4J1XA

Crystal structure of fe(ii)-hppe with alternative substrate (s)-1-hpp
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
193
structure length
193
Chain Sequence
TASTGFAELLKDRREQVKMDHAALASLLGETPETVAAWENGEGGELTLTQLGRIAHVLGTSIGALTPPAGNDLDDGVIIQMPDERPILKGVRDNVDYYVYNCLVRTKRAPSLVPLVVDVLTDNPDDAKFNSGHAGNEFLFVLEGEIHMKWGDKENPKEALLPTGASMFVEEHVPHAFTAAKGTGSAKLIAVNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanistic studies of an unprecedented enzyme-catalysed 1,2-phosphono-migration reaction.
pubmed doi rcsb
source organism Streptomyces wedmorensis
molecule tags Metal binding protein
molecule keywords Epoxidase
total genus 48
structure length 193
sequence length 193
chains with identical sequence B, C
ec nomenclature ec 1.11.1.23: (S)-2-hydroxypropylphosphonic acid epoxidase.
pdb deposition date 2013-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 4j1xA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4j1xA02
3BALA 4KU7A 3B02A 3G7DA 2AWIA 2IVBA 3BB6A 1YHFA 4IEZA 4AXOA 1GQHA 1QXRA 1SQ4A 4FBFA 2BGCA 4BYYA 4I0BA 2EWTA 4AQ6A 4X4IA 1IPKA 3L1PA 4TLFA 4QMAA 3UKNA 2WIUB 5I0SA 1DZRA 3GBFA 1OD5A 2PUCA 4XF0A 4PIZA 5I0RA 4EV0A 4PU7A 3LA2A 4JTOA 1CAXA 3E97A 3I54A 2C0ZA 3QWGA 2PUDA 1UIJA 5D1IA 5BY5A 4XF1A 3BCWA 3F51A 5C8WA 1PERL 4YG4A 1H1IA 2OZ6A 4MGZE 2P17A 3OQNA 1S7EA 2MQKA 3ZHIA 2ATFA 2BEOA 4HZFA 4PU8A 3RYPA 4YSFA 1JFTA 4WBBA 2DCTA 3DV8A 4MV2A 3FYMA 5CU1A 1XRUA 4MUVA 2Q1ZB 2AXVA 3KGLA 5FDBA 3H7JA 1WA4A 3QOPA 2CGPA 2GC2A 3QQ6A 3IWZA 1PNRA 5EFUA 1V70A 4QGLA 4Z07A 1NE4A 2Q0AA 1NERA 1ZZ9A 3EJKA 1EPZA 3SCFA 3O14A 5I93A 3S7IA 2IXLA 4BHPA 4IEYA 1RIOA 4I3PA 1B0NA 1R69A 2XGXA 1BDIA 4X4HA 1QXJA 3QACA 2LYPA 2ZKLA 3HQXA 3D0SA 1QP0A 1EFAA 2H0VA 2IXHA 2V09A 4KWKA 3NL1A 1GQGA 2O49A 3CL1A 4FAGA 1I5ZA 1YLLA 1QP7A 4IEOA 2AUWA 4PU4C 3CECA 2B8MA 1UD1A 2QCSB 3BD1A 4JQDA 1DWKA 4UBGA 3H1MA 1LRHA 3RDIA 1NYWA 1LQCA 3CROL 4AVAA 2E9QA 4KWLA 2K0GA 2GAUA 4I02A 4ONUA 1NEQA 1QPZA 3HT2A 1UPIA 2UY9A 2D5FA 3BPZA 1RGSA 4HN0A 5I0TA 1PRVA 1H1MA 2EA7A 4QXKA 2FJRA 1YUDA 4YG1A 4I8TA 5I8SA 3F6WA 3ELNA 4F8DA 3I59B 5E1RA 5I8TA 1LCDA 3IVPA 5EZWA 2GRLA 3IIAA 4R8HA 3R6SA 2UYAA 1RUNA 4X4DA 2PFWA 3OQOA 2ICTA 1LR5A 4B29A 1UXDA 5J3UA 2VPVA 3H1WA 2IVQA 2OZJA 1J3QA 5KHIA 5HI0A 2OPKA 5KHKA 4OB4A 2D5VA 2HKXA 1ZX5A 4WVZA 1UIKA 1FI2A 5LEJA 2CSFA 5BXXA 3WW2A 3H3UA 2EAAA 3DN7A 2B5AA 3ACLA 3OGJA 1WETA 3S7EA 2O4AA 1RL3A 1ZAYA 4XEZA 4Y42A 1LMB3 2MPFA 4IA8A 5JSOA 4UXAA 5FQ0A 4KU8A 2B9UA 4IWRA 2HJIA 3HIFA 2GU9A 4O9GA 5LRSA 2PHDA 1O4TA 4L11A 3U0ZA 3D1NI 1Y9QA 3D0JA 3CO2A 1RPEL 4GHJA 2WC2A 3EO6A 2FMYA 4LUKA 1ZRCA 2IXCA 1NZCA 2QJVA 3VHRA 1CAVA 3UKVA 2LYLA 5K8SA 5BUVA 1O7FA 3JXBC 2IXJA 2BJCA 3KGZA 4I09A 1CGPA 2XIUA 1CAXB 1I6XA 3UKTA 3ZHMA 1J1LA 3I59A 3PLQA 1YWKA 1QY4A 1ZNPA 4MZUA 4E2SA 3H8UA 4IETA 4XETA 3MYXA 4FN3A 1XE7A 4BH9A 3LA3A 5JSPA 3B7HA 1IPJA 1J3RA 4KWJA 5FPZA 2KZ8A 2XKPA 4X4GA 4L2NA 3U3WA 2XL7A 3EUSA 2Q30A 2BYVE 3WW1A 1ZZCA 4LA3A 3H5TA 2QVSB 2PPXA 4YBAA 4IEVA 4HMZA 2PIJA 2ETEA 1QQAA 2WUSR 4Q0QA 4BIFA 3H1YA 1YFXA 4F7ZA 4X4BA 1ZVVA 5BV6A 3SMHA 2KEKA 4IERA 2QDRA 5FLJA 4JCXA 2XLGA 4D7TA 2MHFA 2XKOA 3S8QA 2VQAA 1VP6A 3HZIB 1WH6A 4MGIE 1JH9A 4Q0PA 5FPXA 2ICPA 1ZZ6A 2OA2A 2GZWA 3ZKCA 1WGPA 3ES4A 4JVAA 3QYXA 4HN1A 3NSTA 1DZTA 4MCTA 2ET7A 4MX3A 4QGNA 1VJ2A 3MDPA 2D40A 2PHLA 2Y0OA 4EWEA 4Q29A 2GC0A 5KHHA 2GRMA 5AVPA 4ZU4A 4META 3RNSA 1RUOA 5BPXA 1J58A 2OFYA 2Z2SB 3KMHA 4IESA 3OQMA 3LISA 4I6RA 2IC1A 1YSEA 3CEWA 4Q0SA 1L3JA 3NJZA 2EF8A 3G5GA 3F52A 4D7SA 1DGWA 4PIYA 1BDHA 2LYKA 4F8AA 3FJSA 5JSRA 4EWAA 4Z58A 4JTNA 2PE5A 1VPWA 3CJXA 5FLIA 2PUBA 1XE8A 3CLPA 4CYDA 3ROUA 3SXWA 1UTXA 3BU7A 3DKWA 4O9EA 2I45A 2KXLA 1O3SA 1O3TA 3OF1A 1Y3TA 3UFDA 3RPQA 3ZDSA 3FZ3A 4E2QA 2IU7A 2F4PA 1R63A 2ET1A 2BNMA 2L8NA 3H50A 4MGKE 4X6QB 4I2OA 2H6BA 4PJYA 1YFYA 5F1RA 2IVGA 1EY2A 5KHGA 2KEIA 1J59A 1UXCA 2WFPA 2O38A 4PU3C 1VR3A 2VECA 3EQEA 2EBYA 2FQPA 4ZU5A 5K98B 4X4CA 1YFWA 3BDNA 1CAUA 3NKTA 2GH2A 4QX5A 5CVRA 5LRRA 4K8FA 2H8RA 1ADRA 1UW8A 4IEPA 2A6CA 4LTAA 4E2GA 3SHRA 2CAVA 3CLCA 4IEQA 3N4MA 1UCXA 1Y7YA 1GT0C 3H7YA 4ORFA 2PAKA 3OTFA 1CAVB 1PM7A 2XI8A 1YFUA 4LA2A 1ZPQA 1OI6A 4KL1A 5CADA 5FCCA 4XF9A 1E3OC 4Z5HA 3MPBA 3OCPA 2XLFA 3HT1A 5LEKA 3FYAA 3USSA 5J48A 5JCTA 2IXKA 5C6CA 3LOIA 3PXPA 4H7LA 4XFHA 2PUEA 3KSCA 4RD7A 1JFSA 1OCTC 3GN5A 3PVBB 4O8BA 2O1QA 3DL3A 3GYDA 4XFGA 2Q4SA 1RC6A 2JVLA 4OLLA 1POUA 3I7DA 2XLAA 5JAXA 3RYKA 2LCVA 3FWEA 3RZZA 2IV1A 4XF4A 4I6UA 1CX4A 1QQBA 3KCCA 3JZVA 1Q5OA 2O8QA 4IVZA 4MH0E 4MCXA 3MLFA 5J7MA 3FE5A 3DNVB 5FLHA 1LCCA 2AW6A 2QNKA 2HINA 2XSDC 1IC8A 2PUGA 1RTVA 3E6BA 3LAGA 1EP0A 4UBHA 4LEJA 4XFBA 1X2LA 2D5HA 4QGMA 2XCJA 1ZVFA 4LULA 3FX3A 4P9GA 3RYRA 3U11A 4IEWA 3KXAA 3NVCA 1CQTA 4J1XA 1LLIA 5KBFA 1SFNA 3E6CC 1HF0A 1X57A 1O3RA 4HVRA 1PRAA 1WIZA 5E16A 5I91A 3E5XA 1CAWB 3LZZA 4Z82A 1O5LA 2LYRA 4FBIA 2B5HA 3M3IA 3ES1A 3C3VA 3JXDL 4NDWA 2KPJA 2OR1L 2ZCWA 3IDCB 4QM8A 4Z59A 4QM9A 3CF6E 2JCGA 3GN5B 1EYBA 1QP4A 2PAMA 2XHKA 2PUFA 4N9HA 1ZRDA 2R63A 1U12A 3E6DA 2LYJA 4I01A 3VK0A 4EROA 2AXUA 1O4XA 4I6TA 1X8EA 3TNPB 1PMIA 4AVCA 3WW4A 4MGYE 2L49A 4EWDA 4HVQA 