4J1XA

Crystal structure of fe(ii)-hppe with alternative substrate (s)-1-hpp
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
193
structure length
193
Chain Sequence
TASTGFAELLKDRREQVKMDHAALASLLGETPETVAAWENGEGGELTLTQLGRIAHVLGTSIGALTPPAGNDLDDGVIIQMPDERPILKGVRDNVDYYVYNCLVRTKRAPSLVPLVVDVLTDNPDDAKFNSGHAGNEFLFVLEGEIHMKWGDKENPKEALLPTGASMFVEEHVPHAFTAAKGTGSAKLIAVNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanistic studies of an unprecedented enzyme-catalysed 1,2-phosphono-migration reaction.
pubmed doi rcsb
source organism Streptomyces wedmorensis
molecule tags Metal binding protein
molecule keywords Epoxidase
total genus 48
structure length 193
sequence length 193
chains with identical sequence B, C
ec nomenclature ec 1.11.1.23: (S)-2-hydroxypropylphosphonic acid epoxidase.
pdb deposition date 2013-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 4j1xA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4j1xA02
5LEKA 4PU3C 4I3PA 1ZREA 4AQ6A 1ZX5A 4YYOA 1RZRA 2GC1A 4IEPA 1PERL 4I6TA 3IBMA 4XFCA 4EROA 2MPFA 1NEQA 3OF1A 2LYLA 1Q5OA 2E9QA 4IA8A 1UW8A 2KZ8A 4X4DA 2PE5A 4XFBA 2FJRA 3B02A 3FJSA 4UBHA 3MPBA 4Z5DA 2H0VA 1IC8A 4IEYA 4IEWA 2WIUB 4YBAA 3ZHMA 2Z69A 3H50A 4OFGA 3ROUA 1X2LA 2H6BA 3NJZA 1CAUB 1NXMA 3S7IA 4BIFA 2AUWA 1QWRA 1QP4A 2L49A 2AW6A 4YG1A 3H5TA 2ETEA 3ACLA 2XLAA 3H7JA 4O9EA 3SXWA 2IVGA 1X82A 1YLLA 3BD1A 4X6QB 4KL1A 1G6NA 2O1QA 4JVAA 4YRDA 1H1IA 5HI0A 1J3PA 3HIFA 2PUCA 2D40A 1J3RA 2CROA 5E16A 4JCXA 2XI8A 3DNVB 4JCYA 4QM9A 5E1RA 4N9HA 3H1MA 1OD5A 3RYRA 1OSLA 4L2NA 2XJ3A 3JXDL 4IEQA 3N4MA 4JTNA 2PPXA 4DINB 1O3RA 4Z58A 1J58A 1S7EA 2B5HA 2XLGA 3FYAA 2EAAA 3C3VA 3FX3A 4KWKA 1NE4A 3L1PA 1CGPA 3JZVA 2ZKLA 3LOIA 2OYZA 1WLTA 4KWLA 5JSOA 3OP9A 3O9XA 1WH8A 5JAXA 4JQDA 2AWIA 3PNAA 2QJVA 4MGIE 1BDIA 3I7DA 4D7TA 4MGYE 1X7NA 1ZRFA 4FBIA 5AVPA 1ZRDA 4I2OA 4EWAA 2UY8A 3EUSA 1JUHA 2OZJA 4I6RA 2LYPA 1Y9QA 3E6BA 1RUOA 3H7YA 1X8MA 2GC0A 4WVZA 1LMB3 3S0MA 1RTVA 1PM7A 3OQOA 3BALA 4AVCA 4Q0QA 4PIYA 5KBFA 2PUEA 4QX5A 4LA2A 1XE8A 4R52A 3USSA 3KMHA 4F8AA 2GRLA 3U0ZA 3VK0A 1RIOA 3I54A 3CECA 1RGSA 3WW1A 3G5GA 2PFWA 3RYPA 5I0SA 5JSPA 4XFIA 2PAMA 4E2QA 1O5UA 2D5HA 2PQQA 4HN0A 2XSDC 4KU7A 1FT9A 1YFUA 2D5VA 3IDBB 1I5ZA 1Q3EA 4FT8A 3UKVA 3PXPA 3D82A 3EHKA 5KHIA 2CGPA 4X4IA 4QMAA 2EF8A 4FAHA 4XF4A 2PHDA 3JXCL 1VP6A 2EBYA 2XL9A 3BPZA 2PAEA 3CROL 3RDIA 3ZHIA 2EVXA 5FLHA 3CLPA 3WW4A 2XLFA 3DV8A 5BY5A 3MZHA 1OMIA 4X4EA 1H1MA 1HW5A 3E5UA 1J1LA 1O4TA 1L3JA 2I45A 3M70A 4WZCA 3H3UA 4XFGA 2XGXA 2IUOA 4LA3A 4MX3A 5BUVA 1ZRRA 4PU8A 3OMTA 2PUBA 2XKPA 3UFDA 3KCCA 4Q0SA 5I0RA 3E5QA 2LYKA 2HINA 3MLFA 3GYDA 4A2UA 4BHPA 2R1JL 2ET7A 1LKNA 4IETA 3GN5A 4Q0UA 4QM8A 3RYKA 3S7EA 1QQAA 3I59B 1DZTA 3D0JA 1R69A 2MHFA 3EBRA 1Y3TA 3L2HA 2WUSR 3CJXA 5BPXA 3BS3A 4Z5CA 2GC3A 4IVZA 3LA2A 4MV2A 4Y42A 4MZUA 5LRRA 3E5XA 4UXAA 3NKTA 4FBFA 2BNMA 2IXCA 2PA7A 3BB6A 1PNRA 1RPEL 2EA7A 4QGLA 4HVOA 3D0SA 2XKOA 3KGLA 1UD1A 1R63A 4P9GA 1OCTC 3RZZA 2C0ZA 1YSEA 2KPJA 3ES1A 1YFXA 4PU7A 3O14A 3R1FA 2CAUA 4IEXA 4AVAA 5J48A 1FXZA 2GRMA 2F4PA 2JVLA 2OR1L 5BXXA 4GHJA 2GAUA 2QCSB 2PHLA 1OI6A 1XRUA 2A6CA 1J3QA 2IC1A 5JCTA 1XWRA 4KU8A 1WGPA 5BV6A 1O3TA 3QYXA 1EFAA 3QACA 1WH6A 3D1NI 3SMHA 1UTXA 1V70A 4RD7A 3FMYA 3UKNA 3OGJA 2WFPA 1ZZ8A 5A7LA 2O4AA 2PUFA 2N7GA 5JSRA 3FE5A 3KXAA 5KHJA 2MQKA 4XFFA 4X4BA 1O4XA 5K98B 4ONUA 4PIZA 4ZU5A 3TNPB 5LRSA 1AU7A 3OQMA 3OD0A 2IVBA 4LUMA 1JH9A 2GH2A 3FFQA 3H1WA 3NVCA 2CAVA 1RZSA 3QF3A 4N9IA 1J59A 1PMIA 2PUGA 2HKXA 3ES4A 4HSLA 4XF1A 3ZDSA 1UIKA 2FQPA 1PRUA 2O38A 5CADA 3LAGA 5FQ0A 2LCVA 1SFNA 4LUKA 3MDPA 2XHKA 4E2SA 4Z07A 4IEUA 4L11A 3NL1A 1SQ4A 2VQAA 1QXJA 3S8QA 5I91A 2QNKA 3U3WA 1JFTA 2Z2SB 5T3NA 2HJIA 2KXLA 4I0AA 4NVPA 1GQHA 3BDNA 1YWKA 2OA2A 2D93A 1NE6A 1UXCA 3E6DA 3EO6A 4LEJA 1UPIA 1SEFA 1RUNA 4HSJA 3FHIB 4AXOA 4F7ZA 3IDCB 4Q0PA 3E97A 2IXJA 2IXIA 1CAWA 1EP0A 4D7SA 2JCGA 3EJKA 1EPZA 2D5FA 1RL3A 4E2GA 1QXRA 1EYBA 2GZUA 2Y0OA 4META 1B0NA 3E6CC 2GU9A 5FPZA 3SCFA 4WBBA 5D1IA 1ZVVA 3KZ3A 2FMYA 3SCGA 1RZRD 4NDWA 3ETQA 4HBNA 5CVRA 2PAKA 1JFSA 2IXKA 3DKWA 3PVBB 2IXHA 3EQEA 4YARA 5F1RA 5LEJA 3QWGA 1HF0A 4IEOA 3DL3A 4I09A 2XCJA 2XL7A 4XFHA 2Q30A 4B29A 5I0TA 3CLCA 1CQTA 3CL1A 3H9AA 5JR7B 4GULA 5C8WA 4OB4A 2ICTA 4QGMA 