2L1PA

Nmr solution structure of the n-terminal domain of dna-binding protein satb1 from homo sapiens: northeast structural genomics target hr4435b(179-250)
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
83
structure length
83
Chain Sequence
MGHHHHHHSHMLPPEQWSHTTVRNALKDLLKDMNQSSLAKECPLSQSMISSIVNSTYYANVSAAKCQEFGRWYKHFKKTKDMM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR solution structure of the N-terminal domain of DNA-binding protein SATB1 from Homo sapiens: Northeast Structural Genomics Target HR4435B(179-250)
rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords DNA-binding protein SATB1
total genus 18
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2010-08-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.70 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) 434 Repressor (Amino-terminal Domain) 2l1pA00
3NZLA 2L1PA 4Q2JA
chains in the Genus database with same CATH superfamily
3MLFA 3A9XA 2PPXA 1CJGA 5DSXA 2PUDA 1RIOA 2PXLA 4Y42A 2IUOA 4ER3A 1ZUGA 2PUCA 1ZZCA 5DRYA 4FN3A 2PXKA 1QZXA 2PXDA 3FMYA 3CECA 3OQMA 2PXQA 2L1PA 2XXAA 2AWIA 3G5GA 2PXBA 3G0TA 1ZZ8A 3EUSA 2J7UA 3NZLA 3RZZA 3ME5A 1OCTC 2GRMA 4GQMA 1ZVVA 5A7LA 2PUGA 1E3OC 3SX0A 2JCGA 1RZRD 3HZIB 2PUFA 1WIZA 2CSFA 1QB2A 2LYKA 3NDBB 2XI8A 1ZPQA 4X4GA 2FFHA 1PRUA 2LLVA 2EWTA 3TEPA 3OKZA 2O4AA 2XJ3A 1IC8A 3SR4A 3SCGA 1Y9QA 2EF8A 3GZDA 2WIUB 3QYXA 3BS3A 2JVLA 2ICPA 4IA8A 2R1JL 4YG1A 3SCHA 4O8BA 2OR1L 1OSLA 1ADRA 3VK0A 2PXPA 1ZS4A 1DWKA 2PUEA 2IVQA 4ER0A 4Z5DA 5DRTA 1JH9A 4WVLA 2YBDA 2LYRA 1VPWA 2LYPA 2HSGA 1DW9A 4OB4A 3OP9A 1HQ1A 4HRAA 4X4IA 1WETA 3GZDC 1YSEA 4FBIA 3DM5A 4ER7A 3JXBC 1SQ8A 2GZUA 3QWGA 1RZRA 3FYMA 4EZIA 4X4HA 4PU4C 1POUA 1UXCA 4IVZA 4YBAA 1QQAA 1ZZ7A 2HINA 2PXEA 2PXVA 4DE9A 1RZSA 4YG4A 1LCDA 4I8TA 4OBMA 1BDIA 2HCNA 4X4FA 3U3WA 3OMTA 2PE5A 3GN5A 1AU7A 1ZAYA 3A9YA 1UXDA 1BDHA 4DE8A 4JCYA 2LYJA 2XCJA 1WH6A 2IU7A 2LNMA 2XIUA 3LISA 3OQNA 3ZHMA 5DTMA 2EBYA 4X4DA 3QF3A 3IVPA 3VWSA 4X4EA 3BD1A 1UTXA 2O38A 3GN5B 1MFQC 4PU3C 2IVBA 4JCXA 2AXZA 2XXQA 2MEZA 3QOWA 1NW3A 1WH8A 1PNRA 5K98B 1LLIA 1JWLA 1PRAA 2MQKA 1U2ZA 1R69A 5DTQA 2PXTA 2H8RA 4MCXA 3H5TA 3JXCL 3ZPXA 3PXPA 3GUUA 4Z58A 3R1FA 1CQTA 1QPZA 4EK9A 2ICTA 3L1PA 3S8QA 2LYLA 2LYQA 3NXHA 3A9ZA 4ER6A 4YG7B 2MXDA 4JQDA 2J7WA 1LCCA 2PUBA 3G7DA 3GBFA 3F52A 4NDWA 4Z59A 2AXVA 2PXFA 4I6RA 4I6TA 2V3CC 3UWPA 1GT0C 2KPJA 4GHJA 3FYAA 2XXPA 2FJRA 3ZHIA 2LYSA 1JFTA 2O49A 4Z5HA 1QP4A 3F51A 3OWQA 5GAHi 4ER5A 2LCVA 1JFSA 2R63A 4EQZA 1XWRA 4MCTA 1QQBA 2VEOA 3QFIA 3OQOA 2L8NA 2JQEA 4PU7A 1EFAA 3QQ6A 2GRLA 3D1NI 3DNVB 2AUWA 1L1MA 4X4BA 5DTRA 3ZKCA 5JUWA 2D5VA 1NERA 