1ZREA 3EHKA 2GC1A 4NVPA 2PQQA 4OFGA 3OD0A 5A7LA 2PA7A 1AU7A 4GQMA 3TNQA 3EBRA 2R1JL 1QWRA 2CROA 3ST7A 1CAUB 1G6NA 3NW4A 4YARA 1DW9A 3LA7A 4Q0VA 2XJ3A 3IBMA 2PYTA 2HSGA 2BNOA 2GC3A 1ZUGA 1ZZ7A 4XFCA 1RZRA 3JXCL 4J1WA 4JCYA 3D82A 4Q0UA 4AVBA 3H9AA 2IUOA 4YRDA 3MZHA 4Z5DA 3L2HA 1CAWA 2XL9A 3KJXA 4IEXA 4GULA 1CJGA 4ZU7A 4HVOA 1FT9A 1NE6A 5KHJA 1LKNA 4X4FA 4YYOA 1TQ5A 4XF3A 2H6CA 3LWCA 4IEUA 1L1MA 3FMYA 2Z69A 2K9ZA 4HLTA 4YG7B 4JV4A 4A2UA 5I0UA 3BS3A 1SQ8A 1X82A 1DGRA 1X8MA 3E5UA 1XWRA 1RZSA 4Z5CA 3FFQA 3WW3A 3U10A 1ZZBA 3OMTA 4AQ2A 1WLTA 5T3NA 2BNNA 3ETQA 4PIXA 4X6RB 4XFIA 3OP9A 2LYQA 5FQ0B 4YNIA 1OSLA 1NXMA 2PTMA 2MEZA 2AXZA 2N7GA 2D93A 1OFNA 1Q3EA 5I8YA 4FT8A 2PUAA 4R52A 4LUMA 4HSJA 3SCGA 1Q43A 4XFAA 1SEFA 1PRUA 1RZRD 4FAHA 2IXIA 1LB2A 2GZUA 4I0AA 3H3ZA 1FXZA 4XFFA 3S0MA 4WZCA 3KZ3A 1ZRRA 1O3QA 2KEJA 2CV6A 4X4EA 2MNGA 3LFPA 3R1FA 1JUHA 2CAUA 1ZS4A 1WH8A 1ZRFA 2UY8A 5JR7B 2OYZA 4HSLA 1O5UA 2UYBA 1JWLA 1ZZ8A 3QF3A 3SCHA 1OMIA 4LLOA 3TRBA 3PNAA 4N9IA 4DINB 1X7NA 3IDBB 3M70A 2PAEA 1J3PA 2EVXA 3E5QA 1HW5A 3O9XA 3FHIB 4HBNA 2LYSA
chains in the Genus database with same CATH superfamily
2W08A 2RS53 1TME1 1COV3 3T0AA 4FOQA 3SR4A 1IS5A 1HQLA 2CNAA 2IVBA 1ZYBA 2HWC1 2RR12 4FPEA 4HG6B 1RUF3 4QXHA 4FVVA 1OFSA 3SH4A 1O4YA 1QOTA 4LKEA 1RYYA 2BERA 4AXOA 1C8M3 1ONAA 4FBFA 1JYIA 2BGCA 3WD5A 4Q26A 3U4SA 4H55A 3W5NA 5FWEA 4X4IA 1F4HA 5FP4A 3PU8A 1OD5A 4XF0A 4PIZA 4EV0A 3LEGA 4M01A 3ZYPA 2Y6LA 2RR13 2WWJA 3A22A 3HN3A 5FKCA 4Q8KA 5A6XA 1ZBE1 3W58A 4JDNA 5BY5A 2E63A 4XF1A 2P3JA 5C8WA 3UWPA 1DDLA 1H1IA 3MW2A 3V64A 1WD3A 2FZ1A 4I0WB 1LGNA 5F37A 4Y33A 2BEOA 1E5RA 2W2IA 3ZR6A 4NPMA 4WBBA 3O1MA 2RMU2 4NRQA 5D8AC 4MV2A 1H9PA 1DYPA 5FDBA 1XRUA 3V65A 5B4NA 1KFXL 1W8WA 3H7JA 5LK7B 1KFUL 3QOPA 5FMCA 4K40A 3WDUA 3QQ6A 1US2A 3IWZA 1V70A 1NCQA 4QGLA 1RUH1 2P5BA 1W2OA 4Z07A 1X9TA 3HN1A 2ORZA 5BNPB 4AF9A 3LFIA 3BIWE 1COV1 3P3NA 1ZZ9A 3IM0A 1NXD1 3KF5A 3ILFA 1AR61 4O7XA 4CA9A 5DTQA 5IVCA 3NXHA 1EV12 2IXLA 2WBKA 3INAA 1DGRN 4NHKA 3VBFA 2W46A 5LWBA 3MUZ1 4QAWA 4WVLA 1OC1A 2JX9A 3B3QE 4LO4B 1RVF2 2UWAA 2WAAA 1QXJA 3OBTA 2BWCA 4Y5TA 2H0VA 2HEWF 3WNXA 3FLPA 1LOGA 3CQOA 1GZWB 3POEA 4LORA 3R09A 5DG1A 1IKPA 5A33A 1G9AA 2MXDA 2XDVA 3J8F2 2UU8A 1QP7A 3NNLA 5JMCA 4PU4C 4JGYC 4GXLA 2WZR3 1UD1A 3BYWA 1UOJA 2QCSB 3HQRA 4JQDA 1LU1A 1RVF3 1UYZA 1JI6A 2E7QA 5FZ0A 3BU0A 4JGYA 1W04A 4QQOA 3WP4A 2W94A 1AR93 3Q8BA 4GH4C 3SEEA 3ZXLA 2WNVB 3LIHA 1QJU3 3RS6A 4FPJA 5F2SA 2NN8A 1OF3A 2VMEA 3VBOC 4AVAA 4KWLA 4GB31 1L7LA 2VOTA 4I02A 5CNAA 4EN7B 1WW7A 4PCRA 5FREA 1U2ZA 2VZOA 5DABA 1QMJA 1VAKA 2D5FA 2Y38A 3PURA 4GMP1 5F5QA 1PRVA 2EA7A 3S5QA 1JN2P 3AM2A 1S0FA 1QJFA 3NZLA 4QXKA 4ES8A 4YG1A 4CU8A 3K46A 4P08A 1I9RA 1F9KA 1GZ9A 2RS33 3QH6A 4RQPB 1REEA 1UOFA 1RXGA 5EYYA 4F8DA 5I8SA 4B7KA 4PBPA 1LCDA 2GRLA 1H0BA 4R8HA 5A7PA 4RR3B 3R6SA 1G9BA 4X4DA 2HLEA 3ZYIB 2PHFA 5DUUA 2VPVA 2NP0A 3IAPA 4GJZA 4FI9A 3HMYA 3UL2A 1AR71 4LMFA 4YLZA 4DFSA 2HEVF 5KHKA 1HB3A 3M9LA 4OB4A 2D5VA 1ZX5A 2VU9A 4KGGA 4OCTA 5JUVA 5LEJA 5DAXA 5FMDA 2CSFA 2B5AA 1WMEA 4B4PA 4RFT0 2ZMNA 1TMF1 3AYDA 2WSUA 5L73A 4YW7A 3KT7A 1W8UA 1RMU1 4JC1A 1AXYA 4P9YA 2DTWA 2RE9A 5JUWA 4UOJA 3VDBA 5JSOA 1HJFA 5FY1A 1A6CA 4KU8A 4XZPA 4ASMB 2VQUA 4QX8A 5FYUA 2DCJA 4IWRA 2DU0A 2DWRA 5FZDA 1HRV2 1D4M3 1O59A 4YVSB 1KDKA 2A3XA 3HIFA 4XJAA 2GU9A 1BBT2 5FYVA 4BU2A 2ZACA 4EK9A 2PHDA 2VXJA 3B01A 1OLRA 4MXWB 4QX1A 2ZGTA 3IKWA 2ZGUA 4HOOA 4A3XA 1OT5A 1H2NA 4ER6A 1YEWA 1RPEL 2WC2A 2X10A 3CO2A 3EO6A 5JI7A 4A7ZA 4CDUB 4LUKA 5AC93 1NZCA 2VULA 3H3LA 5A6YA 2EIBA 1CAVA 1ZBA1 4K20A 4R9CA 4CCOA 4D7YA 1H8TC 3H8OA 1W0NA 3J9SA 1ENXA 1RUH3 5I0DA 1AZDA 2W1SA 4I09A 4I30A 3SITA 1CGPA 4MXWA 4OI0A 1TG7A 1CAXB 1MEC3 3HNYM 3UKTA 4D6SA 5A32A 2RG4A 3J7NA 1UZVA 1QH7A 1R091 2VJXA 3W5MA 5DDJ2 1ZNPA 4FCAA 1RINA 4MZUA 3H8UA 3VLBB 3T0BA 1PGL2 1AHSA 3LA3A 3MHZA 4NMIA 5BNPC 1IPJA 3WF1A 3TWIA 1HLCA 1MEC2 3PMSA 1IOAA 4UWDA 2E26A 3EUSA 1VBD1 2A3WA 3DECA 4ZXEA 4LA3A 5A3NA 2QVSB 1MZFA 4CDQC 4YBAA 1UX7A 2WN2A 4UF0A 2XB6C 2ZGKA 2OUHA 4XJZA 1AR73 3NV2A 2OS2A 4HMZA 1DFQA 4Q0QA 2WUSR 1WLCA 4BIOA 3H1YA 4AVTA 4NOTA 4X4BA 3SMHA 2KEKA 2D44A 4A45A 3AC0A 5FLJA 2D97A 4H3WA 2J22A 3A21A 3K4DA 4JCXA 2BU9A 2MHFA 4AFMA 4N53C 1XXNA 3WG1A 1VALA 3S8QA 3SKVA 1N1TA 3WP6A 4BA6A 2TUNA 4MSVA 4AVVA 4ARXA 2CWMA 4GMP3 2R073 1RUJ2 4UW6A 4YW5A 4PQ9A 2EIDA 2ICPA 5FIXA 3AP9A 1OURA 3ZN6A 3ZKCA 1XPWA 3IIIA 5FY0A 5EV7A 1ALYA 2ZMLA 4LIUA 2QZ3A 2VCMA 3OGRA 2P2KA 1PIV2 3PVNA 5IVJA 2D40A 2PHLA 2Y0OA 5FBZA 1IZ3A 1A3KA 5D2AA 4JQRA 5KHHA 4ZU4A 1MQTB 4J25A 4META 3RNSA 1JYVA 3D5OA 4YM1A 1HV1A 3LDBA 3GZDC 2HBTA 3FBYA 5FY7A 5BPXA 5FPVA 2D98A 3KMHA 3POJA 5JXIA 1VBE2 2WZEA 4XJ8A 5A3MA 3I2GA 2VCBA 4LBQB 4INDA 4YW1A 1YSEA 3CEWA 4Q0SA 1GZCA 1RITA 2L9LA 2OX0A 4N8MA 4D3WA 5F2WA 2BTVC 1XE0A 2HWC3 3M8LA 1RMU3 3F52A 4AL9A 4BPZA 4PIYA 2ZGMA 2LYKA 3FJSA 1MFQC 3POSA 3O1TA 4NRPA 1OF4A 2KM2A 2OQ7A 1P8JA 3AB0A 3WINE 2R0FA 1VPWA 2JDNA 4Y24A 5FLIA 1G7YA 2PUBA 2YPDA 3ACHA 1IKQA 3PUHA 3ROUA 5HCFA 4O9EA 4NR1A 2KXLA 4CDXC 4QQLA 2PHXA 3VZMA 4ZZ5A 4NUBA 4LKDA 3UT0A 3NMBA 2LW8A 1J84A 2HWC2 3FZ3A 3RPQA 4N53A 3VDAA 4I2OA 