4J1XA

Crystal structure of fe(ii)-hppe with alternative substrate (s)-1-hpp
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
193
structure length
193
Chain Sequence
TASTGFAELLKDRREQVKMDHAALASLLGETPETVAAWENGEGGELTLTQLGRIAHVLGTSIGALTPPAGNDLDDGVIIQMPDERPILKGVRDNVDYYVYNCLVRTKRAPSLVPLVVDVLTDNPDDAKFNSGHAGNEFLFVLEGEIHMKWGDKENPKEALLPTGASMFVEEHVPHAFTAAKGTGSAKLIAVNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Epoxidase
publication title Mechanistic studies of an unprecedented enzyme-catalysed 1,2-phosphono-migration reaction.
pubmed doi rcsb
source organism Streptomyces wedmorensis
molecule tags Metal binding protein
total genus 48
structure length 193
sequence length 193
chains with identical sequence B, C
ec nomenclature ec 1.11.1.23: (S)-2-hydroxypropylphosphonic acid epoxidase.
pdb deposition date 2013-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 4j1xA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4j1xA02
1OSLA 2MPFA 1B0NA 1CGPA 3M70A 2PAKA 3F51A 3B7HA 4WVZA 3OQOA 5D1IA 4KU7A 1Y3TA 4LA3A 1PRUA 3CL1A 1UD1A 5BPXA 3BU7A 1CAUB 1SQ8A 2C0ZA 4MZUA 5JR7B 1ZVFA 1IC8A 1YFUA 1O5UA 1FXZA 1RGSA 1UCXA 3S8QA 4GULA 3H7JA 2O4AA 4FAGA 5JSRA 3UKNA 1PRVA 4HSJA 1QQAA 4ONUA 2N7GA 4HVOA 5BUVA 3LISA 4PJYA 2QCSB 2E9QA 5FLHA 3NJZA 4JCYA 1QP4A 4QXKA 4PIYA 1ZRRA 4JTOA 1ZZ7A 4Z5CA 1OMIA 2B5HA 5J3UA 2UYBA 3H1MA 2GAUA 3ES1A 1BDIA 4I0AA 2K9ZA 3HZIB 1XRUA 3FE5A 3KXAA 4YG4A 1U12A 2ETEA 3WW2A 4X4EA 3LFPA 3H1WA 1RUNA 2BJCA 3O14A 1VJ2A 4META 4ZU7A 3UFDA 3H8UA 4XFFA 1UIJA 1ZX5A 2Z69A 5KBFA 5KHGA 1X8MA 1GQGA 4QMAA 2IU7A 2LYLA 3CLPA 5K8SA 4A2UA 4KWLA 3RNSA 2LCVA 1RL3A 2EBYA 4EWEA 1DGRA 1LQCA 3H3UA 4XF1A 2IV1A 1QQBA 2Y0OA 4HN0A 4JVAA 1NYWA 2GC3A 1LRHA 4ZU5A 2XIUA 3L2HA 3H5TA 3SHRA 3UKTA 3LA2A 4X4IA 1O7FA 4YYOA 1QY4A 5CVRA 3H50A 2PA7A 3I7DA 4XF3A 3FWEA 1YUDA 1O4XA 1X57A 2PAEA 2XKPA 1VPWA 1ZUGA 1PMIA 4IESA 2CROA 3ZKCA 2PIJA 2XGXA 1ZZ8A 2OZ6A 3IVPA 3D82A 3S0MA 4EV0A 2PUGA 4KL1A 3DL3A 2ATFA 5JAXA 2KEIA 3FJSA 1ZAYA 4MCTA 4LUKA 2OZJA 2WFPA 1Q43A 2PUCA 2PHDA 4MGKE 1ZRDA 4X6QB 3TNPB 3NL1A 5KHHA 3EO6A 5C8WA 2KEKA 2XI8A 3G5GA 4Z58A 2PHLA 2XL7A 2D5HA 4I8TA 3NKTA 4AVCA 2EA7A 2V09A 1NERA 4AVBA 4I2OA 5J48A 3MLFA 1V70A 1EP0A 1LMB3 2XLFA 3ACLA 2BNNA 2FMYA 3SXWA 3QOPA 1CQTA 2B8MA 2QNKA 2H8RA 1IPJA 1R69A 4D7SA 1HF0A 5FLJA 4IVZA 3CO2A 2FQPA 3GN5B 1EPZA 1Q5OA 3BB6A 4XFIA 4PU8A 4EWAA 1GQHA 4Q0VA 1NXMA 2IXCA 4UBGA 3IDCB 1NE6A 3BS3A 1SQ4A 3KMHA 2KXLA 5FPZA 1RZRA 2H6BA 4AVAA 5C6CA 3B02A 4R8HA 4BH9A 4IERA 2MHFA 4MGZE 5CU1A 2Z2SB 4MV2A 3IIAA 3MPBA 3RYRA 2GRMA 4WBBA 2HJIA 4TLFA 2XL9A 4YG7B 4J1XA 1JUHA 3BD1A 2H0VA 1JH9A 2QVSB 3EJKA 3HIFA 4IEPA 3USSA 2LYQA 1UXCA 1UPIA 4HMZA 3LAGA 3G7DA 5FQ0B 4LUMA 1EY2A 5BV6A 1X8EA 2IXHA 4FBFA 4PU4C 3L1PA 2O38A 3RYKA 2HINA 3ZDSA 3H9AA 3MYXA 3OQMA 4CYDA 2OPKA 2Q1ZB 2GU9A 1X82A 4Q0UA 1R63A 3LZZA 3RPQA 1LLIA 1L3JA 2KEJA 3KZ3A 3OCPA 2CSFA 4IEWA 1UIKA 3CROL 1JWLA 3EHKA 3IBMA 1E3OC 4MCXA 4Z07A 4AQ6A 2MEZA 3I59A 1ZRFA 4IEOA 1RUOA 4XEZA 2CV6A 2HSGA 5BY5A 2QJVA 3EBRA 3EQEA 2LYKA 3SCHA 2IC1A 3MDPA 2IXIA 2O1QA 2WUSR 4QM9A 1YWKA 4XFCA 4ZU4A 3SCGA 4F7ZA 4KWJA 3ST7A 1ZVVA 3SCFA 3TRBA 2PUFA 2KPJA 2GC1A 3H7YA 4X4HA 4JTNA 1JFTA 1LB2A 1QP7A 4OB4A 5EZWA 2QDRA 4Q0SA 1WLTA 4AQ2A 3C3VA 1DGWA 1PM7A 1EFAA 2D93A 5I8SA 2UY9A 5J7MA 3D0SA 1ZS4A 4HVRA 2CGPA 1AU7A 4FT8A 2ICPA 3I54A 1UW8A 2GZWA 2HKXA 1DZRA 1RIOA 2K0GA 4MUVA 2AXVA 4K8FA 4OLLA 2PTMA 4B29A 2IXJA 3KGLA 4O8BA 3RZZA 1WIZA 2IXKA 2MNGA 3CJXA 3MZHA 2KZ8A 1WGPA 3U11A 1X2LA 1FI2A 3OQNA 2ZCWA 3QF3A 4X4DA 4FAHA 5I91A 2XLGA 1I6XA 2AXUA 2EWTA 4XETA 1ADRA 2XCJA 3OMTA 1WH8A 1RC6A 4E2GA 1O4TA 3DV8A 5CADA 5I0SA 3IWZA 3CLCA 2BEOA 2LYPA 2EAAA 1XE8A 2ZKLA 4HVQA 2LYJA 1BDHA 3OF1A 1ZPQA 1CAWA 4X6RB 3OP9A 3QYXA 5I0TA 1RZSA 2EF8A 4RD7A 3VHRA 3IDBB 1WH6A 4PIZA 2B5AA 4MGIE 1CAWB 4I09A 4BIFA 3WW4A 4D7TA 3JXBC 3FHIB 3E5QA 1YFYA 3PXPA 2MQKA 2GC0A 3NW4A 1QXRA 5EFUA 5I0UA 5I8YA 3PLQA 5I8TA 2PYTA 3R1FA 2PUEA 1SFNA 1S7EA 3FZ3A 4YSFA 4Z5HA 1O5LA 3DN7A 5BXXA 4XF9A 4GHJA 4Z59A 2JVLA 4P9GA 4IEYA 1Y7YA 4BHPA 4LTAA 2AXZA 1NE4A 2R1JL 3DNVB 3KGZA 4HZFA 3ZHIA 1Y9QA 4FBIA 2ICTA 1ZZ9A 1OI6A 3PVBB 2OFYA 4IETA 3VK0A 2F4PA 5JSPA 2BNMA 4XFBA 3E5XA 4I6TA 4I0BA 4HLTA 1LCCA 1WA4A 2PQQA 2XKOA 1J58A 4UXAA 2OR1L 2OYZA 4N9HA 4MGYE 3KJXA 4NDWA 4H7LA 5LRRA 4IEVA 4XF4A 3QQ6A 5AVPA 2B9UA 3OGJA 3OD0A 3RDIA 1I5ZA 4Y42A 2CAVA 4F8DA 4NVPA 1YFXA 2XHKA 4MX3A 2XJ3A 4XFGA 1LR5A 4Q0PA 3DKWA 1PNRA 5E1RA 4IEZA 5KHJA 1FT9A 3LOIA 3CECA 3BALA 3UKVA 5KHKA 4QM8A 4X4CA 1CAUA 3F52A 2D40A 4HBNA 4Q29A 4X4BA 4OFGA 2Q4SA 3E6CC 1CAVA 1H1IA 3LWCA 2XSDC 4IEUA 2BGCA 1OCTC 3U0ZA 1L1MA 4HN1A 3D1NI 1YHFA 4E2QA 2Q30A 2AUWA 1CJGA 4X4GA 2JCGA 4YARA 1OFNA 3E6BA 4E2SA 1CAVB 5JCTA 2VPVA 4JQDA 3I59B 2R63A 3TNQA 3E5UA 3H1YA 1RTVA 2WC2A 2BYVE 2XLAA 1O3RA 3FFQA 3F6WA 5KHIA 2UY8A 3LA3A 4QGLA 3FMYA 1ZZBA 1CAXA 4LEJA 4KU8A 3U10A 4JCXA 2GC2A 2EVXA 2ET1A 2D5FA 4KWKA 1X7NA 4AXOA 1J1LA 4Z5DA 1YLLA 1ZNPA 4GQMA 1CAXB 1G6NA 2IVQA 3OTFA 4LA2A 4YNIA 1CX4A 2GZUA 5LRSA 2VQAA 3BPZA 1UXDA 3D0JA 1SEFA 3BCWA 2O8QA 1O3TA 4PU3C 1ZREA 2FJRA 4LLOA 3S7IA 1DW9A 1QPZA 4J1WA 