1AXGA 4OLFA 5KKNB 3GGCA 3H6KA 3ICVA 3QKTA 5E7JA 1LWOA 5KTKA 4MAAA 5LKAA 1CB7A 1WVMA 2PXBA 3T1VA 4CF6A 1JJAA 3E5NA 4XDGA 2WC1A 3CC8A 1ZGHA 3HFJA 3KTDA 4JBIA 3QXHA 3AERB 1XPRA 3I2IA 4EL0A 3KTAB 4FOLA 4OKIA 4XEUA 4CF7A 4K3UA 3VGPA 3RKRA 4ZVVA 1DAOA 4EGSA 3LHSA 1L4MA 4KDFA 4P93A 4MYTA 3LA8A 4WKCA 3KYCB 2QWXA 3CFYA 1CX9B 4RNCA 2QDXA 3PFKA 2IZ1A 2Y1CA 4L9SA 4B46A 3KSMA 4EENA 1WM1A 4ZP1A 1L4LA 1TT5A 2QNBA 3FJYA 4CT0A 3FFWA 3DEAA 3EPRA 4FCTA 2DULA 3S3TA 4AS2A 5HZMA 4R4JA 2XT0A 2LCVA 4B74A 4QD3A 1QR2A 2X8BA 1NAIA 1YHZA 1WX1A 1VJGA 5T3UA 2XECA 4J6EA 3PIIA 1MDBA 1AF7A 1G7RA 3R5FA 1IOWA 3FNEA 1BVUA 1TQ6A 3HDYA 4QDXA 5AKGA 4ECAA 1M6WA 1OA0A 5E4FA 1U3WA 3VR4A 2ZR8A 5IUJC 2YINC 5D1HA 1JALA 2HPAA 1T3ZA 3LMKA 3AI1A 1I2AA 4C4TA 4EBFA 3TD6A 1C9NA 2GHRA 3KZNA 5LYJA 2AW6A 1HLPA 1U8UA 2A84A 1TYCA 1E7WA 2B3DA 2ZRLA 4LTDA 4ER3A 4LTMA 3RYIA 4D6XA 4F2PA 4OBMA 2Q2VA 5DZSA 1D2GA 1DXOA 4RABA 4UE3S 5E7IA 1ZPQA 1OT3A 3KYDB 3OUTA 2F9LA 2ZWPA 4S1WA 5KX5A 1TMYA 1FUKA 1OC2A 4FR0A 4YX9A 5JIBA 3M1AA 4FSXA 1V8BA 3G1UA 3KRTA 3ZS9A 2IS6A 5DVZA 4R3UC 4AJEA 1HX7A 1PE0A 3C74A 3O1IC 1LVHA 3EUWA 3F6EX 1M0TA 1TLTA 3H9CA 4IDEA 1DC8A 2V4ZA 3CF2A 4FYIA 1S1MA 1OX4B 3U7IA 4AJLA 3K30A 4GMFA 2IUYA 1OHHD 4R3WA 5LZ5A 1FU4A 2WSLA 2HYDA 3M81A 3IUQA 3OLXA 3N8KA 4KOAA 1G63A 3IAAA 1UWLA 1Q1BA 3CH7A 4NCIA 3QFFA 4KVAA 3BA1A 1FFXA 2F1HA 4DXDA 1QYWA 3NJ4A 1GRQA 3NTQA 1E1DA 1S7EA 2LNDA 4OP3A 4FR2A 2CWWA 2CK3D 4EJSB 1EP1B 2QTZA 3ICWA 1ZW6A 2FJPA 4O2LA 4XDZA 1IOVA 3L7BA 1LCDA 3U7EB 4YXWD 2HV9A 4L1KA 3GI1A 4Z7OB 2DHEA 2PRZA 1CY7A 3RRMA 2DBVO 4BX8A 3I8OA 4U7DA 2JLXA 1IY0A 2O19A 3TTTA 4GVLA 4QUEA 2F48A 2V7PA 2C9CA 3L6DA 3I6YA 4JJ8A 5IYZF 2ANBA 3QPUA 2CDBA 2YQ5A 3LHKA 3G2HA 4LIPD 1CEXA 