2ET1A 3H50A 2L8NA 4MGKE 4X6QB 1YFYA 4CCJA 3ZYBA 4LBJA 2B4KA 3DEMA 1MQTC 3KV9A 2HWD1 1UXCA 1LHVA 3DYOA 4N90A 2WFPA 5DZFA 4PBOA 2O38A 1WUVA 4QB1A 2PXFA 4JDMA 2FQPA 4BQYA 5C3QA 2XVGA 2VO5A 3WNKA 2WS91 4CPBA 2EXIA 2NLRA 2VW1A 4QX7A 3NAPC 4RN5A 2GH2A 4K8FA 1UW8A 1ADRA 4DRRA 1Z7S2 5FXZA 3OBRA 4IEPA 2A6CA 3SKJE 3GXUA 2CAVA 3CLCA 1QGLA 1UU5A 2YFUA 1RUE2 2WRAA 1N47A 4O65A 5A7NA 4IEQA 5LASA 2RVAA 4CP9A 2LUWA 3OJBA 1REDA 5EJ1B 5LCWL 2JDAA 3WG3A 1AR92 4XHBA 2FCVA 3Q8AA 3I2HA 1QJU2 5C9AC 2LTNA 3OTFA 5FZFA 2PHTA 3WNPA 2WA3A 5EP9A 3TAYA 3UYJA 1PK6C 4DEVA 1OI6A 1H1AA 1H4GA 2ZS6B 1C8M2 4EZ4A 5C3PA 3Q8CA 5FCCA 5KC6A 3LPFA 2RDRA 4ZS3A 4XF9A 3ZYGA 3KCXA 4Z5HA 3JB4C 1A78A 3I2JA 4WVMB 2JDKA 4BXSV 5J48A 1E5IA 1GOFA 2VQ0A 1POV3 5ABJC 3LOIA 4H7LA 2HWD3 4CE8A 1JOPA 3KSCA 4JCKA 4RD7A 3GN5A 5CKMA 3T4VA 3PVBB 1H6YA 3NNGA 1W3VA 3PL0A 4AR2A 2O1QA 1JYCA 3ZN4A 3AL6A 5A7WB 3GYDA 2FFHA 4XFGA 3MF6A 4IW3A 1NCRC 3I3DA 2VAUA 4UFHA 1DQ1A 2MEV3 2JVLA 4EQZA 4NRMA 3VL9A 3WUDA 1UX6A 3I7DA 3MIEA 1VRH2 4EZIA 5SV8A 4B8EA 2QTWB 2IV1A 3TRSB 1GICA 4ATFA 1QQBA 3KCCA 4LT5A 3JZVA 5FZCA 1SDDB 3SH5A 4MCXA 3MLFA 2Y6FA 3FE5A 2E51A 4PHZA 1CVNA 2W91A 5DDJ1 3E6BA 1S0EA 1IC8A 1R092 1FV2A 1DYKA 1K45A 1YQ8A 2X53S 3LAGA 5GJ6A 2PXUA 4CDWA 1EP0A 2QUOA 2XXZA 1YNAA 4UBHA 1PGW1 4LEJA 4AI1A 5A3PA 4RGAA 2R1BA 4E4DX 3FX3A 3RYRA 2HWE2 4FXKB 3U11A 3J7HA 4GH4A 4LITA 2Y6HA 1SFNA 1O3RA 4CXXA 1X57A 1H2MA 1K3IA 1VBD2 2V4VA 1DHKB 1WIZA 4Y1UA 3AL5A 3DXTA 1GOGA 5E16A 4XQWA 3OEAA 1TEIA 3A7QA 5CG8A 4LO7A 4MXVA 1CAWB 3GCWA 1NZIA 3CKHA 2RDQA 4AEDA 2UURA 3ME2A 2P3KA 4GD4A 2XQRA 1UZWA 4UW4A 2HWE3 4DS0A 3TOJA 4UYBA 1JHJA 1M06G 1LTEA 3M3OA 3ZFGA 1O5LA 2QQPA 3KVAA 4YGBA 2VCAA 3M3IA 3ES1A 1SLAA 1AL21 3K4AA 5JXJA 1CPNA 2KPJA 2OR1L 2ZCWA 4AQTA 2RJKA 4Z59A 4AEDB 3UV9A 1QP4A 1CWPA 1ZA7A 4KQ7A 4Q1PA 2R63A 3RMXA 1LOFC 3E6DA 4LBMA 2PLV3 5F7UA 1LODA 3VK0A 1BJQA 1O4XA 1R081 1SLBA 5T55A 4MHRA 5B4XA 5JLVA 4COVA 2XVLA 5GZGA 3WDWA 2RDSA 1W9SA 2EIGA 4MYEA 4N43B 4NVPA 4P02B 1TMF3 2R32A 4QQHA 1BK0A 4CCCA 3OD0A 4IDZA 3VBOB 5L9BA 2WNVC 3EBRA 4CDUA 2FDFA 2CROA 1CAUB 1G6NA 3DF0A 3I2FA 5IVFA 3RZGA 4NWWA 3VBHC 1ND3C 2ADDA 2HSGA 1ZUGA 2GP3A 5HV4A 4AHXA 1TMF2 1RZRA 2DCKA 1AVBA 3ZXJA 3HNMA 4B3NA 4J1WA 1QJY1 2W39A 2YBKA 3BODA 3JUUA 4DZGA 3D82A 5C8CB 5D8AA 4MGQA 5CKNA 2IUOA 1KDMA 2I07B 2VMDA 3JBG3 5GLWA 4A3ZA 5FZLA 4EJRA 4XUQA 1MS1A 4XW3A 1IQAA 4GULA 3I49A 1POQA 1AYM1 4HVOA 4H14A 3MLJA 1CX1A 2E32A 4Y1YA 3JQWA 4G4FA 2H6CA 4IEUA 5LBEA 1L1MA 3AKSA 4HLTA 1RUD2 1QOOA 3BN6A 1T6GC 3LB9A 4LKFA 1O4ZA 5H9QA 4A2UA 5GALA 4UF0B 4YVSC 2J1AA 2G1MA 3RSJA 1I1EA 1QJX3 1X82A 4ASKA 1N1VA 5C3SA 4ER7A 4JHZA 1FPN1 1ENRA 4XBLA 3JCIA 5GM0A 5ANNA 2BGOA 1AR62 2FCUA 1KJRA 3DPRC 3VBOA 3KS7A 3PMEA 3OOXA 3MW4A 2PTMA 1LEMA 5CFCC 2AXZA 1K5MC 1V9U3 4XBNA 1OFNA 2V5DA 3VD9A 1W6NB 1UMZA 1LOBA 5F5AA 3SCGA 3LEKA 4QD2A 1WBFA 1YO8A 2ILMA 4HXCA 2ZOEB 1SEFA 4XFAA 1PRUA 4PLMA 1RZRD 4AQSA 4FAHA 2AZ5A 1LB2A 1GWLA 3PHMA 1W8NA 2BQPA 4WM8A 4ARYA 2BVVA 5FPUA 1YQ5A 1UF2C 1CZTA 2YUEA 3JD73 5LK5A 2X09A 4OI1A 4X4EA 4JKKA 2CAUA 2JDPA 3L9JT 2UY8A 2W68A 4QB6A 2ARXA 1O5UA 2UYBA 5A32B 4XXPA 1YXWA 5FY4A 2BJSA 3M3CA 1ZZ8A 3TBDA 4Q4V2 4BQWA 3IDEA 2JG9B 3ZKUA 1X7NA 2PAEA 4LHKA 2JE7A 2WUHA 3AZXA 5J96B 5DZGA 4HT1T 1K5MB 4LKSA 1GQPA 1JUIA 1PVC2 2OW4A 4YVSA 2LYSA 2P6HA 2VM9A 2YROA 4KU7A 1ACCA 3G7DA 5FYHA 5IVBA 1JZ6A 3BB6A 4L8QA 4G9SB 3AVRA 3R4SA 1YHFA 1AL22 4RS5A 4IEZA 3WLUA 3WVJA 4R4XA 3DUIA 4C8DA 1SQ4A 2WYSA 3AYEA 4BWOA 4N53B 4I0BA 4AW7A 4HETA 3RGBA 1IPKA 2YU2A 4LBLA 3UKNA 1OBNA 5I0SA 3GBFA 5C5UA 2PUCA 3PIGA 3OPWA 5FBJA 1FAYA 4WM7A 1CAXA 3E97A 1WW6A 1CZSA 1W6PB 1RUF2 1UN1A 4R9BA 3W59A 3WOGA 5L7OC 1BVVA 1SBEA 2ZABA 5FYSA 2RMU1 5D1IA 2B39A 3RZLA 4Y20B 2QQNA 4BK5A 5FP3A 4CDQB 3AYCA 5A3TA 1PERL 5JZGB 4YG4A 1OVPA 2W3JA 4FPFA 2WZPP 2CGNA 3IN9A 5FYIA 2OZ6A 3I2KA 2P17A 3OQNA 1S7EA 2J1RA 2WAOA 3AJZA 4HZFA 4EN8B 4X8NA 2XBO2 4B4QA 2XUMA 3R4DB 4CCMA 1ND2A 4F83A 2JEMA 1FATA 1NY71 4TYSA 3ZFEA 1W9TA 3Q8EA 1MS9A 3KV5A 3RRDA 5EFUA 3SC7X 1PNRA 5GLVA 2PMWB 1LNSA 5CYYA 4DXRA 1NE4A 3BI3A 3FC0A 2GNTA 4CUBA 1FOD1 1NQDA 1B35B 1MS8A 1Q8SA 5GKAC 5IAVA 2HWB3 3UGHA 5KR7A 3PVOA 2R041 1RHI2 3O14A 4W6YA 3S7IA 1W8HA 2GP5A 4BHPA 2YC2A 5EIYB 4XYXA 2RR11 4I3PA 1R69A 5FMOS 3VKLA 3A9YA 1W2AX 2LYPA 3HQXA 2IXHA 4IGPA 2Y8KA 2XXPA 3ECQA 5E88A 4TSVA 1GQGA 1PM4A 1UMIA 1GR3A 3UGGA 4FAGA 1I5ZA 1RHI3 3RZMA 2ZGLA 1EAH2 5T5OA 3D8CA 2AEZA 1PO23 4XMIA 4M0NA 2B8MA 3R05A 2WFF3 3BD1A 1OOPC 1VBA3 2G4IA 4UBGA 1SLIA 1HX6A 4BLJA 1LQCA 2AR6A 4LOSA 1MQTA 1VAVA 5JZGA 3H8RA 1US3A 1LENA 4C90A 2XPJA 3M2MA 2ES3A 4E8DA 1JMUB 3HD8B 3AZWA 3I3BA 5A7OA 1QPZA 1SG3A 2Y0IA 2UY9A 3AVSA 2RS11 5CAZA 2WFF2 4HN0A 2GALA 1H1MA 4LBQA 5JR2A 3BTZA 2DURA 3PTRB 2PXTA 3GZDA 1W6QB 2A70A 4V2WA 1W8OA 1GSLA 4OZOA 1FX5A 1WMXA 2ID4A 3F6WA 4ZKTB 3QD6A 3IVPA 5EZWA 5FP9A 1JTZX 2GH8A 3IIAA 4XBQA 1RUNA 3TB0A 4B4RA 3OQOA 3MV11 3MICA 1W0PA 4B29A 1UXDA 5FY8A 5AFBA 2OZJA 5FPBA 4FPYA 2HYKA 3WDVA 4Q1RA 2HKXA 2RS32 3KB5A 2JXAA 3N9PA 4WVZA 2VTXA 1YJKA 5BXXA 3WW2A 3AP5A 3NROA 1HRI2 5JXHA 3ACLA 4DMIA 1MZ6A 4AFAA 1QKQA 2VW0A 5EPAA 1UY0A 2TNFA 4ISQA 2O4AA 2QQOA 