4J1XA

Crystal structure of fe(ii)-hppe with alternative substrate (s)-1-hpp
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
193
structure length
193
Chain Sequence
TASTGFAELLKDRREQVKMDHAALASLLGETPETVAAWENGEGGELTLTQLGRIAHVLGTSIGALTPPAGNDLDDGVIIQMPDERPILKGVRDNVDYYVYNCLVRTKRAPSLVPLVVDVLTDNPDDAKFNSGHAGNEFLFVLEGEIHMKWGDKENPKEALLPTGASMFVEEHVPHAFTAAKGTGSAKLIAVNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanistic studies of an unprecedented enzyme-catalysed 1,2-phosphono-migration reaction.
pubmed doi rcsb
source organism Streptomyces wedmorensis
molecule tags Metal binding protein
molecule keywords Epoxidase
total genus 48
structure length 193
sequence length 193
chains with identical sequence B, C
ec nomenclature ec 1.11.1.23: (S)-2-hydroxypropylphosphonic acid epoxidase.
pdb deposition date 2013-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 4j1xA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4j1xA02
5FLHA 4XEZA 1QQAA 2A6CA 3TNQA 3IBMA 1RC6A 3R1FA 2PHLA 3CLCA 3E5UA 4MX3A 4EWDA 3ETQA 4XFFA 1ZREA 1V70A 3MPBA 1ADRA 3SCGA 3OMTA 1RUOA 2PUAA 3E6BA 3PXPA 2QJVA 3EQEA 2ZKLA 2GZUA 2LYSA 1ZZ7A 1EFAA 3QACA 4IEWA 3QOPA 2CSFA 4XFBA 1QPZA 4X4FA 1NZCA 4JV4A 3NSTA 1O3TA 5BY5A 3CROL 2OZJA 1WH8A 1UIJA 5EZWA 3H1MA 4O9EA 2BGCA 4FAGA 1WLTA 3OF1A 3NJZA 2DCTA 4I0AA 3B7HA 1UD1A 4PU4C 4X4EA 3VK0A 2XL7A 1ZS4A 3EBRA 3CEWA 4ONUA 1YLLA 2K0GA 5JR7B 2PPXA 4JVAA 3E5XA 3LISA 4IERA 1X8MA 4QGNA 5KHIA 1O4TA 3H1WA 2B5AA 1GQHA 4RD7A 2XLGA 3SCHA 4L2NA 1ZNPA 4UBGA 4WBBA 5CU1A 4AVBA 4BH9A 3I59B 3BS3A 1H1IA 5AVPA 2IXHA 1UXCA 4HLTA 2WFPA 4ZU4A 3ES4A 3FX3A 2R1JL 2O49A 2EA7A 4PU7A 4LEJA 5CVRA 4PU8A 3DL3A 1OI6A 4EROA 3D0JA 2KXLA 4HVRA 3S0MA 2AXUA 1SEFA 2XKPA 1OFNA 3E5QA 4AXOA 4FBFA 2IC1A 1Q43A 3JXDL 1X82A 2EAAA 4IA8A 1ZUGA 4IEVA 3FE5A 5C8WA 4D7SA 2IUOA 2AW6A 4Q0VA 2GZWA 3NVCA 3F6WA 2JVLA 2XLFA 4KWKA 4QXKA 4XF4A 2OFYA 1PRVA 1HF0A 3SHRA 4J1XA 1CAUA 1LQCA 3D0SA 4I3PA 1NEQA 3RDIA 2D93A 4F8AA 1WGPA 3LWCA 3USSA 4I6RA 2PUCA 1FT9A 3FYMA 2ET1A 3FJSA 4ZU7A 1E3OC 2OPKA 1YFUA 4XF0A 5I93A 1O4XA 5BXXA 1CAXA 4I6UA 4Z5DA 2AUWA 4I8TA 4MV2A 2XL9A 2XHKA 2R63A 2XKOA 1VPWA 3QF3A 4UXAA 1ZPQA 3OQOA 1ZAYA 4Q0SA 4NVPA 2H6BA 4HSJA 3E6DA 1OCTC 2Q0AA 1XWRA 2ICPA 2LYKA 1UW8A 4PIZA 2UYAA 2GAUA 1Y7YA 3SCFA 1VJ2A 3BU7A 3L1PA 3G5GA 4Q0UA 1PRUA 3IIAA 4IESA 1NE4A 2EBYA 5CADA 1O7FA 4E2GA 1RZRA 3FZ3A 1X57A 2PUBA 3ELNA 4YSFA 5FPZA 4OFGA 1CAWB 3KGZA 4XFGA 1ZRFA 2QVSB 3RNSA 3RZZA 3H3UA 4QM9A 3EUSA 4MZUA 4ORFA 4D7TA 1AU7A 3D82A 5I0TA 1WIZA 1DWKA 2FQPA 1IPJA 3NL1A 1LKNA 1CX4A 1IPKA 4PU3C 2Y0OA 4XF1A 4JTNA 3RPQA 2LYQA 5BPXA 5D1IA 2D5FA 3CL1A 3L2HA 3EO6A 2IVQA 2XJ3A 1R69A 3BB6A 1QP0A 4KU8A 4YRDA 1YFYA 4X4GA 3RYPA 4A2UA 1JWLA 2OYZA 2AWIA 4AQ6A 3OGJA 3FFQA 5E1RA 1J1LA 1Q3EA 2IV1A 1WH6A 4QMAA 1RUNA 2WIUB 3PVBB 1ZX5A 2WC2A 3OD0A 2LYRA 1ZRRA 1VP6A 3ROUA 1GT0C 4Q0PA 1J3RA 3QWGA 3BPZA 3U11A 2PUDA 2EVXA 1ZVVA 1CJGA 1LRHA 2O8QA 2KEJA 2GH2A 2IXIA 3C3VA 3NKTA 4EWEA 2IXCA 1ZRCA 3U0ZA 4OLLA 4MGZE 5JSPA 3GN5A 1ZZ9A 2HJIA 5JCTA 3CECA 3G7DA 1YUDA 1VR3A 2C0ZA 2PQQA 4R52A 4Z59A 4EV0A 3H1YA 3BDNA 4N9IA 2CROA 2JCGA 5LRRA 5I8YA 2XIUA 3IDBB 1CAVB 1NE6A 3KGLA 3KSCA 3S7IA 2QDRA 2KZ8A 1XE7A 1HW5A 1OSLA 1Q5OA 4I2OA 4MUVA 5KHJA 2AXVA 3H3ZA 1RTVA 2H8RA 1EP0A 4BIFA 1PRAA 3MYXA 4E2QA 1LB2A 4JCYA 4Z58A 2F4PA 1FXZA 1EY2A 2O38A 4OB4A 3JXCL 4PIXA 3TNPB 3LA7A 2XI8A 3OTFA 4R8HA 1CAVA 4B29A 5BUVA 3HT2A 3GYDA 4KL1A 3FYAA 2K9ZA 5JAXA 2MPFA 1DW9A 4P9GA 2PIJA 1O3RA 3QYXA 3O14A 2IXJA 3GN5B 2CAUA 1LR5A 4X4CA 2L8NA 2B8MA 3JXBC 1XRUA 4FN3A 2Q1ZB 2PAKA 1XE8A 3EJKA 3OCPA 1UTXA 2Q4SA 2PAEA 2UY8A 2PUEA 2IXKA 4Z07A 3U10A 1JFTA 2ETEA 2Z2SB 5KBFA 5FLIA 4IETA 4YG7B 4LTAA 5EFUA 3CO2A 1POUA 4QX5A 2PUGA 1I5ZA 2VECA 3HZIB 2GRLA 4YNIA 4XFCA 4HVOA 3O9XA 3B02A 3MLFA 3FHIB 1IC8A 4NDWA 5JSOA 1YFWA 2ATFA 3E97A 1O3SA 4O8BA 2VPVA 1LLIA 4JQDA 5JSRA 2VQAA 1JH9A 3TRBA 3KZ3A 3I7DA 2D5HA 2BNOA 1J3QA 2H0VA 5I8TA 2XGXA 5FDBA 4MGIE 5KHHA 2GU9A 2Z69A 5C6CA 1TQ5A 1YFXA 3RYRA 1EPZA 3HQXA 3MDPA 1OMIA 5I0SA 2PFWA 4XFHA 3E6CC 4TLFA 5K8SA 3KMHA 2ET7A 4LA3A 3FWEA 4QM8A 1YHFA 4YBAA 1RGSA 5HI0A 3IDCB 2IVBA 1QXJA 4L11A 4J1WA 3ZHIA 3UFDA 1CAWA 2CV6A 4YARA 2OR1L 3I54A 4JCXA 3R6SA 4YYOA 4X4BA 2MNGA 4MCXA 3BALA 4WVZA 3WW4A 3FMYA 3CF6E 3HIFA 4LUMA 1UPIA 1JFSA 4F8DA 1LCCA 1X7NA 2B5HA 3OQMA 4I0BA 3VHRA 1PM7A 2XLAA 3ACLA 1QP7A 2LYPA 1DZRA 4GULA 1ZZ6A 4UBHA 2V09A 4X4DA 4AVCA 2EWTA 4O9GA 4WZCA 5KHGA 4Z5HA 1BDHA 4DINB 1CQTA 4FT8A 4LLOA 1DZTA 1O5LA 4HN0A 3IVPA 4E2SA 4HN1A 2QCSB 3EHKA 3LOIA 1WETA 5FLJA 1LMB3 4XF3A 3N4MA 1EYBA 5KHKA 3ES1A 3QQ6A 2PAMA 3S8QA 1ZZBA 4GQMA 2L49A 5FCCA 3RYKA 1NXMA 4ZU5A 5I0RA 3NW4A 2LCVA 2GC1A 4HMZA 2CGPA 1YSEA 3DKWA 3PLQA 1SQ4A 1BDIA 1UIKA 1NYWA 3OQNA 4IEOA 4IEYA 1H1MA 4I09A 1X2LA 2FJRA 3DV8A 3F52A 3ZDSA 2HINA 1QY4A 4EWAA 3BD1A 3UKTA 4XF9A 4I6TA 1ZRDA 4X4IA 2UYBA 3UKNA 3OP9A 4MCTA 5A7LA 2PYTA 1I6XA 1U12A 2PTMA 1J59A 2LYJA 5LEJA 2ZCWA 3IWZA 4IEUA 3MZHA 1YWKA 1DGRA 4X4HA 4Q29A 4XETA 2CAVA 2XSDC 4HSLA 4JTOA 2LYLA 2HKXA 1WA4A 2ICTA 1GQGA 2IXLA 2EF8A 1J3PA 2BYVE 3M70A 1JUHA 2UY9A 3WW2A 2OA2A 4CYDA 3KXAA 1L1MA 1DGWA 