4J1XA

Crystal structure of fe(ii)-hppe with alternative substrate (s)-1-hpp
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
193
structure length
193
Chain Sequence
TASTGFAELLKDRREQVKMDHAALASLLGETPETVAAWENGEGGELTLTQLGRIAHVLGTSIGALTPPAGNDLDDGVIIQMPDERPILKGVRDNVDYYVYNCLVRTKRAPSLVPLVVDVLTDNPDDAKFNSGHAGNEFLFVLEGEIHMKWGDKENPKEALLPTGASMFVEEHVPHAFTAAKGTGSAKLIAVNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Epoxidase
publication title Mechanistic studies of an unprecedented enzyme-catalysed 1,2-phosphono-migration reaction.
pubmed doi rcsb
source organism Streptomyces wedmorensis
total genus 48
structure length 193
sequence length 193
chains with identical sequence B, C
ec nomenclature ec 1.11.1.23: (S)-2-hydroxypropylphosphonic acid epoxidase.
pdb deposition date 2013-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 4j1xA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4j1xA02
3B7HA 1O3QA 1WH6A 1IPJA 3FHIB 2Z2SB 3LA2A 4ORFA 5J7MA 1DZTA 3G5GA 3CLCA 3SCFA 3OD0A 3CJXA 1Y9QA 1QP4A 4Q29A 2OZJA 4D7SA 4QXKA 4YYOA 3ZDSA 1U12A 2FJRA 3GN5A 2EVXA 4IEZA 1PM7A 1CAXB 2OZ6A 2ETEA 2PAEA 3IIAA 2IXHA 3WW2A 4Q0PA 5BY5A 4FN3A 4I09A 2B5HA 4J1XA 4Z5CA 3PVBB 4GHJA 4X4HA 2JCGA 3IWZA 1HW5A 1NERA 2BEOA 2OR1L 1WGPA 1VPWA 3FZ3A 2CV6A 1XE8A 4I6TA 2PFWA 4AXOA 4XFIA 4META 2Q30A 4I8TA 1LB2A 2EAAA 4PIXA 1QP0A 3O14A 2PTMA 2JVLA 1DGRA 5AVPA 2LCVA 3E5UA 3H7YA 5LRRA 1ZRCA 3M3IA 1Q3EA 4I2OA 5I0TA 2CGPA 2PHDA 3FJSA 2CAUA 4XF0A 3RZZA 2IXIA 1J58A 4GULA 3O9XA 3OTFA 1EPZA 3SHRA 2IU7A 2VQAA 3MLFA 3PXPA 2VPVA 2K9ZA 4KU7A 4JVAA 1G6NA 4HSLA 3ES4A 1PNRA 3PLQA 4JTNA 4O8BA 3F51A 2D5HA 5KHJA 1ZZ8A 2MHFA 3FFQA 2Q1ZB 4I02A 3UKTA 1WA4A 1J59A 3CL1A 3LWCA 2B5AA 1NE6A 4MX3A 1J3QA 1ZS4A 1ZREA 4YG4A 2BNNA 2KEKA 1ZVVA 3D0JA 5LRSA 4PU3C 3RYPA 1YUDA 1BDHA 2UY9A 4MGKE 1GQHA 5I0UA 2O4AA 3R1FA 3FX3A 2QDRA 1OI6A 4MCTA 4IEOA 3QWGA 2O49A 4MZUA 3BPZA 4X6RB 4XFFA 1WIZA 1ZX5A 1UD1A 4AVCA 3B02A 1JFSA 1LMB3 2AWIA 4I0BA 5C6CA 5I91A 4Q0SA 1WLTA 1UIKA 1BDIA 2GH2A 2K0GA 3I54A 4AQ6A 5J48A 3BS3A 2IXCA 1PRAA 4F8DA 4FT8A 4O9GA 3MYXA 3JXDL 2LYJA 4XEZA 2EF8A 3H7JA 2D40A 4QGMA 1WETA 1O3RA 2PIJA 1SEFA 2D93A 2XL9A 3CLPA 4X4CA 4IEVA 2AXVA 2ZKLA 1YHFA 2EA7A 4I6UA 5I8YA 3HZIB 3HT1A 3EBRA 3H50A 3U11A 3D1NI 4DINB 3E6CC 1QXJA 2GRMA 1QY4A 3FMYA 1ZZ7A 1YFYA 3H1MA 4EWAA 3GYDA 2IC1A 1CGPA 1PRVA 3E97A 1ZZBA 3OGJA 3E6BA 1X7NA 5A7LA 3D82A 2GC0A 4LA2A 2KXLA 3UKVA 1POUA 2KEIA 4QMAA 4JQDA 4IA8A 2ICTA 2E9QA 3DN7A 2GZUA 1CAUB 1QWRA 1RTVA 2XKOA 3U10A 2AW6A 1E3OC 4YBAA 3F6WA 4MV2A 2IUOA 1CJGA 1O4TA 1ZAYA 1QQAA 1Y3TA 1RUOA 3ST7A 2LYPA 1JWLA 4R52A 3KCCA 4X4FA 3OF1A 4Z07A 3LFPA 2PUAA 4O9EA 2GZWA 3DL3A 3LAGA 1QQBA 4NVPA 5K98B 3QYXA 1RZRA 1L1MA 2OFYA 4IEWA 3H8UA 4JTOA 4JV4A 4HZFA 1ZVFA 5KHIA 1CAWB 2AXZA 4FAHA 2IVBA 1J3RA 3RDIA 1O3SA 1RUNA 3LA3A 3MDPA 3I59B 2H6CA 3FYAA 3H5TA 3S7IA 1LRHA 5K8SA 1RPEL 5T3NA 4IERA 4ZU4A 4E2QA 3IBMA 4YARA 4E2SA 3LA7A 2OYZA 4X4EA 4KL1A 2AXUA 2PE5A 5EFUA 3LISA 4N9IA 2BNMA 3CF6E 2A6CA 2MPFA 2PAKA 2XLFA 3EUSA 5KHKA 3G7DA 4I6RA 3E5QA 3H9AA 2BJCA 3KZ3A 1ZUGA 1WH8A 1X57A 5FPXA 4MGYE 2L49A 2WFPA 1RIOA 1X82A 3BD1A 3BU7A 3EO6A 3NKTA 5J3UA 5I0RA 4N9HA 5I93A 3MPBA 4PU4C 4Z59A 1I5ZA 4KWJA 1YFUA 2PUGA 1NXMA 3OCPA 3KMHA 4I0AA 4X6QB 4E2GA 3SCGA 2LYKA 5BXXA 1HF0A 2F4PA 2PPXA 1YWKA 1RC6A 4LUMA 3RNSA 1JUHA 3N4MA 3EJKA 4ZU5A 1SQ4A 1NEQA 2GAUA 3BALA 5JSOA 4KWKA 2KZ8A 3IVPA 1Y7YA 1JFTA 2KPJA 1AU7A 3KJXA 1PMIA 5BV6A 5FLIA 4JCYA 2HINA 4F7ZA 1CAUA 1OMIA 4AQ2A 2PQQA 2MEZA 3ROUA 3HIFA 3I7DA 4IEXA 1ZZ6A 1QP7A 4FBFA 2Z69A 4KU8A 1J3PA 3QOPA 4UXAA 4WZCA 1EP0A 1SQ8A 2PUCA 2XLGA 2XKPA 5JSPA 2C0ZA 1UIJA 4EWEA 1J1LA 4GQMA 1Q43A 2XIUA 3NJZA 4XFGA 1XWRA 2N7GA 3DV8A 4IEUA 4CYDA 2H8RA 1R69A 4Z5DA 4XF1A 3MZHA 1L3JA 3WW4A 2QVSB 1VJ2A 1GT0C 4ONUA 2ET7A 1UTXA 1CAWA 4TLFA 2QCSB 2CROA 2I45A 5HI0A 3I59A 1CAXA 1UXDA 5CADA 1B0NA 2PUEA 1Q5OA 4IETA 4HN0A 4AVAA 5KBFA 2R63A 2XSDC 1YFWA 3SMHA 5JAXA 1OFNA 2XJ3A 3FYMA 1OSLA 4UBGA 2O38A 2FMYA 2WUSR 2OA2A 3CO2A 1X2LA 3ACLA 2CAVA 4XFBA 4LUKA 1ADRA 4EV0A 5I0SA 4HLTA 3OQNA 2PYTA 5FDBA 5I8TA 3JXCL 5LEKA 4NDWA 4OFGA 4BIFA 3BDNA 1DWKA 1O5LA 2GC2A 5EZWA 4PJYA 2B9UA 3H1YA 1ZNPA 4OB4A 4YG7B 1EYBA 2PHLA 1V70A 2LYQA 3NVCA 3QACA 4HSJA 5C8WA 5FQ0B 5F1RA 3TNQA 4HVQA 5JCTA 2AUWA 4AVBA 4D7TA 3RYRA 2BNOA 3UKNA 2EBYA 2UY8A 1O4XA 2D5FA 4WVZA 2ZCWA 3S7EA 1LCCA 3QF3A 3SCHA 1X8EA 2GU9A 3KGLA 2WIUB 2PUFA 4J1WA 1CAVB 1H1MA 3NSTA 4IEPA 4QX5A 2QJVA 5LEJA 4YG1A 4XFCA 3USSA 1OD5A 1NZCA 1XRUA 2BGCA 3OQOA 3S0MA 2O1QA 4Q0UA 4OLLA 2L8NA 3TNPB 1UXCA 2FQPA 2IVGA 4Z82A 2H0VA 4MGZE 3ELNA 4HVRA 2UYAA 2XCJA 3TRBA 3FWEA 1RL3A 2LYLA 1X8MA 1GQGA 3NL1A 3U3WA 3JZVA 4Q0QA 1LQCA 3L2HA 3QQ6A 3S8QA 1R63A 2XL7A 1VR3A 4L11A 3LZZA 1JH9A 1DGWA 1DW9A 3CECA 3CEWA 3H1WA 4BH9A 2Q4SA 5D1IA 5BPXA 4A2UA 2HSGA 3OP9A 4UBHA 4MH0E 4HVOA 4IEYA 2WC2A 2GC1A 1CQTA 4LTAA 1ZZ9A 4IESA 4PU7A 3R6SA 1O3TA 3WW1A 2ATFA 4RD7A 4QGLA 3HT2A 2O8QA 2IV1A 3C3VA 3BB6A 1YSEA 4IVZA 1OCTC 3RYKA 2HKXA 4X4IA 3OQMA 2R1JL 1FXZA 4K8FA 4PIZA 1VP6A 5E16A 3KGZA 4LA3A 2P17A 3L1PA 3IDBB 4HN1A 1IPKA 2EWTA 1ZZCA 4FAGA 2VECA 4Q0VA 2IVQA 1FT9A 