1CAWB 5KHHA 2ZCWA 5C6CA 2QVSB 5CU1A 3NW4A 1ZUGA 2BJCA 1FI2A 2PYTA 4XF0A 3WW2A 4X4GA 4EWDA 1UIJA 4IESA 3TNQA 4XF3A 2QDRA 4HVQA 1SQ8A 5FLJA 4GQMA 1ZS4A 1NERA 4Z5HA 1LR5A 1Y7YA 1DGRA 3KSCA 1PRAA 2GC2A 2PUDA 1IPKA 3CO2A 1BDHA 3ST7A 4LULA 5I8YA 4QGNA 3ELNA 3H8UA 5FCCA 3LA7A 2UYAA 3IIAA 2H6CA 1QP0A 2O49A 4YNIA 5FLIA 5FQ0B 2OFYA 4I6UA 5K8SA 2O8QA 3SCHA 1CJGA 1LCDA 3RPQA 1LCCA 4X4HA 4IEVA 1GQGA 3BU7A 4JV4A 4FAGA 1L1MA 4R8HA 1ZVFA 4XEZA 2MEZA 4MUVA 3LISA 3ZKCA 2OZ6A 3WW3A 2BEOA 3GBFA 1WIZA 4PIXA 2BNOA 3SHRA 2LYQA 4O9GA 2ET1A 5FDBA 1CX4A 4ZU4A 3JXBC 4CYDA 3LZZA 2K0GA 5I0UA 1ZNPA 1O3QA 1WA4A 4PJYA 2KEIA 3F52A 1ADRA 1CAUA 2CV6A 4HN1A 4HVRA 2AXZA 4I02A 2K9ZA 2WC2A 1VJ2A 5J7MA 2BYVE 4TLFA 2BNNA 3MYXA 3B7HA 2Q1ZB 3KJXA 1ZZCA 4PU4C 2IV1A 1OFNA 3LA3A 4Z82A 4HLTA 4ORFA 2BGCA 1EY2A 2KEKA 3G7DA 4X6RB 1YFYA 4ZU7A 5I93A 2PIJA 1QQBA 1Q43A 1I6XA 1CAVB 3FWEA 3M3IA 4YSFA 5KHGA 4HMZA 2KEJA 1CAXA 4MCXA 2V09A 3I59A 3IWZA 3GN5B 1X57A 4LTAA 1GT0C 3IVPA 4MGKE 4BH9A 1LRHA 3F6WA 2AXVA 4I8TA 3FZ3A 4QXKA 4F8DA 4K8FA 2AXUA 1CAVA 2P17A 1DW9A 4YG7B 1CAXB 3HT1A 1RC6A 4Q0VA 1O3SA 2EWTA 2VECA 1PRVA 3KGZA 5FPXA 1LQCA 2B5AA 2LYRA 1LB2A 2LYSA 4X4CA 1JWLA 2UY9A 4XETA 1O7FA 2GZWA 4Q29A 4IWRA 2B8MA 1POUA 3HT2A 1DZRA 4AQ2A 4HZFA 4I01A 1UXDA 4MH0E 3CF6E 4BYYA 4Z59A 2H8RA 1VPWA 3U10A 4LLOA 1YUDA 4XF9A 1XE7A 3F51A 2ICPA 2L8NA 3FYMA 3VHRA 4AVBA 2PUAA 1ZZ9A 2HSGA 3NSTA 2LYJA 5I8TA 1DWKA 3RNSA 4IEZA 4O8BA 3PLQA 4EWEA 4JTOA 3LWCA 3OCPA 2VPVA 4H7LA 1E3OC 1ZZ6A 4MCTA 2ATFA 4X4FA 1U12A 5EZWA 5I8SA 2UYBA 1NZCA 3UKTA 4I0BA 5KHKA 1ZZBA 1WETA 3OQNA 2B9UA 3R6SA 4OLLA 2CSFA 1TQ5A 3LFPA 4FN3A 2Q4SA 2PTMA 3OTFA 4J1WA 4IERA 4YG4A 3HQXA 1ZAYA 2XIUA 3CEWA 2OPKA 4J1XA 1UCXA 1YHFA 2MNGA 3QOPA 1QPZA 5J3UA 1LLIA 4KWJA 2R63A 3HZIB 2IU7A 1YFWA 5EFUA 1QP7A 1NYWA 1DGWA 2IVQA 4UBGA 3H1YA 4MGZE 1ZPQA 2DCTA 1QY4A 2Q0AA 3H3ZA 3TRBA 2IXLA 1X8EA 3BCWA 1O5LA 1ZZ7A 4EV0A 4XFAA 3QQ6A 1ZRCA 3U11A 1VR3A 1IPJA 3DN7A
chains in the Genus database with same CATH superfamily
2RDNA 1L7LA 4QX3A 3PU3A 5GALA 4AQ6A 1S55A 3OOXA 2ZMLA 2NLRA 2Y60A 4I6TA 3IBMA 4QQLA 4TYSA 5A32A 5T52A 1DG6A 3QH7A 2A71A 1LTEA 3VZNA 1UMZA 5FY0A 5JXIA 4AEJA 4Z5DA 3TEPA 3KV4A 3OUIA 2WO3A 2WN2A 3KV5A 5F37A 5IVBA 2WIUB 3ZHMA 1WMEA 3HNBM 5IVFA 1X2LA 4R9CA 2IZWA 4WM8A 1ENXA 3A7QA 1BLZA 2VZ3A 1NXMA 3NJZA 3S7IA 4BIFA 1WW7A 5EPAA 3MF6A 2AUWA 3THDA 4YM2A 1QGLA 1XU2A 2ETEA 3P3PA 5FMOS 4PI2A 2C9KA 4Q4V1 5DG2A 5C3OA 1MS8A 4Q4X3 1JH5A 2JICA 2WYSA 4YRDA 1YNAA 1H1IA 2JB4A 1J3PA 1F31A 1G9AA 4I30A 4OUSA 1QKQA 1K5MB 2D40A 3QFIA 5E16A 4F3JA 4MHRA 2JE9A 4YGDA 4COZA 1OPOA 2HH9A 3OKZA 2TBVA 3GJBA 1JZ3A 2ZZQA 5DRTA 3C7EA 4N9HA 5EWSA 4BDVB 5FY5A 5F32A 2W92A 1FX5A 3JXDL 4IEQA 3N4MA 4JTNA 4PT6A 1S0IA 3I2GA 3V65A 1O3RA 1J58A 1H30A 5JUWA 2XLGA 3FYAA 2EAAA 4YVWA 5DUVA 5B2GB 2WZR1 4KWKA 4Y26A 4XIKA 1KS4A 1CGPA 3LOIA 4JGZC 4PLNA 4KWLA 1GZTA 4LBQD 4IV3B 2JECA 1DQ2A 4QDRA 4CPBD 5CEHA 5JSOA 3VDAA 2QQIA 4M0HA 3BKZA 1NUKA 3IMNA 5JOXA 2Y33A 5C9AA 1RUF3 4TSVA 4ZZ5A 1JYVA 1ZRFA 1NCQA 4I2OA 2ZEXA 3EUSA 4A4AA 4JC1A 1OA3A 2QBXA 2X8KA 2UWBA 4H7MA 4RS5B 4JDNA 4YW4A 1G9FA 1BBT2 2H0BA 4ER6A 2RG4A 5FYMA 3E6BA 2VZTA 2GC0A 4OI0A 1PMHX 1LMB3 3VZMA 1Z78A 4A41A 2TEPA 4LR4A 1RTVA 3BTZA 2XBO2 2VNGA 2PXDA 3BALA 3WP5A 4QB1A 4Q0QA 1D4M2 4Y1XA 5A7QA 4EN9B 2PUEA 3JBG2 1AR72 1XE8A 2Q5TA 4LO8A 2HEWF 5C7GA 1RIRA 2GRLA 1RGSA 2OPWA 4ZS2A 1RUC3 3RYPA 4A7KA 4ISQA 4K40A 2BFUS 4XHBA 3WEZA 4AZZA 1NLSA 2PAMA 2VTFA 3AP6A 1RUE3 3NV3A 3SQOA 4E2QA 3FHQA 1ULGA 1AJOA 1K5MC 1QOOA 3PUHA 4HN0A 3WR0A 3WNMA 3FFZA 1VBB3 1RUI3 4KU7A 1MVQA 1PGW1 3THCA 2WN3A 4DRRA 3LD8A 3IPVB 1DGWX 1SLIA 1VBA3 2WIIB 4GWNA 2CGPA 4QMAA 4XMIA 1LJ7A 2PHDA 4KBZA 4UAPA 2X10A 5T5LA 5D8AB 2Y6KA 5FIXA 1W9YA 3K4AA 3CROL 3WW4A 3ZHIA 2BUKA 2WO1A 2XLFA 3CLPA 5IK5A 4OULA 3VZLA 1HW5A 1AR63 1REEA 2RJLA 2ZABA 1AX2A 3FBYA 3IPVA 1L3JA 2I45A 5FXWA 4OBMA 1VBD1 4Y24A 3WNXA 4Y5SA 2XGXA 1W90A 1HN1A 1OH3A 4LA3A 4MX3A 1POQA 1AR91 4SLIA 1ODMA 3A9ZA 2PUBA 3MLLA 4OUEA 2Q8DA 2Y8KA 2G4IA 3IM0A 1GV9A 2VUAA 3VWSA 4Y5Z0 5EYYA 2VL4A 2HINA 2QUOA 3W59A 4XE9A 3RI8A 4NAOA 2DDUA 4RL7A 1PVC2 2A5ZA 5F5AA 3WSOA 5EP9A 1WCKA 3I59B 1OF3A 3PHMA 5C8CA 4PLMA 1RJ8A 4S2FA 5GLVA 3EBRA 1GNYA 3UJQA 1I9RA 3L2HA 4R9AA 4Y20A 3BS3A 3SITA 1RUH1 