3S5AA 2WN3A 3BVCA 5A33B 4C0BA 1SFYA 4BXFA 1ULCA 3ZN5A 1LMB3 1U5YA 4IA8A 3CNAA 3RWNA 2YDEA 2X5IB 4Z2WA 3SX0A 1TME2 2UWCA 3MEJA 4FFFA 4OMDA 2JENA 5F5IA 5K0UC 1QF3A 2E7AA 2VBBA 1QQP2 2BV4A 4JGYB 5DUWA 1W8TA 4O9GA 2ADEA 3WF0A 4FTBA 3LF7A 2ZTNA 2C1FA 4CP9B 1Y9QA 1WMDA 2D6OX 2ZKNA 3D0JA 1ENQA 1MPXA 1W6QA 1QH6A 5F6LB 4CDXA 1G9DA 3PTYA 2OXBA 1ZRCA 2QJVA 1POV1 2HEYF 3EB7A 4FFIA 1RUE1 2FBEA 5JVVA 2IWGB 3UKVA 2LYLA 1HRV3 3MF9A 3THTA 5K8SA 3NDBB 1BBT3 5CFDC 3ZYJB 1W90A 1TNRA 5C9AB 4FOWA 5FZ3A 2A6WA 4HKWA 1I6XA 3T09A 5DZEA 1BZWA 2W1QA 3OUJA 4XABA 1NA1C 5F8PA 4FPGA 3C7OA 3I59A 3VBUB 3PLQA 1YQCA 4CCEA 4N7IA 1QY4A 3MO4A 1H2KA 5FV3A 3ZSLA 1W9FA 5FO9B 4IETA 3OKZA 3B93A 5IATA 2RHPA 4XETA 1ND2C 3MYXA 4MGSA 3TELA 3ME5A 4ZS2A 3WP5A 4YPJA 1QOSA 3B7HA 1J3RA 3GZTB 2RS13 5FPZA 1PNFA 1YI9A 2XKPA 1HJGA 4L2NA 5AC91 3U3WA 3VGIA 2AREA 4AEKA 5FFOC 4Y1ZA 1IS3A 3WHUA 1KD7A 1OD3A 3H5TA 4NE9A 5CIRA 2NQYA 2YBSA 3VBFB 4IEVA 1G86A 3N3HA 2PIJA 3LKJA 1WCUA 3OPZA 1EUTA 4QKFA 3OGVA 2BFUS 4XPVA 4F7ZA 1LHWA 1ZVVA 3ZFGB 4ASLA 2YBDA 1RIRA 2QDRA 4UW3A 2WR9A 5DPNA 5JPNB 3UK9A 3R4UA 2XKOA 4C1XA 2JDYA 2HYXA 4CDXB 2VQAA 5FP8A 2C9KA 1VP6A 3DKQA 5BYNA 3GDBA 4BLIA 5FUIA 1ZZ6A 2OA2A 4ZHNA 2VG9A 3GBWA 4S2HA 1CONA 3QYXA 4HN1A 2DV9A 1V0AA 3THPA 1E57A 4XQDA 4B7EA 2ET7A 4MX3A 3H0OA 5DG2A 4PLNA 4YFWA 5LATA 5IHRA 1NY72 3I3EA 3CZUA 1KRIA 3TFLA 3LD8A 3OGSA 4LIVA 5AVPA 3ZPYA 2ZBJA 3LIGA 4Y1VA 4LR4A 5FYBA 4F3JA 3J7MA 4Y5SA 2D6MA 4DXTA 2YGLA 3DYPA 2OFYA 4P00B 2R042 5IUQA 5CA6A 5IYYA 1PO11 1SZBA 5F5CA 2BW8A 2W1UA 1N1SA 1C8M1 4P9IA 3ON7A 2LM3A 5DRYA 2EF8A 3NJZA 4JZRA 5T5JA 3AKQA 1HRV1 1ENSA 4NAMA 2XJRA 4ER0A 1BDHA 4GMP0 5JSRA 4W8JA 1UYPA 2O8OA 2E33A 1VBB1 2X8KA 2YC4A 3OG2A 4XCBA 1K5MA 1XSRA 4CYDA 3SXWA 1UTXA 3DKWA 3F95A 2XMLA 1UWWA 4YG6A 2EXJA 3OF1A 3T0DA 3UFDA 3ZDSA 2VTXJ 2EALA 5BNOB 5D21A 1R63A 3VN4A 1W2UA 4QKBA 1R64A 4RS5B 4Y22B 1YQ2A 3MBWA 4DE8A 2WZR1 5KHGA 2JQEA 2KEIA 3IMMA 1SPPA 2R16A 4MO3M 5EXOA 1W03A 4PU3C 2VECA 3EQEA 2EBYA 2XJQA 4IE0A 2VZ3A 1J1TA 5LA1A 1ZRIA 1Q8PA 1QNYA 2WL1A 3KWVA 2AC1A 3PJYA 4ZU5A 1HQWA 4ATEA 2FZ2A 2DCZA 4XXAA 3NKTA 4Y22A 1OUSA 2H8RA 4QU2A 4ZPIA 5ERLA 5C8CA 3H8XA 2XR4A 2QQJA 3PJQA 4PF1A 5IFTA 3RZJA 1U5ZA 2BVBA 3NV1A 3NQHA 1VMFA 2HWB1 3POWA 3VKNA 1CIYA 4HFSA 1GT0C 2C6SA 3MIBA 3H7YA 4NHXA 4K6BA 4ORFA 4XUTA 3OUHA 1LGCA 5H9PA 3V0BB 1IG3A 4LPLA 1PM7A 2WA4A 3ZFEB 1YFUA 1Z7S3 2Q8OA 4LA2A 1Q8QA 3MFCA 4M3CF 3S6PA 5CADA 2ZGNA 2VCCA 2IVJA 2B45X 2XJUA 2YZ4A 3IMNA 1UL9A 1E3OC 3CIHA 2Q8CA 2VBPA 1R1A1 1UXZA 2WWUA 2XLFA 3HAGA 3HT1A 5LEKA 2R0HA 4S2DA 5JCTA 4DXSA 1PMJX 4NIGA 5FTTC 3V0BA 5FYZA 3ZSMA 4CEWC 3PXPA 3J8F1 4DOUA 4QQ2A 2PUEA 3SQOA 1JFSA 2EXHA 4LBKA 3O1OA 2I2SA 4RGGA 4YG0A 3NRUA 2Q4SA 1JZ5A 1R093 5LA0A 4GIQA 4OLLA 1POUA 1YCIA 3QCWA 2ZGRA 4UI9L 4BQ2A 4E8CA 3RYKA 4GWIA 4Z8BA 3FWEA 1O8PA 3ZSEA 1VBB3 4XF4A 4I6UA 1CX4A 2DVDA 2GN3A 2RJ2A 4M3CE 4Q4Y3 5FK7A 1Q5OA 2O8QA 3VUOA 4YW3A 3O1PA 2D3SA 2VH9A 5FP7A 5FZAA 2EXKA 2BPA2 3MIGA 2AW6A 2HCNA 3NNJA 1VBD3 2XSDC 3W21A 1RTVA 3T1MA 4DY3A 1UXXX 2RM23 3OPTA 2JG9A 1AR81 2PXKA 4Y20A 4XAAA 1ZVFA 4UAPA 4CDQA 4LOTA 2E6VA 4P9GA 2X5IC 5IK5A 4IEWA 3KXAA 1GYKA 1PK6A 3NVCA 3NO8A 2BP6A 2D3PA 2VMGA 4XE9A 1PRAA 4YM3A 4FTEA 2VUCA 1CR7A 3J8F3 2XWJB 3N7JA 1W6MB 3ZXKA 3E5XA 1QB2A 3T2OA 3GHNA 1JOJA 1OH3A 3ZLIA 2HBUA 3OBAA 2CYFA 3T4HB 4XOGA 2V73A 3GM8A 3K51A 3GALA 4AGRA 2XJVA 1B35A 1S0CA 2LYRA 4CXWA 4NPLA 2B5HA 1C8NA 3C3VA 1X50A 1PX4A 2WNEA 3IDCB 1ST8A 4JX0A 2JWPA 3CF6E 1XNAA 1VRBA 2PAMA 2XHKA 5DUXA 5FR3A 4N9HA 3I2IA 1L7QA 5C71A 1LU2A 4OUSA 1VB2A 4I01A 5E8AA 2AXUA 4CEYB 2ZX4A 1V00A 4IV1C 5LZ6A 3TEYA 4I6TA 4IV3A 1PMIA 5J98B 3T3YA 3N9MA 3TNPB 3WW4A 1BBT1 2L49A 3ABZA 4URTA 2K2SA 1BXHA 4DO0A 3AKPA 3WQ1A 4HVQA 2DVBA 3EHKA 1F31A 2GC1A 3K75B 1UZ0A 3WNMA 1C5IA 1XSQA 4V1PA 4A7YA 2I74A 1AU7A 4WM7C 1KITA 3ZMOA 4ER5A 3TNQA 2AACA 3NW4A 1C5HA 2W47A 1A8MA 3ZXDA 1DW9A 4GKYA 4HRAA 5B2GB 4KBBA 2XJ3A 4XAEA 3VZJA 5GZDA 2D6NA 1M4WA 4YVWC 2A6YA 3V56A 3JB8A 4XDOA 4Q4X2 4UFJA 4PI2A 3AP4A 1VBC3 3DCQA 4QB2A 4XFCA 3AMHA 5DAPA 1N3QA 3JXCL 1XYNA 4NIHA 3NJYA 3UNPA 4QPGB 4LBNA 4Q0UA 2GMMA 5F32A 5DTRA 4YRDA 3W9AA 4COWA 4XDQA 3MZHA 2RM21 1EPWA 4Z5DA 1E5HA 5F6KA 2VUJA 5FK8A 2C24A 1CAWA 2B7YA 3M3QA 3U78A 1SLLA 2QDNA 4DRVA 3WQ7A 1CJGA 1WMFA 3MEPA 3POYA 2BDRA 5FXWA 2JE8A 1OHFA 2FDKA 3LDKA 2WQ8A 1XU1A 3KM5A 1LKNA 1TQ5A 1XNTA 4WVMA 4XF3A 3LWCA 1DZQA 3FMYA 2B9VA 4IE7A 2ZEYA 3GUUA 1GWMA 5I0UA 4QPGC 1V6LA 1SQ8A 1VMHA 4EKIA 4EKGA 2W0XA 1UZZA 1XYPA 1A8DA 2CHHA 2VL4A 4Z5CA 2E53A 2Z4FA 3U10A 1ZZBA 4IE5A 3WW3A 4AQ2A 2FDIA 2LROA 2YPJA 5T3NA 2GNDA 4XFIA 3OP9A 1LOAA 2X5IA 4YNIA 2QQIA 1OSLA 1NXMA 4QWNA 4XUNA 3WF3A 5C3OA 3U75A 1Q3EA 1FPN2 5FYTA 5FZ4A 5I8YA 4ISRA 2QQVA 2ZHNA 4LUMA 4R52A 1ASJ1 1IG0A 5L7OB 1IHMA 3ACGA 3AMPA 3PUQA 4U36A 1UNBA 1JYNA 3FL7A 5T50A 1AYM3 4K9SA 4COUA 1KS5A 5FUNA 1DYOA 1NT0A 2B46X 3NAPA 1FXZA 3ZXAC 1ZRRA 2A6VA 3B5LB 2KEJA 1WW5A 1FPN3 5FJKA 4RHV1 1ZS4A 3VZLA 2J1UA 3PUSA 1YRZA 3WP3A 1Z0HA 4JHTA 3KLSA 1S0JA 5JR7B 4E9KA 4UFIA 1AYM2 4HSLA 1COV2 2FCTA 3QF3A 1OMIA 3TRBA 3PNAA 4XILA 4DINB 1C1LA 3IDBB 2R1DA 3M70A 4XC9A 2EVXA 2P37A 1APNA 1RUE3 4A4AA 