1LKNA 1EFAA 1I6XA 4B29A 2H6BA 1RZRD 4X4DA 1CX4A 4MCXA 4Y42A 5I8SA 4XFHA 4ZU7A 1NYWA 4XF3A 4HBNA 2MQKA 4LEJA 2LYSA 1PERL 2OPKA 4X4GA 2QNKA 5FLJA 4MUVA 1H1IA 5FQ0A 2GRLA 2PA7A 4EWDA 4X4BA 3GN5B 1DZRA 4XFAA 3ETQA 3ES1A 5CVRA 3GBFA 4XF4A 3EHKA 4IEQA 4BHPA 2B8MA 2UYBA 3SXWA 4PU8A 4Z5HA 3OMTA 2XGXA 3JXBC 2XHKA 4QM9A 1CAVA 1LR5A 4YNIA 1RGSA 3UFDA 5FPZA 5JR7B 1UPIA 1UCXA 2HJIA 1ZRFA 2BYVE 3E6DA 2CSFA 3H3UA 2PUDA 2IXLA 1QPZA 4P9GA 3FE5A 4EROA 2DCTA 1S7EA 3RPQA 1YLLA 2PAMA 1LLIA 4I3PA 4PIYA 4YRDA 4WBBA 3VK0A 2PUBA 1QXRA 1YFXA 4R8HA 3WW3A 2ET1A 4XETA 5BUVA 3KSCA 4I01A 5E1RA 3CROL 5KHHA 3U0ZA 1UW8A 1ZRRA 3EQEA 4MGIE 4KWLA 3LOIA 3ZKCA 3H3ZA 2XI8A 5FLHA 3PNAA 1SFNA 4H7LA 4FBIA 2IXKA 4HMZA 1ZPQA 3F52A 4L2NA 1LCDA 3HQXA 1XE7A 4LULA 3KXAA 3DNVB 2V09A 1O5UA 2D5VA 3M70A 3VHRA 5CU1A 3ZHIA 3BCWA 3NW4A 2IXJA 4XF9A 1IC8A 1ZRDA 1FI2A 2LYRA 1PRUA 1TQ5A 1NE4A 4BYYA 3D0SA 5KHGA 4YSFA 1EY2A 3DKWA 3ZHMA 4JCXA 4IWRA 3E5XA 1O7FA 4QGNA 4LLOA 2ICPA 4F8AA 2KEJA 2Q0AA 4QM8A 4Z58A 5JSRA 2GC3A 1RZSA 2Y0OA 2MNGA 3IDCB 5FCCA 2XLAA
chains in the Genus database with same CATH superfamily
2WNVC 1WH6A 5IVFA 4NHXA 3ILRA 1PO11 1DQ4A 5FPXA 4W8JA 1DLLA 5J7MA 3LEGA 2XDVA 3BI3A 4CRQA 4XTMA 2JWPA 3VDDB 3ZX7A 3ZDSA 1QJY1 1U12A 5DXDA 2EXIA 1UYPA 2DV9A 1IS5A 3TWIA 2R16A 5A32B 1S1AA 1CAXB 3I2OA 3WCRA 3UETA 2ETEA 1H0BA 1F2NA 4IW3A 4LHKA 2Q1MA 2EICA 3SISA 4IV3C 4TXWA 3VBUC 4J1XA 4AHWA 4M3CA 1QJFA 1GNYA 2A70A 1NERA 1D4M2 1WGPA 1VPWA 1ULFA 3AKRA 1D0HA 1D2SA 3SITA 1W9FA 4I8TA 2P4EA 2EAAA 1HRI2 1F31A 5AVPA 1ND2A 2XJSA 3H7YA 2OIIA 1A6CA 2WS93 4RS5C 5C4WB 3HMYA 1HIXA 3TEPA 4DS0A 2AEZA 2ZGQA 3FMGA 3BVCA 1JU3A 4YVWA 2Y64A 5B2GB 4UT5A 5DDJ3 1HB1A 4NPLA 3PUSA 3J26N 1GP6A 3ZYGA 4DQAA 2VQAA 2FDFA 3PVOA 2VZSA 4CU6A 3PXPA 1B35B 2K9ZA 4OUSA 4QDSA 5F6LB 4B4QA 2HWB3 3ZFFC 3ES4A 4LK6A 4PLNA 5DTRA 3N7KA 3IDAA 4P5YA 3NWKA 1EUTA 5KHJA 1RUG3 1ZZ8A 1KD7A 5A7WB 4CP1A 4P9WA 2Y6GA 1W3XA 2ZAAA 2ZXQA 1JZ6A 3OPWA 4FFFA 1DG6A 1H1AA 5C5TA 3LWCA 1VLNA 1W8NA 1NE6A 4HL0A 2X05A 2JE7A 2WUHA 2D98A 4AEDC 2KEKA 3D0JA 1KEXA 5FPAA 4Q4Y2 1YUDA 4MGKE 3VBRA 5AC92 1VRBA 3FX3A 5FBJA 1S55A 2PXTA 4S2GA 4YVSC 3VZJA 5FJHA 5JZGA 4QPIA 3TEYA 3QWGA 5FK8A 2O49A 4AVCA 4XFFA 1WIZA 1UD1A 3B02A 1JFSA 1LMB3 1UZYA 1S0DA 2RS11 3D3AA 4I0BA 4AEJA 5CEHA 5I91A 1JW6A 3OEAA 1SLIA 4Q0SA 3I3MA 1UIKA 1BDIA 2HH9A 3JCIA 3KLSA 4SBVA 5FY7A 1G7YA 1LCLA 1MZFA 3UJOA 1NQDA 2VZVA 3N9PA 4DXRA 5GZDA 4F8DA 4QX7A 3JD72 4K3UA 2QQIA 3MYXA 1XSRA 1UY1A 1VB4A 4O9GA 3ZFEC 2F17A 4IXLA 2HWE2 5BNPA 1NG0A 1UU4A 4XEZA 1JOBA 4MHUA 2D40A 2PLV3 4OI4A 4YG3A 4QGMA 5JDBA 4XIKA 1NZIA 3JBG3 3HOBA 4CCMA 4YZ5A 2AXVA 3OBRA 3ON7A 1YHFA 5GZCA 1D7PM 5FKBA 4I6UA 2LRPA 4JCKA 3SEEA 4ARYA 3HZIB 4Q8LA 2VZRA 3O1SA 4DINB 1NQJA 3OG2A 4K21A 3J8F3 2GRMA 4PF1A 3UK9A 2BTVC 4Y4RA 4DB5A 4LOTA 1HQLA 1K12A 4DUXA 3MW2A 1CGPA 3E97A 1MS1A 2Y6HA 1RXGA 1AR91 4MYEA 1WMFA 2VZQA 4OHXA 1LEDA 3NV2A 2KEIA 1I5PA 3KT1A 4Q4X1 3I3DA 4IA8A 1KFXL 2QQJA 2E9QA 2VNOA 3K46A 4OMCA 2XKOA 1DHKB 4AOCA 4GB33 2HWC1 1E3OC 4YBAA 1AYN2 2DDUA 3IT8A 4AGGA 2G19A 1SBDA 2RMU3 4Q4V1 5C70A 1OPOA 4CDWA 4QQHA 5K0UB 1QQAA 1Y3TA 4H55A 5FZ7A 3WG3A 1RUOA 5HCAA 1XYOA 2Z42A 4JQTA 1QU0A 4A4AA 1JWLA 1WA6X 3KCCA 2X09A 3QH6A 2BPA2 2HLEA 3LFPA 3VHPA 3AYEA 3IM0A 4RHV3 4D69A 2WYFA 3DL3A 4N8MA 5BNOA 2PHWA 4NVPA 3V65A 2QUOA 5DQ0A 2RM21 3WP4A 4KG0A 1OPMA 5L9RA 3H8UA 1LOFC 3LCPA 4JV4A 1ZVFA 4OUMA 2AXZA 5DT2A 1Q56A 1PK6B 3CZJA 3UYJA 5FZDA 2RG4A 5FWJA 1GZ9A 1UPSA 5E8AA 3BTYA 1BKZA 1VBD1 1TZOA 2Y38A 3OUJA 4ZU4A 1SMVA 2QQLA 3LDBA 3ATGA 5F3EA 5FMCA 4L99A 4N43B 4E2SA 5L7OB 4R9AA 3K77A 3N3HA 3NROA 2PE5A 3A9XA 3GZAA 4QX1A 1FAYA 4JGZA 4CCOA 2UURA 2OVUA 2RS51 4ITCA 3LDKA 3MICA 1W06A 3P6BA 4JX0A 2WL1A 5CYYA 1PVC1 5IHRA 2EIGA 2QQUA 1XU2A 4IL7A 2VG9A 4JRAA 2XUMA 2XLFA 3MI8A 1RUC2 1T6GC 4I6RA 3E5QA 3MF6A 3TYJA 1MFQC 4UFHA 5K9YA 2FZ2A 2BJCA 3KZ3A 1O6UA 5DZFA 2VZTA 3WP5A 1X57A 2VZUA 4O7XA 5IVBA 2R32A 3SR4A 2VMEA 1X82A 4QD2A 1YI9A 5J3UA 1XE0A 5I93A 2C9AA 5EXOA 2B42B 4X6QB 4JGYA 5FZ6A 2PUGA 4DO0A 4U2AA 5BNNC 4D6QA 2HEVF 3ACIA 2LYKA 3PMEA 1GBGA 2GDFA 5ACA1 5DTQA 1YQ6A 1V9U1 4LUMA 1W6OA 1W6PA 4GH4B 1PM4A 2R042 1NEQA 3T2QA 5JSOA 2XXQA 2HEWF 2JDYA 4X8PA 3O5SA 5SV8A 1LGNA 3OWQA 4KI5M 1TME1 4E4ZA 1YEWA 3IDEA 2QFEA 3AKQA 4OVEA 2HINA 3MIDA 4Q27A 2L9LA 4AQ2A 4JRLA 3OYWA 4NN0A 2QQKA 2AEYA 3N7MA 5CAZA 2E53A 1AR83 1W6MB 2RVAA 5FYHA 4BQ5A 2ES3A 2XVLA 4B4PA 2Z69A 2YBDA 5CNAA 4CCLA 1H2MA 3QOPA 2ZMLA 3ZXDA 2ZGUA 2ZGRA 3BIWE 3DCQA 4RGAA 5F37A 1UQXA 3OGVA 1SQ8A 2PUCA 5JSPA 3QOXA 3PU3A 2W1QA 2W94A 1REEA 3S6PA 1OOPA 4EN6B 4EWEA 1M4WA 4N53A 4ZZ5A 1ONAA 3NNGA 4CCDA 2PXPA 1UYZA 2H8RA 3D4KA 4XF1A 3MZHA 5CG9A 5CKQA 2MEV2 1BLZA 2QVSB 1VJ2A 4EYUA 3C2UA 5HXMA 3VKFC 1HRI1 2OUJA 2VCMA 4IE7A 1GWLA 3O7OA 3AKPA 4P00B 3ZFGA 1W6NA 3VWSA 3KD4A 1YI7A 4A7ZA 4JAAA 1ZYBA 5CADA 4KG8A 2XMLA 1GV9A 4LOSA 4JKLA 2BERA 1YFWA 1OF4A 5GZGA 1UKRA 3GBWA 3R05A 2W2IA 3SH3A 3FYMA 4UBGA 5C7GA 4YG6A 3WDUA 3ZVXA 2HWF2 2WUSR 3S30A 1WLCA 1UL9A 1R082 2RJLA 3CJIB 1W04A 4P9IA 4CDXA 4CP0A 1JYCA 2KD7A 4A7KA 3OQNA 2WT1A 4KQ7A 3I3EA 3NMBA 3JXCL 1GUIA 3ECQA 3WF1A 5C3SA 5EQUA 3BDNA 1DWKA 