2EJWA 3CX4A 4YRFA 3RGWS 2IYXA 1JQAA 1JXQA 2JZNA 2WSMA 3X1MA 3W5AA 2IH5A 1PVOA 3AJRA 1XRJA 2XGMA 1P0MA 4KQJA 1JUDA 1KU6A 4OL9A 4LXQA 3H75A 2RBKA 2L42A 5CNJA 3G5GA 5CT9A 3DDOA 3D8NA 3MWEA 1NU6A 5K01A 4P34A 1GKLA 2BMFA 4Z59A 1Z3CA 3AEXA 1NKVA 1T4DA 3G2MA 4LXXA 4RHEA 5DNWA 4CM4A 3ACDA 4ACAA 3FDXA 4K8RB 3ND5A 3TGLA 4LHWA 3WYDA 1D5CA 1VHTA 2DZDA 2O4AA 2I8CA 4MW5A 4F7WA 1R5OA 1W8IA 4GF5A 1PR5A 1T6NA 3SX4A 4N3NA 3UB2A 4I5GA 2DTEA 4BDTA 3T0FA 3EZGA 3BSFA 3NATA 4PYQA 1E60A 4RF3A 5EAIA 3W79A 3X1ZA 4TSFD 4ZICA 4Z4EA 3NIFB 5E6UB 4Z2AA 4DLUA 1VL6A 1G3RA 3K0FB 3K5PA 1V7CA 5E6UA 1LNZA 4HATA 4JLMA 1JU3A 2G0AA 4TUYB 4U2KA 3ROKA 3U6KA 2BPOA 4ML3A 3DR3A 3C6KA 4X6UA 1HEUA 1T2UA 1PDVA 1XD2B 1Y98A 4AUNA 1EB9A 1UXKA 4ZJYA 3SMQA 1Y6QA 1B8PA 3AETB 5EC8A 1TLLA 2WJVA 1C4KA 3PJDA 3GJXC 2PY6A 1YWGO 4TN1A 1DKLA 1UKBA 4DMCA 2PTHA 5DNUA 1UAAA 3JAKB 4KR0A 1KH1A 4EYOA 4RHYA 5EJ5A 2X1HA 4R7TA 1E2DA 4Q3LA 3W7AA 5A3QA 3H5AA 2YS6A 5EYPB 5BSWA 5C5EA 3OA0A 2EEPA 4K81B 2GZRA 4CQLA 5LMCA 3IUMA 1IMOA 2WD7A 1BA3A 3J80A 1GZ4A 3L04A 3OT5A 3FDZA 2PZAA 3LT4A 5F3DA 2PLAA 3RYCB 2Q46A 3DW3X 3G0HA 2ZJ7A 1VDMA 2FGJA 2FRVA 5CA1F 4C76A 1LRJA 1Z5GA 4ZT2A 2EZUA 3W2EA 5JXJA 3VH2A 4RTRA 4OBWA 3G2LA 1THMA 4LY9A 1D9XA 2HC9A 2I8LA 4IEFB 4KQXA 5CVDA 5KYUB 5I9TA 2VYVA 1T25A 1E3IA 3T9DA 1GEGA 3AI3A 1P2VA 1HL3A 3WGOA 2FZCA 4RJTA 2NO4A 1FNMA 4Z7QB 3BMNB 5KPJA 2C94A 1ZOPA 1M7BA 4KAAA 2BONA 3EBOA 1MCZA 3KTFA 3FTQA 4EK9A 1JEJA 1BH2A 3CW2A 1CJBA 3HL0A 2CJFA 2HEGA 3KVRA 3YASA 3IT2A 5J4KA 3COZA 4DA7A 3T99A 3LLMA 4JEHA 2Z1NA 2ZDQA 4YK7A 1GAXA 2BMVA 4KE7A 2ZJOA 3ETCA 3SU8A 2HWKA 2D5CA 3CRNA 1KYYA 4LQDA 1WVGA 2WP8J 3NKVA 2ACWA 3NT5A 5EWJA 4ARUA 1LC3A 1X6VA 2I3AA 2OXCA 2W6OA 2O2GA 4NOMA 1IM5A 1AN9A 