4QX5A 2DCTA 4IA8A 3S7EA 2CAUA 3E6DA 1J3PA 4O9EA 4XF0A 2A6CA 4QGNA 2PUBA 4IEXA 1YFWA 2L49A 2P17A 3M3IA 2D5VA 5FPXA 4Q0QA 1RZRD 4UBHA 2AW6A 2IUOA 4I02A 5JSOA 1GT0C 5I93A 1O3QA 3HT1A 1EYBA 4I3PA 5I0RA 3U3WA 1UTXA 5HI0A 2IVBA 2PUDA 1DWKA 2O49A 2I45A 3GYDA 2VECA 1QWRA 3ELNA 3LA7A 1IPKA 4IEQA 2PE5A 1LKNA 2GH2A 2PAMA 3NSTA 1J59A 1LCDA 2PFWA 2GRLA 3WW1A 1PERL 1XE7A 4X4FA 3O9XA 3ZHMA 1WETA 2IXLA 1O3SA 3RYPA 4MH0E 2IVGA 3WW3A 5F1RA 2OA2A 3KCCA 4ORFA 3CF6E 4L2NA 2LYRA 2L8NA 3FX3A 2WIUB 1XWRA 3NVCA 4JV4A 4XFHA 1ZRCA 1DZTA 1J3RA 1NEQA 2BNOA 4I6UA 1VP6A 5FLIA 1ZZ6A 3HQXA 4R52A 4F8AA 5A7LA 5E16A 4YG1A 2Q0AA 4QGMA 1ZZCA 5K98B 3KSCA 2PUAA 1NZCA 4N9IA 3N4MA 2H6CA 1QXJA 4Z82A 3BDNA 1YSEA 2UYAA 4I6RA 3SMHA 3E97A 3GN5A 1OD5A 3H3ZA 4FN3A 1POUA 3JXDL 2AWIA 3FYAA 3R6SA 4I01A 1H1MA 4PU7A 1JFSA 2LYSA 5FCCA 3EUSA 3JZVA 4XFAA 4WZCA 1Q3EA 5T3NA 4L11A 2ET7A 3ROUA 4HSLA 4BYYA 3PNAA 2PPXA 1HW5A 4DINB 5FDBA 4O9GA 4LULA 5LEKA 4IWRA 3QACA 3GBFA 1PRAA 3ES4A 1RPEL 1TQ5A 3HT2A 4EROA 1VR3A 3QWGA 4YBAA 3CEWA 5FQ0A 5LEJA 1J3QA 4YRDA 1QP0A 3FYMA 3JXCL 4EWDA 4PIXA 3ETQA
chains in the Genus database with same CATH superfamily
1H8TC 3F51A 4LR4A 4NR1A 1HB3A 3I3BA 2DDUA 4DE9A 5D1IA 5T52A 5CB7A 1ULFA 2JIGA 4KU7A 1UY4A 1RUG1 4WM7C 5C4WA 1UD1A 1C5IA 1HRI1 2VZTA 2WNUC 2C0ZA 1F5JA 4GULA 1UCXA 2D6LX 1RGSA 1PK6A 3LDKA 3KT7A 4AFMA 4IV1C 3IPVA 2J1VA 5DQ0A 4HSJA 3NV4A 3CZJA 1RUJ2 1HB4A 2EXKA 1GP6A 2WO7A 2YG0A 4AR2A 1MEC3 2ZAAA 1Y4WA 4ZS3A 5FLHA 2AR6A 2E9QA 3UGHA 2EF6A 1AX2A 2DBIA 2JG9A 2VW1A 5LCWL 4JCYA 4QXKA 1F4HA 1ZRRA 2PXJA 3ZFGA 3AKQA 3NJVA 3VBFC 2A3WA 3FHQA 3GJBA 1OMIA 4NHKA 1UYYA 5FXWA 5J3UA 2BZDA 4Q4Y1 3HN1A 2EALA 2Y6JA 2GAUA 3FFZA 1BDIA 3TEWA 1EUUA 3HZIB 1XRUA 1XYPA 1CZSA 3KZ4C 1U12A 3WQ7A 1QH7A 2J7UA 3WW2A 2LROA 2PXQA 2BGOA 1H8VA 1R093 2WSVA 1OOPB 2BJCA 3NV1A 4HKWA 2E7AA 2AREA 4DFSA 4LBQD 2J1RA 4V1PA 4HPKA 3ZYGA 1X8MA 4LO5B 5HCFA 1GQGA 5FY9A 1XOYA 4AI8A 2PHWA 2IU7A 3NNJA 4GIQA 5BNOC 4COYA 4QXBA 2WJSA 1OQEA 3CLPA 4ER7A 5A1LA 5K8SA 4KWLA 2ZX0A 5ISLA 3BN6A 2LCVA 2XBO1 2CWMA 1KITA 4KQ7A 2LRPA 3WVJA 2QTWB 3PE5A 1AXKA 1W6NA 3GHNA 1POV0 3H3UA 1GU3A 3ZM8A 4AZZA 2PXBA 4N7UA 4CP1A 4DZGA 3LF7A 4HN0A 1G9FA 1NYWA 3GJAA 1TMF2 1Y9GA 2DUQA 4QT6A 3AK0A 3H5TA 3SHRA 3ZMOA 1GZWB 4QU1A 1OH4A 5LK7B 4YZ4A 1ODNA 4AW7A 1QJX3 2HCSA 5CVRA 1YNAA 4GMP0 2Q8DA 2JEMA 1QF3A 4PF1A 2QQNA 1VMJA 1R1A2 2Q5TA 1UMZA 3SKVA 3WG3A 3TN91 5KWRA 5FZ6A 1RJ7A 4Z2AA 2O14A 1XXNA 2RS51 4HETA 1W2TA 2CROA 3GM8A 4P9XA 5FO9B 1SFYA 1W6MB 2W08A 2HWC3 2XVLA 2PIJA 5L36A 1N1SA 5A3PA 4XBNA 5E6HA 4QPIC 5C3SA 1S0IA 1XNKA 3IVPA 3D82A 3O7OA 2D3SA 2WLQA 3T2TA 4QPGC 2RS33 2XOMA 3LPGA 1LHVA 3HBZA 2HWF1 2WO1A 2ATFA 1V6JA 2BWAA 3WP3A 4DRRA 2VXJA 4RR3C 1AUYA 3K4ZA 1ND3B 2WRAA 3ZKUA 1ULEA 3RSJA 1EPWA 3RZHA 1B35C 4YFWA 4W6XA 1CJPA 2HWB1 1VBC3 2QBXA 4AFCA 5FKCA 2PUCA 3B01A 2VBPA 1ZRDA 3AP7A 3S6PA 4IV3C 5IVJA 3VDDA 2JWPA 5GLWA 3WDWA 1ZA4A 2ES3A 2X53S 4KBZA 4TXWA 1P8JA 4QHOA 1CWPA 3ZFEC 2VCCA 2A70A 1FOD2 4CEWB 3W20A 2VULA 1HJFA 4OYUA 4I8TA 4KWUA 4AI0A 4DUVA 1YXWA 3RJ2X 1S2KA 4YGCA 4I2OA 4NROA 1V0AA 1OPOA 2QE3A 4Q4V2 2VMFA 2VD7A 2ZGMA 3T2PA 3ZFFA 2C9KA 1WCKA 2B8MA 3T1MA 3FBMA 2H8RA 3SEEA 5F3CA 4YG6A 3D8CA 1R69A 4CDXC 4D7SA 1GP4A 1UZ0A 2RS12 3WF1A 3I2FA 5FYUA 3BB6A 1EPZA 4XFIA 1Q5OA 4JGYC 5JIAA 1GLHA 1GUIA 1SG3A 1WD4A 2BFUL 3WNLA 2DUPA 1NXMA 2JXAA 5FPZA 2LM3A 3GZEA 1RHI1 1UKGA 5C8CC 3LIHA 4DMIA 3B02A 4OUEA 3SLIA 3Q9OA 2O0OA 1RUE2 1VRH1 4MV2A 4N90A 4LKSA 2VH9A 3BVCA 4M01A 2GRMA 2QQIA 4TLFA 4QXHA 2XL9A 4YG7B 4W6WA 2VVDA 4W65A 1DP0A 1JUHA 4I3GA 3EJKA 2AUYA 1CIWA 1UOBA 2DTWA 3IKWA 2LYQA 1VALA 4RHV1 4BPZA 2A3YA 1QJY1 2VZQA 2O8OA 2GNTA 1LAJA 3A0KA 5BV6A 1X8EA 5CFCA 1HB1A 3L1PA 2JJ6A 3TFLA 1RUJ3 3EXUA 4EN9B 2C26A 4CYDA 4XQWA 5C3OA 1OKOA 4G9SB 3B7MA 4EN0A 1C4RA 2GU9A 1JOJA 2E33A 2WQ4A 3POWA 4IE5A 2NQYA 2ARCA 2VGDA 2P34A 1C1LA 4UI9L 1MPXA 3H8XA 1WW5A 4ZZ5A 3KZ3A 4D6QA 2JD9A 1XNTA 2FCVA 2JDZA 4Y20A 3ACFA 2VEOA 3X29B 3CROL 1JWLA 4H3WA 1GWMA 3PMSA 3VDBA 2YBPA 3I59A 4YLZA 1COV1 2XJVA 1BXHA 3ILRA 3U75A 3LEGA 3QH7A 3EBRA 2K46A 2A7AA 4YZ5A 3DPRA 2VOTA 2IC1A 5APAA 3M9LA 3HOBA 5F6KA 3WDXA 3SCGA 5JZGA 1LTEA 2ZHLA 3SCFA 1HQLA 2PUFA 3FUQA 4X4HA 2WR9A 2IUWA 4IXLA 1IHMA 1SLAA 4LITA 5FZ0A 3OEBA 4IE0A 3WX5A 4FPGA 1MS1A 1QP7A 3N3HA 1CESA 5EZWA 3VB9A 5DUXA 1EFAA 1YRZA 2X5IC 4P5YA 1TMF3 5I8SA 1FATA 3ZXEA 3J7HA 2VM9A 4TZDA 1NOVA 4HVRA 2WIIB 4GB32 3QH6A 1W3VA 4FPYA 5EPAA 3WHTA 4B7KA 3I54A 4MUVA 2GZWA 1EV11 3GZDA 4PDWB 1R1A3 4K8FA 4Y22A 3THCA 2E7TA 4Q26A 5D8AA 3V65A 3H42B 3WDUA 2IXJA 3WDVA 1L7RA 3IM0A 2IXKA 2MNGA 3WNNA 2KZ8A 2LNMA 3I97A 3UNPA 1SLLA 1LEMA 2RMU2 4X4DA 1MEC1 4FAHA 2XLGA 5K0UA 4XETA 4P00B 3SX0A 1ADRA 3N7KA 3WR0A 2OKXA 3OMTA 1WH8A 1F15A 1HV0A 4YG3A 2ZABA 2JE7A 1O4TA 1LU2A 1WMFA 2ZAHA 4XHBA 1AYM1 4L8QA 3LFIA 4AG4A 2BEOA 1DQ1A 1AXZA 2HYXA 5FOJB 1C8NA 3MLKA 3O1UA 4CCMA 5FRAA 1MS8A 5DG1A 2VTXJ 2XWJB 3B3QE 1GFF2 1W6PB 1W6OA 5LWBA 3OP9A 2H0BA 1FOD3 2GNDA 4IGOA 4CP9A 5FMDA 3QYXA 5L9RA 5T5JA 1RZSA 1EAH2 1S4CA 1Q8PA 2X8KA 1UAIA 4QQPA 1W8ZA 3FC0A 4MGIE 1CAWB 3LB9A 1O59A 4J6GA 4MXVA 1C5HA 2EIEA 4Q4V3 1GWKA 1NQJA 3O0WA 1SPPA 5FZHA 