3TELA 2BNMA 3M9LA 3KZ3A 3B7HA 4F8DA 1ZZ9A 1NEQA 1ZZ6A 1QP0A 2OFYA 2AXUA 3UFDA 4YARA 4PU8A 1R63A 4EKIA 1RPEL 3TFLA 2BJCA 3LFPA 3BDNA 4I6UA 3R09A 5DT2A 1O4XA 2IV1A 2BNOA 3O9XA 2AW6A 3KXAA 4EKGA 1QP7A 1DULA 2IVGA 3MEJA 3CLCA 3PE5A 3NROA 2PIJA 2KEJA 4Z5CA 1PRVA 3QOXA 3F6WA 2PUAA 3GZCA 2B5AA 2CROA 3KL4A 2M4HA 1LMB3 3KJXA 2KEKA 2WUSR 3LQXA 2HCSA 2KZ8A 1B0NA 4X4CA 2LLWA 3SCFA 3CROL 1X57A 4J1XA 2XSDC 4IWRA 2ODRD 1S7EA 2PXUA 1ZZBA 1Y7YA 1X2LA 4Q2JA 4J1WA 1PERL 5GAGi 2KEIA 3JXDL 2A6CA 1HF0A 2L49A 2BNNA 1LQCA 3TRBA 2HFZA
chains in the Genus database with same CATH topology
3M9LA 4EKGA 3A9XA 4DE8A 2L1PA 3OWQA 4ER5A 4ER0A 4Q2JA 5DSXA 2XXQA 3QOWA 5DRTA 2HCSA 4WVLA 1NW3A 2YBDA 4EK9A 2LNMA 4DE9A 3UWPA 3MEJA 3G0TA 2LLVA 3PE5A 3NROA 4OBMA 4EQZA 4ER3A 2J7UA 3NZLA 5DTMA 2HCNA 2LLWA 3ME5A 1U2ZA 3QOXA 4HRAA 3TEPA 3OKZA 5DTRA 3GZDC 5DRYA 2XXPA 4EKIA 5DTQA 3GZCA 4ER7A 3NXHA 3TFLA 3VWSA 5JUWA 3A9ZA 2VEOA 4ER6A 2MXDA 3SR4A 2J7WA 3QFIA 3ZPXA 2M4HA 4EZIA 3R09A 2ODRD 5DT2A 3GUUA 3A9YA 3GZDA 3TELA 3SX0A 2HFZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NZL A;  2L1P A;  4Q2J A; 
#chains in the Genus database with same CATH topology
 3MLF A;  3A9X A;  2PPX A;  1CJG A;  5DSX A;  2PUD A;  1RIO A;  2PXL A;  4Y42 A;  2IUO A;  4ER3 A;  1ZUG A;  2PUC A;  1ZZC A;  5DRY A;  4FN3 A;  2PXK A;  1QZX A;  2PXD A;  3FMY A;  3CEC A;  3OQM A;  2PXQ A;  2L1P A;  2XXA A;  2AWI A;  3G5G A;  2PXB A;  3G0T A;  1ZZ8 A;  3EUS A;  2J7U A;  3NZL A;  3RZZ A;  3ME5 A;  1OCT C;  2GRM A;  4GQM A;  1ZVV A;  5A7L A;  2PUG A;  1E3O C;  3SX0 A;  2JCG A;  1RZR D;  3HZI B;  2PUF A;  1WIZ A;  2CSF A;  1QB2 A;  2LYK A;  3NDB B;  2XI8 A;  1ZPQ A;  4X4G A;  2FFH A;  1PRU A;  2LLV A;  2EWT A;  3TEP A;  3OKZ A;  2O4A A;  2XJ3 A;  1IC8 A;  3SR4 A;  3SCG A;  1Y9Q A;  2EF8 A;  3GZD A;  2WIU B;  3QYX A;  3BS3 A;  2JVL A;  2ICP A;  4IA8 A;  2R1J L;  4YG1 A;  3SCH A;  4O8B A;  2OR1 L;  1OSL A;  1ADR A;  3VK0 A;  2PXP A;  1ZS4 A;  1DWK A;  2PUE A;  2IVQ A;  4ER0 A;  4Z5D A;  5DRT A;  1JH9 A;  4WVL A;  2YBD A;  2LYR A;  1VPW A;  2LYP A;  2HSG A;  1DW9 A;  4OB4 A;  3OP9 A;  1HQ1 A;  4HRA A;  4X4I A;  1WET A;  3GZD C;  1YSE A;  4FBI A;  3DM5 A;  4ER7 A;  3JXB C;  1SQ8 A;  2GZU A;  3QWG A;  1RZR A;  3FYM A;  4EZI A;  4X4H A;  4PU4 C;  1POU A;  1UXC A;  4IVZ A;  4YBA A;  1QQA A;  1ZZ7 A;  2HIN A;  2PXE A;  2PXV A;  4DE9 A;  1RZS A;  4YG4 A;  1LCD A;  4I8T A;  4OBM A;  1BDI A;  2HCN A;  4X4F A;  3U3W A;  3OMT A;  2PE5 A;  3GN5 A;  1AU7 A;  1ZAY A;  3A9Y A;  1UXD A;  1BDH A;  4DE8 A;  4JCY A;  2LYJ A;  2XCJ A;  1WH6 A;  2IU7 A;  2LNM A;  2XIU A;  3LIS A;  