1KS4A 1O5LA 2D7FA 2WA4A 4BIFA 5C3OA 1LODA 2B9UA 2BUKA 2V5DA 1K5MC 1EYBA 2PHLA 3T2PA 5FBZA 1YQ2A 4HSJA 5IT6A 5FQ0B 5JOWA 3DM5A 2R0HA 4COVA 1GZTA 5L7OC 1XBFA 4N43C 1TMF2 3M8LA 4OYUA 2AUWA 4Q4Y1 3NJYA 2UY8A 5K4LA 3KZ4C 3HJRA 1OT5A 2DVFA 3S7EA 2JIGA 3QF3A 5IVVA 4XBNA 3PUQA 1UOBA 3BN6A 5JUVA 3J7MA 1W0PA 2WIUB 3LQXA 4IEPA 4PBPA 4ZXEA 2HBUA 3AZXA 1DQ5A 4TZDA 1QJEA 1VBE3 5FZHA 4AZZA 1GSLA 1UMZA 4YM2A 3OY8B 2IWGB 2YDEA 4RFT0 2A3XA 5GAGi 1V6MA 4UYBA 1AVBA 3POBA 3VBHA 4BQ2A 2VOWA 2D97A 1ENQA 3JD71 1NZCA 5GLZA 1XRUA 2HWE1 3VKNA 3S0MA 3VBSB 3D5OA 4I0WB 5CFCA 3CIHA 1GQPA 5H9RA 1WBLA 2FQPA 2IVGA 3ELNA 1QQP2 2FDIA 2JQEA 1UYYA 2WZ8A 2CU5A 3FWEA 3GJBA 3ZN5A 1UU5A 1GQGA 3POFA 1QOOA 1UU6A 5CIRA 3ZSKA 4D7YA 3WNLA 3QQ6A 3NJXA 3S8QA 4LIVA 1R63A 1O8SA 3FN9A 5C8CC 4Y1XA 4QKBA 2FDKA 1H8TC 1DGWA 2WQ8A 1U5YA 1U5ZA 3GJAA 5FUIA 2VBDA 5FY8A 5D1IA 1ULDA 1GNZA 2DVGA 4GXLA 3WD5A 3WNPA 1N47A 3OD4A 2P3YA 1JU4A 1CVNA 2CDPA 3HBKA 4Q5OA 1UZVA 4WVWA 1CQTA 1AYN1 2XH6A 2PXKA 5T55A 2G9GA 1ZZ9A 4PU7A 3C8XA 3R6SA 3IMMA 1CZVA 1ND3C 3RJ2X 3ZMNA 1EV12 3MIHA 4QPYA 5IUQA 3WG2A 4CXWA 4Z2WA 5FUPA 2WNOA 2B45X 3BB6A 1OCTC 1BEV3 3AK0A 3AMPA 1BBT2 3X29B 4X4IA 1JH5A 1LHVA 2XUEA 5FYIA 4MXWB 4PIZA 4RQPB 4FPEA 1L7QA 2CYFA 1VP6A 4XJUA 4WM7B 1YQCA 2A6XA 2QQOA 2XG3A 4LA3A 2FBEA 3ZKYA 1UY0A 2EWTA 4P9YA 2PHUA 5LCWL 4B29A 1PZ7A 1OF3A 4AGVA 5KXDA 1AUYA 1QXPA 3Q8EA 2RS32 2A6ZA 3ZIXA 5I8SA 1X36A 3M3CA 2YYOA 1NYWA 3ZYBA 5FJKA 4P14A 1KJLA 4H3WA 4LEJA 5LY2A 2E32A 3GUUA 1APNA 5H9PA 2K2SA 1PIV2 5D8AA 2GRLA 1DGWX 2ZZJA 1ND2C 4MLOA 4D6SA 4DY3A 3POYA 4O65A 3ZXAC 3QH7A 4LE3A 1DZRA 4PBOA 2ZOEB 4XFAA 5JI7A 3VZLA 4AI3A 3PVEA 4YVWC 2R073 3ZYHA 3ES1A 1OUXA 2BW8A 3GBFA 3B93A 3EYPA 3I2DA 4KGGA 4XF4A 3V56A 3W21A 4ES8A 4FO9A 3BOPA 3M2MA 4Y20A 2XGXA 4D0QA 1RUD2 1POV1 1RGSA 5HPOA 3ZDVA 1JS9A 2A3YA 1UPIA 4AGRA 1ZRFA 1RUC1 1NLRA 2B7YA 5DG2A 3URFA 1LOEA 3DECA 2CSFA 1ST8A 1VRH3 2PUDA 2IXLA 3GZEA 4FFHA 4WM8A 4YW7A 1C1FA 1IS4A 1H2KA 2JICA 2FCUA 4NE9A 3O1MA 4JDOA 3FE5A 4S2DA 1W2TA 2WQZC 3PTYA 3JU9A 1NY72 1BJQA 3PL0A 2EIDA 3ZXLA 3BKZA 4DPNA 3LE0A 1JYXA 2HFZA 2ZTNA 1QOTA 1T2XA 4PQQA 4UW4A 4R8HA 3WW3A 5FWEA 5BUVA 2ET1A 1GOGA 1UY3A 2Y8KA 3ILFA 4XETA 2BRTA 3WVJA 4G4FA 4G3YC 1CQ9A 4I01A 3U0ZA 1UW8A 1ZRRA 5LA9A 4FOWA 1XNAA 2R041 1IOAA 3H3ZA 2E7TA 3VBRC 5FLHA 1Y43B 2GNDA 2KR2A 2UWCA 3N36A 4FOVA 2WABA 4N7UA 2IXKA 5JZGC 3O0XA 1PX3A 2D43A 4QPIC 1VB2A 1GZWA 1JHJA 2GNTA 4TYSA 3HQXA 2ADDA 4LBJA 4Z92B 1XE7A 4LULA 1IKPA 3J7HA 1EAH3 1O5UA 5F9TA 1MS5A 3LSDA 3W58A 4P9XA 4SLIA 1MEC3 5CU1A 1PZ9A 3T0BA 3BCWA 3NW4A 1S0EA 3FLPA 4HFSA 5BNPC 5C9AA 3U4XA 3LGRA 4DRVA 4TN7A 4HKLA 4BJ0A 5KHGA 1OQ1A 3D0SA 5T5LA 4DZGA 4YSFA 1EY2A 3ZHMA 4HPKB 3O1TA 3AX4A 1US2A 3AM2A 3KVAA 4LLOA 3S5QA 3TOJA 4G9SB 5H9SA 5FZEA 4A45A 4CP2A 3ZPXA 2W91A 2KEJA 3C7FA 1CD3G 2IVIB 1IG0A 5JXHA 5DAQA 1S2EA 3CNAA 4LQRA 3FL7A 4IE0A 2MEV1 1VIWB 1UZWA 2Y0OA 1MZ6A 3RZJA 3O0VA 2W3JA 4XACA 1YO8A 2XLAA 5B4XA 3ZSJA 1O3QA 5FZ9A 5FZFA 4COYA 5JXGA 2Z2SB 5DRTA 5A3UA 3CJXA 4Y26A 3CZUA 2PLV2 3ZM8A 5JXJA 2TEPA 4CCNA 1W8ZA 3POEA 4QXKA 2DCJA 3POGA 1AYM3 2EVXA 5GLVA 1YJLA 1W6NB 3ZR5A 1PM7A 1G86A 1L7RA 2VBBA 2J7WA 4CDWC 2TNFA 5FMOL 1PZ8A 5L73A 2IXHA 4NAOA 1R081 4XBQA 3RWKX 3VKMA 2CTVA 3B94A 2B9VA 2EXKA 5DZGA 4NO4A 3W20A 3IWZA 2OR1L 3FZ3A 1V6NA 3BGAA 2OW4A 3WQBA 1TE1B 2CV6A 5FO9B 2WNVB 4I6TA 2PFWA 4AXOA 4XFIA 5BNOC 4META 5J37A 4LBOA 1W90A 2A73B 3K4DA 4PIXA 2MXDA 1JI6A 2WNUA 3O14A 4LBLA 1FOD3 1VPHA 2JVLA 2XXAA 4GB32 5A1LA 3E5UA 3HQRA 4XJ9A 2OQ7A 1ENSA 3WT3A 2GH8A 2LTNA 2RMU2 1TMF1 1FMD3 2PHFA 4W50A 5I0TA 5JI9A 2PHDA 3TEZA 4IE5A 2CAUA 2R063 2WT2A 1H9PA 2GMEA 1AJOA 3RZZA 4FPOB 1J58A 4GULA 2VUJA 4XCAA 4QX8A 3WEZA 2IU7A 1GOHA 4Y22A 4CU7A 1NCRA 2VPVA 5FZAA 4GIQA 4KU7A 2XJRA 4JGZC 4QT6A 2W1SA 3KB5A 4JVAA 1N1YA 3PLQA 4AAXA 4HONA 2BQPA 1VBB3 2YZ4A 4LKFA 4B4RA 1O4YA 4UFMA 3W59A 1F9KA 1SDDB 2MHFA 1QNWA 4LBQA 2DUOA 3BTXA 3AMQA 3UKTA 1XYNA 3AYAA 4RS5B 1WA4A 1LEMA 4PDWA 3B7MA 1W8OA 4D94A 1Y7BA 4W6WA 3S57A 3CL1A 1RMU3 3UNPA 2VNGA 3H3LA 4DNYA 2BGPA 1ZREA 1S4CA 1OURA 1QQP1 2VR4A 3ENRA 3MW3A 2WZR3 4WVMB 2BNNA 1JZ8A 1ZVVA 4GD4A 2VL4A 1U2ZA 1WKYA 1AL0G 4XDQA 1BDHA 2UY9A 2RHPA 1GQHA 2AC1A 2W08A 1X50A 4BQ4A 2Y6LA 5F5QA 1E57A 3NNJA 3WUDA 3VKLA 4IEOA 2ZBJA 4HKWA 3ZFFB 3O1OA 4LIUA 4LK7A 3BPZA 4MZUA 1X33A 5F2SA 3SKJE 4FPGA 4CCCA 3AKSA 1WW4A 2Y6KA 4RR3A 1AX0A 2ERFA 1WLTA 2JG9A 4FXGB 4EZ4A 2K0GA 2P2KA 1GLHA 4YW4A 4Z2AA 1PMJX 5J48A 3BS3A 1Y9MA 2IXCA 3NJVA 1PRAA 5DUVA 1V6OA 3T1LA 4BDVB 2W5FA 2J42A 1EV11 3JXDL 2XXZA 2I07B 4CSWA 4FFIA 4BXSV 2EF8A 3WNNA 4DEVA 1WETA 1SLAA 2W92A 5ERLA 2PHRA 4Q1RA 5FZ3A 2D93A 2XL9A 1FX5A 1OQDA 3B00A 4X4CA 2ZKLA 1YIPA 2EA7A 3U1XA 5BNQA 1IQAA 4YVSB 3O1RA 1AR73 1KJRA 3MIBA 4XXPA 1QJU2 4AHZA 5I8YA 3U11A 4BPZA 3VHOA 5I0DA 1QY4A 2CHHA 3H1MA 4ZKTB 5J96B 3T2TA 2IC1A 1MPXA 1OOPC 2G9FA 4IE4A 4N53C 3C7GA 5FIXA 1HJFA 1NXD1 1X7NA 2RS31 2A71A 2GC0A 4LA2A 5FO7B 1PHMA 1H6YA 3UKVA 1HN0A 2JKBA 2OKXA 4QMAA 4JQDA 4AHXA 2ICTA 2VNRA 3GZDA 3SH5A 4NMIA 4NR1A 3DKQA 4BISA 1FV3A 3F6WA 2NZ9A 3THTA 5CG8A 5EYXA 5E88A 1AR82 3ZFGC 3BIEA 1ALYA 2WJSA 4M0HA 3TBDA 2R30A 3UGGA 2NMOA 