4Z5CA 1SDDB 1AR82 2WFF3 2YMZA 4IVZA 1FNYA 4CU7A 5DTQA 4RR3A 2B7YA 2D6KA 1JTZX 3OGVA 2VMIA 3AZYA 2AC1A 1UY0A 5BNNB 4FBFA 3VV1A 4XXAA 1RHI1 1PHMA 2D6MA 4EZHA 4GB33 3ZMNA 1MEC3 5LBFA 2Y0IA 1JZ5A 4ES9A 4QX0A 5H9QA 4QGLA 4EN8B 4YZ2A 1OQDA 5IK7A 3WCRA 1ACCA 2JDMA 3GJAA 4XTPA 2GNMA 1UD1A 4BQ5A 4CVUA 1XYOA 1DQ5A 1VBB1 1QHDA 1OCTC 4FP2A 4QKFA 1HN0A 4D6SA 1HRV3 4LMFA 4NOTA 5GJ6A 4PU7A 3O14A 4YVWC 2WJSA 1DULA 1RUJ3 1RUC1 1N1VA 2EIGA 5J48A 2GRMA 5CA6A 2F4PA 2W2IA 4GH4C 2CL2A 2OR1L 2GAUA 2QCSB 1KD7A 1S0GA 4FXGB 2BVVA 5DUWA 1PX3A 4CCCA 2A6CA 1J3QA 1H4GA 2W94A 5JCTA 3W5NA 4MXVA 5IATA 3GM8A 3QYXA 4X8PA 1NAEA 1WH6A 5A6QA 1UTXA 2FFHA 4RD7A 4AEDB 3THPA 4N90A 2P3JA 3OGJA 4YZ1A 1S0CA 4URTA 3AX4A 2XB6C 1CJPA 3JU9A 2PUFA 5AVAA 1UOGA 3FE5A 3KXAA 5A6XA 3GXUA 4BMEA 1LEMA 2KM2A 1U0AA 1O4XA 1QJZA 1HIXA 4ZU5A 1N3OA 3PVOA 1AU7A 3OQMA 1PK6C 4DZGA 2WWUA 1JHJA 3UYJA 1JH9A 2GH2A 2RS32 2ZEWA 3H1WA 2XJQA 3E1F1 3N9LA 4GMP3 5FY9A 1RZSA 1XNBA 1J59A 1X50A 1PMIA 2WO2A 1POV3 4NHYA 4Q4W3 4YW3A 2QE3A 2J7UA 3IAPA 1UIKA 3ENRA 3P3NA 3ZDSA 4RGGA 2WO7A 2BQPA 5A3TA 4DFSA 1D0HA 4Z07A 4L11A 4AI3A 4R9BA 1W06A 1OOPC 3AVRA 1G86A 2D3PA 2QNKA 1W8OA 2LALA 3O1MA 4AW7A 4QB6A 1JFTA 4FO9A 5T3NA 1PIV1 4HT1T 1NE6A 1CESA 2XJVA 5FV3A 2VMDA 3ZYJB 4AGGA 3N7MA 1RVF1 1NCRA 2W87A 1XU1A 1Y43B 4GWJA 3KVAA 4GJZA 1DGLA 4Q0PA 4Q5OA 3MPPG 1T6BX 3RI9A 2NP0A 1CPMA 2HBTA 2JG8A 1CAWA 1PK6A 4D7SA 4XACA 1EPZA 1IG3A 2D5FA 3CJIC 2JEMA 4AEKA 1EYBA 1FYUA 3HBKA 2GZUA 1B0NA 3E6CC 2PXEA 4DE8A 4FPLA 4CEYA 4DUWA 1LOFA 3SCFA 5D1IA 2X05A 3K3OA 3DF0A 1ODNA 1ZVVA 3M2MA 3SCGA 3ETQA 2ZGUA 4HBNA 1LESA 2VOXA 3WD5A 2WSUA 3WQ1A 4FOQA 2PAKA 1LOEA 3SISA 3NAPA 3GALA 1Z7S1 2VW2A 4YARA 5F1RA 3RVHA 3N9NA 4IEOA 4I09A 4XZPA 1NCQC 2LW8A 4CCLA 2VY0A 4K1ZA 2DVAA 1APNA 4ZXKA 1QQP2 3TELA 1Z7S2 1CQTA 4YW1A 3HVDA 3H9AA 4GULA 4J25A 5C6CA 5L9VA 2V4VA 1ZUGA 1QJEA 1FI2A 2PYTA 1C1FA 1KXGA 2JIJA 3APBA 1GP6A 1O6UA 2QQVA 4AEDA 1AF9A 1HX6A 3VLBB 2QDNA 3MUZ1 4CRQA 1PGL2 4GQMA 1ZS4A 4Z5HA 2ZGPA 1ULPA 4XW3A 2LM3A 2PXKA 1W9FA 3PTRB 3ZPOA 1KQRA 1IPKA 5A6YA 5T5OA 3TYJA 1BDHA 3GF6A 4M01A 4LULA 4NR1A 3WDTA 4KBBA 4ARYA 5DTMA 1AYN3 2CNAA 2ZHNA 4AI9A 4QU1A 1IS5A 5D8AA 2O49A 4E4SA 2G9GA 3BTXA 4D69A 1YYNA 4I6UA 1QJU1 1ULFA 2O8QA 5BNOB 3BIWE 3ACHA 3SCHA 4DE9A 1PO22 5F5CA 4PLOA 4QT6A 3AKQA 3GNEA 1CJGA 1QJU2 5M0TA 2W1UA 3O1UA 4X4HA 1GQGA 1OFSA 4A42A 3AP9A 3GUUA 1TME3 1O91A 5F39A 2PXPA 2MEZA 1PM4A 3A4UA 5FBZA 1FPN3 5BNOA 2JDHA 1UKGA 5DAWA 3VKLA 4AEMA 3LB9A 4CDUA 2ZHMA 4DXSA 3GBFA 5FZFA 2OUHA 2V5DA 4PIXA 4TZDA 1EAH2 2JENA 2VH9A 4IE6A 1PVXA 1ZYBA 2E33A 5JZGC 2KD7A 1W2AX 1EV13 1W3VA 1CX4A 2ZGLA 3UESA 1OHFA 4AFDA 1DGRN 3PL0A 1WA4A 4PJYA 2DCZA 3F52A 3VL8A 1Y9MA 1QDOA 2VOTA 1XYNA 2Z79A 3BYWA 3WQBA 4CDUC 2AXZA 2WC2A 5DPNA 2A73B 3ACGA 1GOHA 2BYVE 5FXVA 2XXZA 3RJ2X 4UFLA 4LO6B 2VXJA 4NAMA 3WDYA 4QXCA 4RHV3 3VBRB 3FN9A 4UI9L 5FKBA 1ULCA 5FRAA 4HLTA 2XJPA 4CZSA 1G8WA 4JGYC 3ZM8A 3HD8B 1XNAA 4CCJA 1EPWA 4QHBA 2PIJA 2D43A 1QQBA 3ORJA 1CAVB 4FQ4A 2WNVA 3K4DA 2Q8CA 1JYTA 2ZJCA 4Y33A 3GN5B 4LTAA 1XC6A 1YIPA 3PJQA 1WA6X 2RJKA 5E6HA 1JODA 3IVPA 3M3EA 3F6WA 3FZ3A 4I3GA 4QXKA 2ZMKA 3THTA 4QPGB 1DF0A 2AXUA 1DW9A 2Y6JA 1DDLA 2RR12 2WT0A 2ZX3A 4Q0VA 4ZHNA 1UZWA 2VECA 2HWC1 4GD4A 3O1SA 2FDHA 5DUUA 3N9MA 3IAQA 2LYRA 4YG6A 3VKNA 1LB2A 2FBEA 4XMAA 4IWRA 1POUA 2DTWA 4YGCA 3ZYBA 1DZRA 4AQ2A 5CG8A 4BYYA 3NAPC 4CEWB 1BEV1 1SCSA 4WVVA 1VPWA 5FZLA 4X8NA 1NW3A 1KEXA 2RS31 3F51A 1OF4A 4NUBA 4XAAA 1M06G 4C1WA 1F15A 3FLRA 3VDDB 2Y38A 1ZZ9A 1LHWA 2XJTA 2HSGA 2VBDA 2LYJA 2CY6A 3NSTA 3I97A 3NWKA 1AR92 1UO9A 2KA3A 4IEZA 4EWEA 2NMOA 1U2ZA 3J4UH 5FZ8A 4H7LA 1ZZ6A 2BVBA 4I0BA 5DMYA 2VG9A 2BU9A 3AZXA 2B9UA 2HWF3 3R6SA 5ACA3 3ZYRA 1YJKA 4BQYA 1D4M1 4LOTA 3ZMOA 3LFPA 2E7QA 3ZXAC 3OTFA 5IFTA 2PTMA 3LE0A 4OI2A 1KFUL 2OXBA 3LIGA 1XNDA 3ZN6A 4XYXA 4JZRA 5LWBA 1CIWA 3HQXA 4A7ZA 1HRI1 1QJX1 1G9DA 1HJGA 3U07A 1YHFA 1OOPA 2MNGA 3HWJA 4YLZA 3ZFFA 5A1AA 4YW6A 2TNFA 4LE4A 1DQ4A 1UYXA 2RS11 1ZBA1 1QPZA 1IS4A 3AKPA 5H9RA 5J3UA 3U4SA 3A9XA 1YRZA 2YU1A 1X9PA 3HAGA 4PBPA 4P9LA 2Y26A 4Y4RA 3WF4A 5KXBA 1H9PA 4JRAA 2XWJB 1W99A 4QXBA 5EJ3A 1PMJX 4NWWA 1NYWA 4UBGA 3L9JT 5BYNA 1WW6A 2DCTA 4MGQA 3ILFA 1R081 3JQXA 4CP1A 1X8EA 4WM8C 1JN2P 2DFCA 3WNKA 2Y6HA 2ID4A 2WNOA 4LBLA 4NHMA 