1H9WA 3QBQA 2R072 3E5QA 1HW5A 3HEIA 5APAA 5DRTA 3N7KA 3FHIB 2WS93 4LK6A 1S2KA 4L92A 3B02A 4UFKA 4BE3A 5DMYA 3MIHA 4WZFA 5FZ8A 4QPIC 1ZBE2 4OHWA 1QXRA 2YU1A 4L9BA 3POFA 3MI8A 5BNOA 2B42B 4YVWA 3L1PA 4TLFA 4QMAA 4DUXA 3KQRA 3D4KA 5A3LA 2RS52 5HXVA 1DLLA 1URXA 3RJ2X 3WF4A 2XBO3 3LA2A 4CU7A 1JZ2A 2C0ZA 2A3YA 3ZFFB 3ENRA 5JI9A 2PUDA 1UIJA 4N43A 5A3UA 4RSUA 2Y33A 4YW6A 3BCWA 4TLGA 3VB9A 4Q5OA 4AOCA 1XNDA 1Z7S1 5HCAA 1OPOA 3DPRB 5EWSA 3ZHIA 1JBCA 4N7UA 3LEMA 4KH9A 4PU8A 1BLZA 2WIIB 4YSFA 1JFTA 3LFMA 4IGQA 1W05A 3DV8A 3A4UA 3FYMA 3M7AA 3ZFFA 1PIV1 1VRH3 2DCYA 4K21A 4K7JA 4MUVA 2Q1ZB 2AXVA 1VBB2 3FLTA 2WO3A 3KGLA 4IQPA 4WM8C 5A3WA 1U5IA 2CGPA 2GC2A 3O7OA 4E4ZA 5D8AB 3S30A 1NERA 1WKYA 3EJKA 5DTMA 1SACA 3UJOA 5I93A 3VZNA 2RMU3 3OY8B 4FO9A 1OOPA 4QX0A 3AZYA 4IEYA 2HWE1 1GU3A 1B0NA 2J1VA 2P4EA 1UKRA 4EN0A 3QACA 4X4HA 5L36A 3U1XA 2ZKLA 4QKNA 3D0SA 5FZ6A 1QP0A 1EFAA 1XC6A 2V09A 4KWKA 1QU0A 2WT1A 2Y6GA 4IL7A 4W4ZA 1ULGA 3VDDB 3O1SA 1T2XA 1XB9A 1T6BX 4CRQA 1JU4A 3BTAA 3K4ZA 4CVUA 3OY8A 5FWJA 5J37A 4RYDA 1DU3D 4DY5A 2AUWA 3URFA 1RUI2 4IE4A 4A44A 4CP1A 1FNZA 2FHRA 2JD4A 4EZHA 4QQPA 2NM1A 3CZJA 5ISLA 2FDJA 2QQWA 3DYMA 5IK4A 2AGSA 3H1MA 2VEOA 1LRHA 2WKKA 2AYHA 1W6PA 4GKXA 3RWKX 2Z79A 1EAH1 3IPVA 2R49A 4MLOA 4QHZA 1IS4A 2W52A 4XUPA 4A6OA 2GAUA 3MUY1 4HL0A 2PXBA 1SPPB 1NEQA 4ONUA 2BRTA 3WXPA 5AFEA 1GLHA 1RUI1 2AENA 5C3RA 5ANQA 4PT6A 5I0TA 1SDWA 3NV4A 3A0KA 3WY6A 5K4LA 1PX3A 2XBO1 1AYN2 1YUDA 3LCPA 2PLV2 4Q4W3 5JWPA 4W6WA 5FZ9A 1O91A 1UPSA 3ELNA 4BQ4A 4Y3OA 5JOXA 5E1RA 4XVHA 3RI9A 1W8FA 2ZZJA 4XCAA 2QQKA 1QJX1 2PN5A 3I4IA 2PFWA 1LR5A 3N9QA 5J3UA 3H1WA 3I3QA 3ILRA 3L2YA 1OLMA 4HANA 4XTPA 5KHIA 1PHMA 2A6ZA 2OPKA 1DQ4A 1ULDA 2VNOA 5HI0A 4FTSA 1HKDA 4JDOA 3VD4A 3GGLA 1AL0G 1FI2A 1UIKA 1NAEA 2R063 2W95A 3N9OA 5L9RA 5T52A 1V9U1 2YYOA 1OA4A 3DN7A 2ZGOA 5CFCB 1D4M2 3ZVXA 2WQ4A 3N9NA 2JD9A 2KA3A 1HQNA 3S7EA 5BNNC 2JICA 1ZAYA 4AFCA 4XIOA 4P14A 4Y42A 2C5DA 3LPGA 1GZWA 2JIJA 5LBFA 1PNGA 4K8RB 1HB1A 2RJLA 1C1FA 4L99A 2ZPXA 5A1LA 2B9UA 3Q8FA 5FQ0A 3GCXA 4TN7A 2GMEA 3RJRA 2WQZC 1HRI3 2JKXA 2HJIA 1YJLA 1ASJ2 3VBUC 5LRSA 4CEWB 4AEMA 3U0ZA 2KD7A 2WT0A 1UOGA 2CWSA 4GHJA 1GKBA 1PVXA 5CFDB 1N3OA 1DLCA 2FMYA 2WABA 4MG2A 1DCSA 2ZJCA 2IXCA 3KQ4B 2NZ9A 4QT6A 4QX2A 4Y26A 3VHRA 5JDBA 3U07A 5F9TA 5KXDA 1XJAA 4QXBA 3WG2A 4D6QA 1QQP3 4ZONA 2VTFA 4AK3A 4CUCA 1LEDA 5FY5A 5BUVA 1LHOA 3HJRA 5KWRA 4BMEA 5C8CC 2XIUA 1WCKA 1B35C 2XOMA 5LB6A 1S1AA 5CFDA 2WNUC 1I3HA 2VZTA 4MHUA 2WYFA 3POGA 4E2SA 3MV01 3KZ4C 1BMV1 5A80A 2ODRD 4FFGA 3A9ZA 2ARCA 1DGWX 1W9YA 3F2ZA 5FYMA 4Q4W1 4OUMA 1S55A 1OVSA 3HVDA 4RFRB 3VBFC 4KWJA 4WVVA 3PU3A 4X4GA 1Y43B 2ZXQA 2DF7A 1FOD2 2Q30A 2XL7A 2BYVE 1JZ3A 3NWKA 5DQ0A 4RHV2 3AXEA 4NWVA 1L7RA 4C91A 3OUIA 3RMYA 4RA0A 2BGPA 4BIFA 4BM8A 3THDA 1RVF1 2CDOA 3LSDA 4IERA 2JIGA 2WINB 4KG0A 3M1HA 1PZ9A 1CN1A 2DDUA 2K46A 2VNGA 2DUQA 3PIJA 3HZIB 1WH6A 1CIWA 1LESA 3ZSKA 3W20A 5CB7A 2Q8EA 4CP2A 5FZMA 5FPXA 3O1RA 4J6GA 5LW9A 1AX1A 3ES4A 4M3CA 4YGEA 1FNYA 4JVAA 4CEYA 2G9FA 2PELA 3JBG2 3NNMA 3NSTA 4JKMA 5FO7B 1DZTA 1VMJA 2KR2A 2VUDA 1RUC2 4MCTA 2YC0A 5CKQA 4QGNA 2VGDA 3BPSA 2JDMA 2Z5WA 1D7PM 4QKDA 1F2NA 5GLUA 4EWEA 4Q29A 2R30A 3D3AA 5IVYA 3SNMA 2GRMA 3WCRA 3GF6A 1LOCA 4S2GA 4NIIA 5K0UB 1FMD1 5JOWA 1K12A 2Z2SB 5F39A 4IESA 3G0TA 3OQMA 1RHI1 1PO13 4I6RA 2G9GA 2VOVA 2YBPA 4L0PA 4PDWA 5F3IA 2X05A 4BDVB 2PHWA 4D8MA 1KXGA 4E27A 1SHWB 1WA6X 2V4AA 3GZCA 1HXS1 4XUOA 1Q56A 2PXDA 1G8WA 3G5GA 1OA3A 1QJY2 4Q4V1 2D6LX 4FOVA 4F8AA 2DVAA 2BOIA 4Z58A 4FP2A 5DT2A 5IK7A 2PE5A 3O0WA 3CJXA 2VQTA 5KXCA 3ZYFA 3CLPA 5FYYA 4EE2A 3EMRA 1ODMA 3MLKA 1UU6A 3T30A 1O3TA 2Y6JA 3AP7A 3AFGA 1Y3TA 1ZBA2 3C7GA 2GNMA 2RV9A 4R9AA 4E2QA 1RMU2 5HPOA 1K5JA 2LRPA 2DTYA 5A7WA 1AUYA 4IV3C 2OKXA 2IVGA 2J1SA 4M3CB 1W2NA 1EY2A 3VZOA 3WF2A 2D6PA 1ULFA 4Y4RA 2WO1A 1UAIA 1C57A 2WDBA 1W3XA 5FAXA 3RQ0A 4DXZA 5FO8B 5K98B 4X4CA 1YFWA 2P1BA 1SBDA 3GZEA 4HONA 4YGCA 5L9VA 5JZGC 5LRRA 5A1AA 3LOBA 5F3GA 2PQSA 4LTAA 4E2GA 5EYXA 1PGW2 1PO22 1HXS3 3NV3A 4PDWB 3N4MA 1UCXA 3I2DA 4QDRA 5HXMA 3VV1A 4LHLA 2QQUA 2SBAA 1H8VA 3NNFA 4NHLA 1Y7YA 1NA1B 4UT5A 2CSGA 4NAOA 1PVC1 2WWSA 2PAKA 3PE5A 4LNVA 5T5PA 1SLCA 2XI8A 4DQAA 3HPNA 3EXUA 1ZPQA 3WDXA 1KJLA 1V6KA 1GNZA 1HXS2 1ND3B 4GWJA 1UQXA 2VOXA 1UMHA 4CDWC 3OCPA 3HR9A 1DBNA 3OGGA 4OZXA 1S0BA 4Q4W2 1MR5A 3FYAA 2IXKA 2PHRA 5C6CA 4JGZB 3HQUA 1GOHA 2VMCA 1GMMA 4GWNA 3PDQA 3LSEA 5F3EA 5FZGA 4N43C 1MS5A 5LBBA 4QPYA 4XQ4A 1DULA 3VDDA 2GSYA 5LY2A 2PHUA 4PF5A 4XACA 1JXNA 4Q8LA 3RFRA 3VBSC 5A70A 2W92A 2VVDA 1KGYA 5JIAA 2IFRA 4AI9A 2LCVA 5FKBA 3RZZA 5BNOC 5JAXA 2EAKA 2BBAA 4IVZA 4MH0E 3B69A 3WQ0A 4SBVA 4CCDA 2BUKA 1AR82 1Q8OA 1UO9A 1UU4A 4TWTA 5FLHA 1TNFA 2HWB2 2PXVA 2QNKA 4D6RA 4BQ1A 2PUGA 2YB7A 5T5LA 3POIA 2YXSA 5DAVA 1H4HA 1V6IA 1BVP1 4Q4X1 3AK0A 1HQ1A 2D5HA 4QGMA 4Q4Y2 1QEXA 1GNYA 3P3PA 3ZXEA 4OHXA 2J7WA 1LLIA 4DNYA 2W5FA 2BZDA 4YZ1A 3ORJA 4HVRA 1DQ2A 2ZGSA 5FMBA 5I91A 1GBGA 3JD71 2JE9A 3WZ1A 1H6XA 2M4HA 1RUI3 4JGZA 4UFLA 2WZR2 3LZZA 4RGKA 2J7MA 1TZOA 1W99A 2NMOA 5FZ1A 1RUH2 5TSWA 2XQXA 2P6CA 4MVTA 1XYOA 4IGOA 4Q2FA 4YW2A 5FZHA 3I2OA 4CPBD 5DAWA 3JXDL 4NIDA 4NDWA 4CXYA 