5D21A 1DYKA 4DFSA 3GHMA 3I2KA 5D8AB 3MLLA 3HPNA 4YGEA 2JDMA 1RUD1 5FREA 3OF1A 3B3QE 4Z07A 1TME2 5F3GA 3RMYA 4Y5SA 4EN0A 2C5DA 1C5HA 4ASMB 4UFKA 4O9EA 3LAGA 3UJQA 3PIJA 5FXXA 4CDXC 3QYXA 5FY4A 2ZGLA 3UGFA 4K1ZA 4XTPA 4HXCA 5EJ3A 3TB0A 5DUWA 2E31A 2ZS6B 4LHLA 5KHIA 1CAWB 3V0BB 2WO2A 2ZMKA 2QE3A 5DAXA 2IVBA 1QZXA 3RDIA 5FP9A 2Y6FA 4FAHA 1NY71 1O3SA 2HBTA 2ZEYA 1LRHA 2CNAA 3M1HA 5T3NA 4IERA 4UW6A 3IBMA 3PTRB 3DPRA 2AUYA 1UAIA 2JE8A 2FMDA 3LA7A 4IDZA 1IZ3A 5FYBA 4X4EA 4LXLA 1RITA 1GOFA 3DEMA 4KL1A 1Q8OA 2ADEA 1OXCA 2ZGPA 2E26A 4YW6A 2HWB1 4E8DA 4QPGB 2NMNA 4E4SA 4COUA 2A6CA 3LKJA 3Q9OA 2MPFA 3OGSA 5ABJA 2LLVA 2J1SA 3SKVA 3UESA 5KHKA 3G7DA 4BIOA 1F35A 3VBHC 4XABA 2VJXA 4MGYE 4AHYA 4FTSA 5FP3A 1RHI3 2FCTA 2P34A 3BD1A 3BU7A 3NKTA 2I74A 3AVRA 4Y5TA 4N9HA 4PU4C 4QQOA 3KMHA 5CFCC 1PO13 1W99A 3O0WA 1HF0A 2AYHA 2EXJA 4XJZA 2VTXJ 1RC6A 4B3NA 4CDQA 3N4MA 2YFZA 1E5SA 4CCJA 1OD3A 5F8PA 3KT7A 4BOWA 4DXSA 1QJY3 2GAUA 2WO7A 4KNCA 5LA2A 5CKMA 5A3NA 3AB0A 5KXEA 2FZ1A 4KWKA 3FBYA 3KHCA 3I97A 1CESA 2YY1A 4U36A 3AYCA 1BQPA 1CX1A 1PMIA 5BV6A 5FLIA 4QHOA 3RFRA 2C24A 3AXEA 2A6WA 1NKGA 4GWJA 1CAUA 1OMIA 4Y5Z0 3WG4A 3A7QA 2RJKA 4ZZ8A 4LNVA 3NXHA 4BCUA 3VL9A 2PLV1 2ZX1A 1W9YA 3I7DA 4IEXA 4AFAA 5FYMA 4AVSA 2GMMA 5BNNB 1QP7A 5A7SA 4B1MA 1SBFA 5FP4A 3BOWA 1CJDA 5FY1A 2JE9A 1J3PA 4KU8A 5AFBA 2JB8A 4UXAA 4WZCA 1JXNA 4IQPA 5ANNA 5GLTA 5JVVA 5A1FA 3UGHA 5LBFA 1UY2A 4WV8A 1JTZX 4XUOA 3ZYIB 3VD4A 1ENRA 2N7GA 3DV8A 2J1RA 2A5ZA 4IEUA 2D6KA 3MIGA 5CZKA 1R69A 4FTBA 2VOVA 4EQVA 1L3JA 3TELA 2NP0A 1QDCA 2JG8A 4HOOA 3DGTA 2WNEA 1ULOA 4TLFA 4B1LA 2YPDA 2FD8A 1JZ3A 4GB31 3R4UA 3I59A 5JUWA 4L8QA 3ZXJA 1UZZA 2XWBB 2RMU1 3FLTA 3R4DB 3JXSA 2PUEA 5IVYA 5F5IA 3ZSEA 2C6SA 1QIQA 2WYSA 1HXS2 4AVAA 1BEV2 1SPPB 2XSDC 2RE9A 5D8AC 5JIAA 4XJWA 3VBFA 4GWNA 2OA2A 2DBNA 2Q8CA 1VBA2 2Z79A 3NDBB 3CO2A 1X2LA 3ACLA 4Z8BA 4E8CA 5IFPA 3L2YA 2EF6A 5CA6A 4W65A 5I0SA 2XJUA 1BHGA 3OGGA 5I8TA 5LEKA 5DAWA 4S2FA 1DCSA 4OFGA 2Q8OA 2GC2A 4CPBD 3JB8A 4JKMA 2VC9A 4PJYA 2AH2A 4WM8C 5CFDA 1SG3A 1W39A 1V0AA 5A3WA 3WSOA 1V70A 3FLRA 4CTEA 3W5MA 2NM1A 5LWBA 4A6OA 5F1RA 1LJ7A 4HVQA 2WSUA 3HNBM 3JB4C 4D7TA 2CSGA 4JQRA 1DGLA 1OKOA 3I2HA 2QQMA 4FQ4A 5FPLA 4Q4W2 3ZXEA 5LBEA 1SACA 5FZLA 3ZN6A 1O8PA 1RUF3 2XJTA 4QPGC 3ZPOA 2M4HA 2BBVA 3PU8A 2GU9A 2PHXA 2Z5WA 1VBC3 3KGLA 3AP9A 3PDQA 4YLZA 1CAVB 3INAA 3NSTA 4CP9B 2YG0A 2VNVA 1RVF2 2QJVA 4XFCA 3ACHA 3QLQA 2W46A 1K5MB 4AFDA 4H14A 1RB8G 3IAPA 3WDXA 1OD5A 3W5NA 1LULA 3I3QA 2LS6A 5H9QA 1AR93 4W6XA 4Q0UA 4OLLA 1LOCA 4CEWA 2FHRA 3TNPB 1RUE3 4COZA 4D8MA 1AL23 4Z82A 4HVRA 4AG4A 4AVTA 2UYAA 2HWC3 4XQ4A 1QJU1 3RWNA 3JZVA 4Q0QA 3KV5A 4V2WA 5DN2A 3SX0A 3L2HA 1XNTA 5F5CA 5A33A 1DBNA 5EP9A 5F39A 3NAPA 2PXVA 3CECA 1CPNA 3CEWA 4NROA 4PI2A 3THDA 3WDTA 4BH9A 5JWPA 3H8XA 1BMV2 5BPXA 4A2UA 2SBAA 5AFEA 2CY6A 1RUJ2 3M7AA 2Y33A 4NPMA 5HXVA 1SBEA 1BVP1 1OLQA 2GC1A 2RR13 5IYYA 3K51A 1P8JA 2C4XA 4LTAA 3K2OA 4IESA 1O3TA 1AR81 5KR7A 4K7JA 1FPN2 4A6SA 1MEC2 2ZGTA 2O8QA 4CDUB 2DU1A 5FZOB 2X5IB 2QQVA 3RYKA 2V72A 4QU2A 1V6LA 3V64A 4Q2JA 3I4IA 4BQWA 5JPNB 4GMP0 1ODNA 4YGCA 1VBD3 5C8CB 3CDZB 1H8TB 4LHSA 5APAA 4BQ3A 1JZ4A 4QQLA 2JKXA 4UOJA 2CL2A 4FAGA 4KBBA 2VCBA 4Q0VA 2LM3A 1LKNA 4OZOA 2JECA 1EFAA 3ITQA 1C1LA 4QB1A 1RZRD 2O14A 3WHTA 3RZHA 4MCXA 5C33A 2ZX4A 2RS53 4W4ZA 2PXDA 4XFHA 4ARXA 4CE8A 1ND3B 4JKKA 2DTYA 2EALA 2MQKA 2GNBA 2W95A 1W6QA 5F5AA 4BLJA 4X4GA 1OHFA 4Y33A 2WNUC 5FLJA 3ZSMA 2VMFA 4A3ZA 4QXBA 1XU1A 4XAEA 1FYUA 1PO23 2JDAA 2ORZA 1OLME 1AYM2 4XVHA 3RI8A 4ET7A 1W28A 1RUI3 3J7LA 5K7PA 1LAJA 1W9SA 4GMP3 3ETQA 5CVRA 2WIIB 1R1A2 2EAKA 4CEYA 5A7NA 4PU8A 4Z5HA 3OMTA 3KF5A 3JXBC 4K6BA 4QM9A 4YM3A 3KCYA 4M3CB 5ACA3 1LR5A 5A1AA 4YNIA 4XZUG 2VU9A 1NCRC 1UCXA 2HJIA 3G6JB 4NIGA 3H3UA 1NCQA 5IK5A 1IS6A 1GICA 2WSVA 3RJRA 1US3A 2XB6C 4LO4B 1CWPA 5JMOA 1REDA 5ANQA 1QJZA 1FOD2 2ZGOA 4RGGA 1ND2B 2DCTA 3USUA 1AR63 3MUZ1 1NA1A 1S7EA 2P6CA 2PXQA 4DE9A 2VUDA 4LKEA 3A22A 4NAMA 4WBBA 2PUBA 1YFXA 3OOXA 4YVWB 5FY9A 4YG0A 2R062 1H4GA 4QKNA 5C3PA 5F3CA 4PLMA 4CUAA 4C90A 4MGIE 4DIQA 3M4FA 1TNFA 3LOIA 2AENA 4QX2A 2YB7A 4URTA 3T09A 1UOGA 3VDAA 3LEIA 1XB9A 3VDCA 1PNFA 2IFWA 4H2AA 3EB7A 4YGDA 1JYTA 4L2NA 1VBB2 4RR3C 4Y4YA 4ER6A 5TSWA 1CIWA 5IK8A 3KXAA 4EZIA 1D4M3 3R4SA 4S2HA 1N3QA 3VD7A 1DDLA 3B5LB 4IV1A 3CHXA 2D5VA 2YUEA 5CKNA 2E33A 3EXUA 3BUCA 3IMNA 3OPTA 2IXJA 4ZY9A 4XF9A 3WNKA 2NLRA 1HRI3 3HVDA 2LYRA 1VAKA 1TQ5A 5T5JA 5HCHA 3O12A 1C5IA 1QMJA 3IIIA 2NPIA 5L9VA 3E5XA 2P5BA 1O7FA 3MFAA 3VBRB 2BJSA 2ICPA 1C8M3 3WF0A 4EK9A 3I49A 3Q8FA 5JZGB 4QPIB 2HCNA 3M3EA 5A7OA 1H2NA 4IV3A 3VBUA 1MQTA 1F5JA 2DYCA 1NLQA 5IFTA 2GC3A 3KM5A 5FFOC 1U5IA 4EKGA 2WFF3 3NNMA 5FCCA 3WOGA 1WCUA 5GJ6A 2DU0A 4LO5B 5FMDA 5D2AA 4ER7A 1IPJA 2Z4FA 3FHIB 2WO1A 4GAZA 1QJX3 3AZVA 2DCKA 3DUIA 3G5GA 3GZDC 3CLCA 4CDUC 1C8NA 2X5IC 5BNPB 4ASKA 3RZLA 1Y9QA 4GZ9A 5GAHi 2DCYA 1HXS1 1BEV1 1CPMA 4YYOA 2FJRA 3GN5A 1KS5A 5FPUA 2WDBA 3VGIA 4D6RA 2PQSA 5EJ1B 1NOVA 4CUGA 2DUPA 2ZHLA 2PAEA 3KV6A 3UWPA 1S2KA 1VBA1 3AFGA 4FN3A 3P1IA 4I09A 5KXCA 2B5HA 1XQNA 5LA1A 2OQ6A 2VOXA 1O91A 3PVBB 4ZXKA 3SH4A 4X4HA 2JCGA 2VE1A 2ZX2A 2OUHA 3BTAA 