3FHIB 1IQAA 1OFSA 5IWFA 5A7PA 1WWYA 3PXPA 2VZSA 1JYCA 4HONA 2MQKA 3T0AA 1GV9A 2MEV3 1QMJA 2RS13 4UW6A 5K7PA 5I8TA 2PYTA 3VKLA 5CEHA 3HJRA 3U4SA 2DCKA 1M4WA 1UU4A 1MZ5A 5BXXA 3VL8A 5FZ4A 3MFCA 1OA3A 4LHLA 4P9GA 4YVSA 2ZBJA 1WLDA 2VU9A 4BHPA 1OOPC 2QQOA 5C3PA 1RUE3 2VUDA 1QJX1 5FY7A 5FY5A 5GLUA 2W3JA 4BK4A 4ISQA 1RUG2 4R9CA 2WNVB 5F32A 3ZHIA 2ICTA 1HRI2 2RHPA 3ENRA 1VBD1 1NCRA 2OFYA 3VZNA 5IVBA 2IFWA 4P9IA 2WT0A 3ZPOA 1MR5A 1V6KA 2UWBA 2QQVA 4HLTA 2PQQA 2CY6A 2BBVA 4LKDA 1H4GA 2HWC1 2VE1A 4FO9A 2A5ZA 3M2MA 3W58A 2BTVC 1NA1B 4XPVA 2RVAA 5H9PA 3WG2A 3I2KA 3KF5A 4OQ9A 1F9KA 1OH3A 4L0PA 4XF4A 2VZUA 2B9UA 3OD0A 4OHZA 1I5ZA 5CYYA 4GZ9A 1JOPA 1OUXA 1VBC1 3NV3A 4IGPA 1F31A 2D3RA 4J25A 4NVPA 5IVFA 1H6YA 3GCXA 3AMQA 4LKFA 5JUWA 2TNFA 1DGRN 4Q4Y2 3MO4A 4AEDC 1UZYA 5A3TA 1AYN2 1DGLA 3S57A 4M4RA 1FT9A 2D43A 1YCIA 4Q4W1 5FZMA 2JKBA 1QHDA 1QU0A 2DFCA 4XUNA 4QM8A 1CAUA 3FHAA 3RG0A 2D40A 4QQOA 3SISA 1V6OA 1K5JA 4K1YA 3Q8AA 1UX7A 1ULPA 2W1SA 4YZ1A 1H1IA 2G4IA 2QFEA 3R0RA 2BGCA 1NUKA 3PTYA 1S1AA 3D1NI 1ND3C 2TEPA 2E63A 3PHMA 4E2QA 2JDKA 2Q1MA 3A9ZA 1QNWA 2Q30A 3C7FA 2J7WA 4W6YA 5T5PA 2XBO2 4RGKA 2CGOA 1RINA 2L9LA 5DPNA 4CCKA 1NZIA 3SH5A 2QDNA 3H1YA 3AXEA 3OGGA 4CEWC 1D2QA 1E5HA 5GAGi 5GM0A 4PQQA 3F6WA 5EIYB 4DXTA 5KHIA 2Y38A 3LA3A 5FV3A 5FYMA 5GJ6A 2WAAA 3NXHA 1ZBA2 1MS0A 4GB33 2W1QA 3P6BA 5JOXA 3TN92 1W06A 2ET1A 3FN9A 5FJHA 5GZFA 5J37A 4XJUA 1J1LA 3VV1A 1ENQA 2RG4A 2VUAA 5FP7A 1ZNPA 1CAXB 2GDFA 4XJ8A 2D6KA 3DKQA 2IVQA 5FK7A 2A6ZA 1AR81 2BQPA 1LULA 2HBTA 3OTFA 2XJTA 5FZOB 2JDNA 1CIYA 4BQ3A 1WCUA 1BHGA 2FDKA 2BJSA 2OQ6A 2XONA 4M00A 2GZUA 4NJ4A 4CVUA 5LRSA 3OY8B 5B2GB 1ALYA 1F5FA 5SV8A 4TWTA 4FOQA 4OULA 4AI3A 4O7XA 1O3TA 2HFZA 2HWB2 4PU3C 3V56A 1VMFA 4A7YA 1ZREA 1QJU2 3WNMA 1DQ0A 2E6VA 1YJLA 3AMHA 3CJIC 4WVMB 1G9DA 1BQPA 2G19A 5CZKA 5GLZA 1H2LA 4LT5A 3RZJA 2ZOEB 4URAA 4CDWC 3THPA 3BTZA 5FYZA 4HG6B 1HQWA 2VNGA 4XF0A 2A6CA 1HIXA 3DUIA 3TWIA 5L9VA 1CZTA 2W1UA 1H8TB 4QGNA 2BV4A 5ANNA 5A3OA 4C8DA 3LDBA 3T2OA 2L49A 1ULDA 1UYPA 2P17A 2P3IA 3M3IA 5LATA 4XBQA 3I2OA 2VR4A 1EAH3 1UQXA 3ZYPA 5BNNA 5JDBA 2XWBB 3ZIXA 1PO23 1MS9A 1JTZX 1W0OA 5I93A 1J1TA 4I3PA 3UV9A 4CUAA 2WUHA 1G7YA 3RVHA 2IVBA 1GOFA 3WUDA 4IV1B 1DWKA 2YHJA 4Y1YA 1RUF2 2NPIA 3IAQA 3ELNA 3MIGA 4YPJA 4Q5OA 4NIGA 1SBDA 3K48A 2PE5A 2PAMA 1RB8G 5FZFA 4C90A 3RZLA 1CZVA 1TMF1 3O9XA 1WETA 2VG9A 4NRMA 4QX2A 4CEYC 1VAMA 1K5MA 1PGSA 3L9JT 3N36A 4JGZA 3O0XA 3VBFB 2EIBA 4B7EA 5C70A 5J96B 3CF6E 5FO7B 4EZIA 3FX3A 1RUG3 1XWRA 3NVCA 2A75A 4CE8A 3VBUA 1DZTA 4IW3A 1HRI3 1R1A1 1VAKA 3C8XA 4M3CF 4ASLA 5FPUA 3K4DA 1AR91 1I3HA 1W9WA 2VOXA 1ZZ6A 2LLVA 2EICA 3K46A 4R52A 4COZA 5GZGA 3WDTA 1W8HA 2E51A 3ETPA 4ZY9A 3KV5A 4XXPA 4QX0A 3N4MA 1QXJA 5IUQA 3GNEA 3BDNA 2ODRD 1UPSA 3FLTA 4WM8C 4BQ1A 2JB4A 1H9WA 4Q4X1 3SMHA 2QQKA 2JDMA 2FD8A 3GBGA 3I2DA 1OD5A 3H3ZA 5FZGA 4FN3A 3JXDL 4WVWA 5BNOB 2ZPXA 2AWIA 2C4XA 3OPZA 4XTMA 3R6SA 4XTPA 5F39A 5JXHA 5L7OB 4PU7A 2W52A 1KJLA 4XBLA 1LOFA 2I74A 3VKNA 4Q4Y3 5T3NA 5L7OC 4FCAA 5HXMA 3V0AA 4HSLA 3PNAA 2PPXA 1AYN3 1UU5A 2HBUA 2ZX2A 5ACA1 5EJ1B 5BNPA 1FOD1 3VUOA 1COV2 2KD7A 1SLTA 3V0BB 5FPLA 1Q8SA 1PRAA 2VOWA 4U2AA 1PX3A 5KR7A 1RPEL 4AEJA 1A34A 1W6QB 3HT2A 3MF6A 3T09A 4RGGA 1J3QA 3ITQA 2BERA 5EP9A 1PZ8A 2YC2A 3VBOA 1QP0A 2BOIA 2EXJA 3F2ZA 4AE2A 3KS7A 3TBDA 4OQ8A 2MPFA 2RS11 1NY72 3M7AA 1CGPA 3WNPA 2XBO3 1NT0A 4WVZA 4ER5A 1QGLA 4N43C 3V64A 1PRUA 4PBPA 5BPXA 1SQ8A 1S2BA 4MHUA 2WZR1 1ZVFA 1YFUA 2OX0A 1GZCA 1QB2A 1O5UA 5A3UA 5JSRA 2O4AA 1U5YA 3LPFA 4R9BA 3UKNA 1FV3A 1DFQA 3BTAA 5FZ7A 2LUWA 4QX8A 1ZBA3 5GZCA 4HVOA 3MW3A 5BUVA 4IV3B 5LA9A 3LISA 4X8NA 3TN93 3AP5A 2QCSB 4NHMA 3NJZA 1JW6A 2WYFA 4HL0A 4PI2A 2D3PA 3AYDA 2RS53 2Y6HA 1OLQA 4JTOA 3UJOA 1Z0HA 4CP2A 1AX0A 2CDOA 5DABA 5C71A 4Z5CA 3KT4A 3B9CA 2R0FA 5HPOA 3CIHA 3AP9A 3KCXA 5FTTC 4LBLA 5FYYA 3GDBA 2HWF3 3PMEA 1CD3G 1VBE1 1QDCA 2HLEA 1AYM2 3ZFGB 4K9SA 2ETEA 4BZ4A 4ZKTB 4X4EA 2HWB3 3C7GA 2RJ2A 3F95A 2P1BA 3K75B 1VJ2A 1VRBA 4RS5C 3ALQA 4ZU7A 1JMUB 4JZRA 3LD8A 2IFRA 4ITCA 4MO3M 4EN6B 1CJDA 2YMZA 4XUTA 4QMAA 1W03A 5DMYA 3Q8BA 4XJAA 2LYLA 4A2UA 4JDMA 1XBFA 1NA1C 3RNSA 4UF0A 5DTRA 5ANQA 1REEA 5A3MA 4NHYA 1DGRA 4H55A 4XF1A 4FVVA 1IS6A 1RXGA 4RN5A 2Y0OA 1CONA 2NLRA 4BDVB 3AYCA 2GC3A 1LOEA 4ZU5A 4A4AA 1WW4A 4YW5A 5FP3A 2W0XA 1O7FA 3VBRA 3AZYA 2PA7A 4RGAA 3ZR5A 4XF3A 4R4XA 2NMNA 2WT1A 2PXVA 1HN0A 5IK4A 2PAEA 3J8F2 1ZRIA 3TELA 3VD5A 5FMBA 4EJRA 5DDJ1 3OUIA 3I3MA 1VPWA 1VB2A 2ZHKA 1PMIA 1BK1A 4P02B 3MLJA 4LBMA 5IK8A 4NIHA 4HXCA 5A7NA 4GB31 1S2EA 3ZKCA 2EAKA 3ZYHA 1R64A 4RQPA 5FP8A 1VBD2 1Z7S1 2PQSA 3ZSLA 5JI9A 5A33A 3WG1A 3U4XA 2DURA 2VW0A 3NNLA 4TN7A 3RRDA 5CFDA 1YQ6A 3VN4A 2FDGA 2HCNA 4IE6A 2FBEA 2KEIA 5IAVA 1ZAYA 1LHOA 3PL0A 4NN0A 2FZ2A 3VZLA 2WFPA 1V6NA 2RMU1 3ZSMA 3RZKA 2WN2A 4MGKE 4XURA 2X10A 1XU1A 4CA9A 4JAAA 3EO6A 5C8WA 3M3CA 4CXXA 2PHLA 2IZWA 4E27A 1KEXA 1LESA 2D5HA 1E5RA 2ZGTA 3NKTA 1NCQB 2V09A 3PTRB 3OYWA 3MGUA 2HEYF 2Y6FA 1JZ2A 4LNVA 5LBEA 3WP6A 3TAYA 2BDRA 5F3GA 4EN7B 1EP0A 1LMB3 4Q4W2 3CMGA 3SXWA 1A78A 3TOJA 5DAXA 3QOPA 5FZ3A 3RS6A 3VD3A 4YGEA 3A9XA 2X5IB 4CXWA 3ZYFA 1IPJA 2A6XA 1AJOA 2NN8A 1COV3 1ND2C 