1VAMA 1LODA 4AG4A 1H1AA 4EE2A 5FZ9A 5LK7B 2FDKA 1OQ1A 3KD4A 3NDBB 3PIGA 2WA3A 4PDWB 4U2AA 2ZHKA 5FZOB 1MS5A 4A7YA 1XYPA 1GANA 3KZ4C 4CXWA 2W1QA 3RZZA 3DN7A 5C3QA 4XBLA 1UXXX 4O7XA 2Y6LA 3W58A 4I3PA 4C1XA 2BOIA 1ZREA 1N1YA 1UNBA 1ZX5A 2VBBA 1CR7A 1E57A 4IEPA 2VULA 1LOCA 2W91A 3P6BA 3OGSA 4XJ8A 4EROA 1MFQC 2MPFA 2PQSA 1NEQA 3TN93 4AE2A 4QXHA 2LYLA 2F4LA 5FUNA 2C1FA 3O0WA 4GKXA 3LEIA 4D0QA 2PE5A 4IV3A 2FJRA 3FJSA 2LNMA 3NV4A 3MGUA 3LCPA 1HRV1 3OPWA 3MPBA 4KGQA 4A3ZA 5L73A 5AFBA 5D2AA 4Q1RA 3RZLA 3ROUA 3WINE 3KT7A 2H6BA 1XOYA 4HANA 4W4ZA 5FPLA 4NIIA 3I2FA 2AW6A 3AXDA 3H5TA 3ACLA 1W6PB 2J1RA 2Y64A 3AJYA 2IVGA 4O9EA 5FPBA 4FFGA 3SXWA 3ZSJA 4AAPA 4BXFA 5ACA2 1R1A3 4X6QB 4W6XA 4CDXA 2BZDA 2K46A 4JDOA 3O0XA 5I8TA 4XXPA 3KV9A 5HI0A 2R1DA 1ASJ3 3CKHA 4YPJA 1GZ9A 2CWMA 2WS93 3VUOA 2PUCA 3ILRA 3C7GA 5CYYA 5FO7B 4ZS3A 1W2TA 5L9BA 3RJRA 1AJKA 3FMGA 3ZSEA 3PDQA 1NOVA 4XC9A 4QPGA 4AWDA 1W2UA 4QM9A 1VIWB 4FVVA 5C5TA 2EICA 3WNPA 3BODA 1OD5A 3O5SA 4FOYA 4LBNA 2XJ3A 3MEJA 3ZVXA 4XJAA 2XVGA 1AYM3 5IT6A 1POV1 4MADA 2PPXA 2O14A 3LPFA 4LLFA 4Z58A 5B4NA 1S7EA 1MS9A 2B5HA 5FZDA 2GNBA 1GYKA 1FMD1 3HOBA 3C3VA 5A80A 3WZ1A 3L1PA 1TZOA 3S5QA 2ZKLA 2PXFA 2LROA 1MEC2 1BXHA 1FATA 3K77A 3NV1A 2VR4A 2R062 4Z2WA 4CDWB 2CGOA 3VBOA 2QJVA 4RR3C 3OG2A 4TLGA 3T30A 4E9KA 1U5IA 1BDIA 1XE0A 3I7DA 2DVFA 3BTAA 4LBKA 1X7NA 3LQCA 3SH3A 5CFCA 5IUQA 4FBIA 1FAYA 2XVLA 4TXWA 4Y1VA 2JD4A 4AFAA 1NY71 4XJUA 3LFMA 5BY5A 4JRLA 3I2HA 5C70A 2YBKA 3D3AA 2LYPA 1Y9QA 4O65A 5C8CC 2HWE1 1W28A 1Y9GA 2YPJA 2FMDA 2AH2A 2HWB2 1T6GC 1X8MA 3H7YA 3K3NA 3ZXJA 1MEC1 1VBC3 1PM7A 4AFMA 1WBLA 4P9XA 3OQOA 4PCRA 5FZ4A 4BXSV 4AVCA 3T0DA 2PXUA 1XNTA 4MO3M 5JI9A 1YIFA 3BOPA 4QX5A 2X5IC 3IDEA 1F4HA 3HMYA 4PDWC 2WWJA 4CEYB 1SPPB 5HCHA 4WM7B 3VK0A 3I54A 4YW5A 5SV8A 1W8ZA 3CECA 1CQ9A 2ARAA 5CKNA 2AGSA 1JOBA 3LGRA 1HKDA 3B5LB 3WW1A 5I0SA 2WKKA 1AUYA 4FFHA 4LBOA 5GLTA 5CB7A 3P1IA 2E63A 4G3YC 5IAVA 1PZ8A 2D5HA 3CDZB 2PQQA 1ULEA 1HQWA 1IKPA 1Q8VA 3AVSA 3DKQA 3I8TA 3INAA 1CIYA 1RYYA 2VQTA 2DVDA 1YFUA 5CFDC 1UY2A 2GP5A 3N7KA 4OMCA 5FY4A 1UX7A 3EHKA 3LQXA 2JDUA 3PUQA 3GGLA 4FAHA 4XF4A 2OUJA 5ACA1 1K5MA 4Q4W1 4LIVA 3WF2A 1FPN2 2JD9A 1DBNA 3FBMA 5IAXA 5FP4A 3BPZA 4NHXA 5G04L 1VAKA 2RM21 4S2HA 5FLHA 2A6VA 3MZHA 1R1A1 1XJAA 1OMIA 4QU2A 4X4EA 4Z2AA 3E5UA 2NM1A 1J1LA 1O4TA 4WZCA 5DAQA 3ITQA 3NKGA 4GXLA 2WLQA 1W9WA 3CJIB 4OUMA 2IUOA 1AR73 1PO12 5BUVA 2RS33 4PU8A 4NIDA 1Z0HA 3B01A 2M4HA 3IN9A 3OGRA 5GZEA 3HR9A 3KCCA 4Q0SA 2W1SA 1AYN2 4EN0A 3E5QA 3H8RA 3TBDA 4FSJA 3JCIA 1TEIA 1LKNA 4Q0UA 4C91A 4HKWA 2JG9B 4LNVA 3D0JA 3NNLA 3T08A 3MUY1 3NJYA 3O0VA 2IUWA 2MHFA 1O8PA 1RINA 3AJZA 3CJXA 5BPXA 4NPRA 4C0BA 3ZIWA 1RUF2 3LA2A 1YI9A 2Y6GA 4MV2A 4CEYC 4MZUA 5F3IA 2E53A 3E5XA 4UXAA 4UYBA 4CXYA 3NKTA 2ARXA 2WQZC 2BNMA 3T4HB 3TB0A 1YQ5A 1QQP3 1GZCA 2PA7A 3BB6A 3O1RA 2E6VA 2LRPA 5F9TA 3LF7A 1MACA 1H6YA 1S2BA 1MS3A 3LFIA 4IW3A 5KXDA 1GFF2 3KF5A 3WP4A 5C9AB 4FTBA 5A3OA 5DAXA 2XJUA 1ND3A 2VZVA 4P9GA 3PVEA 2ZXQA 2RMU2 4JHZA 1WD4A 1FOD1 2KPJA 4QX7A 4DO0A 3QH6A 2OIIA 4ITCA 1OA4A 4HKOA 4GMP0 4KH9A 1JYIA 3R1FA 1ZBA2 1S2EA 2D7FA 3LEKA 4XPVA 3JUUA 4INDA 1FXZA 1HRI2 1QJX2 2C24A 2GP3A 4Q26A 1SHWB 1V6IA 2J1VA 3OSDA 3MIFA 1Y7BA 4ES8A 4HFSA 2PHWA 3I2KA 3BIEA 1XWRA 3Q8AA 3A0KA 5GZGA 1MQTA 4XTMA 3X29B 1Q56A 1LGCA 2R041 3SMHA 3UKNA 3FMYA 2A75A 2YV8A 2WFPA 4NJ4A 4OQ8A 3DEMA 5F6LB 1ZZ8A 2O4AA 5FMOL 1NLQA 1CZSA 2N7GA 2X5IB 5FREA 5JSRA 5GZFA 1SBEA 2GALA 5A3NA 1C5IA 3B9IA 5IVYA 4RFT0 4PIZA 4ZONA 2CHHA 3OBAA 3ZFFB 4QDQA 2IVBA 2V4AA 2QQLA 1VRH2 2ZKNA 3AZWA 3GZDA 1JBCA 1W6NB 1A78A 3FFQA 2P4EA 4RA0A 3NVCA 1GWLA 2B42B 2HBUA 1O8SA 1Q8SA 3KQ4B 4IDZA 1CONA 4YVSB 4XAEA 3N3HA 3I3QA 5FFOC 4N9IA 4CUAA 2JDAA 5T50A 1OSGA 4FPYA 4HSLA 4XF1A 5FZIA 1RITA 1JZ2A 1VRH1 4COYA 2FQPA 4NO4A 5CADA 4ET7A 5F7UA 3LAGA 4HK8A 2LCVA 4NRQA 3T1LA 3MDPA 3VHOA 5L7OB 5CBLA 4IEUA 2HWC2 4ASMB 4EZIA 4CCDA 1HXS2 2BWAA 5IYYA 3U3WA 1PIV3 2RR11 2PLV2 4CSWA 3PUSA 4XUTA 4CDQA 1VBA2 3B69A 3J8F2 2KXLA 4NVPA 3MIEA 1QNYA 4GALA 1GQHA 1KDMA 2OA2A 4R4ZA 2D93A 1WLCA 1UPIA 5FPUA 1SEFA 1RMU2 5HCAA 2PHRA 4IE0A 3H8OA 3K48A 4COVA 5DZEA 5FBJA 3U1XA 1UZYA 3USUA 4JKMA 2YGMA 3O1OA 5F2SA 2YU2A 1OLMA 2XONA 3EJKA 1JS9A 3RDIA 1RL3A 4E2GA 1QXRA 2Y0OA 5DQ0A 1LGBA 4DB5A 