1DQ1A 2OX0A 4Q4Y3 5FYSA 4R4XA 5IJRA 5A6YA 5AC93 2FDGA 1JOPA 3E6CC 4WVLA 5L36A 4KBZA 3R09A 5T54A 4YZ4A 1AX1A 2ARAA 4N7IA 2ID4A 1UO9A 4K1YA 5DMYA 1DGRA 2LCVA 2R1BA 3SLIA 3AC0A 3OGRA 5DPNA 3M3IA 1Q3EA 1V6IA 1KRIA 1JN2P 1ZBA3 1YC61 3POWA 4XJ8A 2ORXA 3RMXA 4AE2A 3FJSA 5C71A 4CDWB 4XOGA 4Q4W1 2HWE3 2QZ2A 2IXIA 2R071 4XF0A 3U75A 3O9XA 4AEDA 2V4VA 3OTFA 2PXEA 1SZBA 3SHRA 4B8EA 3DPRC 4LO7A 5G04L 5E6HA 4GWIA 1V00A 1RUH2 5IVJA 4ZPIA 3VBOA 2HWD3 5C3QA 1RVF1 4FPJA 4BQXA 2BFUS 2VH9A 3NNFA 4BWOA 1HRV3 4HSLA 5BNOB 5DAVA 4R9BA 4UF0A 4JTNA 1FV2A 2D5HA 1JBCA 5ABJC 2CDOA 1MZ5A 2Q1ZB 4Y1VA 3RSJA 1J59A 5JIUA 1A8MA 1G9DA 3VLBB 1SLBA 3ZFEA 2B5AA 1J3QA 1ZS4A 4YGBA 1UWWA 2G1MA 4URAA 5FUNA 5FZ0A 1N3OA 5CISA 1A3KA 2YMZA 3OJBA 5LRSA 1HX6A 4PU3C 4LO8A 1UX6A 1ULPA 2BBAA 3AJYA 5FZKA 5I0UA 4DXTA 2WAAA 4XUQA 2SLIA 4P02B 3ZXFA 4JGZB 1OI6A 4MCTA 3TEXA 4CDQC 4GKYA 5A3OA 4X6RB 3GCWA 1ZX5A 1SCSA 5FOBB 1BMV1 2QQNA 3SQOA 1DIWA 3I8TA 1RUJ1 3I2GA 1U0AA 2WS92 2YGMA 4AQ6A 3ZIWA 3THPA 4K20A 3TN93 4UWDA 4FT8A 1EAH1 2ZX0A 3MUY1 5IAVA 3TAYA 4NHMA 1FPN1 3BPSA 1MEC1 2Y26A 2VBPA 2LYJA 1UXXX 2J1TA 5DDJ2 5DUXA 3VDDA 4COWA 4KMQA 4NIAA 5IATA 1NUKA 4JGYB 2PIJA 5HV0A 5A6XA 2JDUA 1LESA 4IEVA 5A32A 1MVEA 1LHNA 2RDNA 2QQPA 5LB6A 2HWB2 2W1WA 1W6OB 2DUQA 2OT7A 1W6PB 1PGL2 1RYYA 3EBRA 3H50A 1ODMA 2VCAA 4OI0A 1QXJA 2TBVA 1YFYA 5FY0A 4BU2A 1RUG2 1DZQA 1OKQA 1S0FA 3LQCA 1PRVA 4PI0A 1ZZBA 1A8DA 3OGJA 4QQ2A 2LALA 3E6BA 1ZM1A 4LMFA 4OI1A 5A7LA 3D82A 4E4HA 4Q8KA 1FNYA 2KXLA 2YC2A 3NRUA 2XJVA 4FPKA 1HB2A 2HYXA 3DN7A 2P37A 4BM8A 2GZUA 1LENA 1RTVA 2DF7A 2D6MA 2VMGA 2AW6A 3OYWB 3U10A 4NHKA 2IUOA 1CJGA 3GNEA 1CZTA 1O4TA 3OUHA 2ZGSA 5C4WA 5FAXA 3HAGA 5JOYA 1AYM1 1ZAYA 1ZA4A 3WY6A 1GWMA 5JOZA 5DRYA 4QQPA 4FQZA 1R1A1 1Q8VA 3OEBA 3RRDA 1SHWB 2LYPA 1VMFA 4P9JA 3ST7A 4R52A 2ENRA 3VBFC 1W0NA 1REFA 3T4VA 1KDKA 2PUAA 1OOPB 1B35A 1YNAA 4N53B 5FR3A 5J36A 2AREA 5F6KA 3OBAA 3DXTA 1QQBA 3T08A 2WZPP 1ASJ3 3BODA 1LECA 2R043 4MSVA 4HRAA 1WZXA 2OFYA 4IEWA 1Z78A 2X10A 2XWJB 1WCQA 3A4UA 5FZBA 5LASA 1FOD1 3H42B 1J3RA 3ZFGB 1RUNA 3JBG2 3MDPA 1GP4A 2KA3A 1WWYA 3KV4A 2PMWB 1NCQB 3FYAA 4KWUA 3RGBA 3S7IA 2W0XA 1RPEL 3AXDA 2R061 3DXUA 4L0PA 4E2QA 4XBLA 2XOMA 3J8F2 4FPLA 2VOKA 3OPZA 1DYPA 2BDRA 5CB7A 4C0BA 2AXUA 2R7EB 2ZEWA 3N9LA 4PQ9A 5FYYA 5IAXA 1Z7S3 1F4HA 3M3OA 2P1BA 2ZACA 4N9IA 4MGSA 4CDXB 1G9BA 5FYTA 1A34A 1ZRIA 1LOGA 2WBKA 4RFRB 2PAKA 1GFF2 1VBB1 2IFRA 2A75A 5FMBA 3EUSA 2O8OA 4A42A 5GLUA 2B46X 4XW3A 3H8RA 2RJ2A 1ZUGA 2D6LX 4AFCA 2L49A 3LF7A 3N35A 4Y1ZA 3MIEA 2VEOA 3QFIA 5KWRA 2VW1A 1UN1A 3RVHA 1I5ZA 1S0IA 1YFUA 1NXMA 4I0AA 2OXBA 2YXSA 3SCGA 1O59A 5FZ4A 3WINE 4HETA 5BXXA 4RHV2 2J22A 1YWKA 4AL9A 3RNSA 1JUHA 4LITA 2ILMA 4RL7A 5GZEA 4B7EA 1RUF2 3KT4A 2UWBA 3NO8A 5LBCA 4L9BA 1VBC2 4FPCA 4AR2A 3AKTA 2ZEZA 1BCXA 1WLWA 3GBGA 2KZ8A 2WN3A 3LPGA 3WQ0A 2HWF3 4QXCA 3IVPA 1X9TA 5IK7A 1URXA 1R083 3NAPC 3VBHB 4EQZA 3R0RA 4XDPA 1UMIA 2IVJA 1QGLA 4UFIA 2PQQA 2MEZA 2H0BA 3ROUA 2DURA 3HIFA 3VN4A 2E7AA 4JGYC 1HB3A 3A23A 3MBWA 5CFCB 4UW5A 4YW5A 1ZZ6A 1W8WA 4FBFA 1WMEA 2WLPA 1AL22 5K0UA 4AAPA 1XXNA 1JYIA 3WUCA 1CIYA 3DYPA 3K3NA 5IK4A 1W9WA 1EP0A 1PVXA 2ZABA 1YRZA 3OBZA 3POSA 2VMHA 5GZFA 1TMF3 2C0ZA 1UIJA 3B01A 3ZXKA 1OQEA 1PGW1 5J98B 1X9PA 2XIUA 3NJZA 4QKDA 4XFGA 4XUTA 1OUSA 1GWKA 2O0OA 3AMMA 3LSEA 5JPMB 2VW0A 4CYDA 4Z5DA 4YM1A 1D2QA 2VXJA 3WDVA 1GT0C 3F95A 2RR12 2CROA 1PK6A 4GALA 2I45A 3WCSA 4FTEA 4INDA 5DABA 1UKGA 1VE0A 5DZEA 3ZO0B 3U78A 3O1VA 4JHZA 3LOBA 4GKXA 1Q5OA 1VALA 1R1ZA 3N9NA 4OCTA 5LK5A 2F6BA 4M01A 4N43A 5L7OA 4IUGA 2XJ3A 4FCAA 1Z0HA 1XYPA 1RUH1 2R6QA 2ZPXA 2O38A 1UX7A 2FMYA 1COV3 2GN3A 3AP5A 3AL6A 4C8DA 2BFUL 5F3IA 1K42A 2RDRA 1ACCA 1IGOA 3LB9A 3PUHA 4NHYA 4XFBA 4CEYC 1ADRA 4EV0A 1CR7A 4HLTA 2PYTA 2ZJCA 5FDBA 2XBO3 4OMDA 1K3IA 2W47A 2ZA9A 2VTFA 3LEMA 4NDWA 3U14A 4ES9A 1MZEA 1C57A 4CXXA 1KDMA 2PN5A 2QQWA 2BU9A 2WINB 1NCQC 3H1YA 1ZNPA 2YC4A 4OB4A 2J1AA 3B9CA 4YG7B 2WAOA 4LR4A 2LYQA 4HK8A 4FP3A 3GGLA 4TWTA 3AVSA 2YPJA 4QWNA 3TNQA 1AXKA 2CWMA 2VULA 5JCTA 1PO22 5J09A 4AVBA 1XNBA 3RYRA 4RA0A 2OPWA 3UKNA 1O4XA 2D5FA 3C7HA 4GA9A 4WVZA 3M9LA 2Q1FA 1SLLA 2VUAA 1DU3D 2ZCWA 3MW4A 4GH4A 2YC0A 3LD8A 1W8TA 3SCHA 1X8EA 1PGSA 2VMCA 1BBT3 1DF0A 2YV8A 4Y20B 1R093 2J1EA 1ZBE3 3N9QA 2ZZQA 5FOJB 4AF9A 1W2UA 2QKDA 2WS91 2ZGNA 5G05L 2ODRD 3USSA 2YBSA 4PCRA 4WM8B 4XPVA 5HCBA 4OQ9A 2JENA 4KH9A 2B39A 3RG0A 5A3TA 3HEIA 1XNDA 4AW7A 1ULCA 5DDJ1 3OQOA 4AI1A 1RHI1 1OFSA 4CU8A 4QX3A 1W6MA 2O1QA 3OBTA 2L8NA 4UAPA 2QBXA 1UXCA 2JDNA 3VKOA 4RSUA 2H0VA 4M00A 2VQUA 3LFIA 2LW8A 3Q8BA 4MGZE 4NRPA 3DF0A 4QPWA 4YW3A 5A3LA 1I9RA 2XVKA 1QOSA 4JZRA 1PIV3 3KCXA 2X8KA 1UF2C 1X8MA 3VZKA 3NL1A 3THCA 3WF2A 3U3WA 1PGL1 1YIFA 1RUG1 3A0KA 1VR3A 4HANA 4L11A 4YZ2A 1SLCA 1NLSA 3CU7A 1DW9A 2TUNA 3I2FA 4LLFA 4P08A 4MADA 2JDKA 2Q4SA 3A0NA 2C9KA 1GZWB 2JX9A 3HR9A 1RUD3 3MV01 2HSGA 3OP9A 1MQTC 5FPBA 3U07A 4OHYA 1TVGA 4MH0E 3NNLA 4HVOA 2PXJA 4IEYA 2PHTA 2WC2A 4GQ7A 2W87A 3MLKA 4XC9A 1OA4A 4IGQA 3T3YA 2C26A 5FP8A 1W8FA 2ATFA 2D3RA 1W2AX 4QGLA 1H4HA 3HT2A 3DYMA 4P5HA 3RZKA 2GP3A 3I2JA 3WHUA 5C9AB 5CBLA 2AR6A 2C1FA 4MOAA 1OVPA 3GZUC 2FDHA 