4KWLA 4AVAA 1Y9QA 2PE5A 2Q30A 5I8SA 3BCWA 3WW1A 5FQ0A 2I45A 3CLPA 1B0NA 3I59A 5E16A 4IEQA 4YG4A 4Z82A 3S7EA 4FAHA 2BNNA 5LEKA 4H7LA 2BJCA 1O5UA 3F51A 5BV6A 2PUFA 4I01A 2WUSR 4PIYA 1X8EA 2KEIA 4MH0E 3UKVA 4HZFA 1QWRA 1R63A 3M3IA 4META 5LRSA 1CGPA 3ZKCA 1L3JA 4I02A 4XFAA 2GC0A 3LA3A 2O4AA 1RL3A 4IEZA 2MEZA 2MHFA 1OD5A 2PHDA 2P17A 2OZ6A 4YG1A 2PA7A 2XCJA 2IU7A 3KJXA 2H6CA 4KU7A 2FMYA 3DN7A 3GBFA 4MGKE 1ZZ8A 1QQBA 3H50A 2E9QA 1QXRA 3LZZA 3PNAA 1G6NA 3H7YA 3H7JA 1RZSA 4Q0QA 4K8FA 1SQ8A 4X6RB 1S7EA 2N7GA 1PNRA 5I0UA 1J58A 1LCDA 4IEXA 5K98B 3ST7A 3JZVA 3D1NI 4X6QB 2B9UA 2GRMA 4GHJA 2KEKA 5F1RA 4BYYA 1PMIA 1UCXA 5T3NA 3SMHA 2O1QA 1RIOA 3H9AA 4LULA 3ZHMA 5J3UA 1RZRD 3LAGA 2HSGA 2GC2A 4PJYA 1ZVFA 3H5TA 2D40A 1CAXB 1PERL 4IEPA 4F7ZA 4LA2A 4MGYE 4N9HA 3SXWA 4AQ2A 1NERA 4Z5CA 5J7MA 1ZZCA 2BNMA 3LFPA 3DNVB 4IVZA 5FQ0B 2KPJA 1RPEL 3H8UA 5FPXA 4FBIA 1CAUB 5J48A 3U3WA 4QGMA 4Y42A 4QGLA 5I91A 1Y3TA 3KCCA 4XFIA 4BHPA 1O3QA 2IVGA 4HVQA 2AXZA 2D5VA 2QNKA 3HT1A 2MQKA 1SFNA 3CJXA 4IWRA 4HBNA 1UXDA 2BEOA 3LA2A 4KWJA 3WW3A 1FI2A 4LUKA 1QP4A 2GC3A
chains in the Genus database with same CATH superfamily
5JDBA 1STMA 3N9OA 3IBMA 3MIEA 4NIIA 1HX6A 2PHLA 1KQRA 3A7QA 4R4XA 3UK9A 5KXDA 1K5MB 2DWRA 4C1XA 4EWDA 2OIIA 3ETQA 1DDLA 1ULEA 4P02B 3AMMA 3WCSA 4YFWA 1ADRA 1RJ7A 3SCGA 3OMTA 4GB32 4W6YA 1NT0A 3PXPA 2ZKLA 3FLPA 1UO9A 2WIIB 4GMP0 3V64A 1QH6A 3QACA 2LYSA 1ZZ7A 2FMDA 1SFYA 2QQMA 4LKSA 1NKGA 3LIHA 4MLOA 3OOXA 3WP3A 3ZN6B 4P5YA 1QHDA 1SHWB 3WR0A 1N3PA 3GBWA 1O3TA 2LM3A 4P08A 5FOJB 1HRV1 1VRH2 2OZJA 3VBFA 1WH8A 1AYN3 1ULPA 4HPKB 3GZAA 2O14A 2WAAA 1WLTA 2WO7A 5CFCC 2WNVC 4YGEA 3WNPA 3B7HA 1UD1A 2YV8A 4PU4C 1BHGA 2P37A 3MF6A 4IV3A 5CFDA 1ZS4A 3EBRA 3CEWA 1VBB3 4Y22A 3W20A 4LE4A 4A44A 1XNBA 1YCIA 3LISA 2ZGUA 1X8MA 2BOJA 4IERA 4OHYA 3Q9OA 1O4TA 1JS9A 1LNSA 4DUXA 4XIKA 2EIBA 4Y5SA 3HVDA 3OUHA 4RD7A 4UBGA 3SCHA 5BNOC 1ZNPA 1UU6A 5CU1A 4BH9A 3I59B 1QDCA 1H1IA 4CDWA 2R32A 4K6BA 1FMD2 1MS5A 3FL7A 3MIGA 5GM0A 1DYKA 3AYDA 3FX3A 3UJOA 2R1JL 1F4AA 3OBTA 3T4VA 4QX2A 3J8F1 1HIXA 1LGNA 4FOWA 2V3CC 2AXUA 1RUH2 1OFNA 2FCUA 2HWB1 3O1SA 1CR7A 4IQPA 3WG4A 4AXOA 2IC1A 5IVBA 1SPPA 1S0JA 5F5IA 1ZUGA 2E7TA 4FP2A 2AW6A 1B35C 5C7GA 1PGSA 3F6WA 3OY8A 5DXDA 4CP1A 4Q4W3 1COV1 2AR6A 3WP6A 1AR91 2RS31 3RZJA 2OFYA 2BFUS 1PRVA 2PXDA 2HWE3 3FC0A 1HF0A 1BBT3 1E5HA 5IYYA 5A7QA 4COUA 1CAUA 3ORJA 3IAPA 2WQ4A 4F8AA 1X9TA 1WGPA 3LWCA 5AC92 1RUJ1 3RG0A 5C3RA 2TUNA 3VZNA 2BQPA 3U37A 1OXCA 3V56A 4ZU7A 4K7JA 5T5OA 4CSWA 3BU0A 4F83A 3NWKA 4Y5TA 1PK6A 2BVBA 2V5YA 5I93A 1O4XA 1ST8A 5T52A 2AUWA 1JMUB 3DECA 3FHAA 4YG3A 3JU9A 5FMOS 2HWE2 3A9XA 4AEJA 1QU0A 3WDWA 2MEV3 2R63A 1PVC2 3OYWB 2P6CA 4Q4V2 2ARXA 1H8TB 2BWAA 1ZAYA 1OOPA 3P6BA 4XCBA 5FXZA 3SKVA 4AVTA 3PU3A 4NVPA 4HSJA 1VAVA 2FZ1A 4CP9B 3WT3A 1K5JA 2ICPA 2YBPA 3ZYPA 3BODA 4A6OA 4RR3A 4Q5OA 1MS8A 1VB4A 2P1BA 3WQ7A 1VJ2A 1XYNA 4JZRA 4BIOA 3BU7A 3L1PA 4KGGA 3A0NA 3DYMA 3ZPXA 2D43A 3BGAA 3O0WA 4Q0UA 4Q4W1 1W03A 2MEV2 3HMYA 2VOKA 1BYHA 2NPIA 5K4LA 1RZRA 3B7MA 2R062 3DGTA 5FZMA 2E31A 3LFMA 1ZA4A 3N7MA 1UL9A 3LEGA 1FPN2 3NJXA 4N53A 3KCYA 5FZAA 3CHXA 4OFGA 5IVYA 4FTBA 5FZ6A 4CCNA 1TEIA 5T50A 3J4UH 2R071 4XFGA 2QVSB 1ZA7A 3DEMA 1IS6A 3M3OA 4MGTA 2NLRA 2WLPA 1EV13 2ZX4A 1ZBE2 4OCTA 4JDOA 4JKLA 2SBAA 3EYPA 3J7NA 3MUZ1 4CDUC 2X5IC 3OUIA 5FUPA 1GKBA 4AFBA 3QCWA 4CCOA 1F5FA 2QKDA 4UW5A 1BXHA 4XJWA 1RUF3 3N9MA 4JTNA 3MICA 1OUXA 4XF1A 5JXIA 2FDGA 2LYQA 4BK4A 4N43C 5D1IA 3L2HA 4AHXA 3ZXGA 3VUOA 4YW6A 2XJ3A 1DF0A 5DQ0A 2ZXQA 4YRDA 1QOOA 4YVSC 3AB0A 1HQNA 1JWLA 5ACA2 3AP5A 5IUQA 2OYZA 4AQ6A 3UETA 5CA6A 3PUQA 5F7UA 2GALA 5A6QA 4DXRA 1YJLA 5E1RA 3C7GA 4QHOA 1J1LA 2HBUA 1LAJA 2DCKA 2IV1A 1AL23 4QMAA 2TNFA 2WIUB 1ZX5A 4FCAA 5HCFA 1JYVA 1AJKA 2XUEA 2R042 4V1PA 2JJ6A 4Q0PA 4D8MA 3QWGA 2PUDA 1RUE3 1OKOA 5A7NA 5A1AA 1CJGA 1W6MA 2ARCA 2O8QA 5B2GB 2KEJA 5LA2A 2W1SA 4C90A 2RDSA 1CESA 3NKTA 1QZXA 2RS11 2VOXA 3WDUA 4P00B 4GD4A 1W8TA 3IKWA 1VAKA 2G9FA 1SLCA 5FZ1A 4MHUA 4CDQA 1UY4A 2RDNA 1PX4A 2DBNA 2HCNA 1W8HA 3FLTA 5FZ3A 4CUGA 5BNNA 1S2EA 2ZGSA 3VBOA 2WABA 5L7OC 4Q4X1 2C0ZA 2CY6A 2JXAA 4OHWA 4CEWC 4N9IA 1AL21 1LU2A 4HKWA 3JB8A 1JH5A 1LHNA 4JHZA 2JG8C 2E26A 1KITA 5B4NA 1G9AA 1YIFA 3S7IA 1IHMA 1JHNA 4XIOA 2QDRA 3I3MA 3CKHA 4QX1A 4OQ8A 4U36A 1XB9A 1H0BA 4YG0A 2PLV3 2CDPA 2DDUA 3INAA 2PHRA 4BIFA 1PRAA 3MYXA 4E2QA 1OUSA 4JGZB 4PIXA 1D7PM 3JXCL 2YGMA 3HR9A 4INDA 3LA7A 5L7OB 2BBVA 4LHLA 2JDUA 1CAVA 3VBHA 3HT2A 2PXFA 3M9LA 4OQ9A 4CDXB 2HYKA 4IV1C 2A3XA 4QPIA 5F2WA 3SKJE 4BQ2A 2HYXA 1LHOA 4E27A 1POV0 4N8MA 4WVWA 1RUF2 4OYUA 3CU7A 1D0HA 2Q8OA 5E8AA 4TSVA 1R081 2JICA 4BA6A 4BQXA 1ULOA 3BIEA 4P14A 2ZX1A 4WM8C 4YW1A 4BB3A 3POWA 4GB33 2YBKA 2ZKNA 3ILFA 4YVWA 4IE6A 4LKDA 5C70A 3OUJA 1VBC3 1JW6A 2Q4SA 1S0FA 1UMIA 2QQJA 4XPVA 2PUEA 3H3LA 2B39A 2IXKA 1ASJ2 4Z07A 5FZBA 3WP5A 5T5LA 4QPIB 1TNFA 3K4ZA 3AMQA 2Z4FA 4FPYA 4URTA 5FLIA 4A45A 4AHWA 1CIYA 1L7LA 4IE5A 5CKNA 1H8VA 1AL0G 2VTXJ 4Q1RA 2VVEA 3JQXA 2B45X 4N43B 2J1RA 4P9JA 1UNBA 5FV3A 5SV5A 3AYCA 5JWPA 5C9AB 5FPVA 4Q4V3 3WVJA 4HVOA 2VNGA 3O9XA 2YC2A 2C9AA 3H8RA 1XNAA 2DVDA 3AMHA 3GZDC 1IC8A 1RUI2 5JSOA 1ZBA2 