4DUXA 1NG0A 1EAH1 4BQ4A 5CG9A 5FLJA 4WZFA 5EXOA 3QOWA 2DV9A 2FQPA 4HK9A 4FSJA 3GZUC 1RMU1 4PU8A 1LODA 2OQ7A 3MV11 5KC6A 4LXLA 2YYOA 4JRAA 2IXCA 4Q0VA 3U1XA 1NE6A 1SQ4A 3KMHA 4YZ3A 2H6BA 4GKYA 4QKBA 4V2VA 4AI1A 3KQ4B 2W92A 4IERA 2MHFA 4MGZE 3RI9A 4DXSA 4XC9A 3I4IA 2JDHA 2DU1A 2YPJA 3TEYA 2R061 2D6NA 5K9YA 3RYRA 4WBBA 4FP2A 2HJIA 2ORXA 4WVVA 4XJ9A 4JKKA 5CISA 2QVSB 1JH9A 5FY1A 3HIFA 4IEPA 3I3QA 5J36A 3SR4A 1E5IA 2HWE1 2VXRA 4HMZA 3LAGA 1LENA 4YFZA 5C9AA 1GYKA 5FQ0B 3AVRA 1EY2A 1QNYA 4FBFA 1TE1B 4PU4C 4F3JA 1EV13 2O38A 4QPYA 3KVAA 2PLV1 3AVSA 5KXEA 4LHKA 4IGQA 1Q8QA 1G86A 5FPAA 5HV4A 4CDQB 1AR82 4OI4A 1U2ZA 1W05A 3T4VA 3K2OA 1LLIA 2Y60A 2QUOA 1PZ9A 2CSFA 5FZBA 4FOWA 1H6XA 4IEWA 2J1TA 2P6CA 2ZEXA 4RR3A 2WKKA 1UIKA 1Y9MA 1U0AA 4XUOA 5DUWA 1QIQA 1OHFA 1ASJ2 1REDA 1UWWA 1WBLA 4QDQA 1AYM3 3NKGA 4JKLA 1RUOA 4Y20B 2CV6A 5BY5A 2QJVA 2ZS6B 1X9PA 4JDNA 1JUIA 1LU1A 1AYN1 2J42A 2LYKA 1SCSA 2VW2A 3AC0A 4CPBA 4FFIA 2IXIA 2ZHMA 4DPNA 1HQNA 5IW0A 1YWKA 4BCUA 2DCYA 4FXKB 3VBHA 3ZX7A 3ST7A 1ZVVA 4F7ZA 3WP4A 2JD4A 4XUPA 4AF9A 2KPJA 3H7YA 4GXLA 4YVWA 1PMJX 4DXZA 3GXUA 4IDZA 1MZEA 3DPRB 4Q27A 1JFTA 3QCWA 4E4HA 2R041 4AFDA 2ERFA 5DG2A 4OB4A 1D4VB 4Q0SA 3OOXA 1N3PA 3B94A 1TME2 2D93A 2PHUA 1IS3A 5A6YA 3NDBB 2R32A 2C5DA 1BLZA 1MVEA 1R1ZA 2ZHNA 4CCOA 4XZPA 2XXPA 2ICPA 5FZAA 1UW8A 3JD72 1NKGA 1RIOA 2K0GA 3KD4A 1UYZA 4B1MA 1SLIA 2AEZA 4OHWA 1BJQA 3H3LA 4EE2A 3T4HB 5IK7A 4N53C 4YW6A 3HEIA 3KGLA 4O8BA 2W94A 2DUOA 4EROA 4NOTA 1PHMA 3TEXA 1WGPA 1ZBA1 1X2LA 3OQNA 3I2HA 1VBD3 1AR92 4AEDB 2JE9A 2AXUA 1AR72 1TEIA 2ZX3A 4B4PA 4XOGA 2CYFA 5CADA 2E7QA 5I0SA 5EYYA 4NUBA 4BE3A 2V72A 4FP3A 1T6BX 4CTEA 5K0UB 2LYPA 4Q4X2 1Q56A 3KM5A 2ZKLA 2LS6A 3I3EA 1V9U1 3OF1A 3AFKA 2ZJCA 1JHNA 3DECA 4BQ5A 4E4ZA 3I8TA 4CRQA 1SBFA 4X6RB 3WNKA 5C4WC 1WZXA 3N7JA 3BI3A 1QJU1 1OUSA 2ARXA 5I0TA 4XCBA 1DZQA 3VHRA 3VWSA 5LBFA 4RA0A 4PIZA 2JDYA 5ACA2 1W3XA 4W50A 4BIFA 1BK0A 1GKBA 4Q1RA 2DU0A 1LHNA 1WW7A 4Q4W3 4LBQA 4GA9A 3VZMA 1YFYA 3M3EA 1UXZA 2GC0A 1QXRA 1YQCA 3M4FA 3VZOA 2JG9C 2WAOA 4EKIA 3TEZA 3FZ3A 3JQWA 3MIBA 2HEVF 1VB4A 1SPPB 2EXIA 1I1EA 3ZDVA 3ORJA 4RL7A 3ZFGC 1AR62 4Z59A 2JVLA 4LPLA 2JENA 3AZXA 2XQXA 1NE4A 4P9JA 1MQTA 2R1JL 3KGZA 1RUF1 1POV3 4PLMA 2EIGA 1YIFA 1PZ7A 2J1AA 4QX1A 4FBIA 5KC5A 1ZZ9A 3PVBB 3OUJA 2WZR2 2AACA 2WO3A 5JSPA 4XFBA 4Z1VA 4I6TA 4I0BA 2V5YA 2XKOA 4NPMA 2VCMA 4XXAA 1J58A 5EHDA 1GWLA 3JQXA 3CJIB 3AYAA 4OZXA 1NCRB 1OPMA 4MGYE 1JYNA 5DT2A 1JU4A 4MXWA 4CDWB 2DYCA 4OUMA 4BOWA 4UFKA 5LRRA 4IEVA 1HX6A 5A80A 4FFGA 4FOYA 1QH6A 2OT7A 5FY4A 4OHYA 4BQ2A 3W59A 1AR83 1UU6A 3VDCA 2XHNA 4BMEA 2DWRA 2XHKA 4MX3A 1Q8OA 1KS4A 1LR5A 4GKXA 3QLQA 1TVGA 4Q0PA 4I0WB 2CGNA 1VBE2 5E1RA 1AF9A 1LEDA 4IEZA 5DUUA 2PXDA 5FR3A 2IVIB 3UWPA 4FI9A 2CSGA 1PGL2 4S2HA 3CECA 1ASJ3 1BCXA 3WLUA 3ZSEA 5CA6A 1JZ3A 4PF5A 4X4CA 3F52A 4IE4A 3T2QA 1DQ2A 5A7QA 1YIPA 1XSRA 3NRUA 4GWJA 3E6CC 1QQP2 3M3QA 4HN1A 4XABA 2XJUA 3PJYA 2J22A 3RMXA 2VZPA 4CEYB 4CCCA 1LJ7A 1CJGA 1IPSA 1HQ1A 3MHZA 4KG8A 5F3EA 4X4GA 5A32B 4AVTA 2JCGA 4YARA 1N3QA 1OFNA 4E2SA 2NYYA 4KG0A 4BA6A 2VTFA 2FFHA 1DLLA 1V6IA 3CZUA 2XXAA 3TNQA 3E5UA 5K4LA 3N9QA 4GJZA 2ADEA 2BYVE 1RUD2 1O3RA 5FUPA 3FFQA 4HOOA 1BZWA 1NCQC 1TME3 5DRYA 2UY8A 4LBKA 1NY71 1ULGA 3FMYA 4QQLA 3BU0A 3MIHA 3KWVA 1GANA 1OD3A 4LEJA 1F2NA 1W39A 3RWKX 4KU8A 1WCDJ 3WXPA 4WM8B 2XJQA 3U10A 2D5FA 4KWKA 5DDJ2 3ZSKA 1PX4A 4PCRA 4OMDA 1F35A 3SNMA 1SFPA 1GNZA 4Z5DA 1UZWA 1W8OA 3BPSA 1YLLA 4Y1XA 4GQMA 3W5MA 1S55A 1ACCA 2NZ9A 4O65A 1Z7S2 5LB6A 1XU2A 1NLRA 4YNIA 5A1AA 1GZTA 2BUKA 4XIKA 3ZFFC 4DS0A 4O61A 2WDBA 1L7QA 5ERLA 3UETA 2PXUA 1AR93 3ILFA 3PIGA 3BKZA 1QJFA 1AR73 2RDQA 2VQAA 3D0JA 4Y4YA 5LK5A 5LA0A 1HXS1 3A21A 4JCKA 1VLNA 4GAZA 4OBMA 3O0VA 3WEZA 4LLOA 3S7IA 2CNAA 1FPN2 1UMIA 1DW9A 3A7QA 4Y5Z0 4N7IA 3S5QA 3G6JB 5FWJA 4Q4X3 3S7EA 1GZWA 2CAUA 5J98B 1GICA 1D0GA 2P3JA 2YUEA 2D98A 4AFAA 1X50A 1UOJA 4QD2A 3UK9A 3HWJA 5CKMA 2F17A 4JRLA 4DUWA 5JLVA 5FPXA 3ZXKA 2D5VA 1RZRD 4N43B 1IS5A 1A8DA 3O1MA 4LKEA 2ZGQA 1LGNA 4I02A 2WZEA 3PUQA 5ACA3 3N7LA 4CDQC 5JSOA 4ZZ8A 2DTYA 1EYBA 2K2SA 5A7SA 5CFCC 2PUDA 2F6BA 1W2UA 5H9RA 5FPVA 2XG3A 1RMU2 2SLIA 3UGFA 2VECA 1QWRA 2XH6A 4MOAA 2GNBA 1HRV1 4QKDA 5JPNB 1GMMA 4IEQA 2ARBA 4EQZA 1US2A 2ZXQA 3OBTA 5EJ3A 1O4YA 3UJQA 3WW1A 3P3NA 3PUSA 1XE7A 1O91A 3ZPXA 3ZHMA 1AR63 1GOHA 3VKOA 1O3SA 1WUVA 4MH0E 2OVUA 2OA2A 2R062 4ORFA 4L2NA 4LHNA 1ENSA 3VD9A 2RJKA 4DQAA 1BMV1 4XFHA 4MYEA 4I6UA 2BNOA 2QQJA 3AKTA 3POJA 5AFEA 2WZR3 3J8F1 2HWE2 4NPLA 1K5MB 4UFLA 4JGZB 4XUQA 5A7LA 3LGRA 1STMA 2D6MA 3DPRC 3O1OA 2Q0AA 4QGMA 2ZGNA 2PUAA 1HDKA 3A9YA 2PLV2 4N9IA 2H6CA 4RS5B 5IK5A 5JZGC 1U5ZA 5G05L 4CCJA 1H2MA 1DG6A 1HV1A 4CP0A 1M06G 2J1EA 4MSVA 1POUA 5A6QA 1N3OA 2SBAA 4FQ4A 4I01A 2WABA 3WCRA 3EUSA 4S2GA 4XFAA 4WZCA 2JIJA 1CVNA 2GMEA 5KXBA 1VBE3 2ET7A 3BOPA 3MICA 4QKFA 5DZFA 4LIVA 3AKSA 3ROUA 1HN1A 2DVAA 4XYXA 1EUTA 2LLWA 4IWRA 3QACA 4ES8A 1DLCA 3GZDC 3AZWA 5GLVA 5IJRA 4AAPA 2RDNA 5D8AC 1TQ5A 5F5QA 2D7FA 2WYSA 3FBYA 4FPEA 5CNAA 3QWGA 5DTQA 1W2NA 2BGPA 5FIXA 4DB5A 4EYUA 1QQP3 5LEJA 2PXLA 4YRDA 3PU3A 2MXDA 3M3OA 1URXA 2IVJA 3FYMA 1ZUGA 4TSVA 3WQBA 4PIXA 