4YPJA 3AL5A 2HKXA 3OQMA 3SEPA 4K8FA 4XYXA 1VBE2 3KGZA 2J1VA 3PUIA 2VMIA 4RYDA 2YBKA 3MPPG 3WG1A 5B4NA 1D0GA 1C8M2 3CJIA 3L1PA 2GP5A 3IDBB 4HN1A 4ISQA 1ZZCA 2IVQA 1FT9A 3MLJA 1I6XA 4A3XA 3WF3A 3QBQA 1CX4A 2ZEXA 2WFF2 5A7PA 3T2OA 3L9JT 4ZU7A 1WMXA 4XF3A 3RZGA 1OH3A 1PX4A 3JBG1 3QCWA 4HBNA 2WWUA 3NV1A 5F2WA 1JYWA 1MS9A 1QJX2 2LYSA 1BVVA 5L9BA 2OPKA 2VQTA 2JEMA 3PVNA 4DRRA 1E5RA 5FQ0A 4I30A 5IW0A 1KXGA 4UFLA 3UV9A 4XIOA 1DULA 4EWDA 3J8F1 3GZTB 1E5IA 2WKKA 3MF9A 2W52A 4FOQA 2VTXA 3EHKA 4BHPA 4LBMA 2UYBA 1DQ2A 3NV4A 2VCCA 2D3SA 3BYWA 4PHZA 3QOWA 1S2BA 3UFDA 3OY8A 3A9ZA 3VBOC 2DFBA 1QH7A 1QB2A 4Q26A 4FVVA 4EKIA 1MS8A 4BXFA 1LTEA 4WVVA 5FKCA 1W03A 5FYZA 2WWSA 2WNUB 3N9OA 1C28A 1DQ0A 2JJ6A 3VBSA 1Q8SA 3RPQA 3NZLA 4PT6A 4A7YA 1ZBA2 5FO8B 1LLIA 1GKBA 4I3PA 4NOTA 4PIYA 3VK0A 2A7AA 4YRDA 5FYVA 1QXRA 3WNMA 2W9XA 4RHV1 4YM0A 5FK7A 3KSCA 4NPRA 2DFCA 5KHHA 2E63A 1RUF1 3KVBA 3DYOA 2G9ZA 3ZKCA 3V0AA 4AQTA 1VBC1 1WCKA 4F3JA 5IVCA 4Y22B 2HWD2 1NCRB 5HBAA 4H7LA 4FBIA 4HMZA 3BTZA 1HRV2 2RS13 2WQ4A 5FZMA 1LCDA 2V4AA 4AI9A 3WR0A 1NW3A 3O1UA 1UZ0A 4Q2FA 4QDRA 4LBQB 1C4RA 2IUWA 5EV7A 3WP3A 3DNVB 3ASIA 4A44A 4AWDA 5LZ6A 2V09A 3T1MA 4PDWB 3ME5A 4LT5A 1KFUL 3M70A 2R072 3JQXA 4IGOA 4XURA 3ZHIA 1RUE1 2ZHNA 1AL21 5EHDA 5A80A 4LORA 2YHJA 2BZDA 4MXVA 1LU1A 5EYYA 4RGKA 4ER5A 3U4SA 3VDDC 4BYYA 3ZSLA 4MXWA 4RQPA 2YBPA 1GR3A 1BK1A 1NX9A 3DKWA 4IWRA 1DFQA 4WM7A 3POIA 3T0DA 2AACA 4DOUA 3IB3A 2JDHA 3GDBA 4HK9A 2Q0AA 1VRH2 2D44A 4Z58A 4OHWA 4ZONA 4NWWA 1QH6A 4RR3B 4LBKA 1RZSA 3P5BA 4RN5A 2JG9B 4MVTA 1G8WA 3IDCB 3VZOA 1GP5A 1W2NA 1XNKA 2RR11 2WO3A 4Q4X3 1AXZA 3B7HA 1HLCA 3TN92 3B69A 4LKSA 3LA2A 4ORFA 2LLWA 1DZTA 1TNRA 5C9AC 3SCFA 3OD0A 1XPWA 4LPLA 5T5OA 1QP4A 2JD4A 2Y0IA 4Q29A 4MG2A 2OZJA 4Q4V3 1VAMA 4D7SA 4IEZA 1QF3A 5C4WC 1WW7A 2DWRA 2OZ6A 5EWSA 4EZHA 3U37A 3HNYM 3VDBA 3IIAA 3WW2A 3KQRA 3N7JA 4Q0PA 4CVUA 5BY5A 2VZPA 4UW3A 4LJHA 2VW2A 4Z5CA 1VMHA 4GHJA 1UOFA 2Q8DA 1OSGA 4DUVA 1DP0A 2CWSA 4XILA 1HW5A 1WD3A 3FHAA 1U5XA 1B35C 2BEOA 5JMCA 5KXBA 2GNMA 1EAH2 1XE8A 5T5PA 3WLUA 2RM23 4OBMA 1OH4A 3A21A 2PXUA 2Q30A 2RV9A 2VMDA 1B09A 1GMMA 5FPVA 1LB2A 3GXUA 1QP0A 4NJ4A 2PTMA 3HWJA 2BOIA 3I3BA 3AZZA 1QEXA 5LRRA 1ZRCA 2WWJA 4I2OA 2UWAA 4FXKB 4QHZA 4QAWA 5M0TA 1PO21 5LA0A 4DEQA 2QDNA 1WCSA 3WNXA 2CGPA 1RUI1 2WN2A 3ACFA 4OUEA 1DLCA 4GMP1 4QX0A 3RI9A 4EE2A 3ZR6A 1ULEA 2CGNA 3BU0A 4C91A 1RJ8A 3VHNA 5GM0A 1EPZA 2BWAA 4XHBA 3K4ZA 1HKDA 2V5YA 4HG6B 3MLFA 2ARCA 2ZHKA 2J7UA 3GCXA 1G6NA 1QJU3 2NN8A 1PVC3 2D6NA 1G9CA 1PNRA 2E6VA 1MR5A 1ASJ2 3HQUA 5FV3A 4AYUA 4O8BA 3F51A 4XMAA 4CPBA 2P3JA 5EJZB 1CZSA 3FFQA 2VZ3A 4I02A 1N1TA 2PELA 1RXFA 2D6OX 2ZMNA 1AR61 1CONA 1D4VB 1YCIA 3KV9A 4GJYA 3MGUA 4MX3A 3HN1A 4YG4A 3HNMA 4BA6A 1GZCA 3OKZA 4C0HA 3ZYPA 2OS2A 3DPRB 2FDJA 3C7OA 1HDKA 3RYPA 4LKDA 3NKGA 1MVQA 2A6YA 4HPKA 2O4AA 1V9U3 3WXPA 3R1FA 3WV6A 4XHXA 3RZMA 2QDRA 1Z7S2 2XJQA 3C7EA 4NWVA 4X8NA 4MO3M 4AI8A 5KC6A 1DGRN 2QZ3A 5GLWA 5EPAA 2AWIA 2PXBA 1XSQA 4LBNA 2K46A 5C6CA 1YQ5A 2JIJA 1TME3 1FNZA 2GH2A 1OBNA 1YXWA 3I54A 5ABJB 2W68A 4W6YA 1L7LA 1D4M1 4PDWC 1LGCA 1FMD2 1JMUB 1BZWA 3N7LA 1LNSA 5AVAA 4C1XA 4JC1A 4Q1PA 4XE9A 4DXZA 3CKHA 3H7JA 3AP7A 3KL4A 3GF6A 2CGOA 1O3RA 2W1UA 1SEFA 3K75B 5FZIA 3LEKA 3OSDA 4NIDA 1HJGA 3CLPA 2EIBA 4V1PA 3ZMOA 3VD9A 2FCVA 1VBE1 2GN7A 5K0UC 2VOTA 4YWAA 4CDQB 1F4AA 1C8M1 3HT1A 1J1TA 4PLOA 3D1NI 1STMA 3WDWA 3WDYA 1AJKA 2I2SA 2XR4A 4QHBA 5A3MA 3TEWA 3FMYA 1ZZ7A 3HN3A 2JG9C 3GYDA 1SCRA 2BWCA 3GM8A 4XZPA 4EWAA 3MEPA 4DUWA 1H9WA 5IWFA 4NUBA 4Z1VA 2Y60A 4OQ8A 2HCSA 2WFF1 5FMOS 1QNYA 2WNVA 4J25A 1POUA 3AMHA 1RMU2 1N3PA 1BYHA 1V6KA 3OUIA 1CAUB 1QJX1 1QWRA 2WZR2 4XUNA 4ZS3A 3I2IA 4MV2A 1IHMA 1KGYA 2VVDA 1PK6C 1XJAA 3VUOA 3OB8A 4XCBA 3J4UH 1HV1A 5JR2A 1CN1A 2AZ5A 3GZCA 1PMHX 1SFPA 3AP6A 2BV4A 3EMRA 3CQOA 2V3CC 4JHTA 3T30A 4X4FA 2XONA 1H30A 4OZXA 4CXYA 1T6BX 1W8UA 1IQDC 2R0FA 5AC91 2GZWA 1JODA 4XXAA 5K98B 1RZRA 2VGDA 3LDRA 4HT1T 4R9DA 2BVBA 1L1MA 3ILNA 4WZFA 1MS4A 2Y6JA 2JG8B 3PHMA 4JTOA 4HZFA 2NQYA 1CJPA 4MHRA 2DBIA 5FZCA 5FZ8A 4RS5A 1FATA 3LA3A 3PJQA 3I59B 2H6CA 2G4IA 3ACGA 1ZBA1 2R49A 3H5TA 5GKAC 1WW5A 2XHNA 5K8SA 1AR72 5LW9A 4QB2A 4WVMA 3NQHA 5EIYB 3F2ZA 4YARA 3WP6A 3VBFB 1PGW2 2OYZA 4BQ1A 4BMBA 1Y9GA 2BOJA 3FBMA 1IG3A 1DYOA 1EUUA 1E5HA 1G9FA 3IKWA 3LIGA 5EFUA 3LISA 2HWD1 1COV2 3ZFFA 3ZLIA 5FTTC 2BNMA 4GH4C 3B9IA 1HRV1 1LGBA 3IN9A 4N90A 5KC5A 1SLTA 3CF6E 4V2VA 2P6HA 2XBO2 3V0AB 4L97A 1R64A 1S0CA 4M0NA 1SDWA 3H9AA 1OLMA 2YGLA 3G0TA 4XQWA 2B4KA 1WH8A 3IPVA 3JD73 4OHVA 4D3WA 4M3CF 4DY5A 5CFDB 2WFPA 1YJKA 3CBNA 4YZ1A 1C3HA 1RIOA 4IGPA 1POQA 2RDQA 3EO6A 3ME2A 2NYYA 5I0RA 3MPBA 2ZGMA 4Z59A 4KWJA 4OHZA 3OCPA 3SC7X 1RINA 1J84A 4E2GA 3H0OA 1UNBA 1J83A 2Q8EA 3LFMA 2XVGA 2F4PA 5ISLA 2PPXA 4YVSA 1W0OA 2P3KA 1QHDA 1S0JA 2VQ0A 3ZN6B 4CUCA 1HXS3 2A6VA 1SQ4A 3EJKA 3PURA 1VRH1 4ZU5A 3BALA 4L92A 1MS0A 3T4HB 1R092 4YFWA 4IE6A 4ASLA 1IKQA 1ZBE2 3AZYA 4CA9A 1JFTA 1Y7YA 2KPJA 1AU7A 3KJXA 1VBA3 5DUUA 5JLVA 4AI0A 4JCYA 5FY5A 1W8HA 3TN91 4F7ZA 3TFLA 5A3PA 1OA2A 1XOYA 1AYN3 4FPFA 5F7UA 1H2LA 2LNMA 4K40A 1HQNA 1TG7A 1UYXA 4CEWB 2E7QA 2IZWA 4Y24A 4DE8A 3LPFA 4BZ4A 