1V9U1 1YFWA 1DQ1A 2HWD1 3KLSA 4M01A 5E6HA 3RVHA 4AOCA 2W5FA 2DTYA 3NNMA 1URXA 2RM23 2VQAA 1JH9A 3TRBA 2A6WA 2EXIA 3DPRC 2XGXA 3D5OA 2QDNA 5A3UA 1IOAA 1T6GC 2RE9A 4GKXA 4ASMB 1TQ5A 5GAGi 3RYRA 4S2DA 2MEV1 2IFWA 3MUY1 3KT7A 4K1YA 5JMOA 1EAH2 4EZIA 4ES9A 1EPZA 1UOFA 1W8NA 3EB7A 3HQXA 5SV8A 3MDPA 1SDWA 2A3YA 2ET7A 3FWEA 4XUNA 1QJY3 3BTAA 2PELA 4CUBA 4KQ7A 3LPGA 3ZHIA 3UWPA 3OPTA 3VDDA 3WD5A 2WZPP 5FUNA 3WEZA 5BNPB 2OR1L 4MYEA 1EV12 4XACA 4CU9A 1N1SA 3ZFEA 4JCXA 3R6SA 2C1FA 4WM7A 2XONA 3WX5A 4XBLA 2MNGA 3KWVA 2WFF2 2HWE1 1UWWA 3SX0A 2XB6C 1LJ7A 3CF6E 1AR93 5IAXA 1PIV2 4QT6A 2ZEXA 2VAUA 1MZEA 3AZXA 3PJYA 3HIFA 3W5NA 5DABA 5EIYB 2B5HA 2XQRA 3OQMA 4I0BA 3VHRA 3ACLA 1YO8A 1QP7A 2A3WA 1DZRA 5CAZA 2WZR3 1WBLA 4GULA 4W4ZA 2V73A 1RUG3 4AVCA 4ES8A 1W8UA 1ND3A 2Y6GA 3CNAA 1C8M3 4Z5HA 4QWNA 5FPLA 4S2FA 4FT8A 1SBEA 3O12A 4LLOA 1DZTA 2R49A 5TSWA 2QQPA 4HN1A 1UF2C 4P9XA 3BN6A 5FFOC 1WETA 4DEVA 1LMB3 4KBBA 4XF3A 4FXKB 1VBD2 2Z42A 3J7MA 1U5IA 4L99A 1W9FA 5FZ4A 5A3PA 3B93A 3I2IA 4NAOA 5CG8A 2FCTA 4WVLA 3ES1A 1IPSA 5IK8A 2P3KA 3MEPA 3KHCA 3ABZA 5FCCA 2LROA 1SCSA 1NXMA 1AR73 1ODMA 5A33B 3D6EA 4BZ4A 4ARXA 2RJ2A 5I0RA 2WA4A 2WDBA 5ANNA 1WCKA 3R09A 2XVLA 3LIGA 1BDIA 2E51A 2WNUC 1NYWA 4TLGA 5A3NA 1NOVA 3AVSA 3SC7X 4AFDA 3TEWA 1PNFA 2HWF1 1QY4A 1U2ZA 2DV9A 4N53B 4QHBA 1R1A1 4RHV1 3UKTA 4I6TA 3KF5A 4NR1A 4X4IA 1BVVA 2UYBA 3IAQA 2AENA 3OP9A 2R063 3TWIA 5A7LA 1T2XA 2PYTA 2BWCA 2VUJA 2PTMA 3MZHA 3DYPA 4OBMA 4FPLA 1DGRA 5J09A 1GWKA 1NCQC 2VOTA 1WLDA 2CAVA 4HSLA 4LR4A 3I2GA 3ON7A 4YVSB 2EIEA 4P9IA 4JGYA 4CCLA 1JU4A 1O8PA 2VY0A 3EXUA 5KC6A 2EF8A 3POYA 3O1TA 2FFHA 1H2KA 2BYVE 2ZHKA 4MVTA 3LDKA 5C71A 4Q4X3 5H9PA 4OI0A 4JRAA 2YROA 2ZGMA 3N7LA 4IV1B 1VBD1 1WCQA 4XURA 2HEYF 4AF9A 1L1MA 5FQ0A 4KWLA 4A6SA 1Y9QA 4LMFA 4RYDA 4A41A 4QPGB 5DMYA 3KV6A 3UESA 4QQ2A 4NIAA 1VBE1 3WOGA 2J42A 4IEQA 4H3WA 4OVEA 4UT5A 1VIWB 4Z82A 2BNNA 2XHNA 2ZZQA 2HWC2 3AXEA 3LGRA 4NWVA 1O5UA 2UU8A 3I3EA 1KDKA 3F51A 2J1UA 2WWSA 3L9JT 2PUFA 1FMD1 2XDVA 3MW3A 1YQ5A 2ZEZA 4QPYA 4YM2A 3PVNA 2WBKA 4AR2A 4NOTA 1UYYA 1HRI1 4B1MA 2ZGNA 2VZUA 3P3PA 2Y0IA 1HJGA 1C5IA 5FYSA 1IQDC 3TAYA 3JD73 1JOJA 1KD7A 3HWJA 4CUCA 1L3JA 3N9PA 3MI8A 4XJUA 2RM22 1TMF2 3AVRA 4GMP1 5FMDA 2ADDA 2O4AA 2ZABA 2J7MA 4E4DX 4IW3A 2ZBJA 1RL3A 4IEZA 3AKQA 2MEZA 4JHTA 1DYOA 3WCRA 3KCXA 4AE2A 4B8EA 3OSDA 2VVDA 4QXHA 4W65A 2OZ6A 5FYIA 3ZSEA 2J22A 5BNNB 4FTEA 3AZWA 3URFA 1PZ8A 1W28A 4KU7A 5LA0A 2GNDA 2FMYA 4PDWB 3DPRB 4A7KA 3OB8A 3R4SA 1VBC1 1ULGA 2E9QA 1PZ7A 1QXRA 1QF3A 5BNOB 1AR62 2BRTA 1NLQA 1UOGA 5CYYA 1RUG2 3THTA 1VBE3 3SEPA 2YUEA 3VBRC 3WNLA 2YHJA 2N7GA 4BQYA 3DUIA 3R0RA 2GP5A 2Y6KA 3ZXLA 3B00A 5K98B 3I2JA 5FZHA 3KHBA 2B9UA 1RVF2 3LSEA 4ZXEA 4K9SA 3ZYBA 1MQTA 1PMIA 1HRI3 5T3NA 3VBUB 1H4HA 1PMJX 1RIOA 1VBB2 4QXBA 5FR3A 5JOXA 3H9AA 3NAPB 2NZ9A 4DY3A 5L73A 3O1RA 5J3UA 1K3IA 3ZVXA 3WNXA 2GC2A 1HQWA 4QDSA 2WS91 3W58A 4PJYA 1HQ1A 1ZVFA 3ZN4A 5CIRA 3OBZA 2D6KA 1HRV2 1VRH1 2EXJA 5DAVA 4CEYA 3DXTA 3PVEA 4JC1A 4MGYE 5A80A 4B1LA 4Z5CA 5GLWA 2J1EA 1H6YA 5AFEA 1WCUA 1GOHA 2JDNA 3HNBM 4K3UA 5J7MA 2BNMA 3DNVB 2WWJA 4JGYC 5A1LA 2ERFA 1RPEL 3H8UA 4EK9A 4XDOA 4X8NA 1CAUB 5FPXA 1NUKA 3VHNA 1H9PA 1W2AX 5DAPA 5ANQA 4C8DA 4Y42A 1H30A 4QGLA 2WO1A 1W9YA 4B4PA 1B09A 2QZ3A 3HN3A 2XH6A 2AEYA 1JZ8A 5CFDB 1JZ2A 2VMGA 1RHI3 1UMZA 5IFTA 3KD4A 2DURA 1H2NA 4EQZA 1K42A 4HVQA 3HQRA 5FYYA 1I5PA 4CDQB 4A42A 2WNUA 1CZTA 2RR12 5JVVA 1QJU1 2BV4A 3WF0A 4QU1A 4IWRA 3ZXFA 4XJZA 4CCJA 1BEV1 1BKZA 5ABJB 1S55A 3WW3A 2TBVA 3M8LA 2HEVF 4LUKA 4Z1VA 5C8CB 5KHGA 2DVAA 2GC3A 2ZS6B 4KNCA 3RJ2X 3PE5A 5FUIA 3TNQA 3RFRA 3R1FA 5K9YA 3RQ0A 2W52A 1RUH3 2EAKA 5DDJ3 2YY1A 3T0AA 4FQZA 3B5LB 2PXQA 4ZKTB 5GZCA 1NW3A 1REEA 1C8M2 1JZ7A 1ND3C 3VKMA 5A1FA 1GP6A 2KA3A 3K3OA 3QBQA 4EN0A 4EKIA 4I3GA 5FMCA 3KV5A 3AZYA 3PJQA 4DUWA 4IGQA 4UYBA 2WT1A 4AQTA 2HEWF 1UYXA 1UIJA 1V6JA 1AR81 4WZFA 3H1MA 2VCCA 5FZOA 2PXTA 2VZPA 1WW6A 2C26A 1AHSA 3E1F1 3KT1A 1H4GA 3IIIA 2WFF3 3M3EA 4FXGB 3TBDA 4B4QA 1JZ3A 5CKMA 1DQ2A 3VK0A 3ZFEC 3N36A 5C3OA 2K0GA 2Z79A 4JVAA 3E5XA 2HWD3 3KQRA 4XQ4A 5IK4A 3V0AB 4AVSA 2ODRD 1TMF3 3H1WA 2DVBA 4M00A 4OHXA 1JTZX 1UN1A 2OXBA 1IZ3A 3GBGA 4EN6B 1JXNA 4L2NA 1HLCA 1NLSA 3RRDA 3WQ1A 3FUOA 1MACA 1UXCA 1CPMA 3KV9A 3NJVA 4ZU4A 5FZ8A 4CCMA 4E4ZA 5IT6A 2CWMA 4LHNA 2JE7A 3OY8B 4PU7A 5EJ1B 1I3HA 4BQWA 2D98A 4PU8A 3DL3A 1OI6A 1ULCA 2DTWA 3ECQA 1TZOA 3D0JA 4DE8A 2KXLA 3S0MA 5CBLA 2R0FA 3MW4A 2JG9A 4FBFA 1HB4A 3AM2A 2EAAA 4IA8A 3GZUC 3I2HA 2JIJA 3FE5A 5ACA1 4D7SA 2IUOA 4Q27A 2LUWA 4Y20B 1ODNA 2Y64A 3RZMA 1GV9A 2XLFA 1AYN1 4KWKA 4SBVA 5HBAA 1IG3A 4QXKA 3QFIA 5JPNB 3O1PA 3VD9A 1NCRB 4AHYA 1HRI2 2GMEA 3ILNA 1JI6A 3VGIA 3D0SA 1LQCA 3OBAA 5EYYA 4I3PA 5FOBB 3HAGA 2BDRA 2MXDA 1RUH1 2Q5TA 2JQEA 2G4IA 2XBO2 3USSA 5AC93 1FT9A 4MGSA 4JRLA 1ASJ1 1RYYA 3T1LA 3K4DA 1E3OC 2OPKA 4XF0A 4CCKA 4OMCA 2LLVA 4E8DA 5JUVA 5FXXA 3UNPA 5JMCA 3BTXA 3KM5A 4MV2A 3CJIB 1UY3A 1NAEA 1PGW2 2ZGTA 4WM8A 5H9SA 2XL9A 2XHKA 4XAAA 1Y4WA 4ZS3A 5FZOB 1X33A 3VHPA 5CNAA 1MFQC 3QF3A 1OH3A 2OQ7A 2EXKA 3OQOA 2P3IA 3Q8CA 3ITQA 3J8F3 2H6BA 3MIDA 4A7ZA 2LNMA 3Q8EA 2O0OA 3E6DA 5FYVA 2Q0AA 3MF9A 1CPNA 