1HV0A 2D6OX 1GZWB 2GU9A 4OZOA 5FY7A 3H3LA 4JCKA 2FMYA 4M3CE 1AXZA 2NZ9A 5FZ6A 1RZRD 5CVRA 3ZPYA 4B8EA 4DMIA 4BIOA 4JAAA 5JOZA 2IFRA 4CCOA 1JFSA 5IK8A 5FZ0A 3QWGA 2UURA 3AMQA 3JD71 2XL7A 3VBSC 4XFHA 2B9VA 4GB32 2X53S 1W2OA 2B4KA 1ZA4A 2WNVB 3PTYA 4UFHA 3OGGA 4OB4A 4HPKA 1CAWB 1GBGA 1PK6B 3POSA 5FY1A 4CTEA 5GAGi 2FDGA 4RGKA 2L9LA 2W46A 4IUGA 4BLIA 4IESA 3N9PA 4HKLA 4XF3A 2QDRA 4FPGA 1SQ8A 3VD7A 1NX9A 3KWVA 4AGRA 2FHRA 4OYUA 3RMXA 2YXSA 1Y7YA 4Q2JA 4QD2A 3KSCA 2GC2A 1QXPA 3CO2A 5ABJB 1CVNA 5K7PA 2KR2A 1W6QB 2EIBA 1C8NA 2BGPA 3ELNA 4FPJA 3AYDA 4XQDA 1K5JA 1QP0A 1BKZA 4LPLA 5DSXA 2XHNA 5FLIA 2W0XA 3URFA 4YWAA 3DYOA 1LULA 2XDVA 3VBHA 5FOBB 1V00A 3ZYGA 1S0BA 5IVVA 1LCDA 3OD4A 3RPQA 1LCCA 2MEV2 3BU7A 4WVMA 1FPN1 1L1MA 1I3HA 3MLKA 4NWVA 2RM23 4R8HA 3PE5A 1ZVFA 4LHSA 5JVVA 4URAA 4JKKA 5JOYA 4OHYA 3J7NA 1QU0A 2OT7A 1XBFA 2DUPA 4QB2A 4ASLA 3RRDA 2A7AA 3AYEA 3ZKCA 3WW3A 4CDXB 2BEOA 4Y1ZA 3ZFFC 3OY8B 1VBD3 4KWUA 1WIZA 3B93A 5ERLA 2XPJA 5AFEA 1XPWA 5JIUA 3AZZA 3J9SA 2ET1A 4O9GA 3N9OA 1A6CA 1BQPA 3U75A 2VOWA 4Q4Y2 1UMIA 3NNFA 1TNFA 4XBNA 4YVSC 2DURA 3CNAA 3DYPA 4CYDA 4Z8BA 5I0UA 1GMMA 4M0NA 3NXHA 1K42A 2EXJA 2DBIA 3Q8FA 2Y34A 3U14A 2HYKA 2EXHA 4WVLA 2P34A 4QX8A 5FYCA 5FYSA 4CCEA 1G7YA 2HWE3 4HN1A 5IK4A 4I02A 2EXKA 2K9ZA 1C1LA 5HCBA 1UMHA 3UGHA 1WLDA 1UOBA 3WG3A 2QQUA 5J7MA 2V3CC 4TLFA 3NNGA 3B7HA 2V72A 3NROA 3MV01 5KXEA 3OUJA 5LZ6A 3I2OA 2RV9A 3KM5A 5A3LA 4M3CF 3ZIXA 5DDJ2 1OFNA 5KWRA 3WLUA 1E5RA 2HWE2 1EY2A 3T1MA 2G9FA 1NA1B 1UZZA 4CP0A 2CWSA 5FMDA 3KCYA 2ARBA 1Q43A 1YEWA 5GZCA 3WDVA 5KHGA 2XUEA 2HYXA 3AM2A 4HMZA 5EIYB 4K20A 3C2UA 4H14A 3RFRA 3ZSKA 1CAXA 2V09A 1URXA 5A7WB 1QOTA 2ZEYA 1JZ7A 4GH4B 4AQSA 1V9U3 2GH8A 2HWD2 2NN8A 1KDKA 2VZUA 3IB3A 5KC6A 1LRHA 4CUCA 4KI5M 5J1XA 1C28A 3MIGA 2AXVA 1W8TA 1PIV2 4FFIA 5FXXA 3V0AA 5LCWL 3F95A 1NQJA 3MFAA 1W03A 1CAXB 2WA4A 3HT1A 4JGZB 4UFMA 1O3SA 1QJFA 2R49A 4QKDA 2OS2A 2W1WA 3R0RA 1I5PA 2IVIB 2B5AA 3ON7A 2EXIA 1JWLA 4X4CA 3D5OA 2ZBJA 5FUPA 4QX1A 2GZWA 1AR61 2VCCA 2B8MA 2A6YA 2WZ8A 2I74A 4NMIA 5LBEA 2G19A 3C7FA 3HT2A 3TOJA 1RXGA 3VBUA 4BWOA 5DT2A 3L2YA 5FK7A 5B4XA 4D6QA 1MS4A 4Z59A 1QJY3 2W52A 5FKCA 2JDNA 5BNPB 4Q27A 4CDQC 4FPEA 2ICPA 3FYMA 3I4IA 1JMUB 1XNCA 1QJY1 4AR2A 4AVBA 1RUG2 5ANQA 1DFQA 4I0WB 2VUJA 1VMFA 1W8WA 3KHBA 1DWKA 2QFEA 2R043 1LENA 2J42A 4XCAA 1OQEA 4LORA 4MCTA 1W0OA 2ATFA 1U12A 2O8OA 1WW5A 4KQ7A 1JU4A 5BNPA 5KHKA 1ZZBA 1C8M2 3HQUA 2CSFA 5L7OC 1DQ0A 5FYHA 2RJ2A 3I49A 1L7RA 5C33A 1B35B 4YG4A 3WNLA 4XABA 2P3KA 1GP5A 1SLAA 4QDSA 1NT0A 3POGA 2FDIA 4KG0A 4Q4X1 3M3OA 1CWPA 1W8NA 2D44A 1WMFA 3C7HA 4UF0A 5IFPA 2WT1A 2ZACA 1GOGA 4KWJA 3ZDVA 4AHYA 2R63A 2VJXA 2CU5A 1ALYA 1LHNA 5FTTC 4AYUA 3H1YA 1H8TB 1ZPQA 4MGZE 5C8CB 2GSYA 3GDBA 3H3ZA 3TRBA 1S2KA 2P3YA 3SH5A 3BCWA 1A8DA 3MW3A 4EYUA 4WM7C 1JI6A 5BNOC 4K21A 3ZYHA 4EV0A 3HNMA 2WQ8A 4XFAA 2R16A 3QQ6A 5ABJA 4P9WA 3U11A 3WNNA 1UOJA 1NCQB 3ECQA 2I07B 2NMNA 4XUNA 5LEKA 4CDWA 1REDA 4PU3C 4QQ2A 5A70A 1RUD1 5A3PA 5E88A 3TAYA 4IGOA 1RZRA 2GC1A 3MW4A 4LE3A 5F3EA 1PERL 3P5BA 4XFCA 2P37A 3I3BA 3VBUC 3OF1A 5FYIA 1Q5OA 2E9QA 2R071 2XR4A 5DDJ3 4IA8A 3QBQA 1UYPA 1TME1 1W8FA 1NQDA 2KZ8A 4X4DA 1COV1 1HB1A 1UW8A 3VDDC 3B02A 1V9U1 4UBHA 5G05L 4XUPA 4YM0A 1N3PA 2DTYA 4LIUA 4R9DA 2H0VA 5LY2A 2OW4A 2PXQA 1SBDA 3SKJE 1JW6A 3AFGA 5DTRA 2XMLA 2HWF1 2YROA 1VRH3 1OKQA 4FP3A 4N7UA 1S0EA 5BNNC 1ENSA 1HLCA 1AL23 1QP4A 1QWRA 2C5DA 3M1HA 3M4FA 3WF0A 3WF3A 3KLSA 4AI0A 4C90A 4UF0B 1G9CA 3SEEA 3H8XA 1LHUA 3H7JA 1NLRA 1QEXA 2QQJA 4KL1A 1C8M3 1G6NA 1F5JA 2VZSA 3I2JA 3VHNA 3TEXA 3AL5A 5HXMA 1IQDC 4Y22B 3CJIA 2JG9C 3T3YA 3HIFA 2YGLA 1PGW2 3W21A 1KJRA 1DYOA 4JCXA 3RG0A 3ZKYA 3DNVB 4AL9A 1TMF3 1YQ6A 4XURA 4FPFA 5JLVA 2NPIA 2ZOEB 1LNSA 2MEV3 1TVGA 4XDOA 1LOFC 3V0BB 5L19A 1RUI1 2GNTA 1TMF1 2D6NA 2DYCA 5E1RA 1F35A 4WM8B 1OSLA 3RYRA 4RS5A 1ENQA 1K3IA 4EK9A 2VOKA 3UWPA 4K6BA 3RWKX 1NG0A 3EB7A 4DINB 2GDFA 2DBNA 1CZTA 4BOWA 5FZBA 3PUIA 4AFCA 1ZRIA 2XQRA 5C3PA 1J84A 1GKBA 2ERFA 3UL2A 4YVSA 1PNFA 2OYZA 1WLTA 2D97A 3WDWA 2WT2A 5JR2A 1I1EA 2R0HA 3OP9A 4FFFA 3M9LA 5FAXA 5JAXA 2AWIA 5HV0A 4XDPA 4G9SB 5GLWA 3WVJA 1POV0 2VZRA 1SZBA 1V9U2 2HWD3 4LO5B 4ER7A 1UY4A 5FZOA 4MGYE 3RSJA 3WG4A 2R072 4RR3B 4WZFA 2UY8A 4EWAA 2OZJA 1GU3A 1MZ6A 4FOWA 4L92A 3HN1A 