3FUQA 4AI2A 2VO5A 3MO4A 4GWMA 5DG1A 5A7QA 2XLGA 2XKPA 3Q8CA 2ZX3A 1MACA 2JB4A 2Y34A 1JYNA 4BB3A 3AFKA 1J1LA 4GQMA 1Q43A 1QKQA 4Q4W3 5A33B 1AF9A 1XWRA 1NAEA 2ARBA 2EIEA 3K3OA 3MHZA 3NAPB 3CJIC 4AEKA 5LY1A 4CCEA 4ATFA 1POV0 1V6JA 3K4AA 1WCDJ 3MIFA 5HV4A 4CCKA 5FXVA 2F4LA 3WW4A 1RHI2 5FZ1A 3J7NA 4ONUA 4MGTA 2ET7A 1UTXA 1CAWA 1RVF3 2QCSB 3FC0A 3V0BA 4A41A 5HI0A 1ULGA 4NRQA 1PO12 1CAXA 1UXDA 1LU2A 3P3NA 5C5UA 1HV0A 4ISRA 5GALA 1B0NA 2HYKA 2VZ1A 4IETA 5FP7A 4HN0A 1Q8QA 3ZXGA 3S5AA 5KBFA 2R63A 2E51A 1QJY2 1YQ8A 4XDOA 3SMHA 5JAXA 1OFNA 4DMIA 1OSLA 4BK4A 5SV5A 4TTGA 2Q5TA 3K48A 1I3HA 1W9TA 1VAVA 2XJPA 4O61A 4K9SA 4XQDA 4ATEA 1MS3A 1POV3 2CAVA 4QPGA 1K5JA 4LUKA 1RJ7A 3KQ4B 4EJRA 2VZOA 5A6ZA 1ASJ1 4BMEA 2L1PA 2JG8C 4QDQA 1LOFA 3PJYA 5FYCA 1BXHA 5FYUA 1RUC3 1N1SA 2VD7A 5EZWA 3WQ7A 2VY0A 2DCZA 4UI9L 3O1PA 4LBQD 5A6QA 1NT0A 3ZYRA 1W6QB 1RUJ3 3QD6A 3NVCA 3PE5A 3QACA 4I3GA 4P9LA 5C8WA 4E27A 2X29A 3ZYJB 4AEMA 1WUVA 4ER3A 4K8RB 3VBSC 3ZKUA 1TEIA 5LATA 1LOAA 3Q8AA 3WZ1A 5BYNA 2WA3A 2BNOA 2EBYA 2WZEA 2VUCA 1FPN3 2XQXA 2YU1A 5L19A 3WQ1A 1PNGA 4QXHA 1LCCA 2WLQA 1Z7S1 4FI9A 4CEYB 1S0BA 2RDSA 2PUFA 4J1WA 1H1MA 5A7WA 5C3RA 1WD4A 1QDOA 1UOJA 4QX5A 4TLGA 5LEJA 1W05A 4YG1A 1W3VA 3UT0A 3LIHA 3VV1A 3ZPYA 4LE4A 5CFDC 5LK7B 2PXFA 1FMD1 2YFUA 2ZKNA 2J1UA 4CUBA 1DQ6A 4XJAA 3M3QA 2BGCA 3JQWA 4NIHA 4AFBA 4Y1YA 2P3IA 1JYVA 1GU3A 3WF4A 3WNOA 2GSYA 3N9MA 3T0AA 3USUB 3ZYFA 4EN8B 2VVFA 1NA1B 4LO6B 5BNNA 3VZMA 2BVVA 3MFCA 2J7MA 1EPWA 1I1EA 2WR9A 3J9SA 3A9YA 2XCJA 3TRBA 1RL3A 1XNCA 3PUAA 2LYLA 4YW1A 2GMPA 2W39A 3HBZA 1LQCA 1N1VA 3IZOA 3MV11 5DSXA 4RQPC 1M06G 2GALA 2V73A 4HKOA 2XL7A 2LUWA 4WM7C 3RS6A 3LZZA 1JH9A 3ABZA 3AJZA 5E89A 4NHLA 2HWF1 2JD9A 3H1WA 1R1A3 2RS12 3AZWA 2D3PA 3HD8B 4FPYA 4C1WA 2MEV3 1RMU1 3TRSB 4UBHA 5J1XA 3ORJA 4M4RA 5LBBA 2BGOA 5DTMA 2WZR1 2PXLA 4QB6A 1KQRA 1O4ZA 2WT0A 2DVAA 3VL8A 4CEWC 4IV1B 3WW1A 4BE3A 4RD7A 4OULA 4AK3A 4E4DX 3UL2A 1RIRA 1F5FA 2XPJA 2IV1A 2YU2A 4NRMA 1YYNA 4QKFA 3AMNA 3C3VA 1YSEA 4IVZA 1SPPA 1XC6A 2R1JL 1F15A 1FXZA 3D8CA 5FRAA 4JDMA 4JDNA 5E16A 3W9AA 2WRAA 2QTWB 1WBFA 1WW6A 2R1DA 3GHNA 2P17A 2XQRA 4ZS2A 4E9KA 4AVVA 1ENXA 1A78A 1IPKA 1OLRA 4FSJA 1K45A 4FFGA 1LOBA 2VECA 1LHUA 4IV3B 1MQTB 1S0GA 4FP2A 4M3CE 5FZGA 3VBUB 5A70A 2H6BA 5F32A 4CU9A 2AGSA 4X4DA 1AR92 2ZAHA 1AHSA 4Y42A 1WLDA 3ETPA 3E1F1 4Q4X2 1RUE2 1HQ1A 4PF5A 1GYKA 4FPHA 1PERL 1OA3A 2QNKA 2HWC2 1Y4WA 2KM2A 1AR71 1H1IA 1H8VA 3GALA 4MUVA 1HQWA 2PA7A 4XUPA 4XMIA 4QU1A 3ZOIA 4Q4V2 1F8VA 2DVBA 4X4BA 3GN5B 2ARXA 2UU8A 4LHNA 3PIGA 4TSVA 1JHNA 3MEJA 3FHQA 4J6GA 5T52A 1AZDA 1VMJA 2HEYF 1COV1 3POJA 4IEQA 4YFZA 2VM9A 2B8MA 3CMGA 3SXWA 3WX5A 2XHKA 4XAAA 1CAVA 4Y1UA 4CP9A 4AFMA 3KS7A 2XBO1 5FPZA 5JR7B 3IAQA 2BYVE 5FXZA 3E6DA 1OC1A 2JDPA 2RM22 3PMSA 1QPZA 1K5MA 4OI2A 5JOXA 4R4ZA 1ZA7A 1JZ5A 4P9GA 4MGQA 4GJZA 4YZ3A 2VVEA 3FUOA 5FXWA 4EN9B 4EROA 3RQ0A 4B7KA 1YLLA 2YROA 2PAMA 1HB4A 1WMDA 4NIIA 4BK5A 1QQP3 3VD3A 1VBD2 3IPVB 1UY4A 4FOYA 3FFZA 5DAPA 5E1RA 3CROL 4Y3OA 3NV3A 3KHBA 1SFYA 3EQEA 4AEDB 3D6EA 4KWLA 1Q8PA 3ALQA 1BBT1 1UMHA 2XI8A 1H6XA 1R091 3VBOB 1BK0A 3PNAA 1OVSA 2JDZA 4UFJA 1ZBE1 1SFNA 2RS52 3VZNA 3VB9A 1HN1A 3KWVA 1ZPQA 3F52A 1PVC2 3AP4A 4ER0A 2X53S 4UF0B 5HCFA 4KGQA 3SNMA 1LHOA 4H7MA 1IPSA 5T50A 2XXPA 4EN7B 2EXHA 3P3PA 4F83A 1JZ2A 2DVDA 2FFHA 1W2OA 4BQYA 2JXAA 1NA1C 2LROA 2VXRA 1RUI2 4CZSA 1EV13 1KITA 3H8OA 3VHRA 1JOJA 1G9AA 3ZFEB 4CDUA 4BLIA 1AX2A 2X5IA 1IC8A 2ZGKA 5FZOA 2BP6A 1ZRDA 1FI2A 1PRUA 1NE4A 1LHWA 1PIV1 2ZHMA 1IS3A 2A1XA 3KF3A 3AYDA 5ACA2 4JCXA 4ZHNA 1AXYA 1UXZA 1V9U2 3JUUA 4QGNA 4R9CA 4M4PA 2DTWA 5C8CA 1H8TA 4F8AA 4QM8A 1GNHA 5JXIA 3VD5A 1JZ7A 3APBA 5JSRA 5IVEA 4AQSA 1RUH3 3ZN4A 2VAUA 2MNGA 1GANA 2D6PA 1JUIA 2RS33 4YW2A 1AR62 2A3WA 4IV1C 1ND3A
chains in the Genus database with same CATH topology
2WNVC 1WH6A 3ILRA 1PO11 1DQ4A 1DLLA 5J7MA 4CRQA 4XTMA 3VDDB 3ZX7A 3ZDSA 1QJY1 1U12A 5DXDA 2EXIA 2DV9A 1IS5A 3TWIA 2R16A 5A32B 1S1AA 1CAXB 3WCRA 2ETEA 1H0BA 1F2NA 4LHKA 2Q1MA 3SISA 4IV3C 3VBUC 4J1XA 4AHWA 4M3CA 2A70A 1NERA 1D4M2 1WGPA 1VPWA 1ULFA 3AKRA 1D0HA 1D2SA 3SITA 4I8TA 2EAAA 1HRI2 1F31A 5AVPA 1ND2A 2XJSA 3H7YA 2OIIA 1A6CA 2WS93 4RS5C 5C4WB 3HMYA 1HIXA 4DS0A 4YVWA 2ZGQA 3FMGA 5B2GB 5DDJ3 3J26N 3ZYGA 4DQAA 2VQAA 3PVOA 3PXPA 1B35B 2K9ZA 4OUSA 4B4QA 5F6LB 2HWB3 3ZFFC 3ES4A 4PLNA 3N7KA 3NWKA 5KHJA 1RUG3 1ZZ8A 1KD7A 4CP1A 4P9WA 2ZAAA 1DG6A 1H1AA 3LWCA 1VLNA 1NE6A 4HL0A 2JE7A 2D98A 4AEDC 2KEKA 3D0JA 4Q4Y2 1YUDA 4MGKE 3VBRA 5AC92 3FX3A 1S55A 4S2GA 4YVSC 3VZJA 5JZGA 4QPIA 3QWGA 2O49A 4AVCA 4XFFA 1WIZA 1UD1A 3B02A 1JFSA 1LMB3 1UZYA 1S0DA 2RS11 4I0BA 5I91A 4AEJA 1JW6A 4Q0SA 1SLIA 1UIKA 1BDIA 3JCIA 3KLSA 4SBVA 1G7YA 1LCLA 1MZFA 3UJOA 1NQDA 5GZDA 4F8DA 4AQTA 3JD72 4K3UA 4O9GA 3MYXA 3ZFEC 1VB4A 5BNPA 4IXLA 2HWE2 1NG0A 1UU4A 4XEZA 2D40A 2PLV3 4OI4A 4YG3A 4QGMA 5JDBA 4XIKA 3JBG3 4YZ5A 2AXVA 3OBRA 1YHFA 5GZCA 4I6UA 4JCKA 3HZIB 4Q8LA 4DINB 1NQJA 4K21A 3J8F3 2GRMA 3UK9A 2BTVC 4DB5A 1HQLA 3MW2A 1CGPA 3E97A 1MS1A 4OHXA 1AR91 4MYEA 1WMFA 1LEDA 3NV2A 2KEIA 3KT1A 4Q4X1 4IA8A 1KFXL 2E9QA 2VNOA 2XKOA 1DHKB 4GB33 2HWC1 1E3OC 4YBAA 1AYN2 3IT8A 