3S5QA 2LYKA 1SFPA 4X8PA 2UYAA 2GAUA 1Y7YA 1ND3B 2W68A 4IE4A 3SCFA 3AXDA 4P9YA 1MVQA 4RS5A 1VBD3 4QD2A 1A34A 5FAXA 2PXUA 4GZ9A 4MADA 3QH7A 4CA9A 2Q1FA 3RWKX 3QOWA 4IESA 1NE4A 2IVJA 2EBYA 4YW2A 3AKTA 4XC9A 4E2GA 1S0IA 5FJKA 1QQP3 2A75A 5JUWA 2PUBA 3ELNA 5FYTA 2QQVA 3JBG2 1SLBA 1PIV3 2AREA 2WR9A 3ME2A 2VZSA 2QTWB 3ATGA 5DAWA 2W87A 3KGZA 4CDXA 1BCXA 3RNSA 1V6MA 4Q2JA 5D21A 5FYMA 2W2IA 3RZZA 3AL5A 4COWA 5B4XA 5A33A 4HONA 3EUSA 3ETPA 4Y4RA 4PDWA 4XJ8A 4LITA 2WINB 4RL7A 2JG9C 1W8WA 4CDQC 3D82A 2P2KA 2D3SA 4Y22B 1XSRA 1LECA 1IPJA 1CX4A 4PU3C 2Y0OA 4R4ZA 5G05L 4C0BA 4V2VA 2RJKA 4ZPIA 2D5FA 2V4AA 1JOBA 3EO6A 2IVQA 4KU8A 3BB6A 1QP0A 3KS7A 5C8CA 1YFYA 4A2UA 3OPWA 4YW5A 2JKXA 3GZEA 3OJBA 4HKLA 2BGPA 3OGJA 3SNMA 3WF3A 3WSOA 1DG6A 1XPWA 4XYXA 5ERLA 1Q3EA 1WH6A 5L36A 3OD0A 2LYRA 1V6LA 2YFZA 1ZRRA 3ZYHA 4KH9A 5LCWL 4AEKA 4YGBA 2BOIA 5DAXA 5F6LB 1S0BA 2EVXA 1CJPA 4FOVA 1ZVVA 3OGGA 4GJYA 1UU5A 4ET7A 1YI9A 4BXFA 3OG2A 1C57A 2GH2A 2IXIA 1RUI3 2VMCA 2DU1A 3C3VA 4FOYA 4ARYA 4FFIA 4CDUA 1OVPA 1WD3A 4RN5A 1AXYA 1ASJ3 2XJTA 3ZDVA 5JSPA 5A6ZA 1W2TA 3CECA 3G7DA 3D4KA 1VR3A 3RI9A 2UWBA 2WNOA 2YMZA 4EV0A 2XXPA 2F4LA 5FO8B 5DAQA 3ZX7A 5JZGA 5ISLA 3NV1A 4ZY9A 1A78A 5LRRA 5I8YA 2AYHA 3G6JB 4RHV3 3IDBB 2P6HA 1CAVB 3JBG3 4N53C 1CONA 4XTPA 3K46A 2BERA 1JN2P 2UURA 1Q5OA 2ZX2A 4K40A 4YM0A 2YU1A 5KHJA 4COZA 4M0HA 3H3ZA 5FZ0A 3VD5A 2J1AA 1YEWA 4E4HA 1LB2A 2X10A 3ACIA 4KBZA 3VZOA 2F4PA 1JHJA 2J1SA 4YZ1A 4OB4A 3VBRB 2WO2A 3GZCA 1Y9MA 4R8HA 5K0UB 4KL1A 5JAXA 3ZYRA 2WT2A 1YQ8A 4LBLA 4D6QA 2QQKA 1SLIA 4AYUA 3GALA 4XAEA 3KT4A 4P9GA 5J36A 1O3RA 2EXHA 1QOSA 3TEPA 1OOPC 2VVFA 4FFFA 3VD3A 4EKGA 4LNVA 1KFXL 3GN5B 1RINA 4QQOA 1MEC2 1LOEA 1LR5A 4X4CA 1LU1A 2B8MA 4QB1A 2Q8DA 3UT0A 1XRUA 4ZONA 3BYWA 3LPFA 4O7XA 3NAPC 4HFSA 2Q1ZB 4J25A 4D6SA 1EPWA 2HWB3 3OCPA 1PK6C 1UTXA 5L9BA 5FY5A 2UY8A 4PLMA 2ARAA 2PXJA 4Y24A 3U10A 1CIWA 4H2AA 4C0HA 2NM1A 1NQDA 1UY0A 3QLQA 4UI9L 4IETA 1HXS3 1WW5A 1ZRIA 4YG7B 1ONAA 2XWBB 1KJRA 4LTAA 3S5AA 1G9FA 1QMJA 3RZHA 3CBNA 2VMFA 4K8RB 2PUGA 1I5ZA 2VECA 2WFF1 3NQHA 1DQ5A 2P4EA 3CJIA 5LBCA 2PXPA 5LY1A 1HQLA 3FHIB 3VZMA 2J7UA 4NDWA 1B35A 2BBAA 2OUJA 3AJZA 1GU3A 4XXPA 1LLIA 1CJDA 3HN1A 3J7LA 3GJAA 5T55A 2VBBA 3I7DA 1MS3A 1S4CA 2ZA9A 4LBJA 1SBFA 2H0VA 1Q56A 2RMU3 4LHSA 2GU9A 3N9QA 3JD71 5EWSA 4L9BA 5F5CA 1XNKA 2VXJA 3AK0A 1RUD2 3IT8A 4BJ0A 2RS32 4SLIA 1BK0A 1A6CA 1MPXA 1RITA 1S0GA 4BOWA 4DOUA 1L7RA 2I74A 3V0BB 2YU2A 3GM8A 3MIFA 2VMHA 5EV7A 4XBNA 1OKQA 4D0QA 1FPN1 3HBZA 3KMHA 4TLFA 5C8CC 4QM8A 4YBAA 1RGSA 4LK6A 1WD4A 1Z0HA 5HI0A 1QXJA 3C2UA 4J1WA 2F6BA 3M4FA 3R4UA 4L11A 1OPMA 3HPNA 3I54A 3D3AA 3PUAA 1VLNA 4DIQA 4IGPA 3T0DA 3R05A 4ZS2A 3B94A 3QH6A 4X4BA 3JQWA 1QKQA 2DU0A 2GNBA 2H0BA 5GZEA 2LALA 3WW4A 1Z78A 1XC6A 5EPAA 1POV1 4LUMA 1UPIA 2WSUA 5GZGA 5HXMA 2VE1A 3GCXA 2NN8A 4NPMA 4LO6B 2W39A 3WG1A 3H8OA 5GKAC 1BEV2 4AAPA 2LYPA 4CDXC 2QQWA 3OGVA 2WNVB 4R9BA 1SLLA 1K12A 2RVAA 4X4DA 2V09A 3VZLA 2HFZA 1XU2A 4Q4Y2 4LKEA 2NMOA 4DINB 5FY4A 3PMSA 3JXSA 1JYWA 4HN0A 3EHKA 1W06A 5FLJA 4DE9A 5A6YA 3AJYA 4MOAA 4HK8A 1FX5A 3I3DA 1EUTA 3N4MA 1EYBA 3WV6A 3QQ6A 5JIAA 3S8QA 1OBNA 4DXTA 1ZZBA 2VMIA 3RS6A 3TEZA 2L49A 3RYKA 4FTSA 2VQTA 1NG0A 1DULA 2FBEA 1SMVA 4DNYA 2RJLA 3NW4A 1R091 4V2WA 5GAHi 4XTMA 2W1WA 4TXWA 3CZJA 5LBEA 4I09A 4EWAA 3F52A 2WN3A 3VL9A 4XF9A 3LEKA 1ZRDA 4YZ4A 4Q2FA 2A5ZA 3PMEA 5DUXA 1G9CA 1ZBA3 4HG6B 2XXZA 1VRBA 2ARBA 5HPOA 5LEJA 2RS52 2ZGOA 1WA6X 4PBPA 3OKZA 1YWKA 2BZDA 4Q29A 4X4HA 2D44A 4C91A 4Z8BA 1W6OA 4OUMA 1GYKA 2B46X 4JTOA 5KXBA 1U5ZA 3U75A 5IVJA 2ICTA 5C9AA 2Y26A 5LBFA 2BPA2 2R16A 1MEC3 2HWF2 3SH3A 3ZR5A 2UY9A 3VHOA 4JGZC 3WW2A 1HRV3 4UF0B 1NA1C 4URAA 5FWJA 4CP2A 1AL22 2I45A 4TYSA 1E57A 1RVF3 2C4XA 1W8OA 2XOMA 2YG0A 1OC1A 4ISRA 4HETA 1B0NA 3GJBA 3I59A 4GQ7A 3WXPA 5HV4A 1RHI1 2VNOA 5DTRA 4ZHNA 1UKGA 5LEKA 2D6NA 1P8JA 4H7LA 2A71A 1IKQA 3AFGA 2GDFA 1O8SA 4LBNA 3ZXKA 5BV6A 4UAPA 5FWEA 4IDZA 4QPGC 2WUHA 3UKVA 2J7WA 1AYM3 3BOPA 4DXSA 3WP4A 1LENA 1Y9GA 1OPOA 1HKDA 1QWRA 3TFLA 1VBA1 1LEMA 2KM2A 2V4VA 1VALA 1KEXA 1CGPA 2VC9A 3BTYA 3GNEA 3LA3A 3HNMA 4IUGA 1LEDA 5FJHA 1JODA 2W9XA 2W92A 3HQUA 4NIHA 1LODA 2ES3A 2MHFA 2JD4A 4I30A 1R64A 5FZFA 4L92A 5H9QA 4YG1A 2PA7A 1KFUL 4COYA 4A7YA 5A3LA 2IU7A 4UFHA 2JDKA 4KWUA 4AEMA 4FO9A 3HBKA 5A3OA 5C33A 3O1OA 1QQBA 1JYCA 2A7AA 2W3JA 3I97A 3H50A 2PXEA 4DB5A 1F2NA 1DQ4A 2PLV2 1GANA 1JZ5A 4QPGA 3ZFGB 2WYFA 1G6NA 1U5XA 1RZSA 3KVAA 4L0PA 4DUVA 3H42B 1W9WA 3PUSA 4QKNA 4GH4A 4RQPA 4YZ2A 1UOJA 5I0UA 1J58A 2P34A 3DPRA 4CUAA 2WNUB 3DYOA 4IEXA 1ZBE1 3ZXAC 3LQXA 1ZYBA 4LO4B 4B7EA 2GRMA 5C4WB 1D4M2 4BYYA 1UCXA 3AP4A 4AFAA 3H8XA 1PZ9A 4D6RA 2D3RA 3JBG1 3V0BA 2GMMA 4KGQA 3POIA 1QJFA 4GJZA 5FK8A 4DZGA 3ZFGA 2HSGA 1GSLA 4B4RA 3AX4A 2JKBA 4BK5A 4D7YA 1OQ1A 3BI3A 3H5TA 1CZSA 2D40A 3B9CA 3VBFB 1CAXB 1GZCA 1VMFA 2XXQA 1MZFA 2JDMA 3B69A 3M3CA 4IEPA 1LGBA 1R083 2RV9A 1KRIA 3MFCA 3TN93 5CZKA 3ZSJA 2VZ1A 1L7QA 1QJY2 3NDBB 2CDOA 3LFPA 5DTMA 1B35B 4L97A 4IVZA 2VTFA 5FQ0B 3F2ZA 4FBIA 5D2AA 4J6GA 2HWB2 5J48A 4QGMA 1I1EA 1Y43B 2JEMA 1YIPA 2XQXA 1VB2A 1Y3TA 1BVP1 4Q4Y3 4QB6A 4BISA 1J84A 5HXVA 2W0XA 2VG9A 5FZIA 4BQ1A 