3ETQA 1AL0G 4XAEA 3ZXJA 1POQA 4AK3A 3R4UA 4COVA 5K0UC 1ENXA 3A23A 3OQOA 2R042 4RFRB 1Y3TA 4LA3A 4A44A 3BU7A 2FZ1A 3POYA 4MZUA 5JR7B 3VBSA 3ZXAC 4OI0A 1IC8A 1RUD3 4FAGA 2R49A 1POV1 4UW5A 3THDA 1SLCA 1PRVA 2ORZA 3GALA 4DIQA 1QQAA 4XVHA 4ONUA 3AMNA 3K4AA 2P6HA 3ZYRA 5DDJ3 2ZEYA 2GN3A 3PUHA 4B3NA 2OUHA 4GMP1 5A7OA 3DGTA 4PIYA 1DIWA 3MUY1 1OBNA 3SEPA 1ZZ7A 1Q8VA 1MS5A 1KS5A 1MS4A 1Z7S3 3N7MA 3ZVXA 1JZ5A 1OLMA 2DFBA 3H1MA 4C1WA 1J83A 1OF3A 2JG8B 2JQEA 3BTYA 3ES1A 1IZ3A 2OW4A 2K9ZA 4I0AA 1DF0A 1W99A 4NRQA 1PM4A 3FE5A 4QX7A 3KXAA 4YG4A 1ND2B 1PNFA 3ZXDA 2R6QA 1VBB2 3LFPA 3H1WA 2RMU3 2WWJA 3O14A 1RUNA 3KB5A 5EWSA 1FPN3 1RUC1 1V9U2 4Q2JA 5JIUA 5HXVA 3UFDA 4YVSC 4XFFA 4COUA 4NRPA 1SACA 5KHGA 1ASJ1 2OS2A 3LOBA 2YDEA 2D6PA 5LA2A 4PDWA 2ZMKA 1NCRC 3OGRA 2FCUA 5L7OA 2OXBA 2RR12 2WA4A 3DXUA 3LKJA 3UYJA 1RL3A 1DULA 1UY1A 1H4HA 1N47A 4R9DA 2IV1A 3SKJE 1QQBA 5FZLA 4JVAA 2WFF1 1DBNA 2XIUA 1K3IA 1MS3A 1PVC1 3CHXA 3L2HA 3LA2A 3Q8EA 4RYDA 1BBT2 5F6LB 5T5OA 4UF0B 4X4IA 4QKNA 4K8RB 5E88A 1W04A 4Q1PA 4LOTA 1RMU3 1QY4A 1WA6X 3S30A 4YM3A 3USUA 1RUH2 3I7DA 1D2SA 3FWEA 1YUDA 1DQ4A 1GBGA 4D69A 4FPKA 2M4HA 3J9SA 1X57A 5FXXA 1OSGA 1IG0A 1TME1 4M0HA 4IESA 3T3YA 5FY8A 4CSWA 5DXDA 5A7WB 5FOBB 2GMMA 2R063 4FPOB 3POIA 1ULCA 3RQ0A 4UT5A 3JD71 2XGXA 3WF4A 5JCTA 2OZ6A 2VBBA 2GN7A 3S0MA 2PUGA 4HRAA 3DL3A 1FNZA 2HWE3 1KFXL 1U5IA 5JAXA 1OLME 3FJSA 5F7UA 2VVFA 3AM2A 3WQ0A 4QQHA 5FPBA 3MW2A 3CU7A 5A33B 2PLV3 2PHDA 4X6QB 2JKXA 2YV8A 1PIV1 1AR71 4YGDA 5KHHA 2XMLA 3TNPB 2ID4A 4HKOA 3N9MA 1LECA 4E8DA 1AL22 2RV9A 2PXFA 1H9PA 4Z58A 4A6SA 5IVEA 2YB7A 5J09A 2XR4A 2QQUA 2ZEWA 3JCIA 2EA7A 1NERA 4JHTA 4NPRA 2D44A 1FV2A 4KMQA 2Y8KA 4FFFA 5FZIA 5FYCA 5J48A 1T2XA 4AI2A 4Y26A 2XLFA 1W0NA 4AYUA 2FMYA 1CQTA 2WNVA 2QNKA 2W87A 3ZO0B 2W95A 4M4PA 4BB3A 4AHYA 4M3CA 4UFHA 3U07A 1REFA 5LW9A 4L92A 3CO2A 1IS4A 3GN5B 5DZEA 5IFTA 3B69A 2AEYA 2YBSA 3OBRA 4P08A 2Y6LA 3RZGA 3IDCB 2WQ8A 3MEPA 4N53B 1LGCA 5BYNA 4AVAA 5C6CA 3WD5A 3EYPA 4R8HA 4BH9A 2Z2SB 3IIAA 3MFAA 4Y1ZA 3MPBA 1VBA1 5A3LA 2VMEA 4OHVA 2VJXA 2R043 4QB2A 3O1VA 2AC1A 1JOBA 1WMXA 3J7NA 1W9YA 4C91A 4NHLA 1AR61 2QQPA 3USSA 4TYSA 4GH4B 1UXCA 1T6GC 3R4DB 4K3UA 4MVTA 4PHZA 4DOUA 2R7EB 4XMIA 5JOYA 1LOBA 4XDQA 3G7DA 1UNBA 2YFUA 5LA1A 3T30A 4NIAA 2IXHA 3OD4A 4YG0A 1SDWA 3RYKA 4INDA 2HINA 5HCHA 3ZDSA 3MYXA 3OQMA 1C3HA 2OPKA 2JICA 3CBNA 5F5AA 4CDUA 4KBBA 1R081 5C4WB 5BNNC 2VAUA 4D6RA 3N35A 3HQRA 3LZZA 3OJBA 4Q0UA 3RPQA 2Z4FA 3NNFA 5ABJA 1GZ9A 1L3JA 1ODMA 1VPHA 2GMPA 3ZKYA 3O5SA 1PK6B 1HXS2 3IPVB 3EHKA 1OQ1A 3IBMA 3GGLA 3ZOIA 1LOAA 4MCXA 1PVXA 4Z07A 1W8NA 3MV01 2MEZA 2WWSA 4ATFA 1XQNA 5JXJA 1XNDA 2P5BA 4XEZA 2BVVA 2JG9B 2WL1A 4G3YC 1VAVA 2HSGA 1V9U3 2FCTA 1K5MC 3L2YA 3EQEA 4IQPA 3MDPA 3SCHA 4H14A 4JGZC 3NAPA 4M3CE 1DYOA 1RVF1 2O1QA 3N9OA 4QM9A 4AL9A 1PGL1 4XFCA 5JR2A 1JN2P 3WDYA 1JXNA 3GZAA 1MZFA 1QJU3 4FFHA 3VBUC 5FKBA 1YYNA 4JTNA 1S0JA 5C33A 5F2SA 3WQ1A 2GP3A 1QQP1 1JYXA 4XZUG 2DF7A 1F4AA 2QDRA 3ACHA 3MF9A 3ON7A 5E89A 1PM7A 2OUJA 4YW4A 4AQ2A 2UWAA 4EZHA 4AEKA 5KXDA 2UY9A 4HPKB 3R4SA 1HRV2 1BBT3 1ZS4A 3INAA 2CGPA 1AU7A 2AZ5A 4FT8A 3VGIA 1BEV1 4NO4A 1RUH3 2AYHA 3VKFC 3UL2A 4OLLA 1RUD1 2AH2A 2PTMA 3BIWE 4LIUA 4UFJA 4B29A 1J84A 1LOFC 3RZZA 1WIZA 2BBAA 1MFQC 2P3KA 2B45X 1W6NB 4LO4B 1RUF3 5GZEA 3HNYM 3O12A 4AHXA 2VUJA 4BWOA 5AC91 1BMV2 3R09A 1FI2A 2XQRA 3B9IA 2ZCWA 1H8TA 5BNPC 2XCJA 3HAGA 3CQOA 2XPJA 2QZ3A 3VHOA 4WM7A 2YBKA 4E2GA 3DV8A 4XCAA 2WNUA 2Y64A 1XYNA 4AQTA 3IWZA 3ZYIB 3CLCA 1XNBA 2B46X 3HNBM 2EAAA 2YY1A 1DDLA 4R9AA 2WS91 3VBOC 1HB2A 4IV1A 4LK6A 3ZIWA 4BLIA 2VCAA 1ZPQA 2JX9A 4MG2A 3EB7A 2Y6KA 3NQHA 1OXCA 1TZOA 4DXRA 1AL23 5BNQA 3CKHA 3KHCA 3SC7X 1UN1A 1FPN1 1PGW2 4RD7A 5FP9A 5M0TA 2V3CC 4UOJA 1WH6A 3AMMA 1SDDB 2Z42A 2BPA2 4ZS2A 3VBFA 4I09A 4FTEA 2PMWB 3RMYA 3VD7A 3N9PA 3WW4A 3JXBC 4D7TA 2XUMA 5LBCA 3IAPA 3JBG1 3VDDB 5EFUA 5I0UA 3PLQA 2WZ8A 3R1FA 2JG8C 2PUEA 3J26N 5HCAA 1G9BA 1QJEA 1SFNA 4Z5HA 2YC0A 3DN7A 4R4ZA 2B9VA 4GHJA 4XF9A 1SLBA 4DRVA 4E4DX 3FLRA 5EYXA 4FPHA 1NQDA 3R05A 1S0EA 4LTAA 2QQMA 2AXZA 4A41A 3U78A 3DNVB 3ZFFB 4P14A 5BNOA 1SHWB 2YFZA 3NNMA 5HBAA 3LQXA 4YW7A 3ME2A 5IT6A 4IETA 2F4PA 3HR9A 5FMCA 2A3XA 3E5XA 4HFSA 2PXTA 1LCCA 1MQTB 2GALA 1UXXX 3O1TA 5JMOA 4UXAA 3D5OA 1WD3A 3K77A 4XJWA 4DY5A 3LEMA 5EV7A 4N9HA 2OYZA 4FTSA 5GZDA 1F8VA 2A73B 3KJXA 4NDWA 4JKMA 1JI6A 2YZ4A 2ZZJA 4H7LA 3DYMA 3T0BA 1AXYA 3QQ6A 5AVPA 1W6QA 4CUGA 3OGJA 3RDIA 4Y42A 2CAVA 2HYKA 1UZVA 1VIWB 5DUVA 4F8DA 5FZCA 4NIIA 4WV8A 5FP4A 5FZKA 1OT5A 1RITA 3VZJA 4DY3A 2PHFA 3DM5A 1CQ9A 1LCLA 4ARXA 5JOZA 4QPIA 1HXS3 3LOIA 3VBRC 5CFCB 4XHXA 2FDHA 4NWWA 2B4KA 3DXTA 1FNYA 1OF4A 4QPGA 4CU6A 2CTVA 1RUC2 3HD8B 4X4BA 4TLGA 1W8TA 5IATA 2G9ZA 1CAVA 5DZGA 1H1AA 1B35A 4E4SA 2XSDC 4IEUA 1OCTC 2W91A 3U0ZA 3ACGA 2XB6C 4BMBA 1PNGA 1YHFA 4RQPC 4IV3A 2AUWA 2VOKA 2A71A 4AVSA 1X33A 4UFIA 3OUHA 1IKQA 2ENRA 1NW3A 1ZA7A 3W9AA 3ZFEA 4D7YA 5JUVA 3O1SA 1W90A 2P2KA 5CFDC 1WBFA 3LQCA 3N9LA 1A3KA 5FJKA 3WINE 3I59B 2WFF2 3ZN6A 2ADDA 1RTVA 1PO12 1PVC2 2VVEA 1A6CA 2WC2A 1IGOA 4IL7A 3WF3A 1OQDA 3AL6A 1ZZBA 1WW6A 4BIOA 3ASIA 1HRV3 4UW4A 3LSDA 1LHWA 4RSUA 3MLLA 4Z92B 