4YI5A 1DQPA 4CFYA 4F12A 3ZDAA 2IXAA 4HB4A 1UJNA 3NDPA 3OFVA 2I76A 3GZJA 3V7YA 4PC2A 1UZLA 3WRYA 4ROSA 4YASA 4XWWA 4N1AA 1CEYA 2N46A 1JJIA 2C5SA 3ZY6A 2C9OA 3U4DA 4P2BA 1TO2E 2G6TA 1N2GA 4HDNA 4RTMA 1QNFA 5L7WA 2PXVA 3DEJA 2B7LA 3V6LA 1GTVA 4B48A 4K6CA 3BSYA 2BHTA 1STOA 2FVYA 3D6UA 5IK2D 5HMLA 5ALVA 4MWDA 4L5CA 5BVGA 1FTYA 2BGNA 5HR5A 5C4MA 4JSYA 1LDNA 3ZCSA 1FZTA 4U2BA 2OPHA 5L40A 2RK3A 5JCJA 2X15A 5D6NA 2VL7A 5DOVA 4BNLA 4URHA 3PCXA 3O4VA 3KT8A 3VZRA 8ADHA 1VKOA 1W8DA 1Q1NA 4YNBA 5KSYA 2RHOA 2B25A 4FBMA 5F7XA 4JCYA 5JUWA 3FRJA 4GI1A 3LUPA 5BN5B 4BJ1A 3LQQA 2FUG1 2GEUA 1N5MA 4NCXA 1ZJYA 4PC6A 3VPAA 3ABZA 4WK0B 3WGZA 2QSUA 2OCXA 2XGJA 1X57A 4J0KA 4ZT5A 4P5PA 1FFBA 4Q7MB 3I8SA 4XGQA 1LVGA 1I10A 3OM0A 2ZJBA 2G76A 3RSSA 1XT6A 5TIIA 5FI3A 5DSTA 3OTQA 4M7PA 4BEWA 1HFJA 1PRVA 3Q10A 2HRDA 3OCYA 2EBYA 1KI2A 3FLEA 5COBA 5ESDA 2H4YA 1OC4A 2H51A 4QATA 4Z8XA 3M4NA 5KI6A 4EKDA 1V35A 4OIFA 2YASA 3E23A 4V0RA 5BQ3A 3U5TA 1MJNA 4ND1A 1KAEA 4EHDA 1M2GA 1T34A 2FPIA 2ZJ2A 3OFKA 3P97A 3QY0A 3RVQA 1JVNA 3KBBA 5P8WA 3W6OA 1GA4A 1SPXA 1DIHA 2PRKA 2BBTA 1DKNA 3EVCA 2W9XA 4URVR 3WAJA 1JFTA 1A7KA 1XWIA 3B78A 2EFJA 4UVGA 1RCFA 2VAMA 3GPCA 3A1NA 5LFAA 4LBYA 5EKXA 3ET4A 3WSWA 1TT5B 3OF2A 3OZBA 4MS3A 2YYYA 5I4KA 3UJ3X 5F7JA 3L8CA 5TEVA 1KZ9A 3N2KB 3PEYA 1C9YA 3G0GA 3NV7A 2E4UA 3DDHA 2BFDB 1ZNYA 2UKDA 2ADOA 3I5AA 2I4LA 4MRPA 4DJAA 4QX6A 4JBLA 5KC9A 4XCXA 2FUCA 4QUJA 3RANA 3W2HA 1WKBA 4C08A 1ZIOA 4YPFA 1BS9A 1JKFA 2M1ZA 1PFUA 1WSDA 1WZIA 1W87A 2JI9A 2P6MA 1KDPA 2QM3A 3AVPA 5CP8A 5E1OA 5CB4F 2BHSA 2J9YB 1RCUA 3E8MA 3I4LA 4LMRA 3RR2A 3ZZ0A 1F7UA 3E70C 1GGJA 1VE9A 4DA9A 1UZAA 3E35A 2DETA 4X4IA 2H06A 2XCUA 3JVDA 5TRTA 2QOEA 3MQ4A 4U9UA 2PH7A 1IFXA 4KE9A 