1OOPB 3Q9OA 3DM5A 2QBXA 3KF3A 4QM8A 2D7FA 5AVAA 4QM9A 5LY1A 2JCGA 3GN5B 1UY1A 5FYCA 1H8TA 3GBGA 2CU5A 5H9RA 3KVBA 3WR0A 5ACA1 1ZRDA 1AYN3 1OKOA 2JDHA 4RQPC 2LYJA 2VUAA 5FUPA 4EROA 2QZ2A 1NLQA 4AI8A 4LE3A 1X8EA 3PUAA 1GFF2 1QQP1 5A7QA 3MFAA 4AVCA 4MGYE 3ZFGC 4R9DA 1KQRA 1ZREA 4Q4X3 1RJ8A 4CEWA 1AJKA 2PQQA 1S0IA 3C7EA 1HN1A 1IS6A 4UW5A 5A7LA 3ZSJA 2ARBA 3C7FA 1SBFA 2RDNA 3T2QA 1RJ7A 3AMMA 3CDZB 4GQMA 3KT1A 4ZXKA 4NN0A 3ST7A 1UY3A 2D3RA 1POV0 3ZOIA 4YARA 3IPVB 4LO8A 5JPMB 4JRLA 4Q0VA 3CHXA 3IBMA 1HRI1 4OMCA 1LHUA 2GC3A 1HIXA 3VD7A 1V6OA 1YQ6A 1PK6B 1RUJ3 2O14A 3WT3A 1H30A 1E5SA 4AYUA 1XQNA 1F5JA 1RUC1 3H9AA 4AVBA 4IUGA 3SH3A 1W39A 2A7AA 4YZ2A 3T2TA 3P1IA 2XL9A 3KJXA 1WD4A 1NW3A 3N36A 4XURA 4XIKA 3ZKYA 3IAQA 5GLTA 1NE6A 1WW4A 2Y6KA 4FPOB 5KHJA 5CISA 1MACA 4X4FA 1QJEA 2VR4A 2ZHLA 4YYOA 2R043 1PZ8A 1D4M1 1VBE3 3AP6A 4OQ9A 1V9U2 4W6XA 4ZZ8A 4V2VA 3WNNA 1LCLA 1DGRA 4PQQA 1X8MA 1G9FA 3E5UA 1OLQA 4EN9B 2A1XA 2O0OA 3FFQA 3KV4A 4GWMA 3OMTA 3VBHA 1DQ6A 5GZEA 1YC61 4YGDA 1WLTA 2W9XA 2A75A 4WVWA 2BNNA 1U0AA 3ETQA 4LE4A 3VD3A 5DSXA 1RUD3 4LQRA 4B1LA 1JZ4A 2FMDA 5FQ0B 5DDJ3 4P5YA 2MEZA 2N7GA 4OYUA 1BHGA 3I97A 1BK1A 2D93A 5IWFA 4FT8A 2PUAA 2RS51 3ALQA 1Q43A 1W0OA 1ZBA3 5FZOB 3CJIC 2UWBA 4QDQA 2DUOA 4H7MA 4FQZA 2VZSA 4FPLA 3H3ZA 3S0MA 5G05L 2C9AA 1Y7BA 4WZCA 3KZ3A 1JH5A 4AHZA 3LEIA 4D0QA 2R7EB 3R1FA 1ZM1A 4HK8A 5CFCA 1WH8A 1NCRB 2WO2A 4KNCA 5FZ7A 4DEQA 2JDZA 2LLWA 2OYZA 4HK9A 4BK4A 2XJTA 1JWLA 2CGOA 3LDRA 3SCHA 1OPMA 2ZHKA 1AX2A 3O0VA 1BYHA 2Q1MA 2YY1A 3E1F1 1AL23 1W6MA 4N9IA 3BOPA 3ZX7A 2VZ1A 1CZVA 3FFZA 1R1A3 3PVEA 3ZIXA 3GJBA 1F4AA 4H2AA 4JGZC 2VVFA 3CU7A 3GJAA 4XTMA 4A41A 4HBNA 3SISA 3BALA 2GN7A 4I3GA 1BEV2 5GZCA 2WJSA 1CQ9A 1TVGA 2D43A 3A0NA 4B1MA 2AWIA 1OUXA 1R083 3J4UH 1JU3A 1RUC3 2C26A 4R4ZA 5K7PA 4BB3A 2R071 1GQHA 4LO6B 5IFPA 4BYYA 3ZXGA 2EWTA 4AQ6A 2NPIA 2R6QA 3SLIA 4TTGA 5SV5A 2WIUB 2WS92 5GAHi 1DZRA 1BEV3 1JZ8A 1DG6A 1H2LA 1WLDA 5I0RA 1I5PA 3O5SA 3VBSA 3KHBA 4PU7A 4JTOA 4EQVA 1G9CA 3I54A 3OD4A 2WNVA 2VVEA 5CG9A 3QWGA 1AXZA 1WCDJ 1V6NA 2HWD2 1ZBE3 4P9LA 2W87A 1EUUA 1GNHA 4YW4A 3F51A 2JG8B 1OXCA 4Q4Y1 4MGZE 1S0DA 2MQKA 1NCRA 2ATFA 1WCQA 3RYPA 3VBSB 3WNOA 2DCTA 3HOBA 4OQ8A 2PLV1 4YFZA 3ZDVA 2LNMA 3ZYHA 5CU1A 3GZAA 3FUOA 2Z42A 1LGBA 1WA4A 1NA1A 3B9CA 5IVEA 3BTYA 1AR83 1KS4A 1XNCA 3MLLA 2Q0AA 5IW0A 2V5YA 4BJ0A 5ABJB 2XH6A 3THCA 1J83A 1EPZA 4COYA 4Z92B 1LOFA 1MVEA 3SCFA 5T54A 1VBE1 2VE1A 4QDSA 5C70A 1Y4WA 2VMIA 2CDPA 1RIOA 2RM22 4E4SA 1HV0A 1NLRA 1S0GA 4CSWA 4KI5M 3LQXA 1PMHX 1VBA2 2XGXA 1BDIA 3ZIWA 4DPNA 3K3NA 2V72A 2DFBA 4JAAA 1OQDA 1MS4A 2ZX0A 2QE3A 4P5HA 3NL1A 3AFKA 4YWAA 2O49A 1UZYA 3CL1A 1MZ5A 4GB32 3TYJA 2Q5TA 1JW6A 1YLLA 4IEOA 1VB4A 3RI8A 1RUG2 4DIQA 4AEDC 4XDPA 4YVWB 3CECA 3A9XA 5CZKA 2FD8A 2WO7A 3TN92 3WNLA 4AGGA 3OBZA 2BOJA 3U4XA 1MS0A 1DWKA 3N7MA 4LK7A 5FXVA 4ZY9A 3RDIA 1NYWA 3ZN6B 1XBFA 5IAXA 3CROL 4WM7B 1S2BA 3A23A 1CESA 2E9QA 3ATGA 4GB33 1OH4A 4XMAA 3KHCA 2K0GA 3OEBA 1XOYA 2ENRA 1JZ7A 4ER3A 3HT2A 3FBMA 4GAZA 4GJYA 4QPIA 1UPIA 5L7OA 3BPZA 1Q8VA 1RGSA 3P6BA 3TN93 4LXLA 4S2FA 2ZEWA 2ZMKA 2FJRA 4JRAA 5FY9A 1A34A 1STMA 3KV6A 3VL8A 3X29B 4I8TA 3HBZA 2ZEZA 3I59B 3VBUA 2R062 4NO4A 5I8TA 1GWKA 4XJUA 1Y9GA 3T1LA 1OQEA 4CTEA 3QOWA 2UYAA 5JMOA 5LA9A 2ICTA 1AX0A 1V6MA 3OWQA 1W8ZA 1PZ7A 4AFBA 1BMV2 1BKZA 2IVQA 1J3QA 3O1UA 3G6JB 2NMNA 3MGUA 2YG0A 3USUA 2ZX2A 4DE9A 2DUPA 2OIIA 1GP6A 1W6OB 2VMFA 3HWJA 1LECA 3VBRB 3I3MA 3H3UA 4FOYA 2EAAA 2ORXA 4TZDA 3IZOA 3OGJA 2DU1A 1WETA 1F5FA 2OT7A 1OSGA 1ASJ3 1BQPA 1KEXA 4YZ4A 3UJQA 2G9ZA 3JQXA 3OYWB 1RL3A 2VW2A 4OHYA 2VC9A 4NJ4A 4XEZA 2MPFA 2ZAAA 3IB3A 4UXAA 4E4HA 3K77A 3VKMA 3VKOA 4WV8A 5A1FA 4AVSA 3FHAA 5LA2A 2PXQA 3JXSA 4KWUA 4M4PA 3PUIA 4AFDA 5LBCA 1GANA 2WNUA 3RG0A 1O4TA 1XNBA 4L11A 3D1NI 4FFHA 1O8SA 4FQ4A 4AHWA 4LHSA 5F3CA 2XUEA 1CPMA 2YFZA 2TBVA 2JG8C 4RL7A 3GNEA 1FYUA 1DQ0A 1SMVA 2BWAA 1NX9A 3FHQA 3LE0A 5A3OA 1JYWA 1O7FA 1SFPA 4OI2A 3JXBC 2IXJA 2BJCA 3IDAA 3KGZA 4HPKB 3WCSA 3ZPOA 1W06A 3AJYA 3CJIA 1W28A 2XHNA 2ZGPA 3DPRA 2X29A 3ZHMA 1LULA 3AXDA 1FOD3 1ULPA 4IV1A 5FJHA 5C33A 1J1LA 1YWKA 1AF9A 2AEYA 2CL2A 4RHV3 2WT2A 2Y34A 3N35A 1W6OA 4FN3A 3GHMA 1AR72 1NQJA 5IJRA 3VBRA 4Y4YA 4CZSA 4ET7A 1XE7A 5GZFA 4BH9A 5IVVA 5JSPA 2XWBB 5JOYA 4K1YA 2DFCA 4HPKA 2ZHMA 2J1TA 2KZ8A 1QZXA 4P9JA 1NUKA 5FPAA 3DXUA 5BNNB 1MVQA 2E31A 3WW1A 1DGLA 1JHNA 3ETPA 4G3YC 1ZZCA 2QQMA 4K1ZA 5FZBA 1UY4A 4AG4A 1K42A 2PPXA 3LGRA 1B09A 4Z2AA 4CCLA 5BNPA 3MIDA 3WSOA 3ZFEC 2ETEA 2DBIA 1RUD1 1QQAA 4CEYC 1RXFA 1UKGA 4A6SA 5L19A 1GUIA 1VBA1 1YFXA 3AX4A 3J26N 3FMGA 5BV6A 3FUQA 3BIEA 5BNNA 1JOBA 2WNUB 2XONA 4CCKA 5JIUA 1ZA4A 4KMQA 2XLGA 3AZZA 4GZ9A 4AI3A 4D7TA 2XXAA 1OKQA 1PIV3 1VRH1 3C2UA 4IE6A 1R1A2 2A6XA 5GLZA 1WWYA 3TN91 1H8TB 3IT8A 4MGIE 1JH9A 2Q1FA 4Q0PA 1RUG1 3UESA 4A42A 3WQBA 1N1YA 2GZWA 1WGPA 3V0AB 2Q8DA 4CDUC 1NKGA 3QH7A 4CCNA 3BOWA 1FMD2 4FPHA 3CJIB 1R082 5J1XA 2LS6A 3QFIA 3AKRA 3RZHA 2JB4A 1ULEA 2EF6A 1VJ2A 4FSJA 3MDPA 2GC0A 4GQ7A 2DVGA 2ZEXA 3MIFA 3VZKA 1NCQB 2Y64A 1V6JA 1ULOA 2A5ZA 4GH4B 3JBG1 5C9AA 5FOBB 5J09A 1PO21 2Y60A 1S2EA 3VHPA 1RUOA 1J58A 1DF0A 2D6KA 4AAXA 4MADA 1UYYA 