5A6ZA 4FPOB 2FCTA 4F83A 2ZX4A 3W20A 1RUJ1 4M4RA 5DDJ1 2WNUC 4WVZA 5IHRA 3S0MA 2ILMA 5KR7A 3LSDA 2XVKA 4D3WA 5KBFA 5F8PA 1OOPB 2XQXA 5FP7A 1NA1A 4ATEA 1C8M1 4CDUB 3USSA 3KMHA 2LLVA 1F5FA 2JKXA 4FXKB 4OHZA 4F8AA 3GZTB 5K0UC 1RIOA 3SC7X 3ZO0B 4P00B 5LBBA 4K9SA 5A1LA 4BMBA 4V2WA 3G5GA 3GZCA 2PFWA 2YPDA 4OI4A 4XBQA 4B4QA 1W8HA 1G9BA 2OX0A 2WR9A 3Q8BA 1DLLA 5D21A 2VW0A 2XSDC 3UETA 1WD3A 2WWSA 3I2DA 1XNKA 3SEPA 3DM5A 1FT9A 3OBRA 3WHUA 4FT8A 4HXCA 1W6OA 3J8F3 3KF3A 2JQEA 1R091 3WOGA 3V0BA 4X4IA 2D3RA 2YC2A 2EF8A 3I3DA 4SBVA 1HXS3 4S2DA 1ZBE3 5C4WA 1H8TA 2ENRA 2G9ZA 3POYA 3A9YA 1NKGA 1H9WA 5LBCA 4QPWA 5FYVA 2YBDA 4YGEA 1D2SA 1YI7A 1N1TA 5FOJB 3TRSB 5F2WA 3H3UA 3W9AA 1UPSA 4FI9A 3WUDA 1C3HA 3D6EA 5LASA 3FC0A 1DCSA 1ZRRA 3OMTA 1UY3A 1VMJA 3K4ZA 5K0UA 1KITA 5IVEA 3GZDC 1SG3A 2DUQA 3O7OA 4P9YA 4N53B 5I0RA 3MLFA 1JUIA 3GYDA 4A2UA 4BHPA 4CU9A 2HWB3 1IG0A 4HOOA 2R1JL 1C4RA 2ET7A 2PHXA 4H55A 4QM8A 1KJLA 3JB4C 4FQZA 4HPKB 3S7EA 1DZTA 2VCBA 1R69A 1R083 3A21A 1ND2C 3ACFA 5T5JA 4J6GA 1FV3A 1VBC1 2BDRA 3CIHA 1O59A 5H9PA 2WNUA 3SX0A 2WUSR 2A6XA 4Y5TA 4A6OA 5CFCB 5JSPA 1RVF3 1DQ6A 3LOBA 2FCVA 4IE5A 5JPMB 3VD9A 4LKSA 4RHV1 5LRRA 3VD3A 1WUVA 5DUXA 4CCNA 2B39A 2Q1MA 2DVBA 5C71A 2R063 3VBFC 2HFZA 2AENA 3JD72 2IXCA 5CISA 1HRI3 1QJX3 1PNRA 2VU9A 1RPEL 2YFZA 2EA7A 4LK7A 4CP9B 3BI3A 5FZAA 5K0UB 2RDRA 4MLOA 1RHI3 1ZBA3 5LY1A 5DAPA 4ER3A 2VVFA 2ZTNA 3D0SA 4HVOA 1H2KA 5A32B 3KGLA 3VBUB 1E5HA 3VBOC 2NQYA 4UFJA 5A3WA 3O1TA 1KGYA 1W0PA 1K45A 2C0ZA 3A0NA 1YSEA 3CZUA 5FY8A 1P8JA 2BTVC 4W6YA 3ES1A 1AYM2 1ZM1A 2BOJA 1PZ9A 3VDCA 2CAUA 1HQNA 1J83A 3WQ0A 4K3UA 4AVAA 3WP6A 2WS91 2JVLA 5BXXA 1LEDA 2ZAAA 4GHJA 4MHUA 5H9SA 5JMCA 2PHLA 2DV9A 1YCIA 1COV3 3FHAA 1OI6A 1PNGA 1MZEA 2A3YA 4ER0A 3ZN4A 2VMHA 5FPAA 1WGPA 5BV6A 1GZWA 1O3TA 1EFAA 1ASJ2 2VUDA 4MOAA 1HQ1A 1RMU3 2E7TA 2JXAA 3AYCA 3B00A 1VBA1 4YM1A 2E32A 4CUGA 1RB8G 4BB3A 1D0GA 4MSVA 1BVVA 1HXS1 1GSLA 3WHTA 1V6OA 3N7JA 2VQ0A 2ZX0A 5JXHA 2J1SA 5KHJA 2MQKA 4XFFA 4G4FA 4ONUA 4OCTA 2HWC3 4CDXC 3CBNA 4LUMA 3MW2A 4DXRA 1AX1A 1A3KA 2CAVA 2FDJA 3POEA 2VMEA 2Y6FA 1HDKA 3HJRA 3ES4A 4P5YA 4PBOA 3QCWA 4JGZA 1D4VB 4YM3A 3ZFEC 3VB9A 5C4WC 1PRUA 4LK6A 4NROA 5FQ0A 4NIHA 5FWEA 2PHTA 4EKGA 2XHKA 4E2SA 3TN92 3ZN5A 2VQAA 2CDOA 1QXJA 2PN5A 3ACIA 2Q8EA 5KC5A 3ZYFA 1H2NA 4GB31 2YBPA 2Z2SB 3DGTA 4IV1B 1HV1A 4I0AA 4AF9A 1KRIA 1SFYA 2OQ6A 2AEYA 3VBFB 5JDBA 4AVTA 3BDNA 3E6DA 1CD3G 5IWFA 1GICA 2VTXA 4L97A 1IGOA 1VBE3 4HSJA 1SPPA 2VMGA 3FHIB 3IDCB 4AXOA 4EJRA 3E97A 2IXJA 1EV11 2IXIA 3WXPA 2C6SA 4UW5A 1EP0A 1VPHA 4IV1A 4GQ7A 2JCGA 1ND3B 3ZKUA 5T55A 3VDBA 2LLWA 1WKYA 5FPVA 1MS0A 1DHKB 3R05A 4BPZA 4BQ4A 1H8VA 1W2NA 1IOAA 1V6NA 4LBJA 4JDMA 1ND2B 1O4YA 4LHLA 4NDWA 4PF5A 3JB8A 4FPKA 3T09A 5JOWA 4LBQA 4RQPA 5GKAC 5LB6A 4B4RA 2Q8OA 4QQPA 3VL9A 4DY5A 5DXDA 2FCUA 2BBVA 1UWWA 4CA9A 2XCJA 3J8F1 4HL0A 2PLV1 3FUOA 1W6MA 2Q30A 1OD3A 3OEBA 3CLCA 4UW6A 5FZCA 5CFDA 5A33B 2WNEA 1AR81 3CL1A 4XIOA 4GJYA 5JR7B 2W3JA 2ICTA 3J7LA 4W8JA 3VZJA 4A45A 4BU2A 3VZKA 1OH4A 3IIIA 3I3MA 2DVGA 3WG2A 2BJCA 2EALA 3NV2A 4UW4A 4BQXA 3WW2A 4X4GA 3LPGA 1UIJA 1GWKA 1KS5A 2VW1A 5FZ7A 1SLCA 3BPSA 5FZKA 4ZY9A 5L7OA 3RZHA 4HVQA 2J1AA 3AMMA 1CPNA 1MPXA 1AR93 1HB4A 1DGRA 4PDWA 4QPYA 1DU3D 3VBFA 2FD8A 3KT1A 5I8YA 5FCCA 3H8UA 3ZFEB 1U5YA 3J26N 3LA7A 2UYAA 3IIAA 2H6CA 1W9SA 4AK3A 4FPHA 1RMU1 4P9JA 5GZDA 2ZHLA 3UNPA 1F2NA 5K8SA 1B35C 2YDEA 1AL0G 1JHNA 1PO13 3N9QA 3OPTA 4RGAA 3OY8A 1HQLA 1B09A 5A7WA 2J1EA 1V0AA 2TUNA 3B7MA 3TN91 4QPIC 2VZOA 1E5IA 5AC92 2QTWB 1LOGA 3OUHA 5FO8B 4DEVA 3O12A 3U37A 5JUVA 3AC0A 4MUVA 2HEVF 2RR13 4DUXA 2C4XA 2ZGKA 4XCBA 2RE9A 3MEPA 5DZGA 4AI1A 1HJFA 1DIWA 2WS92 3QOXA 4EN6B 3AP4A 4NRMA 4E4DX 3SHRA 1WMXA 2LYQA 4JQTA 1GWMA 4HRAA 1AYM1 1ZA7A 4L8QA 2BFUL 2YHJA 5J98B 4BM8A 4OVEA 2WNUB 3LZZA 2R6QA 2GMPA 1VAVA 2KEIA 3WUCA 4COWA 1CAUA 4Z1VA 2G1MA 2XOMA 2CV6A 1H8TC 1CZVA 3NJVA 2CTVA 1UF2C 5F6KA 2F6BA 1M4WA 1AXKA 1AR71 3VDDA 2WNVC 4P08A 1XQNA 5FZMA 1ASJ1 3ZXEA 1JZ6A 3GZAA 2BNNA 4RHV2 3MYXA 2VO5A 1JYWA 3Q9OA 4N43B 3VD4A 2W5FA 1W6MB 1RUF1 2VTXJ 1LECA 4KGGA 2WRAA 4QPIA 4XILA 1EUUA 4XUOA 4YFWA 2JX9A 4GWMA 4K8RB 4E4HA 3SKVA 2HWB1 3J7MA 4Y4YA 2IV1A 2VAUA 1SCRA 4CP2A 5J96B 1VBC2 4ORFA 2BGCA 4LKEA 4AFBA 2KEKA 2ZGRA 3G7DA 3OYWB 1C5HA 3SR4A 