1J25A 2IH4A 4RA6A 4A0RA 4WKPA 4F0JA 3QPAA 4UBKA 4NXMB 1H6CA 2IZZA 2OFPA 5ALEA 2PT7A 4UNQA 2EJTA 2R0QC 3KQQA 1WMSA 4F4HA 1W4LA 2QZSA 5BURA 1XEXB 1OBFO 1O94D 1QONA 1XEXA 3KUDA 4MP3A 1PS8A 1NV8A 2NV2B 1T3HA 5EQFA 3SIXA 4W5OA 2RKBA 5K20A 2C9MA 3P9YA 4KFRA 4OQMA 1UEIA 2NU9B 4EGFA 4YMVA 3U26A 5C1OA 3MWYW 2QMUA 2NT4A 1PZNA 2DCUA 2G70A 4GBGA 5FHQA 2F43B 4LY3A 1KZ6A 3LDUA 5FP0A 1JG7A 2EHJA 1RJ9A 2R47A 2AW3A 4E7OA 3GPLA 3H8VA 5I4IA 1QV9A 2VG8A 3W9YA 4M1ZA 1KAMA 3SOZA 3FYUC 3O95A 2FR1A 3RYFA 3RAPR 2JARA 3KLNA 1KH3A 1OV6A 1NXTA 3B1JA 4EELA 1NN5A 4HLUA 4J3JA 3QUCA 4N47A 4MLPA 5B1HA 3KWLA 3HO1A 2HU8A 4RF4A 2ZRMA 1DAMA 1V1RB 3FGNA 1ADCA 4UULA 4MW1A 5DNAA 3UW3A 4J16A 1T5DX 1Y6GA 1H0SA 1X2EA 5ALLA 5JYEA 1Z88A 2ZQ5A 1HWYA 3VR1A 3ZE9A 1FVHA 3Q8LA 3IEVA 1JFRA 2ZQYA 2HD4A 4TYPA 4DBLC 1K66A 1WPGA 2REBA 1PS9A 4X63A 4AC9A 1VBKA 5KKAA 4PYRA 4S1OA 2P4QA 3AR4A 1EGVB 1QTNA 2QDKA 1ZPDA 3QFCA 4QRDA 3T9FA 4F2HA 3O7WA 4N7BA 4RD2A 1SGWA 3TQQA 3QU4A 3KR0A 3AVTA 3BJIC 2FWJA 4KXWA 1OE0A 4FSHA 1ZSNA 3PVCA 4XDYA 2ZREA 2Q3DA 3AHDA 1WXEA 1NJ1A 2R6DA 3WS7A 4DCJA 3C24A 1K0UA 1BJKA 1XLTC 3TL3A 5IEJA 3GLFA 3MMXA 3KFVA 4MGKR 3C15C 1FJXA 3AUTA 4PIPA 2VSQA 4L5YA 1XMVA 1RBZA 2EFYA 2C77A 2JC3A 2WD9A 2BL4A 2GKOA 1XTSA 4R8MA 1DTSA 4D4MA 4N9QA 2PMFA 1MC8A 2QM0A 1FQKA 4HZGA 2PKCA 2QEQA 4PZAA 1D0IA 2FSFA 4W6QA 1J8DA 2ZYHA 1PR6A 3W9SA 5BVHB 2OYRA 3TW8B 2Z2IA 3T3PB 3B3FA 4QJ3A 2MSCB 3KVNA 3NHLA 4WNIA 5E1MA 3PLAE 2YHUA 2Q6TA 2HQOA 3C4JA 1JHMA 4RJ2A 4ESHA 1KK0A 5JH7A 4E3ZA 3EQ8A 4BX0A 3GJ0A 1G6OA 1YQDA 2JHPA 2VZ8A 4EWLA 2B5VA 2NP6A 1KDTA 2YVLA 3DNFA 3PEFA 3QF7A 1BHO1 3U7RA 4FHFA 1P4RA 2P9CA 5AKYA 2W6IA 1JF8A 6PFKA 3PE3A 5FWYA 2WTMA 3BERA 1QS0B 3JYQA 1LDBA 3N75A 2J31A 4HHEA 