4AGGA 2RMU3 1SBDA 4Q4V1 1OPOA 4CDWA 4QQHA 5K0UB 1QQAA 1Y3TA 4H55A 3WG3A 1RUOA 5HCAA 1XYOA 2Z42A 1QU0A 1JWLA 3KCCA 3QH6A 2BPA2 3LFPA 3VHPA 3AYEA 3IM0A 4RHV3 4D69A 3DL3A 5BNOA 2PHWA 4NVPA 3V65A 2QUOA 2RM21 3WP4A 4KG0A 1OPMA 3H8UA 1LOFC 3LCPA 4JV4A 1ZVFA 4OUMA 2AXZA 1Q56A 1PK6B 1GZ9A 1UPSA 5E8AA 1BKZA 1VBD1 2Y38A 4ZU4A 1SMVA 3ATGA 4E2SA 5L7OB 4L99A 4N43B 4R9AA 3N3HA 2PE5A 3GZAA 1FAYA 4JGZA 2UURA 2OVUA 2RS51 4ITCA 3MICA 2WL1A 1PVC1 2EIGA 1XU2A 4IL7A 2VG9A 4JRAA 2XUMA 2XLFA 3MI8A 1RUC2 1T6GC 4I6RA 3E5QA 3MF6A 3TYJA 5K9YA 2FZ2A 2BJCA 3KZ3A 5DZFA 3WP5A 1X57A 2R32A 1X82A 4QD2A 1YI9A 5J3UA 5I93A 2C9AA 5EXOA 2B42B 4X6QB 4JGYA 2PUGA 4U2AA 5BNNC 2HEVF 3PMEA 2LYKA 5ACA1 1GBGA 2GDFA 1V9U1 4LUMA 1W6OA 1W6PA 4GH4B 2R042 1NEQA 5JSOA 2HEWF 4X8PA 3O5SA 5SV8A 1LGNA 4E4ZA 1TME1 3IDEA 2QFEA 3AKQA 4OVEA 2HINA 3MIDA 4Q27A 4AQ2A 4JRLA 3OYWA 4NN0A 3N7MA 5CAZA 2E53A 1AR83 1W6MB 2ES3A 2XVLA 4B4PA 2Z69A 5CNAA 1H2MA 3QOPA 2ZMLA 3ZXDA 2ZGUA 2ZGRA 3BIWE 4RGAA 1SQ8A 2PUCA 5JSPA 1REEA 3S6PA 1OOPA 4EN6B 4EWEA 1M4WA 4N53A 1ONAA 2H8RA 3D4KA 4XF1A 3MZHA 5CG9A 2MEV2 2QVSB 1VJ2A 3C2UA 3VKFC 1HRI1 2OUJA 3O7OA 3AKPA 3ZFGA 1W6NA 3KD4A 1YI7A 4A7ZA 4JAAA 1ZYBA 5CADA 4KG8A 1GV9A 1YFWA 5GZGA 1UKRA 3GBWA 3R05A 3SH3A 3FYMA 4UBGA 4YG6A 3WDUA 3ZVXA 2HWF2 2WUSR 3S30A 1WLCA 1UL9A 1R082 2RJLA 3CJIB 4P9IA 4CDXA 4CP0A 1JYCA 4A7KA 3OQNA 2WT1A 4KQ7A 3JXCL 3ECQA 4BIFA 3BDNA 1DWKA 1KS4A 1O5LA 2D7FA 2WA4A 1LODA 2B9UA 2BUKA 1K5MC 1EYBA 2PHLA 5FBZA 5IT6A 4HSJA 5FQ0B 5JOWA 2R0HA 4COVA 5L7OC 4N43C 1TMF2 3M8LA 2AUWA 4Q4Y1 2UY8A 3KZ4C 2DVFA 3S7EA 3QF3A 4XBNA 1W0PA 2WIUB 4PBPA 4IEPA 3AZXA 1DQ5A 4TZDA 1VBE3 1GSLA 1UMZA 4YM2A 3OY8B 2IWGB 2YDEA 4RFT0 2A3XA 1V6MA 1AVBA 3VBHA 2VOWA 2D97A 1ENQA 3JD71 1NZCA 5GLZA 1XRUA 2HWE1 3VKNA 3S0MA 3VBSB 3D5OA 4I0WB 5CFCA 5H9RA 1WBLA 2FQPA 2IVGA 3ELNA 1QQP2 3FWEA 3ZN5A 1UU5A 1GQGA 1QOOA 1UU6A 5CIRA 4D7YA 3QQ6A 3S8QA 1R63A 5C8CC 4Y1XA 1H8TC 1DGWA 1U5YA 1U5ZA 5D1IA 1ULDA 1GNZA 2DVGA 4GXLA 3WD5A 1N47A 3OD4A 1CVNA 4WVWA 1CQTA 1AYN1 2XH6A 5T55A 2G9GA 1ZZ9A 4PU7A 3R6SA 3RJ2X 1ND3C 3ZMNA 1EV12 3MIHA 4QPYA 5IUQA 3WG2A 4Z2WA 2B45X 3BB6A 1OCTC 1BEV3 3AK0A 3AMPA 1BBT2 3X29B 4X4IA 1JH5A 1LHVA 4MXWB 4PIZA 4RQPB 4FPEA 2CYFA 4XJUA 1VP6A 4WM7B 2A6XA 2XG3A 4LA3A 2FBEA 2EWTA 4P9YA 2PHUA 4B29A 1PZ7A 4AGVA 5KXDA 1AUYA 1QXPA 2RS32 2A6ZA 3ZIXA 5I8SA 1X36A 3M3CA 2YYOA 1NYWA 4P14A 1KJLA 4H3WA 4LEJA 1APNA 5H9PA 2K2SA 1PIV2 5D8AA 2GRLA 1DGWX 2ZZJA 1ND2C 4MLOA 4DY3A 3POYA 3ZXAC 3QH7A 4LE3A 1DZRA 4PBOA 2ZOEB 4XFAA 5JI7A 3VZLA 4AI3A 3PVEA 4YVWC 2R073 3ES1A 3B93A 2BW8A 3GBFA 3I2DA 4KGGA 4XF4A 3V56A 4ES8A 4FO9A 3BOPA 3M2MA 4Y20A 2XGXA 1RUD2 1POV1 1RGSA 2A3YA 1UPIA 4AGRA 1ZRFA 1RUC1 1NLRA 2B7YA 5DG2A 3URFA 1LOEA 2CSFA 1VRH3 2PUDA 2IXLA 4WM8A 1C1FA 1IS4A 1H2KA 2JICA 4JDOA 3FE5A 4S2DA 2WQZC 3PTYA 3JU9A 1NY72 1BJQA 3ZXLA 4DPNA 2ZTNA 1QOTA 4UW4A 3WW3A 4R8HA 5BUVA 2ET1A 4XETA 3ILFA 3WVJA 4G4FA 4G3YC 1CQ9A 4I01A 3U0ZA 1UW8A 1ZRRA 4FOWA 2R041 1IOAA 3H3ZA 2E7TA 3VBRC 5FLHA 1Y43B 2GNDA 2UWCA 4FOVA 3N36A 4N7UA 2IXKA 5JZGC 3O0XA 4QPIC 2D43A 1VB2A 1GZWA 2GNTA 4TYSA 3HQXA 4LBJA 4Z92B 1XE7A 4LULA 1IKPA 1EAH3 1O5UA 5F9TA 1MS5A 3LSDA 3W58A 4P9XA 4SLIA 1MEC3 5CU1A 1PZ9A 3U4XA 3BCWA 3NW4A 1S0EA 3FLPA 4HFSA 5BNPC 5C9AA 3LGRA 4DRVA 4HKLA 5KHGA 1OQ1A 3D0SA 5T5LA 4DZGA 4YSFA 1EY2A 3ZHMA 4HPKB 3AX4A 4LLOA 3AM2A 3TOJA 4G9SB 5H9SA 4CP2A 2KEJA 1CD3G 3CNAA 2MEV1 1VIWB 2Y0OA 1MZ6A 3O0VA 1YO8A 2XLAA 3ZSJA 1O3QA 4COYA 2Z2SB 3CJXA 4Y26A 2PLV2 2TEPA 4QXKA 2DCJA 1AYM3 2EVXA 5GLVA 1YJLA 1W6NB 1PM7A 1G86A 4CDWC 2TNFA 5FMOL 1PZ8A 5L73A 2IXHA 1R081 4XBQA 3VKMA 2CTVA 3B94A 2EXKA 5DZGA 4NO4A 3IWZA 2OR1L 3FZ3A 1V6NA 5FO9B 2OW4A 1TE1B 2CV6A 2WNVB 4I6TA 2PFWA 4AXOA 4XFIA 5BNOC 4META 5J37A 4LBOA 2A73B 4PIXA 2WNUA 4LBLA 3O14A 1FOD3 2JVLA 4GB32 3E5UA 4XJ9A 1ENSA 3WT3A 2GH8A 2LTNA 2RMU2 1TMF1 1FMD3 2PHFA 5I0TA 5JI9A 2PHDA 2CAUA 2R063 2WT2A 1H9PA 2GMEA 1AJOA 3RZZA 4FPOB 1J58A 4GULA 2VUJA 2IU7A 4Y22A 1NCRA 2VPVA 4GIQA 4KU7A 2XJRA 4JGZC 4QT6A 3KB5A 4JVAA 1N1YA 3PLQA 2BQPA 1VBB3 2YZ4A 4B4RA 1O4YA 3W59A 1F9KA 2MHFA 1QNWA 4LBQA 2DUOA 3AMQA 3UKTA 1XYNA 3AYAA 4RS5B 1WA4A 1LEMA 4PDWA 3B7MA 4D94A 1Y7BA 4W6WA 3CL1A 1RMU3 2VNGA 4DNYA 1ZREA 3ENRA 1QQP1 3MW3A 2WZR3 4WVMB 2BNNA 1ZVVA 1AL0G 4XDQA 1BDHA 2UY9A 2RHPA 1GQHA 2W08A 1X50A 5F5QA 1E57A 3WUDA 3VKLA 4IEOA 2ZBJA 4HKWA 3ZFFB 4MZUA 3BPZA 1X33A 4FPGA 3AKSA 1WW4A 4RR3A 1AX0A 2ERFA 1WLTA 2JG9A 4FXGB 2K0GA 2P2KA 1GLHA 4YW4A 5J48A 3BS3A 2IXCA 1PRAA 5DUVA 1V6OA 3T1LA 1EV11 3JXDL 2I07B 2EF8A 1WETA 1SLAA 2PHRA 4Q1RA 2D93A 2XL9A 1FX5A 1OQDA 3B00A 4X4CA 2ZKLA 1YIPA 2EA7A 1IQAA 4YVSB 1AR73 1KJRA 3MIBA 4XXPA 1QJU2 4AHZA 5I8YA 3U11A 4BPZA 3VHOA 1QY4A 3H1MA 4ZKTB 5J96B 3T2TA 2IC1A 1OOPC 2G9FA 4N53C 1NXD1 1X7NA 2RS31 2A71A 2GC0A 4LA2A 5FO7B 1PHMA 3UKVA 2JKBA 4AHXA 4QMAA 4JQDA 2ICTA 2VNRA 3SH5A 4NR1A 1FV3A 3F6WA 2NZ9A 3THTA 5CG8A 5EYXA 5E88A 1AR82 3ZFGC 1ALYA 2WJSA 4M0HA 3TBDA 2R30A 2NMOA 1DYKA 4DFSA 3GHMA 5D8AB 3MLLA 4YGEA 1RUD1 5FREA 3OF1A 3B3QE 4Z07A 1TME2 3RMYA 4EN0A 2C5DA 1C5HA 4ASMB 4O9EA 3LAGA 3UJQA 4CDXC 3QYXA 2ZGLA 4K1ZA 4XTPA 5EJ3A 3TB0A 5DUWA 2ZS6B 4LHLA