1VB4A 1YFYA 4QHZA 3T2TA 4ZU7A 2Z4FA 2C26A 3FWEA 2ZGOA 3MIDA 3ETPA 3EYPA 2RS13 1OUXA 2AR6A 3NNMA 2KEJA 1EV12 1NA1C 1JYNA 3IWZA 5T5PA 2WLPA 4CCKA 2RS52 4CPBA 1GT0C 4MGKE 4LJHA 4M00A 4B1MA 5LA2A 3N36A 2PMWB 2VOVA 5ANNA 2ES3A 3K51A 1OVPA 2BW8A 3VHPA 2GN7A 2VVDA 2P17A 1QH7A 5CNAA 3WV6A 3I2IA 3EMRA 2BP6A 3T2OA 1NZIA 4W6WA 2VNVA 2HLEA 1JYCA 1UU5A 2W95A 2WQ4A 4UT5A 1V6JA 1LQCA 1QJU3 3B94A 4Q4W2 2LYSA 5JPNB 4XETA 4W65A 1PO23 1R092 4JHTA 4N53A 3KT4A 3AMNA 1MQTC 2VVEA 3WF1A 2WZEA 3K75B 5F5IA 1BYHA 1UXDA 4EKIA 3CF6E 1HB3A 4A44A 2SLIA 4BQWA 2WAAA 3N7LA 2J7MA 4XF9A 1YUDA 3FUQA 3U10A 4EWDA 1XE7A 2QZ2A 2L8NA 3GBGA 4JX0A 3ZR5A 3LSEA 1BEV3 5CKMA 2SBAA 3T2QA 2R7EB 2OKXA 4XOGA 2RHPA 4OI1A 2ZGSA 1W6PA 5F3CA 3PLQA 4E4ZA 2VXRA 5D8AC 3AP7A 3I3EA 5APAA 1GQPA 1E3OC 4LHKA 3S6PA 5EZWA 5I8SA 2UYBA 4XUQA 4IV1C 1F8VA 5C4WB 1AXYA 3OQNA 1R1A2 3ZXLA 2ZGQA 1EUTA 5TSWA 2VMFA 3IKWA 1PX4A 1GUIA 1TQ5A 1YC61 3CZJA 5FYTA 5GAHi 1BZWA 5L36A 4J1WA 1OXCA 1FMD3 1Z7S3 3POJA 4IERA 4LBMA 4LO4B 3IZOA 4QPIB 4NPMA 3QD6A 3V64A 5LW9A 1RUJ2 1ZAYA 2C9AA 1QB2A 4KMQA 4UW3A 1BMV1 4J1XA 2W68A 4LO7A 1HRV2 2RVAA 2BRTA 2YZ4A 1W9TA 2W39A 1H6XA 1NY72 5A33A 5CFDB 1LLIA 2VNOA 4ER5A 1W04A 3UGGA 3ATGA 4ZXEA 2IFWA 1R64A 3OBTA 3ZFGC 5EFUA 1O4ZA 5I0DA 1QP7A 2K2SA 3OBZA 2IVQA 3GZEA 4ZPIA 2A3XA 2Q0AA 3DPRB 2WSVA 4NPLA 4N7IA 4BISA 1UU6A 5EJZB 3T0BA 4MGSA 1WWYA 5SV5A 3G6JB 2RS53 1ENRA 3GHNA 4EQZA 3AK0A 1UYZA 3CU7A 1ZRCA 5ISLA 1W39A 5IVCA 3VBSB 1UL9A 4N8MA 3ZXDA 1IPJA 3RZGA 1R082 5C3SA 1RXFA 2JDPA 4BQ3A 4KG8A 3OYWA 2JKBA 3R4UA 1PVC3 4YYOA 3MIHA 3C7OA 2WL1A 1H0BA 3O1PA 3POWA 4YVWB 3FL7A 4XJZA 3USUB 1US2A 4U36A 3ZXFA 2ADEA 5FJKA 4DEQA 4XFBA 2JE8A 3ME5A 3S57A 5F5QA 1US3A 2VBPA 5DG1A 5A7OA 2E51A 3ZR6A 1IC8A 4Y20B 2D3SA 4IEYA 4IEWA 3ZPXA 4OFGA 4YBAA 2Z69A 4XHXA 3H50A 2AUYA 1D2QA 3V56A 1AL21 1W6OB 2HEYF 3NRUA 1MS1A 4DRVA 1CAUB 2IWGB 2PXLA 4EN7B 1GNZA 1FMD2 2L49A 4YG1A 2AYHA 2P6CA 1ZBE2 1LCLA 2XLAA 1ULOA 2UWCA 4K7JA 3VBRC 4MG2A 5FJHA 1YQ2A 1X82A 1YLLA 1LGNA 1STMA 3N35A 4N53C 2CGNA 2HWF2 3BD1A 3GBWA 1WCDJ 2O1QA 4JVAA 2BV4A 1EAH3 2JG8B 3LKJA 5T54A 3ZN6B 4DIQA 4XJWA 1RUI2 2A70A 4V2VA 5FWJA 5HV4A 3Q8EA 5CG9A 4BLJA 1IKQA 1J3RA 4XQWA 1VE0A 4YZ3A 2CROA 1VBE1 1RUE2 1XXNA 4HG6B 1COV2 2VM9A 4B7KA 2XI8A 1TME2 4NHKA 5E89A 4LT5A 4JCYA 2WYFA 1BEV2 1TE1B 4BJ0A 4IQPA 4GWIA 4LXLA 5A1FA 1ND2A 1QOSA 5IW0A 3H1MA 1YQCA 4L2NA 1YXWA 1Q8OA 3VKMA 3GCWA 3NO8A 4RFRB 4BE3A 1JXNA 4AVVA 4QKBA 1R093 2YC0A 1IQAA 2XBO3 3IT8A 4TTGA 5KXCA 3FX3A 1F4AA 2R32A 4MXWB 1NE4A 3JZVA 1X36A 2LTNA 3SH4A 5HPOA 4QQHA 1T2XA 2QKDA 3O9XA 1WH8A 1W8UA 1QDCA 4JQDA 3PNAA 2VE1A 4MGIE 1U5ZA 1BK1A 3UK9A 1LHOA 3ASIA 3J7HA 4D7TA 2LS6A 1OUSA 1ZRDA 3BVCA 5AVPA 3VBSA 3WT3A 2JIGA 4MGTA 4DS0A 2RS12 2WBKA 1JUHA 3LEGA 3VN4A 1IZ3A 4BK4A 3MF9A 4I6RA 1SDWA 3QOWA 1PGSA 4RQPC 2HCSA 1WCUA 5FZHA 4D7YA 1QNWA 2EAKA 1WCSA 3H0OA 4DQAA 3ZFGB 1RUOA 2DCKA 4YG3A 3BOWA 1JZ8A 3KHCA 4LKDA 4CE8A 1VLNA 2QQKA 5CKQA 3WCSA 3DPRC 1V6MA 3AB0A 2WAOA 3KCXA 4PIYA 4BK5A 5LA0A 2WDBA 4BZ4A 5LATA 4ZZ8A 4LA2A 5A7SA 3D4KA 4R52A 3LDKA 3DXTA 4ZKTB 2YYOA 1DZQA 2RDSA 4BCUA 2ZEZA 3U0ZA 2PELA 3R4SA 3ZXKA 2DFBA 4PF1A 3JQWA 2VEOA 1TMF2 4XFIA 1W05A 3KL4A 1AZDA 5DRYA 1O5UA 2VZ1A 4YZ4A 3NZLA 5EXOA 2V5YA 4V1PA 2ZX2A 1NXD1 3SNMA 2PXVA 3BN6A 1AHSA 1SFPA 3AMHA 1UN1A 1VBE2 4O61A 1YO8A 1NCRC 3KQRA 1B35A 1EAH1 4B7EA 2D5VA 3IDBB 1GLHA 1I5ZA 1Q3EA 4MXWA 4Q4X2 2WZPP 3UKVA 3PXPA 2W9XA 3D82A 5KHIA 3M3QA 4R4XA 4D94A 5FR3A 3ZFEA 4EZ4A 2DUOA 2GNDA 3AKTA 3JXCL 2E26A 3GHMA 1VP6A 2EBYA 2XL9A 3CMGA 4YG0A 4AGVA 1UY1A 2PAEA 2VGDA 2EVXA 2W47A 2ZPXA 2J22A 3PJYA 3PMSA 3DV8A 2ZGNA 3ALQA 3T4VA 5AC93 1H1MA 1JOPA 1PO21 3R09A 4QAWA 1ULDA 4CU8A 3HBZA 4AQTA 2QQMA 3M70A 4W50A 3AMPA 1S0FA 4OHXA 4XFGA 2PHFA 1ND3C 3DCQA 4WVMB 1GP4A 4ARXA 4LHNA 1S1AA 2HWD1 3BUCA 1XB9A 2ZGMA 2XKPA 4AAXA 3UFDA 2JG8C 4NHLA 1OC1A 3AL6A 4B3NA 2LYKA 1OURA 3HNYM 4UOJA 4KNCA 3A22A 5DZFA 4XVHA 5GLZA 1PZ7A 3ILNA 4IETA 4LITA 2ZS6B 3GN5A 4S2GA 3RYKA 5FO9B 1PGL1 1QQAA 2A3WA 1BBT3 1MVEA 4ATFA 4OHVA 4P14A 2A1XA 3ZXGA 3FLTA 4NIGA 2NYYA 2WFF1 2E31A 1Y3TA 2ODRD 1RUD2 2GMEA 3AZVA 4A3XA 4YGBA 2FDFA 3V0AB 2V73A 2GC3A 2W08A 5A7NA 1LHVA 4Y42A 3DUIA 2JG9A 3KV6A 1UQXA 4AI2A 3G0TA 1Q8QA 5FUIA 4YW2A 5CFCC 4MYEA 3PVNA 1KFXL 2CYFA 3KB5A 