4CP0A 3LISA 4URAA 1QJZA 2QKDA 1EV11 3ACIA 2YHJA 3QLQA 2IC1A 4MOAA 3VHNA 2VBDA 2F6BA 1L3JA 1WZXA 2VZVA 3J7LA 1WLWA 3KCYA 2EICA 4D7SA 1DGWA 4NHMA 2HCSA 1UY2A 2YV8A 4OVEA 4LO5B 4QHBA 4XHXA 4EWAA 1REFA 4RR3A 4JTNA 3VKFC 1RB8G 4AI0A 4COZA 2YGMA 1PO12 3ZMNA 3MW3A 1HB4A 1XE8A 2J1EA 1AXKA 5IT6A 3BU7A 5K9YA 2V3CC 1BEV1 2I45A 1O3SA 2FDGA 2HH9A 2YMZA 5EHDA 1WCSA 1QJY3 5FXXA 5HBAA 2JDUA 2IU7A 2F4PA 4KBZA 2BNMA 4U2AA 2LALA 4OI4A 2G19A 2H6BA 4PJYA 5F1RA 2JB8A 2JECA 2ZA9A 4Y5Z0 3V0AA 4AZZA 3C7HA 4XZUG 4MGTA 1VIWB 1J59A 2VNRA 1YYNA 1SCSA 1O6UA 2A73B 1VR3A 4QU1A 1S4CA 1CD3G 3M4FA 4NPRA 3VBHB 1OA2A 3O1VA 3HNBM 3BDNA 4JKLA 5FMOL 1CAUA 1VLNA 1C3HA 2CY6A 4QX5A 5CVRA 4OHZA 3WUCA 4Q4V3 5A6ZA 4AE2A 5HCHA 4M00A 3SHRA 1EAH3 4X8PA 3ZFFC 1RUG3 2JG8A 2NYYA 5DUVA 5K0UA 3WHTA 4CDWB 4Q2JA 4D94A 5FZIA 4EN6B 3OB8A 3KL4A 2ZGQA 4P9WA 3NJXA 2MEV1 2IZWA 3POBA 2ERFA 3ZPXA 3ITQA 4FPCA 1F8VA 3DGTA 2IUWA 1CAVB 4QPWA 4BCUA 2P34A 2PXPA 3NKGA 4DUVA 1LAJA 1D2QA 2GMPA 4KL1A 1X9PA 1VBC1 2E7TA 2VOWA 3KT4A 2XJSA 4PDWC 3UGFA 1W2TA 3MPBA 4XJ9A 4CUAA 5ABJA 3R0RA 1NLSA 2R061 3USSA 3UETA 1TE1B 1Y9MA 3M3EA 2EIEA 1QJU1 5E6HA 2FDHA 3C8XA 5DAQA 4XFHA 3VDCA 1OCTC 1GZTA 3AMQA 2IFWA 4O8BA 2CTVA 4AI2A 3DL3A 2XG3A 1RC6A 3BUCA 2QQLA 4LJHA 5FZOA 1LOEA 1DQ5A 4IV3B 4QX3A 3SEPA 1WBLA 2VD7A 2W1WA 3BTXA 1CJPA 2XLAA 3ZYRA 4BQ5A 4CU9A 4EYUA 1JODA 4QXCA 4LBOA 5G04L 3N9LA 2ARAA 4L97A 4PLOA 2L1PA 5A7SA 2JKBA 2AH2A 5FOJB 2OUJA 1IGOA 2WLQA 3O0XA 5J7MA 3DNVB 1R1ZA 2LLVA 4GALA 4IXLA 1LCCA 2ZX3A 1IPSA 3ACFA 2HINA 3TEPA 5EJZB 3B7MA 2MEV2 2HWF1 2F17A 5EJ3A 1EV13 4RQPA 4TXWA 3QOXA 1XNKA 4QHOA 2VY0A 3LQCA 4XFBA 1LHNA 1X2LA 4RR3C 5JXGA 5E89A 2XCJA 4LULA 4AWDA 4BMBA 1Z78A 2ZZQA 5FPLA 3O12A 1CQTA 4J1XA 5KBFA 3FN9A 3E6CC 3RZKA 1HF0A 1C28A 3BGAA 1X36A 3CMGA 5EQUA 5AC92 1IQDC 2PXEA 3T08A 3TEXA 2RS31 1PGSA 4ITCA 3WG4A 4OULA 3TEWA 4Z82A 2OPWA 3ZO0B 1JS9A 4YZ5A 3BKZA 1LJ7A 3B94A 4BZ4A 4OBMA 4FBIA 1GP4A 3N7LA 4FPKA 4GA9A 4K3UA 1GP5A 4OHVA 3FLRA 5HV0A 4HKOA 3OYWA 1EYBA 4SLIA 3VD5A 2PUFA 2OVUA 5H9SA 1CJDA 4M4RA 2DYCA 1U12A 3U14A 2RS12 4LBQD 3B00A 4W65A 3VDDC 4CUGA 2PXLA 2DVFA 3VWSA 2VZUA 4EWDA 1F15A 2XJPA 1NOVA 2WZ8A 3P5BA 4O61A 5CBLA 5ACA2 1X33A 2WSVA 3ASIA 4OFGA 1SCRA 2J42A 1VAMA 2PA7A 1NG0A 1W6NA 5C4WA 3B9IA 1QNWA 4KGQA 4A7KA 1UYXA 2R1JL 1QWRA 2F4LA 3NAPB 2ZAHA 3D6EA 4YG3A 2JJ6A 4AAPA 2HFZA 2BFUL 3LA7A 4CU6A 5C4WC 5KXEA 1ND2B 1HB2A 1FV3A 2PYTA 2C4XA 2BNOA 3K2OA 1ZZ7A 4WM8B 4XJWA 5ACA3 1F35A 1AYN1 2WFF1 4FP3A 5GAGi 2BBVA 4P9XA 4IV1B 3CBNA 4BQ3A 4JCYA 3OSDA 3WEZA 1D4VB 2VMHA 3K48A 4LLFA 3ZR5A 4HKLA 1C4RA 1FMD3 1XU2A 3I8TA 2WNOA 3L2HA 4M0HA 3WDTA 1YIFA 1TME3 3WDYA 1MEC1 1D0GA 4IEXA 2VZRA 1W9WA 1QJX2 1U5XA 2HWF3 2P3YA 4ZU7A 2VZQA 5KXBA 3S57A 1D0HA 1VBC2 2QFEA 1FT9A 5BNQA 1ND3A 1VE0A 3APBA 4YZ3A 1YI7A 3U37A 4AHYA 3JU9A 4AGVA 2Z69A 3AYAA 2K9ZA 1GV9A 4YG7B 2A71A 4JV4A 4PI0A 5DXDA 3USUB 3WV6A 1DIWA 3BS3A 4YM2A 1MS3A 5C5TA 4AEJA 2HWF2 1N3PA 2IVIB 4OUEA 1XWRA 3H42B 1RZSA 1QIQA 4QPIB 5FRAA 4Z1VA 4RS5C 3HBKA 4X6RB 1RUJ1 2AUYA 4PIXA 3AKTA 5DN2A 3WX5A 4ES9A 5C4WB 2LYQA 1DP0A 1OQ1A 2DBNA 1RUF1 1D2SA 1VPHA 2PXJA 1PGL1 4DUWA 4Y1XA 1QHDA 4LHNA 5M0TA 3AZVA 3VBRC 1OLME 3EYPA 5FZEA 4HSJA 4BISA 1YIPA 5HCBA 2H0BA 1AR63 2IXIA 3GZUC 3ILNA 3MPPG 1AR91 3K3OA 2Y26A 2GZUA 4I0AA 4D69A 1ODNA 2P3IA 1QXPA 2VZPA 2VNVA 4XFFA 3RVHA 1HDKA 2VOKA 2WLPA 5CEHA 1SLTA 1HN0A 2XVKA 4C1WA 2OQ6A 1UOBA 1O3QA 1JYTA 2CV6A 2MNGA 4BOWA 3LFPA 2J7UA 4FXGB 1JUHA 2SLIA 4JQTA 1PVC3 4YM0A 2XXQA 4NIAA 3VHOA 3ZM8A 1AJOA 4Q27A 4DB5A 4QPGA 5KC5A 5C7GA 5FZKA 4C0HA 1ZRFA 1JYXA 3ZXFA 3T2PA 3NJVA 4NROA 2TEPA 4LLOA 2GNBA 4UFMA 1BCXA 1NCQC 2GDFA 5IK8A 5JOZA 1QDCA 3JD72 1J3PA 3TEZA 5A6QA 2VXRA 4W50A 4NHYA 2ZX1A 3AMNA 4BQXA 1MZEA 2JG9C 3O9XA 1QDOA 4KG8A 5J36A 3KD4A
chains in the Genus database with same CATH topology
2W08A 2RS53 1TME1 1COV3 4FOQA 1IS5A 1HQLA 2CNAA 2IVBA 1ZYBA 2HWC1 2RR12 4FPEA 1RUF3 4FVVA 1OFSA 3SH4A 1O4YA 1QOTA 4AXOA 1C8M3 1ONAA 4FBFA 1JYIA 2BGCA 3WD5A 4Q26A 4H55A 4X4IA 1OD5A 4XF0A 4PIZA 4EV0A 4M01A 3ZYPA 2RR13 4Q8KA 1ZBE1 3W58A 4JDNA 5BY5A 2E63A 4XF1A 2P3JA 5C8WA 1DDLA 1H1IA 3MW2A 3V64A 1WD3A 2FZ1A 4I0WB 1LGNA 2BEOA 4WBBA 2RMU2 5D8AC 4MV2A 1H9PA 1DYPA 5FDBA 1XRUA 3V65A 1KFXL 3H7JA 5LK7B 1KFUL 3QOPA 4K40A 3WDUA 3QQ6A 3IWZA 1V70A 1NCQA 4QGLA 1RUH1 4Z07A 1BMV1 5BNPB 3HN1A 4AF9A 3BIWE 1COV1 3P3NA 1ZZ9A 3IM0A 1NXD1 3ILFA 1AR61 1EV12 2IXLA 3INAA 1DGRN 4NHKA 3VBFA 2JX9A 3B3QE 4LO4B 1RVF2 2UWAA 1QXJA 3OBTA 2BWCA 2H0VA 2HEWF 3WNXA 3FLPA 1LOGA 1GZWB 5A33A 5DG1A 1IKPA 1G9AA 3J8F2 2UU8A 1QP7A 5JMCA 4PU4C 4JGYC 4GXLA 2WZR3 1UD1A 2QCSB 4JQDA 1LU1A 1RVF3 2E7QA 4JGYA 4QQOA 3WP4A 1AR93 4GH4C 3ZXLA 2WNVB 1QJU3 3RS6A 4FPJA 4AVAA 2NN8A 3VBOC 4KWLA 4GB31 4I02A 4EN7B 5CNAA 1WW7A 4PCRA 5FREA 1QMJA 1VAKA 2D5FA 2Y38A 4GMP1 5F5QA 1PRVA 2EA7A 1JN2P 3AM2A 1S0FA 4QXKA 4ES8A 4YG1A 1I9RA 1F9KA 1GZ9A 2RS33 3QH6A 4RQPB 1REEA 5EYYA 5I8SA 4F8DA 4B7KA 4PBPA 1LCDA 2GRLA 1H0BA 4R8HA 4RR3B 3R6SA 1G9BA 4X4DA 3ZYIB 2PHFA 5DUUA 2VPVA 2NP0A 3HMYA 3UL2A 1AR71 4YLZA 4DFSA 2HEVF 5KHKA 4OB4A 2D5VA 1ZX5A 2VU9A 4KGGA 5LEJA 2CSFA 2B5AA 1WMEA 4B4PA 4RFT0 2ZMNA 1TMF1 