3OQN A;  3ZHM A;  5DTM A;  2EBY A;  4X4D A;  3QF3 A;  3IVP A;  3VWS A;  4X4E A;  3BD1 A;  1UTX A;  2O38 A;  3GN5 B;  1MFQ C;  4PU3 C;  2IVB A;  4JCX A;  2AXZ A;  2XXQ A;  2MEZ A;  3QOW A;  1NW3 A;  1WH8 A;  1PNR A;  5K98 B;  1LLI A;  1JWL A;  1PRA A;  2MQK A;  1U2Z A;  1R69 A;  5DTQ A;  2PXT A;  2H8R A;  4MCX A;  3H5T A;  3JXC L;  3ZPX A;  3PXP A;  3GUU A;  4Z58 A;  3R1F A;  1CQT A;  1QPZ A;  4EK9 A;  2ICT A;  3L1P A;  3S8Q A;  2LYL A;  2LYQ A;  3NXH A;  3A9Z A;  4ER6 A;  4YG7 B;  2MXD A;  4JQD A;  2J7W A;  1LCC A;  2PUB A;  3G7D A;  3GBF A;  3F52 A;  4NDW A;  4Z59 A;  2AXV A;  2PXF A;  4I6R A;  4I6T A;  2V3C C;  3UWP A;  1GT0 C;  2KPJ A;  4GHJ A;  3FYA A;  2XXP A;  2FJR A;  3ZHI A;  2LYS A;  1JFT A;  2O49 A;  4Z5H A;  1QP4 A;  3F51 A;  3OWQ A;  5GAH i;  4ER5 A;  2LCV A;  1JFS A;  2R63 A;  4EQZ A;  1XWR A;  4MCT A;  1QQB A;  2VEO A;  3QFI A;  3OQO A;  2L8N A;  2JQE A;  4PU7 A;  1EFA A;  3QQ6 A;  2GRL A;  3D1N I;  3DNV B;  2AUW A;  1L1M A;  4X4B A;  5DTR A;  3ZKC A;  5JUW A;  2D5V A;  1NER A;  3TEL A;  2BNM A;  3M9L A;  3KZ3 A;  3B7H A;  4F8D A;  1ZZ9 A;  1NEQ A;  1ZZ6 A;  1QP0 A;  2OFY A;  2AXU A;  3UFD A;  4YAR A;  4PU8 A;  1R63 A;  4EKI A;  1RPE L;  3TFL A;  2BJC A;  3LFP A;  3BDN A;  4I6U A;  3R09 A;  5DT2 A;  1O4X A;  2IV1 A;  2BNO A;  3O9X A;  2AW6 A;  3KXA A;  4EKG A;  1QP7 A;  1DUL A;  2IVG A;  3MEJ A;  3CLC A;  3PE5 A;  3NRO A;  2PIJ A;  2KEJ A;  4Z5C A;  1PRV A;  3QOX A;  3F6W A;  2PUA A;  3GZC A;  2B5A A;  2CRO A;  3KL4 A;  2M4H A;  1LMB 3;  3KJX A;  2KEK A;  2WUS R;  3LQX A;  2HCS A;  2KZ8 A;  1B0N A;  4X4C A;  2LLW A;  3SCF A;  3CRO L;  1X57 A;  4J1X A;  2XSD C;  4IWR A;  2ODR D;  1S7E A;  2PXU A;  1ZZB A;  1Y7Y A;  1X2L A;  4Q2J A;  4J1W A;  1PER L;  5GAG i;  2KEI A;  3JXD L;  2A6C A;  1HF0 A;  2L49 A;  2BNN A;  1LQC A;  3TRB A;  2HFZ A; 
#chains in the Genus database with same CATH homology
 3M9L A;  4EKG A;  3A9X A;  4DE8 A;  2L1P A;  3OWQ A;  4ER5 A;  4ER0 A;  4Q2J A;  5DSX A;  2XXQ A;  3QOW A;  5DRT A;  2HCS A;  4WVL A;  1NW3 A;  2YBD A;  4EK9 A;  2LNM A;  4DE9 A;  3UWP A;  3MEJ A;  3G0T A;  2LLV A;  3PE5 A;  3NRO A;  4OBM A;  4EQZ A;  4ER3 A;  2J7U A;  3NZL A;  5DTM A;  2HCN A;  2LLW A;  3ME5 A;  1U2Z A;  3QOX A;  4HRA A;  3TEP A;  3OKZ A;  5DTR A;  3GZD C;  5DRY A;  2XXP A;  4EKI A;  5DTQ A;  3GZC A;  4ER7 A;  3NXH A;  3TFL A;  3VWS A;  5JUW A;  3A9Z A;  2VEO A;  4ER6 A;  2MXD A;  3SR4 A;  2J7W A;  3QFI A;  3ZPX A;  2M4H A;  4EZI A;  3R09 A;  2ODR D;  5DT2 A;  3GUU A;  3A9Y A;  3GZD A;  3TEL A;  3SX0 A;  2HFZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...