4MRVA 5FBLB 3WP0A 1E94E 1NLMA 3KEMA 3FVQA 4J0EA 1SVNA 1YZKA 3S2UA 4HSEA 4G2TA 2AD5A 2DFVA 4AO6A 4KN8A 3DHWC 2F1KA 5IKXA 1SO8A 3WNBA 3FPCA 1YJCA 3N39C 5CLLA 3KZVA 4H0CA 4ND7A 1PBNA 1UEXC 3AKYA 3EY9A 1RXIA 1P6XA 3LRPA 2XNHA 4N7JA 5EE5B 4DEVA 4ZOBA 5I45A 5D2CA 2O38A 1YDWA 2QD5A 3ASYA 3FPEA 2GD6A 2Z8YM 3LC1O 3VOSA 4EW3A 1MX9A 3O94A 5D3MB 4Q01A 1ZJ4A 2AYYA 4DYDA 1X87A 4NV0A 5JAUA 4LKRA 4NABA 2C3OA 2NXCA 2CLIB 4FNAA 3GA0A 2IX9A 4FEYA 5AKLA 5TQJA 4R1NA 4YBAA 4M22A 2I87A 3SHWA 2CDNA 3THWB 1EESA 2QQFA 3EWIA 1K7SN 1T2CA 4F6LA 5A2GA 4IHQA 3B6KA 4LFCB 2WJHA 2XD9A 3VAAA 1F1BA 1KDZA 3WGGA 2HEIA 4IKPA 1BCRA 3KJXA 4I6TA 2RGNA 4MWSA 5CJJA 4ZO8A 4EX7A 4NHOA 2VNSA 1NLFA 4QM6A 1PJ3A 4GX0A 3M6IA 4L72A 1YZYA 2QMZA 3LT2A 4JUCA 2PFSA 3GPBA 4YP5A 1HE1C 2GBIA 1G0NA 2XI8A 2Y76A 1J7KA 3B70A 3QA3E 4JSRA 4W1QA 3WNCA 2QMHA 2ICAA 4ARAA 4CU2A 1OREA 2ZB7A 3EVGA 3O0TA 1AQJA 1M2OB 2FFBA 3AL2A 4MUKA 2H4JA 2IGBA 1C1DB 1Z28A 2CJPA 4UM8B 1Z8HA 1RXEA 5KYGA 3AEUA 4RVSA 4EHHA 3R4CA 2VI5A 3VVBA 1UODA 4MCHA 3W8DA 3T3MB 3HB1A 1E9BA 3ZNNA 2GCNA 1CR0A 2GEBA 2RKWA 3EGDB 4JVLA 4X6LA 4YV0A 2GLXA 1CDDA 2AZDA 4NYJQ 3QEKA 1JWBB 5ALXA 2H9IA 4FKZA 4BZXA 4ZGGA 1W7AA 2ZBPA 4JR0A 5EHIA 4LYJA 4MYHA 2J59A 4OTZA 4D42A 3JQ8A 2CF5A 4FR5A 2ZIWB 3O4GA 3AF0A 4U2DA 3K72B 1T8UA 4BEVA 1EE2A 1F2UB 3HJGA 3KT3A 3TLKA 5J58A 4N5NA 1KRXA 6YASA 1C1HA 2QX9A 3ANNA 1HOXA 5IF9A 1RPZA 1XAJA 2Y0BA 1R4NA 1GP2A 3WHIA 4RA9A 2VJLA 2WOJA 3BDVA 3L0YA 4WNAB 1ZUHA 2N75A 4AY6A 2GSWA 3QVGB 3TBFA 1GIAA 2IPAB 3IP3A 3DGFC 5CCXA 1JDVA 3OD5A 1KMHB 2W2MA 3P2OA 1GNPA 4OQEA 1Y82A 1NLYA 1EIZA 4MUMA 1YS2X 3ELYA 4N7RA 4F9EA 5DHFA 5JI3E 3KB1A 5EE3A 1JHXA 1VG8A 5BSFA 2VZ0A 4Z0HO 2NUAB 3K2QA 3O2SB 3A1CA 3JQBA 4QGGA 4GP7A 4D80A 