4W8JA 2BWCA 4CDXA 5JZGB 2GC2A 2EVXA 1W2AX 2OIIA 2GNMA 1X7NA 5A1FA 1XYOA 3LEIA 5CAZA 3LCPA 4JGYA 3ZYJB 5LY1A 4QB1A 2Z5WA 3SH4A 3PIJA 1DHKB 2UURA 5C8CA 3HPNA 1CX4A 1KJRA 1TNFA 2FMDA 3AL5A 4EK9A 3J8F3 3BGAA 5FYHA 1DQ6A 1UXDA 1SEFA 4UYBA 4MGQA 3SH3A 5A3NA 1LOCA 2PXPA 3I2JA 4KI5M 4AGGA 2B39A 2FJRA 1MZ6A 4DEQA 4OZOA 4Y22B 1QPZA 4ER6A 4J1WA 1PIV2 2VNVA 4QX5A 3GCWA 5D21A 5D8AB 2DCTA 4Z2WA 5B4NA 3IT8A 2Q8EA 5G04L 1C8M2 3E6DA 4GH4C 1J3PA 1OKQA 4NAMA 4O9EA 5A3WA 3HVDA 1YQ2A 5FYBA 4YM2A 2P37A 2XDVA 2ZGLA 3H0OA 4MLOA 1VBB1 1YFWA 1PMHX 1W8WA 1KD7A 3DF0A 4UBHA 1W9TA 2BRTA 2XXQA 2AW6A 3PJQA 4QPWA 2IUOA 5F8PA 3BODA 3AFGA 5C9AC 1GT0C 1O3QA 5I0RA 1JBCA 3DYPA 3MI8A 2BVBA 2WQZC 2GSYA 1FMD1 2RR11 3WF0A 2B7YA 5E8AA 2JDUA 1PK6C 3LA7A 3D6EA 1XNAA 1W6OB 3UESA 3C7OA 4AHWA 4FXGB 1LKNA 2GH2A 3NSTA 4W4ZA 3FL7A 4CP9B 3IN9A 4FPJA 2PFWA 3WG4A 2GRLA 3H8RA 1PERL 2V4AA 3IMMA 4Y5TA 3G0TA 4CUCA 1RYYA 5IFPA 4HT1T 4DE8A 3WW3A 5F1RA 3AZVA 1BBT1 3P1IA 1VBA2 5F5CA 3OKZA 2LYRA 5H9QA 4AGRA 2L8NA 1RUH1 2HWD1 1KRIA 4JV4A 1HJGA 3T1LA 4QHBA 1UY3A 1NCQA 4Q2FA 5DAPA 3ZPYA 5FLIA 4E9KA 4HANA 4YW2A 3WOGA 1N1VA 4D3WA 4F8AA 1KXGA 5E16A 4B4QA 2J1UA 2UU8A 4FOVA 4WVLA 1BVVA 2W5FA 3AYEA 1NZCA 2VNOA 2X5IA 4ZPIA 2CL2A 4YVSB 3VBHC 1D4M1 1D7PM 2UYAA 4URTA 1R082 2FDIA 4A3ZA 4QHZA 4CCNA 5C3RA 1Z78A 2J1SA 4YVWC 5F9TA 4GMP3 3OGVA 1NX9A 4QX3A 4JHZA 3FYAA 2JDPA 4OHXA 4XQ4A 5FCCA 5FYVA 4BLJA 3W5NA 2MEV2 1RUI2 2RM22 4IUGA 5GLTA 4FTBA 1Q3EA 3OSDA 2FDJA 5C3QA 1AL21 4OCTA 4P5HA 4DINB 2R0HA 4H2AA 1GNYA 4BQXA 3C7EA 4Y5SA 3GBFA 2V5DA 3ES4A 1RUC3 3WT3A 5C5UA 2JECA 1SCRA 2DVDA 2VC9A 4XDPA 1RVF2 2KR2A 3CEWA 4ZXEA 3KT1A 4XJZA 5AFBA 1W2OA 3I2GA 5FQ0A 1H0BA 3GHMA 1YC61 2E31A 1TG7A 1OSLA 1B0NA 3M70A 2PAKA 2W68A 3B7HA 2BFUS 3KHBA 2D97A 3NJYA 4CDQA 5JPMB 5J1XA 3CL1A 1IKPA 3U14A 1CAUB 1H2KA 2WFF3 4K1ZA 3AXDA 1PO13 1PVC3 5FMOL 3J4UH 1FXZA 3S8QA 3LE0A 3H7JA 3POBA 2RE9A 4BXFA 4DO0A 4Y24A 1GP5A 4Y3OA 1S0FA 4AFBA 1BEV2 1U5XA 2N7GA 5DSXA 1JS9A 2CDPA 2VZ3A 4OMCA 1NLQA 1BVP1 3VBSB 2WINB 4PJYA 4BQWA 3OPTA 2C24A 1RIRA 2A6VA 4GALA 3VDDC 5AC92 1QP4A 4KH9A 2TUNA 3M8LA 4NAOA 1S0BA 4BM8A 5FUIA 3POSA 2W9XA 3JD73 5FMOS 4CCDA 4D0QA 1APNA 4L97A 1OOPA 5F37A 2B5HA 2UYBA 2V73A 4BQYA 4ER3A 4NIDA 1C28A 2VTXA 4FPCA 4P9YA 2YBDA 1DGWX 2RDSA 4ASMB 2CU5A 1ZBE2 2VQ0A 3LIGA 4FQZA 2YGMA 3CDZB 1YEWA 2CHHA 4D8MA 2ZACA 2WS92 4META 4OUSA 5IVYA 4FPFA 4NMIA 1PIV3 1ST8A 3CNAA 4UW3A 4XMAA 3WZ1A 3H8UA 4ZXKA 3ZR6A 1UIJA 1ZX5A 2Y0IA 2Z69A 5FZOA 5KBFA 1JYIA 2DVFA 1MQTC 1C8M3 2A1XA 4ASKA 3IB3A 2QZ2A 4QWNA 2PXKA 1YI9A 5GKAC 2OPWA 4AI9A 3MEJA 2EBYA 1YI7A 2DVBA 2Q8OA 4EWEA 1WCQA 1LQCA 5T55A 5A70A 4AHZA 4LO7A 2G9GA 2ZGSA 1XJAA 3GZCA 3J7LA 1LRHA 3JBG2 5IHRA 2L1PA 4AEDA 3QD6A 3U37A 1LHUA 3OG2A 3UKTA 2V4VA 1IG3A 3URFA 3W21A 5DAVA 1OLRA 4YYOA 3PURA 3ACIA 1S0GA 3H50A 4AVVA 1W6MA 3OGSA 2X29A 3RI8A 1O4XA 3POEA 3VHNA 4B8EA 1JZ6A 2VQTA 3AKPA 1YO8A 3DEMA 2XKPA 3HQUA 3K51A 4QDSA 1JH5A 2R072 4YW1A 1QKQA 5BNNB 3EMRA 2XJRA 3KVBA 3K3OA 3FUOA 1VBA3 1ND3A 3USUB 4LMFA 1O6UA 1ZZ8A 2YROA 4EV0A 3QBQA 1K42A 4KL1A 3TRSB 3PVEA 2ZZQA 3MUZ1 4K20A 4Q8LA 2E26A 2PXEA 3BUCA 1UY0A 4EKGA 3DYOA 4MCTA 4LUKA 1ZM1A 4XE9A 3UGGA 2OZJA 4B1LA 4CEWA 2Q1FA 2R1DA 1R091 1Q43A 1X9TA 1RJ8A 3FMGA 4Z8BA 1UO9A 2LTNA 3NL1A 5JMCA 2GP5A 2WLPA 1ENRA 2KEKA 2YGLA 1R083 1DCSA 1QXPA 1SMVA 4NE9A 1PO22 2WNOA 3BYWA 3OPWA 2BOJA 2XI8A 4IE7A 3G5GA 3PUAA 2YXSA 3VBUB 2XL7A 2ZGOA 4LBJA 4AVCA 4AVBA 2WA3A 2J7MA 2C1FA 2BW8A 3JXSA 1RUI3 2RM23 2Z79A 5CKNA 3MLFA 1V70A 2XVKA 3NNGA 1JZ4A 3ACLA 2BNNA 2R1BA 5FXZA 3A22A 5EJZB 3O1RA 4F83A 1QZXA 1PGW1 3A0NA 1HF0A 4JQTA 4S2FA 4IVZA 2W47A 1X36A 3LFMA 4K21A 4XILA 3SQOA 4EWAA 1BYHA 2ZMLA 4LJHA 1GQHA 2WBKA 1RVF3 4UBGA 3BS3A 3AJYA 1BKZA 2KXLA 3CJIA 1RZRA 1HLCA 2YU1A 3VDAA 4LK7A 4M3CB 3NWKA 1GQPA 2XJPA 5C7GA 5CU1A 4ES9A 2VL4A 4CDWA 1XB9A 3Q8CA 3V0AB 5FZ8A 3ZXFA 1QEXA 5BNPB 4QAWA 4J1XA 2VOVA 2I2SA 2H0VA 3BD1A 1KDKA 2RS31 5FREA 1ZYBA 1UPIA 4LUMA 4BXSV 3VL9A 1BEV3 2QQWA 2R30A 3ME5A 5FBJA 3VBOB 5GALA 2VZVA 2VZ1A 3LDRA 3H9AA 4UWDA 4A7KA 3MPPG 2QKDA 5AVAA 5JOWA 2Q1ZB 2VZOA 2WN3A 5D2AA 3AKRA 1X82A 1R63A 1V6LA 3LEKA 5AC93 2NP0A 3AP6A 4C0HA 3C7HA 4MADA 1US3A 4CEYA 2KEJA 3K3NA 3OCPA 3PUIA 1JHJA 4CDUB 5A32A 3PU8A 2FDFA 5L19A 1E3OC 1W9FA 1YQ8A 4AQ6A 1ZRFA 1NAEA 2PN5A 3ZSJA 1E57A 1YQ5A 4XW3A 1AHSA 1ZBE3 5ABJB 2BP6A 4IEOA 5SV5A 2EIDA 2PHRA 5LY2A 5FO8B 3KV4A 2WS93 4LQRA 4UFMA 5I91A 4CXYA 4QB6A 5JXIA 4JQRA 2WUSR 4ZU4A 4LORA 4KGQA 3GF6A 4KWJA 4WM8A 4YW3A 3TRBA 4U36A 4CU8A 1O8PA 2GC1A 1LOGA 1VMHA 3GZTB 3JB8A 2ZEZA 2G9FA 2VNRA 1CX1A 4GD4A 4C0BA 2ARAA 3AB0A 4XACA 3NAPB 4CU9A 2EXHA 2W1WA 3I2IA 4BISA 1LB2A 4BU2A 4CUBA 1WLTA 3C3VA 1DGWA 4BJ0A 1GSLA 1FMD2 2PHTA 3KCYA 3JBG3 5F3IA 3BIEA 2ZMNA 3RFRA 5JVVA 2R16A 1S0CA 2ZA9A 2ZGKA 1UKRA 2RS52 2VMHA 3D0SA 4QQ2A 4JX0A 5DAWA 4C1XA 1CPNA 1YJKA 4K40A 5LASA 1KGYA 2HKXA 1DZRA 4AWDA 1RUJ1 1W8FA 1UY2A 4LE4A 2AXVA 1PO11 4ISRA 3ILNA 3KV6A 1LNSA 4N8MA 5JI7A 4A42A 2HWF2 2R073 4FPLA 3UT0A 2YU2A 1E5SA 1O8SA 1WLCA 2ZGUA 3CJXA 2HWD2 3QFIA 3MIFA 5F5IA 3VLBB 5JWPA 3U11A 1Y43B 1OURA 1KQRA 3KL4A 3QF3A 1L7LA 2ZX4A 2DCZA 3ATGA 3IMNA 2WNEA 5DN2A 