2VD7A 2VNVA 5FP4A 5DPNA 2X05A 1QJY1 4NPLA 1QJU3 3HT1A 3ZSKA 2QNKA 4XDPA 5IWFA 1VBB1 3MIHA 2MQKA 5A7WA 1MQTB 4Q26A 4HBNA 5FY9A 3VBUA 1UXDA 3LA2A 4AFMA 1FI2A 2W95A 1QP4A 3T2PA 2SLIA 5FLHA 4XEZA 1QQAA 2A6CA 4YZ5A 1O59A 4Y1UA 1UAIA 3LFIA 4DO0A 1A3KA 1BLZA 3CLCA 4PBOA 2M4HA 4XFFA 1ENQA 1FOD1 1MQTC 1NX9A 1V70A 3MPBA 4LLFA 4U2AA 3N9NA 4LQRA 4LBQA 1LCLA 2PUAA 2YBSA 3KL4A 4Y1YA 4CEWA 1VBC2 1GUIA 3VBRA 5L7OA 1EFAA 5M0TA 5BNNC 5LY2A 4LIVA 4XFBA 1QPZA 4X4FA 1MVEA 4UFLA 4JV4A 3NSTA 5BY5A 3PVOA 1NA1B 1QQP1 4KI5M 3AL6A 1QIQA 4Y20A 4YWAA 5EYXA 2JDHA 2HWF3 5EZWA 2BGCA 4CXXA 3NJZA 3SQOA 1S0CA 4I0AA 4HK9A 3S57A 1FV2A 1UXXX 1XJAA 3TRSB 3I8TA 4LK7A 1YLLA 5KHIA 2VL4A 2PPXA 5J96B 4MG2A 3ZN6A 1V0AA 3VZJA 1RIRA 3WDYA 4AG4A 2B5AA 4CDUB 1KJLA 3MBWA 2AUYA 2RR13 4YLZA 4CU7A 1DIWA 1WKYA 3DM5A 3IMMA 5FP9A 4AVBA 3T08A 3VL8A 4KMQA 5AVPA 1FAYA 4D69A 4ZZ8A 2IXHA 3CQOA 3NV4A 1EAH3 2ZX0A 2GNMA 2OQ6A 3ES4A 5GLZA 4N43A 4BQ4A 3RWNA 5KXCA 3WDXA 2EA7A 2KD7A 1W0PA 5CVRA 3UL2A 1UMHA 2RS13 2P3YA 2ILMA 3M2MA 3MLJA 1K45A 2WYSA 4AI3A 2X5IA 3LKJA 3PUIA 4N90A 3CJIC 5EJ3A 4QXCA 5GALA 1GR3A 1ULDA 2YGLA 1XBFA 1Q43A 2C6SA 1X82A 1IS5A 1D2SA 4FPJA 2ORXA 4IEVA 5IVFA 3KVBA 3NNLA 3LCPA 4CEYB 1FMD3 1WCSA 2VW2A 2JVLA 1XNCA 5FBZA 2DCYA 3SH4A 5JI9A 1R082 4ER3A 3L2YA 4XUQA 1O6UA 4ATFA 5LK7B 4XF4A 3OD4A 3LDRA 4XJAA 5FTTC 3POEA 4J1XA 1CN1A 4PQQA 1R1A2 4OULA 1WMEA 1NEQA 3RDIA 1GP5A 3NAPA 3U14A 1FOD3 1NCQA 5F3CA 4IL7A 4I6RA 2PUCA 4OI4A 1TMF1 1IGOA 2C5DA 2ET1A 3FJSA 3ZKYA 3JCIA 2RS51 4FFGA 2QQNA 4FPHA 3ZXDA 5BXXA 3BUCA 1QJX1 2CWSA 5FYHA 4Z5DA 2PHXA 5J98B 4RR3C 3WF1A 4LBOA 5J37A 4LBMA 3ZKUA 1VPWA 4UXAA 3MW2A 4BPZA 2WQ8A 3J8F2 4Q0SA 4YG6A 1LOCA 4CCEA 5LW9A 2R7EB 1W9TA 2FDJA 4JAAA 2JB4A 3M1HA 5FP8A 1XWRA 5HCAA 5A70A 2PHFA 1GWLA 1ALYA 2GNTA 2VJXA 2XUMA 4GIQA 2E7QA 4Y1ZA 1NQJA 5T5JA 3O1MA 3KV4A 4R9DA 4E8CA 2W94A 3A4UA 4NUBA 3B3QE 4TWTA 1C5HA 3WF4A 1PRUA 3AKRA 3IIAA 5JZGC 1VAMA 5CADA 3WQBA 5KR7A 1BMV2 3K75B 1JU3A 5IK7A 5FYZA 1HDKA 1X57A 1SLTA 3TELA 2VM9A 1WZXA 3T4HB 3WNMA 3FUQA 2VO5A 3WUDA 1M06G 1CAWB 1OSGA 2PN5A 2JE9A 2WAOA 1AXZA 2JG8B 2DUPA 1ZRFA 3NNFA 4WM7B 1HB2A 1LESA 1N1TA 1RUF1 4M4RA 3U78A 1EV11 3H3UA 2GMPA 2XVGA 3AC0A 4HXCA 1WW7A 2ZGKA 4NHMA 4QU2A 4MZUA 1YYNA 4QAWA 5C3QA 5C5UA 1AUYA 5J1XA 1AU7A 4LO7A 3PTYA 2B4KA 1DWKA 2RR11 2ZMLA 3NV3A 1H1AA 3BTZA 4WM7C 2FQPA 1QJZA 1HXS1 2W91A 1LKNA 1YQCA 1IPKA 1WLCA 4GKYA 4YGCA 3K51A 2YC0A 1W6QB 3RPQA 5F3EA 3VDDC 1D0GA 4HL0A 5BPXA 3CL1A 3D8CA 3BIWE 4RFT0 2L9LA 3RYPA 5F3IA 2WS92 5FKCA 4FPFA 4F7ZA 2OT7A 4Y33A 3OPZA 1W39A 2BUKA 2PQSA 3FFQA 2ZHNA 1Q8PA 3Q8FA 3ACFA 4QX0A 2X8KA 1FV3A 2ZEWA 1RUNA 3A9ZA 1N1VA 2WC2A 3USUB 5KC5A 3ROUA 1GT0C 4AQSA 1AVBA 5CFDC 4RGGA 3U11A 1UZ0A 1JUIA 4AW7A 4QKFA 4ASLA 1AX2A 5CFCA 4QHZA 1E5IA 1FATA 1LRHA 1SG3A 1TG7A 2JWPA 4PDWC 3O1VA 4NMIA 3GZDA 1HN1A 3IM0A 2HWC1 2IXCA 2DVGA 2ENRA 3RI8A 5JOZA 1ZRCA 4Q4W2 2B7YA 1GNZA 2VCMA 4FPOB 3H0OA 4BWOA 5IVEA 2W1UA 3GN5A 1ZZ9A 1C1LA 2X5IB 5F5QA 5JCTA 2R1BA 3GHNA 4Y1VA 2VZQA 2YPJA 2JX9A 4R52A 4LT5A 4Z59A 3BDNA 3SITA 1DBNA 2V72A 1GNHA 2F17A 2R1DA 2RS33 4KG8A 2BFUL 4BLJA 2FDHA 2XIUA 4Z2WA 5FP7A 3POFA 1NE6A 1C28A 3KGLA 4CCCA 4RS5C 1XE7A 2DBIA 5HCHA 1OSLA 5FPBA 5AFBA 4I2OA 1D2QA 4MUVA 4PLOA 4AHZA 2AXVA 1RTVA 2EIDA 2LLWA 2AC1A 4Q4X2 1FXZA 1EY2A 2XVKA 4LOSA 4CZSA 1XQNA 3ZXJA 2PXKA 1RXGA 4B29A 5FMOL 3GYDA 4PT6A 1G9DA 1M4WA 1V6OA 3VBHC 3GF6A 5A3TA 1GWMA 1Z7S2 5JOYA 2VCBA 2Y6HA 1COV2 3JD72 1X9PA 4UW6A 3N7KA 5FRAA 2ADEA 3DF0A 2L8NA 3JXBC 4GB31 2O8OA 3ZYIB 2PAKA 1XE8A 1DGLA 3EJKA 2QQLA 3DXUA 2VMEA 4RR3B 2D6OX 2PAEA 4XMAA 3ZYFA 2WZEA 5DUVA 1DCSA 1JFTA 3P1IA 1LOFC 2VZOA 3MPPG 2ZZJA 5CFCB 2Z2SB 1PO13 3DCQA 4GH4B 4Q4Y1 4RQPB 2ZAAA 3J7HA 5EFUA 4HOOA 4ER5A 3VBOC 1POUA 2BP6A 1PK6B 2BVVA 3A0KA 3FBMA 1AJOA 3O5SA 1HB1A 2X09A 3HZIB 4GMP3 2GRLA 4NN0A 4YNIA 4XFCA 4AAXA 1KDMA 1HJFA 2DFCA 3B02A 4ITCA 3OEBA 3MLFA 1F4HA 2QFEA 4NO4A 3RGBA 1CQ9A 2VMDA 4NPRA 1N1YA 2D6MA 5LASA 1OLME 5AC91 4O8BA 2Y34A 4DS0A 1AXKA 2W46A 2D5HA 4Z92B 2HBTA 2QBXA 5I8TA 4MGIE 1US2A 4NHKA 2UWAA 2Z69A 4LKFA 4CU6A 5C6CA 4FPEA 4XQDA 2ZGRA 4UFKA 1CZVA 1RUD3 4IXLA 4EYUA 4RHV2 3LDBA 1OMIA 1GBGA 3AKPA 4MHRA 4MXVA 5A7SA 1OA2A 5JR2A 1YHFA 3HOBA 4BQ3A 1S1AA 4YW3A 3IDCB 2IVBA 3AP6A 3MHZA 3UFDA 1CAWA 2RG4A 5FY1A 2XXAA 4DFSA 4XZUG 3SH5A 1Z7S1 1OF3A 1W8FA 2P3JA 4PI0A 3NO8A 1RUE1 2CL2A 1ND2A 5IK5A 2WJSA 2PHWA 4JKMA 2CTVA 3WHUA 1VMJA 5FMBA 2XPJA 2E32A 2R061 1JFSA 4F8DA 2CGOA 1HXS2 4Q4V1 4QQLA 5A6XA 4H7MA 4LOTA 1PM7A 2JDZA 2XLAA 4MXWA 1RJ8A 2WWUA 4BE3A 3UGGA 4UBHA 1BQPA 2WZR1 3UYJA 3SR4A 4PCRA 3APBA 1C8NA 4OUSA 1QH7A 3VN4A 1F15A 1C4RA 4CXYA 1CQTA 1MR5A 2G9ZA 5GLTA 3X29B 1UQXA 1O5LA 1W04A 2QCSB 3B9IA 4EZ4A 1JYIA 1W9SA 3RMYA 4P9WA 4AI9A 3VKFC 2VCAA 2XJVA 1PHMA 2I2SA 3MIBA 5KHKA 2OPWA 4G4FA 2Y6FA 3IZOA 1E5RA 2D7FA 2WQZC 3WLUA 4CTEA 1IS3A 1XYOA 4LXLA 2GC1A 4HMZA 1RUE2 3PLQA 3IPVA 1HV1A 5G04L 4M3CF 1SBDA 4IEYA 1XE0A 5FO7B 1X2LA 1YQ6A 1S0DA 2XJUA 3DV8A 2HINA 4HRAA 2ORZA 3FHQA 4FOQA 4JQRA 3ZDSA 4M0NA 5EHDA 1V9U2 1ZBA1 2GSYA 2VZRA 2XBO1 4RS5B 4LE3A 1JYXA 1U12A 2CGNA 1J59A 2BW8A 2CSGA 5JXJA 2ZCWA 3IWZA 4IEUA 4XHXA 1WWYA 3GHMA 1GFF2 4CEYC 