4B85A 2G25A 4A6PA 1N7JA 4AJ2A 4OAPA 2DKNA 3VKGA 1TW3A 3I9JA 1W96A 2VBFA 1TO6A 2CDAA 1KZ7B 4LHXA 3FYMA 1N0WA 3FKJA 5LYYA 5DSXA 2R6R1 5HFJA 1SJ9A 5F1YA 1ZS4A 3H2BA 1DIBA 4AIRA 2X6TA 2AIRA 1GO2A 5CIYA 3ABQB 4J1SA 2AKEA 1PR9A 2XQIA 4P3NA 4AJ4A 4CKWB 4PSVA 1ONNA 1U8XX 3FTPA 4IV5A 1TRKA 1GKKA 2PGAA 4Y8VA 4X8MA 4EG7A 4I5EA 1DDOA 3QVKA 2ORVA 4D8VA 5BR1A 1AS3A 1UADA 1VFNA 1N5DA 1TD9A 1E59A 5GJCA 3OIYA 1WF6A 1SHTX 4G1MB 3O8QA 2YWXA 2GESA 2GRMA 2V55B 4KKXB 5AK6A 3IO3A 1I3NA 2Z2XA 2UZ1A 2PV7A 3M4YA 3PL5A 3WHPA 1XCPA 3NDIA 1PERL 3C16C 3R41A 2RCYA 4KODA 4N3AA 2G9ZA 3FGOA 4Y9UA 3U3KA 2PXEA 1VGRA 4FXPA 7GPBA 3CNBA 2ZTUA 1TK9A 2CSXA 3JQ9C 2TMDA 4YCCA 5IARA 4AYTA 3EA4A 3LQKA 2EWVA 4AJJA 3FZGA 3G6WA 5EJAA 2HHJA 3LYAA 1C81A 1J9GA 5FUBA 3W7VA 2OV1A 3I2JA 3JPYA 4FD3A 4D5GA 1EHYA 2WVJA 4HCJA 4I3FA 1BHJA 3I1IA 3OTOB 3DMNA 1SQ8A 4L8LA 2A1UA 5SZHB 4DYHA 4EZEA 2X77A 2C98A 2VYCA 1QVAA 1W5TA 1MJHA 2WR8A 3MTAA 4ZMBA 3ZCPA 1E1NA 2WSYB 5KNCD 1KSFX 3N8NA 2PTGA 2GILA 2YXEA 4LZWA 3WLRA 3ZWNA 4UM9D 4IFBA 1IAQA 1ZD1A 3AB3A 2XMQA 3SHOA 1C3OA 5CT6A 2Q7DA 4Z7NB 5KYWA 4IJKA 4A2QA 1KI6B 1KR5A 2JEOA 3KUCA 2GUWA 3PVZA 2WVAA 1OT5A 2C61A 5HSGA 2FRXA 5AW6A 4C43A 1AHPA 3DV0B 5FOUA 3R3SA 2BCJQ 1QO9A 3U4HA 1YZFA 3DW1X 1X3LA 5HIAA 2QQ5A 3DZIA 3B12A 1SELA 1CYEA 4NX2A 4KFCA 4D4GA 4DLSA 1Y4DE 1A9SA 1PEAA 4X85A 1E3WB 5GVRA 1OR8A 1WMEA 2ZIEA 2H4XA 2FW0A 4BMVA 5EZSA 1CDZA 1VCOA 4TX1A 2JFFA 1PHPA 1QDLB 2ECFA 3LUBA 4HH3C 3AGPA 2BJWA 1M3SA 1VLHA 1BWSA 3OWHA 3JQRA 2VJQA 1BD4A 2XHZA 1PR1A 2W11A 3AHIA 3LUDA 4LVCA 5EHGA 1JKMA 2XCRB 4PPQA 2RAUA 3E8SA 1GQYA 3WTCA 1A95A 4EYKA 1PJQA 4OX9Y 5DTQA 3BWEA 1FNSA 1SAYA 1VL0A 4G41A 3VR0A 4DLNA 3R5TA 1QTRA 4DLLA 4CETA 1VSUA 2KSQA 4G4SO 1NNI1 