3AYDA 2WSUA 5L73A 3KT7A 1RMU1 4JC1A 1AXYA 4P9YA 2DTWA 2RE9A 5JSOA 1A6CA 4KU8A 4XZPA 4ASMB 2DCJA 4IWRA 2DU0A 2DWRA 1HRV2 1D4M3 4YVSB 1KDKA 2A3XA 3HIFA 4XJAA 2GU9A 1BBT2 2ZACA 2PHDA 3B01A 1OLRA 4MXWB 2ZGTA 3IKWA 2ZGUA 4A3XA 1H2NA 3CO2A 1RPEL 2WC2A 3EO6A 5JI7A 4A7ZA 4CDUB 4LUKA 5AC93 1NZCA 2VULA 1CAVA 1ZBA1 4K20A 4R9CA 4D7YA 1H8TC 3J9SA 1ENXA 1RUH3 1AZDA 4I09A 3SITA 4I30A 1CGPA 4OI0A 4MXWA 1CAXB 1MEC3 3UKTA 5A32A 1QH7A 1R091 5DDJ2 1ZNPA 4FCAA 1RINA 4MZUA 3H8UA 3VLBB 1PGL2 1AHSA 3LA3A 5BNPC 1IPJA 3TWIA 1HLCA 1MEC2 3PMSA 1IOAA 3EUSA 1VBD1 2A3WA 4LA3A 2QVSB 1MZFA 4CDQC 4YBAA 2XB6C 2ZGKA 2OUHA 4XJZA 1AR73 3NV2A 4HMZA 1DFQA 4Q0QA 2WUSR 1WLCA 4BIOA 3H1YA 4AVTA 4NOTA 4X4BA 3SMHA 2KEKA 2D44A 5FLJA 2D97A 4H3WA 4JCXA 2MHFA 4AFMA 4N53C 1XXNA 3WG1A 1VALA 3S8QA 4BA6A 1N1TA 3WP6A 2TUNA 4MSVA 4AVVA 2CWMA 4GMP3 2R073 1RUJ2 4UW6A 4YW5A 4PQ9A 2ICPA 3AP9A 3ZN6A 3ZKCA 5EV7A 1ALYA 2ZMLA 2QZ3A 2P2KA 1PIV2 3PVNA 2D40A 2PHLA 2Y0OA 5FBZA 1IZ3A 1A3KA 5KHHA 4JQRA 4ZU4A 1MQTB 4META 3RNSA 3D5OA 4YM1A 1HV1A 3FBYA 5BPXA 2D98A 3KMHA 1VBE2 4XJ8A 5A3MA 4LBQB 4INDA 4YW1A 1YSEA 3CEWA 4Q0SA 1GZCA 1RITA 4D3WA 2BTVC 2HWC3 3M8LA 1RMU3 3F52A 4BPZA 4PIYA 2ZGMA 2LYKA 3FJSA 3POSA 2KM2A 3AB0A 3WINE 2R0FA 1VPWA 5FLIA 4Y24A 1G7YA 2PUBA 1IKQA 3ROUA 5HCFA 4O9EA 4NR1A 2KXLA 4CDXC 4QQLA 2PHXA 3VZMA 3RPQA 2HWC2 3FZ3A 4N53A 4I2OA 2ET1A 3H50A 2L8NA 4MGKE 4X6QB 1YFYA 4LBJA 1MQTC 2HWD1 1UXCA 1LHVA 4N90A 2WFPA 5DZFA 4PBOA 2O38A 1WUVA 4JDMA 2FQPA 2XVGA 2WS91 2EXIA 2NLRA 2VW1A 3NAPC 2GH2A 4K8FA 1UW8A 1ADRA 4DRRA 1Z7S2 3OBRA 4IEPA 2A6CA 2CAVA 3CLCA 1QGLA 1UU5A 3WG4A 1RUE2 1N47A 4IEQA 2LUWA 3OJBA 1REDA 3WG3A 1AR92 4XHBA 1QJU2 5C9AC 2LTNA 3OTFA 2PHTA 2WA3A 3TAYA 1PK6C 1OI6A 1H1AA 1H4GA 2ZS6B 1C8M2 5KC6A 5FCCA 4XF9A 3ZYGA 3KCXA 4Z5HA 3JB4C 1A78A 4WVMB 5J48A 2VQ0A 1POV3 5ABJC 3LOIA 4H7LA 2HWD3 3KSCA 4JCKA 4RD7A 3GN5A 3PVBB 2O1QA 1JYCA 3ZN4A 3GYDA 4XFGA 3MF6A 1NCRC 1DQ1A 2MEV3 2JVLA 3WUDA 3VL9A 1UX6A 3I7DA 3MIEA 1VRH2 5SV8A 4B8EA 2IV1A 3TRSB 1GICA 4ATFA 1QQBA 3KCCA 4LT5A 3JZVA 3SH5A 4MCXA 3MLFA 3FE5A 2E51A 1CVNA 5DDJ1 3E6BA 1IC8A 1R092 1S0EA 1FV2A 1DYKA 2X53S 3LAGA 4CDWA 5GJ6A 1EP0A 2QUOA 4UBHA 1YNAA 1PGW1 4LEJA 4AI1A 4RGAA 2R1BA 4E4DX 3FX3A 3RYRA 2HWE2 4FXKB 3U11A 4GH4A 1SFNA 1O3RA 1X57A 1H2MA 1VBD2 1DHKB 1WIZA 4Y1UA 5E16A 4XQWA 1TEIA 5CG8A 4LO7A 4MXVA 1CAWB 4AEDA 2UURA 3ME2A 2P3KA 4UW4A 4DS0A 2HWE3 3TOJA 1M06G 1LTEA 3M3OA 3ZFGA 1O5LA 2QQPA 4YGBA 3M3IA 3ES1A 1SLAA 1AL21 1CPNA 2KPJA 2OR1L 2ZCWA 4AQTA 2RJKA 4Z59A 4AEDB 3UV9A 1QP4A 4KQ7A 4Q1PA 2R63A 3RMXA 1LOFC 3E6DA 4LBMA 2PLV3 1LODA 3VK0A 1BJQA 1O4XA 1R081 1SLBA 5T55A 5JLVA 4COVA 2XVLA 5GZGA 3WDWA 2EIGA 4MYEA 4N43B 4NVPA 1TMF3 2R32A 4QQHA 3OD0A 3VBOB 2WNVC 3EBRA 4CDUA 2CROA 1CAUB 1G6NA 3DF0A 4NWWA 3VBHC 1ND3C 2HSGA 1ZUGA 4AHXA 1TMF2 1RZRA 2DCKA 1AVBA 3ZXJA 4B3NA 4J1WA 1QJY1 2W39A 3BODA 3JUUA 4DZGA 3D82A 5C8CB 5D8AA 2IUOA 1KDMA 2I07B 5GLWA 3JBG3 4EJRA 1MS1A 4XW3A 1IQAA 4GULA 1AYM1 4HVOA 4H14A 3MLJA 4Y1YA 3JQWA 4G4FA 2H6CA 4IEUA 1L1MA 3AKSA 4HLTA 1RUD2 1QOOA 3LB9A 1T6GC 5H9QA 1O4ZA 4A2UA 5GALA 4YVSC 3RSJA 1I1EA 1QJX3 1X82A 1N1VA 1FPN1 1ENRA 4XBLA 3JCIA 5GM0A 1AR62 1KJRA 3DPRC 3VBOA 3KS7A 3PMEA 3MW4A 2PTMA 1LEMA 5CFCC 2AXZA 1K5MC 1V9U3 4XBNA 1OFNA 1W6NB 1UMZA 1LOBA 3SCGA 4QD2A 1WBFA 1YO8A 2ILMA 2ZOEB 1SEFA 4XFAA 1PRUA 4PLMA 1RZRD 4AQSA 4FAHA 2AZ5A 1LB2A 3PHMA 2BQPA 4WM8A 2BVVA 1UF2C 3JD73 2YUEA 5LK5A 4OI1A 4X4EA 2CAUA 3L9JT 2UY8A 2W68A 2ARXA 1O5UA 2UYBA 5A32B 4XXPA 1YXWA 3M3CA 1ZZ8A 3TBDA 4Q4V2 3IDEA 2JG9B 1X7NA 2PAEA 4LHKA 2JE7A 3AZXA 5J96B 5DZGA 4HT1T 1K5MB 1JUIA 2OW4A 1PVC2 4YVSA 2LYSA 2YROA 4KU7A 3G7DA 3BB6A 4L8QA 4G9SB 3R4SA 1YHFA 1AL22 4RS5A 4IEZA 3WLUA 3WVJA 4R4XA 3DUIA 1SQ4A 3AYEA 4BWOA 4N53B 4I0BA 4AW7A 4HETA 1IPKA 4LBLA 3UKNA 5I0SA 3GBFA 2PUCA 1FAYA 4WM7A 1CAXA 3E97A 1WW6A 4R9BA 1W6PB 1RUF2 1UN1A 3W59A 3WOGA 5L7OC 1BVVA 1SBEA 2ZABA 2RMU1 5D1IA 2B39A 4Y20B 4CDQB 3AYCA 1PERL 5JZGB 4YG4A 4FPFA 2WZPP 2CGNA 3IN9A 2OZ6A 2P17A 3OQNA 1S7EA 3AJZA 4EN8B 4HZFA 4X8NA 2XBO2 4B4QA 2XUMA 3R4DB 1ND2A 4F83A 2JEMA 1FATA 1NY71 4TYSA 3ZFEA 1MS9A 3RRDA 5EFUA 1PNRA 5GLVA 1NE4A 3FC0A 2GNTA 1FOD1 1NQDA 1B35B 1MS8A 1Q8SA 5GKAC 2HWB3 3PVOA 2R041 1RHI2 3O14A 4W6YA 3S7IA 4BHPA 4XYXA 2RR11 4I3PA 1R69A 5FMOS 3VKLA 2LYPA 3HQXA 2IXHA 3ECQA 5E88A 4TSVA 1GQGA 1GR3A 4FAGA 1I5ZA 1RHI3 2ZGLA 1EAH2 5T5OA 3D8CA 1PO23 4XMIA 4M0NA 2B8MA 3R05A 2WFF3 3BD1A 1OOPC 1VBA3 2G4IA 4UBGA 1SLIA 1HX6A 4BLJA 1LQCA 2AR6A 1MQTA 1VAVA 5JZGA 1LENA 4C90A 2XPJA 3M2MA 2ES3A 3HD8B 3AZWA 1QPZA 2Y0IA 2UY9A 2RS11 5CAZA 2WFF2 4HN0A 2GALA 1H1MA 4LBQA 2DURA 1W6QB 2A70A 1GSLA 1FX5A 3F6WA 4ZKTB 3QD6A 3IVPA 5EZWA 1JTZX 2GH8A 3IIAA 4XBQA 1RUNA 3TB0A 4B4RA 3OQOA 3MICA 1W0PA 4B29A 1UXDA 5AFBA 2OZJA 4FPYA 2HYKA 3WDVA 4Q1RA 2HKXA 2RS32 3KB5A 2JXAA 4WVZA 1YJKA 5BXXA 3WW2A 3AP5A 1HRI2 3ACLA 4DMIA 1MZ6A 4AFAA 1QKQA 2VW0A 2TNFA 4ISQA 2O4AA 5A33B 4C0BA 1SFYA 1ULCA 3ZN5A 1LMB3 1U5YA 4IA8A 3CNAA 3RWNA 2YDEA 2X5IB 4Z2WA 1TME2 2UWCA 2JENA 5K0UC 1QF3A 2E7AA 1QQP2 4JGYB 5DUWA 4O9GA 4FTBA 2ZTNA 2C1FA 1Y9QA 1WMDA 2D6OX 2ZKNA 3D0JA 1ENQA 1W6QA 1QH6A 5F6LB 4CDXA 1G9DA 3PTYA 1Z