4EE2A 4XETA 1G9BA 2XSDC 2DYCA 1W6PA 2LYLA 2HKXA 1NXD1 1GQGA 3I4IA 2IXLA 1J3PA 1O91A 5K0UC 3M70A 3G0TA 1RUD1 2B42B 1JUHA 2QQIA 4OI2A 4LJHA 5DZEA 5IJRA 1POQA 4CYDA 5FZLA 3KXAA 1DGWA 1W99A 2WO3A 4AVAA 5JOWA 5I8SA 5LWBA 3WW1A 3PUHA 3U1XA 1PGL2 1NY71 3VBSC 4GAZA 5DUWA 3IDAA 3EMRA 3LB9A 4KG0A 4HANA 4ATEA 5D8AA 3ACHA 1WUVA 3VDAA 1QJX2 3RJRA 4NRQA 3ZMOA 1ENXA 2BJCA 1RUJ3 2JENA 1FNZA 1PVXA 3WDTA 4I01A 2WUSR 1YNAA 4PIYA 4MH0E 1BMV1 1AYM2 4CDWC 3ZN5A 4HZFA 4WVVA 1F9KA 1JOPA 4IV3B 1SDDB 2IVIB 4YW7A 5LBBA 5BNPC 1VE0A 1J1TA 5BNOA 1R63A 3M3IA 2R041 1UX6A 3ACGA 1PX3A 1AX0A 3O0XA 2VEOA 1UY1A 2RHPA 2NYYA 3JUUA 1D4VB 4UOJA 2OUHA 1OD5A 1WMDA 4IV3C 4E4SA 2C24A 2PHDA 4N7UA 4AI8A 4YFZA 4H55A 3LD8A 2VUDA 3ZSLA 2JDPA 4ZXKA 1MEC1 2H6CA 1AR92 1V6IA 1W8ZA 2VQ0A 3DN7A 3GBFA 1KS4A 4MGKE 3ILRA 1PO12 5HV0A 1RMU3 3VBFC 4BLIA 2IUWA 5FYUA 3BVCA 5FXWA 4AEDB 1O4ZA 1OQDA 3ZMNA 3MV11 1QNWA 1OD3A 2D6LX 1YC61 3H7JA 3AZZA 1CVNA 1UU4A 4K8FA 1ND2B 3VZKA 1SQ8A 1QQP2 3I2KA 4XQWA 3MV01 1S7EA 4GWJA 1PNRA 5FZCA 1HN0A 3WY6A 2YXSA 1JYTA 3D1NI 1ENSA 4GHJA 4JDMA 2ZHLA 2LS6A 4R9AA 3V0AA 4B7KA 1KGYA 3HJRA 2WRAA 2G19A 3SMHA 5A7OA 2BTVC 4FI9A 1UXZA 2VW0A 3AP7A 1XSQA 3OWQA 2FHRA 2XBO3 3POGA 4N7IA 4AZZA 3LAGA 3T2QA 5FZKA 3VBSA 3CDZB 3SLIA 1UZZA 1IS4A 4A3ZA 4Y3OA 1DLCA 4EJRA 1GLHA 1PERL 4BM8A 4LA2A 3SXWA 4ER7A 4AQ2A 4CEWB 5K0UA 4MGQA 5C3SA 1GZWB 3NMBA 1W0NA 1ZZCA 1LHVA 3CMGA 1ENRA 5T5PA 2KPJA 2OS2A 4HKOA 4M3CA 2W1QA 1DHKB 3VKLA 3VKOA 5FPAA 3U3WA 5DZFA 5A3WA 3C7FA 1W6NA 2IFRA 2VNRA 1V6NA 3KCCA 4HPKA 3TB0A 5GJ6A 4XFIA 4L8QA 5JZGB 3BKZA 4O65A 2VOWA 4XBQA 4BHPA 4NIGA 4A3XA 2W47A 1AR82 4JCKA 2WZ8A 2BU9A 5H9RA 3JB4C 4UW3A 2R0HA 5DN2A 2AXZA 2D5VA 1SFNA 3NROA 1ZM1A 1TVGA 3NKGA 1OOPB 4JDNA 4QB2A 3W21A 1DFQA 4PF5A 1SZBA 3GXUA 3TOJA 4CP9A 5LA1A 1RC6A 2DCJA 4NWWA 4FP3A 2RMU1 3A21A 3E5UA 4MX3A 4XE9A 4OI1A 1ZREA 3K77A 3FBYA 3QD6A 2D3PA 5CKQA 5EXOA 5FBJA 2L1PA 4BMBA 5JLVA 4NRMA 1RUOA 3IPVB 1PVC1 3E6BA 2QJVA 3EQEA 3U4SA 3POBA 1RUC2 1OLQA 2QQUA 2GZUA 4D94A 4IEWA 1OHFA 3ASIA 1NLRA 2CSFA 3QOPA 3N7JA 3AMPA 1NZCA 1O4YA 4RA0A 5LK5A 1IG0A 3WG2A 1OFSA 1GQPA 2E53A 3CROL 4EZHA 5DTQA 3U07A 5CB7A 4K21A 4Y26A 4O9EA 5F6KA 5LA9A 5FZ9A 4FAGA 3OF1A 5C4WC 1OA3A 3K3NA 3M3QA 2DCTA 4YPJA 2WSVA 5A32B 4X4EA 4DMIA 1WW4A 2XL7A 2XMLA 1T6BX 4ONUA 1OA4A 2YPDA 1JZ6A 1WLWA 5JR7B 4QGNA 3ZYGA 3I2FA 2JG9B 1UOBA 2LTNA 4XUOA 1GQHA 1BJQA 1GOGA 4TTGA 2A6YA 4XUPA 5HCBA 2XLGA 1LTEA 1H2LA 4WBBA 1TME2 1W2NA 2PXVA 4JX0A 3BS3A 2VOVA 4NAMA 4QDRA 3KF3A 2R30A 3VDCA 4HLTA 4XW3A 4AK3A 2WFPA 3K48A 3OYWA 2XJPA 5FYCA 4JKKA 1OLMA 1MZ5A 1QOTA 2O49A 2VUCA 2VQUA 4LEJA 1LOGA 1X36A 1RUI1 3PHMA 4EROA 4Z2AA 4ER0A 1YI7A 4HVRA 3ZFFC 1SEFA 2XKPA 1LHWA 3E5QA 2AACA 3J9SA 3F95A 1FYUA 2ZX3A 5EQUA 3JXDL 1GOFA 5C8WA 4Q0VA 2XR4A 2GZWA 1FNYA 3NVCA 3TYJA 4AEDC 2XWJB 2ZOEB 4AVVA 4LBQD 2RS53 4XJ9A 3T30A 3MLLA 5IVCA 1A8DA 2OVUA 2NMNA 3WZ1A 5JIUA 5DRTA 1AZDA 1UX7A 2YB7A 1AYM1 4FPKA 3SHRA 2FDIA 4LIUA 1QJU2 4QQPA 3WINE 1VBA2 1VRH3 5FP3A 4AFCA 1JBCA 4YVWC 3VLBB 5L9RA 1DLLA 1AR61 2D93A 5LZ6A 2E33A 5IVVA 1V9U3 1WMFA 5DT2A 3FYMA 2WL1A 1Q8VA 5GLUA 2X29A 1UZWA 1H8TC 3T1MA 1REFA 1AF9A 1YFUA 1FPN3 3I2OA 4GXLA 4Q1PA 1CAXA 1GZWA 2HCSA 4I6UA 1TE1B 4I8TA 3RZKA 5F39A 4QPWA 4LBQB 2DVFA 4IV1A 4QPIC 2CNAA 2QUOA 1NCQB 1EAH1 5DSXA 1F5JA 4AI1A 1PO11 2DFBA 2WS93 2XKOA 3VDBA 5CG9A 1ZPQA 2WN2A 4RSUA 5DUUA 3I3QA 5FO9B 1W0OA 2JDYA 2YZ4A 5IAVA 4OZOA 1OCTC 1C1FA 3GZTB 1G86A 1CX1A 3KQ4B 1UW8A 1YRZA 4NHLA 4PIZA 2ZHMA 3AZVA 5F3GA 2RS12 1BZWA 1LOAA 1RHI2 1TME1 2J1TA 4AGRA 3I49A 2JG8A 3G5GA 1H8TA 4XCAA 3VV1A 4F3JA 1ACCA 3C8XA 4CRQA 1O7FA 4ER6A 1MS9A 2PHUA 2XJRA 1DQ0A 3I2DA 2QQOA 3FZ3A 4XZPA 3UV9A 2FDKA 2NP0A 2AZ5A 2AH2A 1W6MB 1C3HA 1S2BA 2ZGLA 4I0WB 2R6QA 5FPZA 5F5AA 4E9KA 1QNYA 2OW4A 3THCA 4BQ5A 4CP0A 4DEQA 1W2UA 3POJA 5I0DA 2CYFA 3A9YA 3TN92 2LRPA 3BPSA 3FFZA 4QM9A 1VPHA 2FDFA 3NXHA 4ORFA 3BOWA 3WF2A 4IGOA 3UGHA 1R1ZA 4P5HA 4D7TA 3PDQA 1SLAA 2J1VA 5I0TA 1D4M1 1WIZA 1PIV1 1WBFA 2DCZA 1DP0A 2IWGB 5GZDA 2PHTA 3NL1A 1XYPA 3CZUA 4AWDA 1AR83 1NY72 2VULA 3LF7A 1F8VA 2VBDA 4XHBA 1SPPB 3TN91 4BXSV 2Z5WA 3OBRA 3ZPOA 1R69A 1POV3 2ZPXA 4S2HA 2ZTNA 5FY0A 4X4GA 2JECA 3ENRA 2RMU2 1TME3 3T0BA 2AWIA 2A6VA 4YVSA 3P3NA 1AR71 5DDJ2 1FOD2 4XUTA 2Y60A 5IATA 2D97A 3N35A 2YBDA 4MXWB 3PVBB 2YYOA 1PO23 1VP6A 2PMWB 4FPCA 1JYNA 5FZEA 1J3RA 1R1A3 1G7YA 3VBSB 3ZYJB 3GGLA 3THPA 1RUJ2 2GN7A 3LE0A 1ZBE3 1N3QA 1TNRA 3AMNA 2TEPA 4QDQA 1W6PB 4CE8A 2WLQA 3ZPYA 4EWEA 2QZ2A 2RDRA 3WNOA 3U0ZA 2ZGQA 4OLLA 4MGZE 1APNA 1KS5A 2HJIA 4BMEA 4W6WA 4WVMB 1MS1A 1YUDA 4QX7A 2WNEA 5A7WB 3IB3A 4B3NA 2PQQA 2ZGPA 3K4AA 3H1YA 5A32A 3ZO0B 4LBKA 4GWNA 3J26N 1LOBA 1S0EA 5JXGA 2VTXA 2CROA 2JCGA 2VW1A 3AKSA 3AP9A 5F32A 1W6QA 4AGVA 3QOXA 3KSCA 4NRPA 4UFMA 3WG3A 1X50A 5FY7A 4CPBD 1HV0A 2KZ8A 4UW4A 3UJQA 2Y33A 1HW5A 1OH4A 1XU1A 2KR2A 1RB8G 2Y8KA 3SEEA 4R9CA 2H8RA 1EP0A 1KXGA 2Q8EA 4JCYA 4Z58A 2O38A 2HWC3 2VH9A 3B01A 3TNPB 4YSFA 5F9TA 2XI8A 3PTRB 3OTFA 5BUVA 3ZFFB 1XNTA 3ZM8A 1HB3A 3FYAA 2K9ZA 3OGRA 2RM21 5AVAA 3KB5A 5LB6A 4NIDA 1PGL1 1YJKA 2MPFA 3SISA 4AI2A 1BBT1 3KZ4C 4EQVA 1DW9A 2PIJA 4PI2A 4WV8A 3PU8A 3QYXA 3HD8B 