1I6XA 3VBHB 4JDOA 2D6OX 2EWTA 4KGGA 5DAQA 4YZ2A 1O4ZA 5FZ1A 3WNOA 3MBWA 4N43A 3VBRB 5HV0A 1DYKA 2VBDA 1RC6A 4XAAA 3M1HA 1N1TA 2LALA 1W6PA 4MGSA 4CU7A 1D4M2 4GJYA 5CKQA 5JXGA 1MVQA 4AAXA 1XE8A 1WCSA 4HVQA 3NV2A 1CPMA 2LYJA 1BDHA 2AENA 3O1PA 2E53A 2VMCA 2WSUA 4LOSA 4OVEA 4WM7B 1CAWA 5DRTA 4RQPB 4Y1VA 2WNUB 3ZXGA 2Q8CA 4MGTA 3VKMA 3H8OA 3QOXA 2EF8A 4TTGA 2YC4A 3IDBB 1TNRA 3AZZA 2E32A 3VBSC 4H7MA 5CFDB 3APBA 5IYYA 2B5AA 5T50A 4ZONA 2W46A 2VMDA 1C8M1 4PBOA 2Y33A 4B4RA 5CG8A 4P9WA 1RHI2 3HN3A 4Q8KA 3E5QA 1A8MA 2Y6GA 2WZPP 1N1YA 3OB8A 1OVPA 1VRH2 4GWIA 3NW4A 5A6ZA 5I8YA 3WCSA 2AGSA 4ET7A 2RJLA 1XSQA 2P3YA 2WWUA 1S7EA 4AGVA 4YSFA 1O5LA 2NM1A 2Y34A 3PVOA 1JYVA 3SITA 5T5LA 1KDMA 2C9AA 4RS5A 3POFA 2G1MA 1JU3A 3OYWB 4IEYA 1Y7YA 2XUEA 4RHV2 3BTXA 1FX5A 1QJY2 3PVNA 1UOGA 4XIOA 4HZFA 1JYTA 2JDAA 1AZDA 1W0PA 1Y9QA 3BOWA 5FWEA 1WLWA 1XNCA 4PQ9A 1CN1A 1OI6A 1K45A 1G8WA 1CR7A 2XVGA 3TEPA 3VK0A 1NA1A 4OI2A 1H30A 5TSWA 2BNMA 2TBVA 1QJZA 2VQUA 3NJXA 4XDOA 4CCEA 5L9BA 1WA4A 4G4FA 4HK8A 5EQUA 2OR1L 3FLPA 1W8UA 1FYUA 5FZ9A 2ZGPA 4PDWC 2VCBA 2DCJA 4LHSA 5FFOC 3ECQA 3OBAA 3OWQA 1AX1A 4K7JA 5IAXA 3RWNA 1YFXA 3JUUA 2XJ3A 4L99A 4XFGA 3P5BA 3DKWA 4L9BA 1PNRA 2XJSA 1S0DA 5C9AB 3WSOA 1SBEA 5KHJA 4ATEA 4DEVA 1XC6A 4KNCA 4PI0A 3B93A 4Q4V1 4Y33A 3BALA 3UKVA 1SZBA 5KHKA 4A3XA 4LLFA 4HBNA 4Q29A 2MEV1 1RUI1 1K12A 2RM21 4GWNA 4OFGA 2Q4SA 1RXFA 3LWCA 2Y26A 4QPIB 3A4UA 2I07B 1L1MA 3C2UA 2X05A 1UX6A 1D0HA 1DQ5A 1MACA 4QPGB 3IDEA 1VBB3 1OA4A 3NZLA 4PLOA 1W9SA 4RR3B 4CCLA 1RUE1 5I0DA 1QOOA 3E6BA 4Y4RA 1CAVB 4YM1A 2RDRA 2KM2A 1B35B 2VPVA 3WV6A 2UWCA 3AP4A 4JQDA 5FK8A 1C1FA 2VZRA 3HNMA 1EV12 3ZYBA 5IVCA 2R63A 3IDAA 5CIRA 1OC1A 2XLAA 4JC1A 3MW4A 3MIEA 1UF2C 1I5PA 1FMD3 2XXZA 2JG8A 4MHRA 2RR13 2ZGRA 4QGLA 1UZZA 3E1F1 3NROA 3ZFEB 1CAXA 3ZN4A 2HEWF 3WP5A 4PLNA 2CWSA 1UOFA 2P4EA 1IQDC 1I9RA 3OEAA 4JCXA 1MEC2 1ND2A 3ZN6B 1QDOA 1GR3A 3KV9A 4S2DA 1WMEA 4AEMA 3RZMA 4YVWB 3D3AA 4AXOA 3OY8A 2B42B 1NLSA 4A7ZA 1W28A 1G6NA 3B5LB 2VY0A 4QU2A 4EN8B 3WF2A 4D94A 2A6YA 4CDXB 4LA2A 4AQSA 2HWD3 1B09A 2WNVC 4A6OA 1NXD1 2X09A 4WVMA 3WNXA 5CBLA 1OVSA 1FAYA 2JE8A 4JGYB 3VD4A 3BPZA 3BCWA 4UAPA 2O8QA 4I30A 5DTMA 3JU9A 3JB4C 1GNHA 2W2IA 2ZTNA 5F2WA 1R092 5FAXA 5L73A 5C8CB 1GOGA 5A6XA 1D4M3 4YM0A 4IA8A 3ABZA 3IZOA 4SBVA 2PHXA 2DBNA 3ZLIA 3ZXLA 4LO8A 1ZBE1 3RJRA 1IOAA 3VZKA 2PUBA 4IEXA 4YGBA 4OI1A 5FBZA 1C57A 5J7MA 2QQLA 5C5TA 4Q0QA 5LZ6A 3POGA 5FUNA 4ARYA 4CZSA 2YPDA 1UL9A 3RGBA 1KFUL 2A6WA 5A7WA 1UMHA 1JYWA 3AMPA 1HKDA 3KF3A 3HT1A 4ER0A 5FXVA 2IWGB 3U3WA 1RHI3 1UTXA 2F4LA 5FYIA 5HI0A 4M0NA 3HBKA 3Q8FA 2JB8A 4P9LA 1AJKA 4QXCA 2LW8A 2O49A 1QJX2 1VRH3 2I45A 3AJZA 3GYDA 4LE3A 3WY6A 4LBNA 4EZ4A 1DYPA 5LBBA 1IPKA 3IIIA 4CDUC 1ULOA 3I49A 4COWA 5FYSA 5FZDA 4A45A 4D6SA 4GWMA 1LCDA 1J59A 2IXLA 4X4FA 5ABJC 2WT2A 4NWVA 5FYTA 3RYPA 2IVGA 4RFT0 4RHV3 3VHPA 1WKYA 3KCCA 4K6BA 2HWC2 1QJY3 1Y7BA 5HCBA 3OBZA 5B4XA 5GAHi 3T08A 3THTA 2WIUB 4LBQB 3DCQA 1ZRCA 3B00A 2VUCA 1J3RA 2HH9A 1LGBA 1NEQA 2VO5A 1VP6A 2RS32 1ONAA 1XE0A 2NMOA 2R071 1XPWA 5FY0A 1QOSA 3D4KA 3HQXA 4HKLA 3N9NA 4YG1A 4AOCA 1VBC2 1JZ7A 1G9CA 1ZZCA 5K98B 3KSCA 3NAPC 3MIDA 3I3DA 3PDQA 4GQ7A 4X8PA 1G9AA 4Z82A 2ILMA 2KA3A 2ZX1A 1YSEA 4NHXA 4I6RA 1UYXA 3E97A 1DU3D 1JZ8A 3GN5A 2VMGA 3ZMNA 3MZHA 5IVVA 2DVGA 2ZKNA 4YWAA 5FZEA 3GUUA 4QDRA 4LO6B 3P3PA 3J7MA 1H1MA 1JFSA 2PELA 2LYSA 3LSEA 4N53A 3JZVA 4SLIA 4BK5A 4CPBD 3V0BA 1H2NA 1WMDA 3KQRA 1VE0A 1OA2A 3WHUA 3HMYA 3WUCA 4L11A 2FHRA 4BYYA 4DNYA 5FDBA 5KXCA 4ZHNA 1HW5A 1PO21 4O9GA 4LULA 5LEKA 3GBWA 3TYJA 2BU9A 3ZN5A 4E8CA 5H9SA 1AVBA 4XQDA 2WO2A 3AX4A 3NMBA 4MXWB 3T0DA 1JODA 3NO8A 2W39A 4GH4A 2GH8A 1VR3A 5T54A 4YBAA 3TB0A 2C6SA 1QOTA 3S5AA 4EQVA 4LBOA 4PT6A 1V00A 3KLSA 4V2WA 2VMIA 3JXCL 4EWDA 1V6MA 4Y1UA
chains in the Genus database with same CATH topology
1H8TC 3F51A 4LR4A 4NR1A 5D1IA 5T52A 5CB7A 1ULFA 4WM7C 4KU7A 5C4WA 1RUG1 1UD1A 1C5IA 1HRI1 2WNUC 2C0ZA 1F5JA 4GULA 1UCXA 2D6LX 1RGSA 1PK6A 3KT7A 4AFMA 4IV1C 3IPVA 4HSJA 3NV4A 1RUJ2 2EXKA 1MEC3 2ZAAA 5FLHA 2AR6A 2E9QA 2EF6A 1AX2A 2JG9A 2VW1A 4JCYA 4QXKA 1ZRRA 3ZFGA 3AKQA 3VBFC 2A3WA 1OMIA 4NHKA 5J3UA 4Q4Y1 3HN1A 2EALA 2GAUA 3FFZA 1BDIA 3HZIB 1XRUA 1XYPA 3KZ4C 1U12A 3WQ7A 1QH7A 3WW2A 3NV1A 2WSVA 1H8VA 1R093 1OOPB 2BJCA 4HKWA 2E7AA 2AREA 4DFSA 4LBQD 4V1PA 4HPKA 3ZYGA 1X8MA 4LO5B 5HCFA 1GQGA 4AI8A 2PHWA 2IU7A 4GIQA 5BNOC 4COYA 2WJSA 1OQEA 3CLPA 5K8SA 4KWLA 2ZX0A 2LCVA 2XBO1 2CWMA 1KITA 4KQ7A 3WVJA 1AXKA 3GHNA 1W6NA 3H3UA 1POV0 4CP1A 4N7UA 4DZGA 4HN0A 1G9FA 1NYWA 1TMF2 2DUQA 4QT6A 3AK0A 3H5TA 3SHRA 3ZMOA 1GZWB 5LK7B 4YZ4A 4AW7A 1QJX3 5CVRA 1YNAA 4GMP0 2JEMA 1QF3A 1R1A2 2Q5TA 1UMZA 3WG3A 3TN91 1RJ7A 1XXNA 2RS51 4HETA 4P9XA 2CROA 5FO9B 1SFYA 1W6MB 2W08A 2HWC3 2XVLA 2PIJA 5L36A 1N1SA 4XBNA 4QPIC 1S0IA 1XNKA 3IVPA 3D82A 3O7OA 2D3SA 2WLQA 3T2TA 4QPGC 2RS33 1LHVA 3HBZA 2HWF1 2ATFA 1V6JA 2BWAA 3WP3A 4DRRA 4RR3C 1AUYA 1ND3B 1ULEA 3RSJA 1EPWA 1B35C 4YFWA 4W6XA 1CJPA 2HWB1 1VBC3 4AFCA 2PUCA 3B01A 1ZRDA 3AP7A 3S6PA 4IV3C 3VDDA 3WDWA 5GLWA 1ZA4A 2ES3A 2X53S 3ZFEC 2A70A 1FOD2 4CEWB 2VULA 4I8TA 4AI0A 1YXWA 3RJ2X 1S2KA 4YGCA 4I2OA 1OPOA 2QE3A 