2P9GA 4B84A 4E5KA 4H3SA 4DJFC 1TEVA 3MINA 5GAJA 2F3TA 2I65A 5EQJB 5HZGA 4RFSA 2DSTA 4RKEA 1ESNA 4HDCA 4B83A 2NVUB 3T0GA 1N2CE 3P1JA 4UJ3A 5CA1A 5AVSA 1YRLA 2NVUA 1EP9A 1GUZA 1Z6ZA 3BCSA 3FWHA 5JMPA 1QGDA 3U60B 2IUFA 3KSDO 3HN2A 3N2IA 1CR6A 5GVSA 3I1YA 3UT0A 1R0XA 2PYZA 2REQA 1IXSB 1CK4A 3K5HA 4HUQB 1FQJA 1HFEL 3H7IA 4FCWA 2JFVA 3DQQA 4FDTA 5SV2A 2PSEA 3BGDA 2ODNA 5EFZA 4HX5A 1Q7CA 1OU0A 3BIOA 3Q7QA 3Q3HA 4KITB 1MJGA 3D4IA 1NQUA 3PNBA 8ABPA 4FGJA 4CFZA 4DQLA 3LA6A 5CG2A 1TZKA 1R00A 4JNKA 1R0SA 1FVOA 3S2GA 3I34X 1BQEA 4I8IA 1UK8A 1N9ZA 3EB9A 3PFWO 4C0LA 4PLHA 5IM4A 1WW2A 5DLYA 5GAGi 2NWQA 3JYPA 5U1PA 2VUUA 3PC7A 1ZA2A 3QF4A 3HUUA 3H5OA 4PGHA 4X97A 4LFAB 4B3RB 3DEKA 2YQZA 4EGCB 4LECA 4YJGA 2R6JA 3AFOA 5F64A 1DUIA 2G09A 3AUXA 1U2PA 3DMYA 3LLVA 2FPOA 5F7ZA 3D7SA 4KN9S 3QUBA 1NF9A 3NHUA 2HMSA 1QU3A 3P20A 3WLOA 1LV8A 4WN9A 5JSZA 2FPMA 2W6ID 5ALKA 2GGSA 1HDCA 5HKBA 5JECA 3ID6C 4RADA 2VDUE 1IRIA 3T4EA 2C8LA 1SHUX 4JJZA 1W85B 3L1KA 4RCZA 3W06A 4WGGA 5BNZA 1AQYA 1U4SA 1AGPA 1TUEA 5EQTA 2EKLA 4TRRA 2W2NA 1EK5A 2J87A 2ZSUA 5E7MA 1W0JD 1A8QA 4EY7A 3DT9A 3GJQA 3F98A 1ZMRA 3RVPA 2VHQA 4RZIA 1VRCA 1B76A 1BROA 3WBKA 4UCXA 3WRYC 4I4TA 3CX6A 1O96A 4LPKA 1DJLA 1P3Y1 4FFWA 3QJGA 1AE1A 4OMCA 1ZHOA 4LYHA 2PUDA 1EFRA 4DMMA 4KHPB 1MQ8B 2ERCA 4NZPA 5CEFA 1NJ8A 1N2JA 5CLJA 1X1BA 1R6AA 5IAJA 4HV4A 4QGFA 2GXUA 1ACJA 4R69A 3U3JA 4C6HA 4DA6A 4EHIA 2I2CA 3ZDEA 3RVOA 2CYCA 4OXXA 3A32A 3BXFA 1HNNA 3ZBUA 1DWOA 1AKNA 1EJ2A 1M10A 3MUFA 4G24A 4DEYA 5DM1A 3G49A 2IU0A 4M0KA 1DEKA 1U9JA 3WIEA 3ZNPA 1CQIB 5A0TA 5A06A 5H59A 3UMCA 4JODA 5NLLA 3PFNA 1PL0A 1SU4A 3K70D 4CEHA 1RABA 2VYQA 3JCZA 4QKQA 2VXOA 1M2HA 4NP6A 1YOVB 2QJTA 4ARVA 3W5HA 4HTAA 1GZ6A 2Q2QA 5BPHA 