1LULA 3O14A 3MEJA 2IXJA 5F8PA 2CAUA 1IKPA 1RVF1 4IE0A 1QXPA 4QKBA 1GNYA 3T3YA 3W9AA 5DZGA 5KWRA 5IHRA 2BJSA 4UFIA 4FN3A 1EUUA 1GZTA 2D6PA 1US3A 3N3HA 1RUC3 4OUEA 4Q8LA 3ZXEA 2AEZA 3PIJA 5CISA 4OHVA 2ETEA 1YXWA 2ZMKA 2E63A 1SACA 2X53S 2XG3A 4YW4A 2A70A 5KBFA 4ISQA 2K46A 2Y6JA 4LORA 5CEHA 1VBA3 3FMGA 4UFJA 2Y38A 3CO2A 4Q8KA 4QX5A 2EICA 3CIHA 1F31A 1OURA 3V65A 1YQ2A 2W08A 3Q8AA 2BGOA 4RGKA 2OKXA 3ZR6A 1U5YA 5FKBA 1VMHA 2ATFA 3E97A 2CHHA 1O3SA 1N47A 2VPVA 4JQDA 1DZQA 4QX8A 3S30A 5JSRA 5FK7A 3KZ3A 2C9KA 2BNOA 1PO21 1J3QA 3C7OA 2HLEA 5FDBA 2G1MA 5KHHA 4PHZA 3ZIWA 4EN9B 1YFXA 4XDQA 3NZLA 4DPNA 4W6XA 3MO4A 3O7OA 4LO5B 3A22A 4TZDA 1NZIA 3R4DB 2K2SA 1RXFA 3IDEA 4YM3A 5I0SA 2PFWA 4W50A 1H9WA 4XFHA 2VU9A 4COVA 5K8SA 3E6CC 3LSDA 1UY2A 3HEIA 1Q8OA 4LA3A 4A4AA 4YVWB 4MO3M 4ZZ5A 4O61A 2WNVA 1W3VA 5IFPA 5KXEA 2CV6A 4YARA 4M4PA 4PF1A 4TN7A 1W90A 4YYOA 2I07B 1S2KA 4K1ZA 1R092 4MCXA 1PGW1 3BALA 3OGSA 4WVZA 3FMYA 5E89A 5JPMB 4G3YC 2OX0A 1J83A 4UF0A 1LCCA 1X7NA 2PXLA 2FCVA 5BNPA 1GMMA 3VD7A 4CU8A 3NJYA 3PIGA 4CCDA 2B9VA 4FSJA 1ZZ6A 3WQ0A 2R072 4XABA 1Q8QA 2UWCA 4JGYB 5IW0A 2EWTA 3LQCA 4O9GA 4WZCA 3NRUA 4OZXA 1Y7BA 1RMU1 1BDHA 3T2TA 1GICA 3WHTA 4RGAA 4EN8B 1MS4A 4FQ4A 2ID4A 5D8AC 1SCRA 4QQHA 4YGDA 4QX3A 3U4XA 4E2SA 3IVPA 5FZDA 4CDWB 5C3PA 3TEXA 2VZ3A 3LOIA 3ALQA 3AYEA 3ZSMA 1W05A 5FZGA 3GUUA 5EJZB 5L9VA 1CWPA 4YZ3A 2DUOA 2A73B 2PAMA 1LGCA 1XNDA 4W8JA 3VWSA 5D8AB 4OHZA 4GQMA 1PM4A 2HH9A 4IE7A 5E88A 3T2OA 1UKRA 3O0VA 5L19A 4Y5Z0 3GCWA 1AX1A 1IQAA 3VBUC 4XVHA 4ZU5A 1K5MC 1N3OA 4NROA 5ABJC 2LCVA 4BCUA 4DY5A 2G9GA 1YSEA 3DKWA 4LHKA 1SQ4A 2XJQA 1UIKA 2CGPA 1LHUA 2E6VA 2YC4A 3OQNA 4IEOA 4XILA 2JIGA 1H1MA 5FREA 2FJRA 4GWMA 3DKQA 2NQYA 2WKKA 5DG2A 5F2SA 3BD1A 3M7AA 5DRYA 3ZOIA 4DRVA 1MS0A 4ASKA 3ZLIA 3UKNA 1QB2A 4MCTA 1OF4A 4K20A 3MGUA 3VB9A 1I6XA 5C5TA 2LYJA 3RZGA 2WA3A 4XMIA 3FN9A 5APAA 1PO22 5GZFA 4DRRA 5F37A 2FD8A 4D3WA 2GN3A 3MFAA 4GALA 1H2MA 1W3XA 4LO8A 1WA4A 2XJSA 3THDA 5A3MA 1I9RA 1AYN2 2LW8A 3FLRA 4NJ4A 2VUAA 4M3CE 1PNGA 1V00A 1UYZA 5ACA3 3NV2A 5BYNA 5JXHA 3RZLA 4AEDA 1WMXA 3K2OA 4Y4YA 1E5SA 2OA2A 1QJEA 3A23A 5K7PA 1DGWX 2PE5A 2Q30A 1OQEA 3BCWA 3N9LA 4P9LA 4PLNA 3W5MA 4DXZA 2A1XA 3ZFGC 2JE8A 2A6XA 3CLPA 2GP3A 5E16A 1OLRA 4H14A 1W2OA 3ZFFA 2R043 5FZ7A 4YG4A 2ZMNA 1UZVA 1W6OB 3ME5A 2Q1MA 2Y6LA 3OEAA 3S7EA 4FAHA 3TEYA 4MSVA 2AGSA 4NHYA 2EF6A 1PMHX 2R073 2ZAHA 3P5BA 2VGDA 4RFRB 3WNKA 2A6ZA 1NCRA 4BDVB 1X8EA 2KEIA 4XOGA 3T09A 4YM1A 3W59A 1F35A 3WNNA 3HNYM 1QEXA 2DUQA 4GH4C 1V6KA 4RQPC 3C7HA 4META 5LRSA 3ZKCA 4I02A 4XFAA 3NNJA 2GC0A 5FXVA 5FYBA 2WZR2 1ND2C 1MZ6A 1BBT2 1RUG1 4AL9A 1BK1A 3PURA 4QKDA 1U0AA 1ULFA 4CXWA 2P17A 1QDOA 4CPBA 4AGGA 4OMDA 4WVMA 4Y1XA 2XCJA 2ZJCA 5C4WA 3KJXA 3RMXA 1UYPA 2RDQA 2GH8A 3ZIXA 5FY8A 1ZZ8A 2IZWA 5T54A 3Q8BA 1RUC1 1D4M3 3I3BA 1XXNA 4NE9A 1OVSA 4FFHA 3LZZA 2E7AA 3AFKA 3PNAA 3H7YA 1NCRC 1G8WA 1JZ4A 1H6XA 4Q0QA 1VBE2 1PVC3 3GDBA 5LATA 1DU3D 3O1UA 4X6RB 1DYPA 3ZFEB 1AR72 1CD3G 2VZVA 2Q8CA 4CVUA 1LCDA 3MLKA 5FIXA 3VDDB 3ST7A 3JZVA 3LEMA 4X6QB 5BNQA 2KEKA 2PXBA 4HT1T 5F1RA 2ZACA 2O1QA 2DF7A 4PQ9A 3UGFA 1A8MA 1QJX3 4LULA 3AYAA 2HWD2 3NNGA 3ZHMA 1GP4A 1BEV3 3POSA 3S6PA 1RZRD 1DQ6A 1WCDJ 2VR4A 1REDA 3C7EA 4WM8B 4G9SB 4M3CB 1XOYA 1NA1A 5GLVA 3LOBA 4AI0A 4UWDA 4LPLA 5DDJ1 4JGZA 4BU2A 1W6NB 4DQAA 5FPUA 2JB8A 4GA9A 3LEIA 1LOFA 4N9HA 1NERA 3RSJA 2JDAA 3VBHB 2VBPA 2ZEYA 5C9AC 1UZYA 5JI7A 3IN9A 1C8M1 1OT5A 2EALA 2PLV1 2WT0A 2YFUA 2CU5A 4FVVA 4NHXA 5A7PA 3PL0A 2P5BA 5DG1A 2FZ2A 4GWIA 5I91A 2EIGA 5ABJA 1RMU2 1K5MA 1Z7S3 3WUCA 5EP9A 4FPGA 1COV3 1O3QA 1AR63 1UPSA 2IVGA 2JD9A 2QE3A 2VXRA 1Q8SA 3VKNA 3USUA 2YDEA 3VD4A 3VBOB 2V5DA 3CJXA 4JQTA 4S2GA 4XXAA 2VZTA 1QGLA 1R093 2BEOA 1DGRN 1GZ9A 4KWJA 3BPZA 4C1WA 3IMNA 4EN7B 3WDVA
chains in the Genus database with same CATH topology
5JDBA 3IBMA 3MIEA 1HX6A 2PHLA 1KQRA 4R4XA 3UK9A 5KXDA 1K5MB 2DWRA 4C1XA 4EWDA 2OIIA 3ETQA 1ULEA 3AMMA 3WCSA 4YFWA 1ADRA 1RJ7A 3SCGA 3OMTA 4GB32 4W6YA 3PXPA 2ZKLA 3FLPA 2WIIB 4GMP0 3V64A 1QH6A 3QACA 2LYSA 1ZZ7A 2FMDA 1SFYA 4Y26A 3WP3A 4MLOA 3ZN6B 1QHDA 3WR0A 1N3PA 3GBWA 1O3TA 2LM3A 5FOJB 1HRV1 1VRH2 2OZJA 3VBFA 1WH8A 1AYN3 4HPKB 3GZAA 1WLTA 5CFCC 2WNVC 4YGEA 3B7HA 1UD1A 2YV8A 4PU4C 2P37A 5CFDA 3MF6A 4IV3A 1ZS4A 3EBRA 3CEWA 1VBB3 4Y22A 4LE4A 1XNBA 1YCIA 3LISA 2ZGUA 1X8MA 4IERA 4OHYA 3Q9OA 1O4TA 4XIKA 4RD7A 4UBGA 3SCHA 5BNOC 1ZNPA 1UU6A 5CU1A 4BH9A 3I59B 1QDCA 1H1IA 4CDWA 2R32A 4K6BA 1FMD2 1MS5A 5GM0A 3MIGA 1DYKA 3AYDA 3FX3A 3UJOA 2R1JL 3OBTA 3J8F1 1HIXA 1LGNA 4FOWA 2AXUA 1RUH2 1OFNA 2HWB1 1CR7A 4IQPA 3WG4A 4AXOA 2IC1A 1S0JA 1ZUGA 2E7TA 4FP2A 2AW6A 1B35C 1PGSA 3F6WA 3OY8A 5DXDA 4CP1A 4Q4W3 1COV1 2AR6A 3WP6A 1AR91 2RS31 2OFYA 2BFUS 1PRVA 2HWE3 3FC0A 1HF0A 1BBT3 4COUA 1CAUA 2WQ4A 4F8AA 5AC92 1WGPA 3LWCA 1RUJ1 3RG0A 2TUNA 3VZNA 2BQPA 3V56A 4ZU7A 4K7JA 5T5OA 4F83A 3NWKA 1PK6A 2BVBA 2V5YA 5I93A 1O4XA 5T52A 2AUWA 4YG3A 3JU9A 5FMOS 2HWE2 4AEJA 1QU0A 3WDWA 2MEV3 2R63A 1PVC2 3OYWB 4Q4V2 2ARXA 1H8TB 2BWAA 1ZAYA 1OOPA 4AVTA 4NVPA 4HSJA 1VAVA 2FZ1A 3WT3A 2ICPA 3ZYPA 3BODA 4RR3A 1MS8A 1VB4A 3WQ7A 1VJ2A 1XYNA 4BIOA 3BU7A 3L1PA 4KGGA 3A0NA 