4Q4V2 2ZGMA 3ZFFA 1WCKA 2B8MA 3T1MA 3FBMA 2H8RA 5IK8A 4YG6A 3D8CA 1R69A 4CDXC 4D7SA 2RS12 3BB6A 1EPZA 4XFIA 1Q5OA 4JGYC 5JIAA 1GLHA 2BFUL 1WD4A 2DUPA 1NXMA 2JXAA 5FPZA 2LM3A 1RHI1 1UKGA 5C8CC 4DMIA 3B02A 3SLIA 3Q9OA 2O0OA 1RUE2 1VRH1 4MV2A 4N90A 2VH9A 4M01A 2GRMA 4TLFA 2XL9A 4YG7B 4W6WA 2VVDA 4W65A 4I3GA 1JUHA 3EJKA 2AUYA 1CIWA 2DTWA 4RHV1 3IKWA 2LYQA 1VALA 4BPZA 2A3YA 1QJY1 2O8OA 2GNTA 3A0KA 5BV6A 1X8EA 5CFCA 3L1PA 2JJ6A 1RUJ3 3EXUA 4EN9B 4CYDA 4XQWA 4G9SB 3B7MA 1C4RA 2GU9A 1JOJA 2WQ4A 3POWA 2NQYA 2VGDA 2P34A 1C1LA 1WW5A 3KZ3A 4Y20A 2JDZA 3X29B 3CROL 1JWLA 4H3WA 3PMSA 3I59A 4YLZA 1COV1 2XJVA 1BXHA 3ILRA 3QH7A 3EBRA 2A7AA 4YZ5A 3DPRA 2IC1A 5F6KA 3WDXA 3SCGA 5JZGA 1LTEA 2ZHLA 3SCFA 1HQLA 2PUFA 3FUQA 4X4HA 4IXLA 1IHMA 1SLAA 4FPGA 1MS1A 1QP7A 3N3HA 1CESA 5EZWA 5DUXA 1EFAA 1YRZA 2X5IC 1TMF3 5I8SA 1FATA 3ZXEA 4TZDA 1NOVA 4HVRA 2WIIB 4GB32 3QH6A 4FPYA 3WHTA 4B7KA 3I54A 4MUVA 2GZWA 1EV11 4PDWB 1R1A3 4K8FA 4Y22A 3V65A 2E7TA 4Q26A 5D8AA 3WDUA 3WDVA 5L7OB 2IXJA 3IM0A 2IXKA 2MNGA 2KZ8A 1SLLA 1LEMA 2RMU2 4X4DA 1MEC1 4FAHA 2XLGA 5K0UA 4XETA 1ADRA 3N7KA 3WR0A 3OMTA 1WH8A 1HV0A 4YG3A 2ZABA 2JE7A 1O4TA 1LU2A 1WMFA 2ZAHA 4XHBA 1AYM1 4L8QA 4AG4A 2BEOA 1DQ1A 1AXZA 5FOJB 1C8NA 3MLKA 5FRAA 1MS8A 5DG1A 2XWJB 3B3QE 1GFF2 1W6PB 1W6OA 3OP9A 2H0BA 1FOD3 2GNDA 3QYXA 5T5JA 1RZSA 1EAH2 1Q8PA 2X8KA 1UAIA 4QQPA 3FC0A 4MGIE 1CAWB 3LB9A 4J6GA 4MXVA 1C5HA 4Q4V3 1NQJA 3O0WA 3FHIB 1IQAA 1OFSA 3PXPA 1JYCA 2MQKA 1GV9A 2MEV3 1QMJA 2RS13 4UW6A 5K7PA 5I8TA 2PYTA 3VKLA 2DCKA 1M4WA 1UU4A 1MZ5A 5BXXA 3VL8A 3MFCA 1OA3A 4LHLA 4P9GA 4YVSA 2ZBJA 1WLDA 2VU9A 4BHPA 1OOPC 1RUE3 5GLUA 1QJX1 4ISQA 1RUG2 4R9CA 2WNVB 3ZHIA 2ICTA 1HRI2 2RHPA 3ENRA 1NCRA 1VBD1 2OFYA 3VZNA 2IFWA 4P9IA 2WT0A 1MR5A 1V6KA 2UWBA 4HLTA 2BBVA 2PQQA 2CY6A 1H4GA 2HWC1 4FO9A 2A5ZA 3M2MA 3W58A 2BTVC 1NA1B 4XPVA 3WG2A 5H9PA 1F9KA 4XF4A 2B9UA 3OD0A 4OHZA 1I5ZA 3NV3A 1VBC1 1F31A 2D3RA 4NVPA 3AMQA 2TNFA 4Q4Y2 1DGRN 4AEDC 1UZYA 1AYN2 1DGLA 1FT9A 2D43A 1YCIA 4Q4W1 2JKBA 1QHDA 1QU0A 2DFCA 4QM8A 1CAUA 3RG0A 3SISA 2D40A 4QQOA 1V6OA 4K1YA 4YZ1A 1H1IA 2G4IA 2QFEA 3R0RA 2BGCA 3PTYA 1S1AA 3D1NI 1ND3C 2TEPA 2E63A 3PHMA 4E2QA 2Q1MA 2Q30A 1QNWA 4W6YA 5T5PA 2XBO2 2CGOA 1RINA 3SH5A 2QDNA 3H1YA 3AXEA 3OGGA 4CEWC 1D2QA 5GM0A 3F6WA 5KHIA 2Y38A 3LA3A 5GJ6A 1ZBA2 1MS0A 4GB33 5JOXA 3TN92 5J37A 2ET1A 5GZFA 4XJUA 1J1LA 3VV1A 1ENQA 2VUAA 1ZNPA 1CAXB 2GDFA 4XJ8A 2D6KA 2IVQA 2A6ZA 1AR81 2BQPA 1LULA 3OTFA 2XJTA 4M00A 2GZUA 5LRSA 3OY8B 1ALYA 1F5FA 5SV8A 4TWTA 4FOQA 4OULA 4AI3A 1O3TA 2HWB2 4PU3C 3V56A 4A7YA 1ZREA 1QJU2 1DQ0A 2E6VA 1YJLA 3AMHA 3CJIC 4WVMB 1G9DA 1BQPA 5GLZA 1H2LA 4LT5A 2ZOEB 4CDWC 3THPA 1HQWA 2VNGA 4XF0A 2A6CA 1HIXA 3DUIA 3TWIA 4QGNA 1H8TB 2L49A 1ULDA 2P17A 2P3IA 3M3IA 4XBQA 3ZYPA 1EAH3 5JDBA 5BNNA 2XWBB 3ZIXA 1PO23 1MS9A 1JTZX 1W0OA 5I93A 1J1TA 4I3PA 3UV9A 1G7YA 2IVBA 3WUDA 4IV1B 1DWKA 2YHJA 4Y1YA 1RUF2 2NPIA 3ELNA 3MIGA 1SBDA 3K48A 2PE5A 2PAMA 1RB8G 4C90A 1TMF1 3O9XA 1WETA 2VG9A 4CEYC 1VAMA 1K5MA 1PGSA 3L9JT 3N36A 4JGZA 3O0XA 3VBFB 5J96B 4B7EA 3CF6E 5FO7B 3FX3A 1RUG3 1XWRA 3NVCA 2A75A 3VBUA 1DZTA 4M3CF 1HRI3 1R1A1 1VAKA 4ASLA 1AR91 1I3HA 2VOXA 1ZZ6A 4R52A 4COZA 5GZGA 3WDTA 2E51A 4XXPA 3N4MA 1QXJA 5IUQA 3GNEA 3BDNA 1UPSA 4WM8C 3FLTA 4BQ1A 1H9WA 4Q4X1 3SMHA 3GBGA 3I2DA 1OD5A 3H3ZA 4FN3A 3JXDL 4WVWA 5BNOB 2ZPXA 2AWIA 3OPZA 4XTMA 3R6SA 4XTPA 4PU7A 2W52A 1KJLA 4XBLA 1LOFA 2I74A 3VKNA 4Q4Y3 5T3NA 5L7OC 4FCAA 3V0AA 4HSLA 3PNAA 2PPXA 1AYN3 1UU5A 5ACA1 2ZX2A 5BNPA 1FOD1 3VUOA 1COV2 1SLTA 3V0BB 1Q8SA 1PRAA 2VOWA 4U2AA 1RPEL 4AEJA 1W6QB 3HT2A 3MF6A 4RGGA 1J3QA 1PZ8A 3VBOA 2EXJA 1QP0A 4AE2A 3KS7A 3TBDA 2MPFA 2RS11 1NY72 3M7AA 1CGPA 2XBO3 4WVZA 1QGLA 4N43C 3V64A 1PRUA 4PBPA 5BPXA 1SQ8A 1S2BA 2WZR1 1ZVFA 1YFUA 1GZCA 1O5UA 5JSRA 2O4AA 1U5YA 4R9BA 3UKNA 1FV3A 1DFQA 3BTAA 2LUWA 1ZBA3 5GZCA 4HVOA 3MW3A 5BUVA 4IV3B 3LISA 4X8NA 3TN93 3AP5A 2QCSB 4NHMA 3NJZA 1JW6A 4HL0A 2D3PA 3AYDA 2RS53 1OLQA 4JTOA 3UJOA 1Z0HA 4CP2A 1AX0A 4Z5CA 3KT4A 3B9CA 2R0FA 3KCXA 3AP9A 5FTTC 4LBLA 2HWF3 3PMEA 1CD3G 1VBE1 1QDCA 1AYM2 3ZFGB 4K9SA 2ETEA 4BZ4A 4ZKTB 4X4EA 2HWB3 1VJ2A 4RS5C 4ZU7A 3ALQA 2IFRA 4ITCA 4EN6B 1CJDA 2YMZA 4QMAA 4XJAA 2LYLA 4A2UA 4JDMA 1NA1C 3RNSA 5A3MA 1REEA 1DGRA 4H55A 4XF1A 4FVVA 1IS6A 2Y0OA 1CONA 2NLRA 3AYCA 2GC3A 1LOEA 4ZU5A 1WW4A 4YW5A 2W0XA 1O7FA 3VBRA 3AZYA 2PA7A 4RGAA 4XF3A 4R4XA 2NMNA 2WT1A 5IK4A 2PAEA 3J8F2 5DDJ1 1VPWA 1VB2A 2ZHKA 1PMIA 1BK1A 3MLJA 4LBMA 4GB31 3ZKCA 2EAKA 4RQPA 1VBD2 1Z7S1 3ZSLA 5JI9A 5A33A 3WG1A 3U4XA 2DURA 2VW0A 3RRDA 5CFDA 3VN4A 2FBEA 2KEIA 1ZAYA 1LHOA 4NN0A 2FZ2A 3VZLA 2WFPA 1V6NA 2RMU1 3ZSMA 4MGKE 1XU1A 4JAAA 3EO6A 5C8WA 3M3CA 2PHLA 2IZWA 4E27A 1LESA 2D5HA 3NKTA 2ZGTA 1NCQB 2V09A 3OYWA 3MGUA 2HEYF 4LNVA 3WP6A 3TAYA 4EN7B 1EP0A 1LMB3 4Q4W2 3TOJA 3SXWA 1A78A 3QOPA 3RS6A 4YGEA 2X5IB 1IPJA 2A6XA 1AJOA 2NN8A 1COV3 1ND2C 1NG0A 1EAH1 5CG9A 5FLJA 4WZFA 5EXOA 2DV9A 2FQPA 4HK9A 4FSJA 3GZUC 1RMU1 4PU8A 1LODA 5KC6A 4Q0VA 2YYOA 4JRAA 2IXCA 1NE6A 1SQ4A 3KMHA 4YZ3A 2H6BA 4GKYA 4AI1A 4IERA 2MHFA 4MGZE 3RI9A 3I4IA 2DU1A 2YPJA 2R061 2D6NA 5K9YA 3RYRA 4WBBA 4FP2A 2HJIA 4WVVA 4XJ9A 2QVSB