3VSAA 1JIIA 2WSSD 1BYUA 3E4CA 5PNTA 2YXNA 3OIDA 5LP6B 3FZYA 5AI0A 4HAXA 3TEJA 3PEWA 2AXZA 4OGLA 1EVEA 2DP4E 4MI6A 2I7XA 3OMXA 2Q3JA 5DI3A 3NTUA 4A7PA 4Z3KA 1FP4A 1EUYA 3CQ9A 4HTFA 1L3CA 4DUGA 3BD8A 3M82A 3W34A 1DBRA 4H1UA 1GU7A 1RWOA 1S2LA 1T5LA 2JI8A 3AJ8A 4J2OA 3WLFA 1CF2O 1JJFA 2G8LA 4WK6A 4YCSA 1DMSA 5F35A 2J0VA 5IDYA 1GYQA 1KS9A 3HJUA 3MTEA 4LNUA 1KU0A 3C48A 2FMFA 2J3JA 4YRBA 1AY0A 2OBYA 1N1EA 3FTDA 1WTCA 5KS2A 2ES4A 4G23A 4WZAB 3QWGA 2FEXA 3ITNA 4TRMA 1YB4A 1Y63A 4XLTA 3WA7A 3DO6A 3I52A 3FUVA 4GEGA 3QP9A 1QUEA 1BDBA 2CJWA 4GGOA 4TTQA 3R7FA 3OQ1A 1Y7PA 3B6MA 3MZ0A 3HBNA 3DDSA 4YBZA 1EVYA 4PU4C 3HCRA 5ICCA 2QAGA 3JRWA 5IT0A 4D0GA 4ER6A 1FSFA 3M6FA 2PRIA 4R71A 5THXA 5BYJA 1Y8ZA 3KQSA 4N6NA 1D4OA 3OTWA 4R7GA 4KIFA 4H1TA 3R8FA 5KX5B 5HF5A 3HP4A 1ULZA 1NBWB 2FF5A 2TRSB 3OKFA 1JXAA 3AP3A 5JH7F 2E4YA 4IGKA 5I8WA 4BJ5A 3UMYA 1QGUB 5JTTA 5DBOA 4C30A 5DTRA 3WL4A 4NPCA 4JI8B 2W98A 2QYOA 1LEHA 2CUTA 4RZUA 5DIFA 3LYUA 1J0EA 4OH7A 4O02B 3S4YA 3PZRA 2ZRJA 2OLKA 3R3HA 1WY7A 3ZLUA 1EFKA 1QB2A 1S01A 3L4JA 4KRYA 5ENZA 1FF9A 1PO7A 4P4NA 1XMQB 4EQ6B 3Q3CA 1WBBA 1SULA 2O20A 4O63O 3GZNA 4C4AA 2E4ZA 3AI7A 3FNHA 1U5CA 3JSAA 1WAMA 2P5YA 3B9BA 3Q7SA 3M49A 2HTEA 2I1VB 1KERA 3BOSA 1RRMA 1FK8A 3L8EA 4GXRA 3WJ7A 1O95A 1CC1S 4ZZ2A 2W4QA 1JHUA 3SF8A 3PNQA 2V3CC 2ZKLA 3U9SA 5EIBD 1GKUB 3LQ1A 1WLSA 3NPMA 1RJEA 4KUEA 4IMPA 3ZY4A 2OXEA 3DMPA 2X8WA 3FTNA 4KYUA 3UJAA 4BPRA 1EXMA 3D7KA 3O8OA 4KUGA 1QH8A 5KZMB 3REQB 3FSJX 2C83A 4A0FA 3K5IA 1P1KA 1W1UA 3GA5A 2BP7A 4QTYA 2CCJA 1ZITA 1FU8A 3H2IA 2C97A 3A1DA 5TVGA 3V8MA 2PA0A 3DMTA 3QE3A 3Q7IA 3RD5A 1AMUA 4P4TA 4ADSG 3EF1A 4WZ6A 1UMKA 1VJ1A 4E2ZA 2Q5IA 5IJZA 3AR5A 4V0LA 5EVCA 1UZMA 3UICA 1U11A 1DHTA 2RH4A 3QPVA