4Q4W1 2D43A 3O0WA 4Q0UA 3USUB 2MEV2 3HMYA 2VOKA 1BYHA 2NPIA 1RZRA 3B7MA 2R062 3DGTA 4YSFA 1ZA4A 3N7MA 1UL9A 4N53A 1FPN2 4AHXA 3KCYA 4FTBA 4OFGA 1TEIA 5T50A 3J4UH 2R071 4XFGA 2QVSB 3M3OA 1IS6A 2NLRA 2WLPA 1EV13 2ZX4A 1ZBE2 4JDOA 2SBAA 4CDUC 2X5IC 1GKBA 4AFBA 3QCWA 1F5FA 2QKDA 4UW5A 1BXHA 4XJWA 1RUF3 4XF1A 4JTNA 3MICA 2LYQA 4N43C 5D1IA 3L2HA 3VUOA 3ZXGA 2XJ3A 1DF0A 4YRDA 1QOOA 4YVSC 3AB0A 1HQNA 1JWLA 5ACA2 3AP5A 5IUQA 2OYZA 4AQ6A 5CA6A 2GALA 1YJLA 5E1RA 1J1LA 2DCKA 2IV1A 1AL23 4QMAA 2TNFA 2WIUB 1ZX5A 4FCAA 5HCFA 1AJKA 4V1PA 2R042 2JJ6A 4Q0PA 3QWGA 2PUDA 1RUE3 1CJGA 1W6MA 2O8QA 5B2GB 2KEJA 4C90A 1CESA 3NKTA 2VOXA 2RS11 3WDUA 3IKWA 1VAKA 2G9FA 1SLCA 4CDQA 3FLTA 5BNNA 2ZGSA 3VBOA 5L7OC 4Q4X1 2C0ZA 2CY6A 2JXAA 4OHWA 4CEWC 4N9IA 1AL21 1LU2A 4HKWA 3JB8A 1JH5A 1LHNA 2JG8C 1G9AA 1KITA 1YIFA 3S7IA 1IHMA 1JHNA 4XIOA 2QDRA 4U36A 1H0BA 4YG0A 2PLV3 3INAA 2PHRA 4BIFA 1PRAA 3MYXA 4E2QA 4JGZB 4PIXA 2YGMA 3JXCL 5L7OB 3HR9A 4INDA 3LA7A 2BBVA 4LHLA 3VBHA 1CAVA 3HT2A 4CDXB 2HYKA 4IV1C 2A3XA 4QPIA 1LHOA 4E27A 1POV0 4WVWA 1RUF2 3CU7A 1D0HA 2Q8OA 5E8AA 4TSVA 1R081 2JICA 4BA6A 4P14A 2ZX1A 4WM8C 4YW1A 3POWA 4GB33 2ZKNA 3ILFA 4YVWA 1VBC3 1JW6A 2Q4SA 1S0FA 4XPVA 2PUEA 2B39A 2IXKA 1ASJ2 4Z07A 3WP5A 5T5LA 4QPIB 1TNFA 4FPYA 3AMQA 4URTA 5FLIA 4AHWA 1H8VA 1AL0G 4Q1RA 2VVEA 3JQXA 2B45X 4N43B 4P9JA 5SV5A 5JWPA 3AYCA 5C9AB 3WVJA 4Q4V3 4HVOA 2VNGA 3O9XA 2C9AA 3AMHA 2DVDA 1IC8A 1RUI2 5JSOA 1V9U1 1YFWA 1ZBA2 1DQ1A 2HWD1 3KLSA 4M01A 2DTYA 1URXA 2RM23 2VQAA 1JH9A 3TRBA 2A6WA 2EXIA 3DPRC 2XGXA 3D5OA 2QDNA 1IOAA 1T6GC 2RE9A 4GKXA 4ASMB 1TQ5A 3RYRA 4S2DA 2MEV1 2IFWA 3KT7A 4K1YA 1EAH2 4ES9A 1EPZA 5SV8A 3HQXA 3MDPA 1SDWA 2A3YA 2ET7A 3FWEA 1QJY3 3BTAA 2PELA 4KQ7A 3ZHIA 3WD5A 3VDDA 2WZPP 5BNPB 2OR1L 4MYEA 1EV12 1N1SA 3ZFEA 4JCXA 3R6SA 2C1FA 4WM7A 3WX5A 4XBLA 2MNGA 2WFF2 2HWE1 2XB6C 1LJ7A 3CF6E 1AR93 1PIV2 4QT6A 3AZXA 1MZEA 3PJYA 3HIFA 2B5HA 3OQMA 4I0BA 3VHRA 3ACLA 1YO8A 1QP7A 2A3WA 1DZRA 5CAZA 2WZR3 1WBLA 4GULA 2V73A 1RUG3 4AVCA 4ES8A 1ND3A 3CNAA 1C8M3 4Z5HA 4S2FA 4FT8A 1SBEA 3O12A 4LLOA 1DZTA 2R49A 5TSWA 2QQPA 4HN1A 1UF2C 4P9XA 5FFOC 1WETA 1LMB3 4KBBA 4XF3A 4FXKB 1VBD2 2Z42A 4L99A 1U5IA 5BNOB 5CG8A 3B93A 3ES1A 5IK8A 2P3KA 3MEPA 5FCCA 1SCSA 1NXMA 1AR73 5A33B 3D6EA 4BZ4A 5I0RA 2WA4A 1WCKA 2XVLA 1BDIA 2E51A 2WNUC 1NYWA 1NOVA 4AFDA 1PNFA 2HWF1 1QY4A 2DV9A 4N53B 4QHBA 1R1A1 4RHV1 3UKTA 4I6TA 4NR1A 4X4IA 1BVVA 2UYBA 2AENA 3OP9A 2R063 3TWIA 5A7LA 2PYTA 2VUJA 2BWCA 2PTMA 3MZHA 4FPLA 1DGRA 5J09A 1NCQC 1WLDA 2CAVA 4HSLA 4LR4A 4YVSB 4P9IA 4JGYA 5KC6A 2VY0A 3EXUA 2EF8A 3POYA 1H2KA 2BYVE 2ZHKA 4MVTA 4Q4X3 5H9PA 4OI0A 4JRAA 2YROA 2ZGMA 3N7LA 4IV1B 1VBD1 2HEYF 4AF9A 1L1MA 5FQ0A 4KWLA 1Y9QA 4QPGB 4QQ2A 1VBE1 3WOGA 4IEQA 4H3WA 4OVEA 1VIWB 4Z82A 2BNNA 2ZZQA 2HWC2 3AXEA 3LGRA 4NWVA 1O5UA 2UU8A 3L9JT 1KDKA 3F51A 2WWSA 3MW3A 4QPYA 2PUFA 1FMD1 4YM2A 3PVNA 4NOTA 1HRI1 2ZGNA 3P3PA 2Y0IA 1C5IA 3TAYA 3JD73 1JOJA 1KD7A 3HWJA 1L3JA 4XJUA 3MI8A 2RM22 1TMF2 4GMP1 2ZABA 2O4AA 4E4DX 2ZBJA 1RL3A 4IEZA 3AKQA 2MEZA 3WCRA 3KCXA 4AE2A 4B8EA 2VVDA 3ZSEA 4W65A 2OZ6A 5BNNB 4FTEA 3AZWA 3URFA 1PZ8A 4KU7A 2GNDA 2FMYA 4PDWB 3DPRB 4A7KA 3R4SA 1VBC1 1ULGA 2E9QA 1PZ7A 1QXRA 1QF3A 1AR62 1RUG2 3THTA 1VBE3 2YUEA 3VBRC 2YHJA 2N7GA 3DUIA 3R0RA 3ZXLA 3B00A 5K98B 2B9UA 1RVF2 3LSEA 4K9SA 1MQTA 1PMIA 1HRI3 5T3NA 3VBUB 1H4HA 1RIOA 1VBB2 5JOXA 3H9AA 3NAPB 2NZ9A 4DY3A 5L73A 5J3UA 3ZVXA 3WNXA 2GC2A 1HQWA 2WS91 3W58A 4PJYA 1ZVFA 3ZN4A 5CIRA 2D6KA 1HRV2 1VRH1 2EXJA 4CEYA 3PVEA 4JC1A 4MGYE 4Z5CA 5GLWA 5AFEA 4K3UA 5J7MA 2BNMA 3DNVB 4JGYC 2ERFA 1RPEL 3H8UA 5FPXA 4X8NA 1CAUB 3VHNA 1H9PA 4Y42A 1H30A 4QGLA 4B4PA 1B09A 2QZ3A 2XH6A 5CFDB 2VMGA 1RHI3 1UMZA 3KD4A 2DURA 1H2NA 4HVQA 4CDQB 2WNUA 2RR12 5JVVA 1QJU1 4IWRA 3ZXFA 4XJZA 1BEV1 1BKZA 5ABJB 1S55A 3WW3A 2TBVA 3M8LA 2HEVF 4LUKA 4Z1VA 5C8CB 5KHGA 2GC3A 2DVAA 2ZS6B 4KNCA 3RJ2X 3TNQA 3R1FA 5K9YA 3RQ0A 2W52A 1RUH3 2EAKA 5DDJ3 2YY1A 4FQZA 3B5LB 4ZKTB 5GZCA 1REEA 1C8M2 1ND3C 3VKMA 2KA3A 3QBQA 4EN0A 4I3GA 3AZYA 3PJQA 2WT1A 4AQTA 2HEWF 1UIJA 1V6JA 1AR81 4WZFA 3H1MA 1WW6A 4Q26A 1AHSA 3M3EA 3KT1A 1H4GA 3TBDA 2WFF3 4FXGB 4B4QA 1DQ2A 3VK0A 3ZFEC 3N36A 2K0GA 2Z79A 4JVAA 3E5XA 2HWD3 3KQRA 4XQ4A 5IK4A 3V0AB 4AVSA 3H1WA 1TMF3 4M00A 2DVBA 4OHXA 1JTZX 1UN1A 1IZ3A 3GBGA 4EN6B 1JXNA 4L2NA 1HLCA 1NLSA 3RRDA 3WQ1A 3FUOA 1MACA 1UXCA 1CPMA 4ZU4A 4E4ZA 5IT6A 2CWMA 4LHNA 2JE7A 3OY8B 4PU7A 1I3HA 2D98A 4PU8A 3DL3A 1OI6A 1ULCA 2DTWA 3ECQA 3D0JA 2KXLA 3S0MA 5CBLA 2R0FA 3MW4A 2JG9A 4FBFA 3AM2A 2EAAA 4IA8A 3GZUC 5ACA1 3FE5A 4D7SA 2IUOA 4Q27A 2LUWA 4Y20B 1GV9A 2XLFA 1AYN1 4KWKA 4SBVA 5HBAA 4QXKA 5JPNB 1NCRB 1HRI2 2GMEA 3ILNA 3VGIA 3D0SA 1LQCA 5EYYA 4I3PA 5FOBB 3HAGA 1RUH1 2Q5TA 2G4IA 2XBO2 3USSA 5AC93 1FT9A 4JRLA 1ASJ1 3T1LA 1E3OC 2OPKA 4XF0A 5JMCA 3KM5A 4MV2A 3CJIB 1PGW2 2ZGTA 4WM8A 5H9SA 2XL9A 2XHKA 1X33A 3VHPA 5CNAA 3QF3A 2P3IA 2EXKA 3OQOA 3J8F3 2H6BA 3MIDA 4A7ZA 2O0OA 3E6DA 2Q0AA 3MF9A 1CPNA 2LYKA 4X8PA 2UYAA 2GAUA 1Y7YA 1ND3B 2W68A 4P9YA 3SCFA 3AXDA 4RS5A 1MVQA 1VBD3 4QD2A 5FAXA 3QH7A 4IESA 1NE4A 2EBYA 4YW2A 3AKTA 4E2GA 1S0IA 1QQP3 2A75A 2PUBA 3ELNA 3JBG2 1SLBA 1PIV3 2A