5F3GA 4DUVA 1Q8PA 1N3QA 4K1YA 1J1TA 3AFKA 2LUWA 4E27A 3RQ0A 3B3QE 1RJ7A 3T0AA 1UKRA 2XKOA 3D8CA 1R63A 5IJRA 4NN0A 2D6PA 5BNNA 1L7QA 5A3MA 2UWAA 2XJSA 3AYAA 1U5XA 3DECA 4H2AA 1YFXA 3S30A 1SACA 4JKLA 2VC9A 4XQ4A 4EQVA 4NE9A 5EJ1B 4ISRA 3TFLA 1NCRB 2WABA 2O0OA 4CP9A 3WG1A 4IEXA 1BMV2 1CN1A 1VB2A 2R30A 5LA9A 2GN3A 5DN2A 3LDRA 3S5AA 2BWCA 1TNRA 1BCXA 1XRUA 3WX5A 3UV9A 2IC1A 1RVF2 1AR83 1OBNA 2D6LX 3DPRA 4KU8A 3HEIA 5J37A 2VCMA 3PIJA 3QACA 3D1NI 1V70A 1FNZA 2D98A 2XG3A 3T2PA 1K12A 1IHMA 4XZUG 5A7LA 1H4HA 1GR3A 2BGOA 4CDWC 3ZX7A 2PXBA 1WLWA 1XSQA 1RUG3 4QX2A 1WW4A 3BTYA 4X4BA 5FMCA 5K98B 3TNPB 5LRSA 3KVBA 1RUG1 3OD0A 2PXJA 4Q4Y1 1QJY2 4DOUA 1OPMA 1UZVA 3JXSA 2P3IA 1OA2A 1SBFA 2DU1A 5CZKA 3AKRA 2X5IA 3POFA 3QF3A 2DU0A 1LOAA 2PUGA 1S0DA 2HKXA 5JIAA 3VKFC 4L0PA 1AR62 3KS7A 2DCJA 2O38A 5EYXA 5FXZA 3LDBA 4FPCA 1MR5A 1SFNA 3Q8CA 4LUKA 2ADDA 4BQ2A 4TN7A 1D7PM 2XJRA 3NL1A 1MZ5A 1SQ4A 2QQPA 1W0NA 2X09A 4JGYA 4QPGC 3S8QA 1H2MA 3M8LA 3PUAA 2Q1FA 1DQ1A 1REFA 5I91A 2XXAA 4QQOA 4CU6A 3U78A 2J1UA 2XXPA 1W6QA 2HJIA 3M3CA 5A7PA 1YWKA 3TWIA 1QZXA 1UXCA 3EO6A 3OEAA 4LEJA 4AOCA 4DXTA 1RUNA 3WY6A 2Z5WA 2RS51 1DLCA 2IVJA 4F7ZA 1GNHA 2WZR3 2Z42A 4FCAA 2EIDA 4FOVA 5FYZA 3MV11 4PQQA 3QLQA 5BNPC 1Y4WA 4CDQB 3NAPB 4CEWC 2VNRA 5CAZA 1QF3A 1RUC2 1SMVA 2ZA9A 5L9RA 3ZOIA 4META 2OQ7A 5FPZA 4WBBA 4D6RA 3CHXA 4TWTA 2QZ3A 5FK8A 5FZ3A 3KZ3A 2GMMA 3JBG3 2ORZA 1D4M3 1LU2A 3WDUA 3BGAA 3B9CA 2IXKA 3DKWA 4M3CB 3PVBB 2DF7A 1R1ZA 2IXHA 3EQEA 2CDPA 1QQP1 1UYYA 3DYMA 2JB8A 5LEJA 1HF0A 1RHI2 5DABA 3DL3A 1X9TA 3HPNA 3MFCA 1W6NA 4LKFA 4COUA 2XXQA 2JJ6A 2R0FA 4B29A 5I0TA 3JD73 2YB7A 2BPA2 3VBRA 4OZXA 4B1LA 3ZYPA 4HETA 1OVSA 5BNQA 5C8WA 4H3WA 3RWNA 3AKSA 2R073 2VD7A 4Q4Y3 2ZCWA 4QGMA 2R1BA 5KHHA 3RGBA 2QVSB 4UFKA 5CU1A 5HXVA 3NW4A 2WFF2 2JDYA 4GAZA 3A23A 4XF0A 4C0HA 2YFUA 4Q4V3 4IE4A 1SLLA 3TNQA 5FP9A 5FZGA 1X33A 3H42B 5FLJA 2PHUA 1LR5A 1NERA 4JGYB 4M4PA 4N43A 1WMDA 4Q1PA 3VBHB 4CUBA 3HN3A 1PRAA 3NQHA 2PUDA 1BHGA 1LOBA 2P5BA 3ST7A 3EXUA 3LIHA 5HBAA 4FTEA 1OKOA 4QGNA 1JU3A 2JDZA 4RS5C 4YW7A 2QQOA 5JMOA 4LQRA 4IGQA 4YNIA 5AC91 2XUMA 2P6HA 5FQ0B 2AZ5A 2MEV1 3W5MA 2OFYA 1BVP1 2CSGA 3PURA 4AEDC 3WP3A 1SLBA 1E5SA 4Y1UA 3UJOA 1A8MA 3ME2A 4IEVA 4JV4A 4WVWA 1OLRA 4FAGA 1DP0A 2BERA 4QWNA 4XEZA 4IGPA 4PQ9A 3LISA 5FZEA 4BA6A 5JZGB 5C9AC 2OZ6A 3CQOA 3RS6A 4Y22A 3F2ZA 3ZYIB 2XWBB 2EIEA 4XDQA 3U4XA 4AVSA 4Q8LA 2ZGTA 2BNOA 1LU1A 4YZ5A 2J7WA 3BU0A 3GCXA 3ZFGA 3IMMA 4AHXA 3PMEA 1JYXA 4AHWA 5FDBA 2I2SA 4QKNA 3JXBC 1UOFA 1VBB2 2AREA 4ZU4A 3ZSLA 2K0GA 1LAJA 1ZNPA 5J09A 5JXJA 2FZ1A 3POBA 5J36A 1O3QA 4NIAA 1IPSA 1ADRA 1WCQA 2QQNA 3POIA 2E7AA 4P02B 1DYPA 1ST8A 4GIQA 3TEYA 2P2KA 4RYDA 4HVRA 5K4LA 4IV3C 1VJ2A 1V6KA 2RDQA 2VCAA 3JBG1 3MHZA 2AACA 3NNJA 4NRPA 5FYUA 4D8MA 1IS6A 4P5HA 1RUH3 2L1PA 2Q1ZB 2XBO1 4A6SA 2P1BA 4GKYA 1RUH2 1UX6A 4GZ9A 3KJXA 4HONA 1JZ4A 3AXEA 3GZUC 5FZ1A 1ZZCA 2YY1A 3HQRA 1YJLA 4PU4C 3LA3A 4Z82A 1MZFA 5K9YA 2HCNA 1H2LA 3VBOB 3VBHC 2MXDA 2QQWA 2AEZA 2J1TA 3ABZA 4X6RB 5I93A 2F17A 2UU8A 3MI8A 5GLUA 1PVC1 1I6XA 4YSFA 3M3IA 4Q8KA 3WDXA 5DAVA 1AYN1 2RMU1 1F9KA 4UWDA 5LA1A 4MCXA 2WINB 4Z92B 1W3XA 3I59A 4RSUA 5IVJA 4M3CA 1X57A 1V6LA 3C8XA 3DXUA 1UU4A 4GMP1 4BH9A 2DWRA 2JE7A 4I8TA 1VBD2 2PLV3 3FLPA 1BK0A 4F8DA 3ZLIA 4B4PA 4K8FA 1CAVA 2JDKA 2YC4A 4OMDA 5GM0A 4YG7B 3UT0A 5JZGA 1OLME 1RC6A 4OQ9A 1UAIA 3TEWA 2EWTA 2RM22 1PRVA 1TG7A 3KGZA 4CEWA 5FPXA 4DY3A 1QMJA 2ORXA 1FOD3 1JOJA 2DCYA 4L9BA 5JWPA 1VRBA 3RZMA 2UY9A 1O7FA 1UXZA 4Q29A 1GOFA 1VALA 2OVUA 5EHDA 3MIBA 3WNOA 5JI7A 1N1SA 5A3UA 4IL7A 4HZFA 4I01A 4Q2FA 4MH0E 3RZKA 2H8RA 2BJSA 4LLOA 5HCFA 2ZMNA 3MLJA 3NMBA 1RUE1 1MQTB 3VHRA 2EF6A 4RN5A 4WV8A 4GH4A 2PUAA 5FYYA 2BBAA 3IDAA 4MVTA 3WQ7A 3RNSA 1YQ8A 1S4CA 4O8BA 4CXXA 1PO11 4JTOA 1IS3A 1SLTA 2VPVA 3LWCA 3M7AA 3OCPA 5EQUA 3UGFA 3VZOA 2ZX1A 4AHZA 4X4FA 4YFZA 4Q4V2 3UKTA 3OWQA 1NZCA 1XSRA 4GA9A 4DXZA 4E8DA 2A6ZA 3MO4A 2VUCA 4BQ1A 4P9IA 2WUHA 1WETA 3RZJA 4IE7A 1A34A 1FV2A 1N47A 1QH6A 1ZBE1 1WZXA 2R042 3OJBA 4N43C 3NJXA 4OLLA 1ONAA 4UFIA 5EV7A 5FMBA 4DPNA 4L99A 1S0JA 2VMCA 5LK5A 3VKOA 4FN3A 2Q4SA 2XH6A 2ARCA 5C5UA 5JXGA 4XJ9A 4FTSA 1CX1A 3TEZA 1AL22 2JWPA 3RMYA 2ZZJA 1AX0A 2A6WA 2XIUA 3CEWA 4OHWA 2OPKA 3K46A 1BBT1 1UCXA 1OLQA 4HK9A 3QOPA 4DNYA 5FP3A 2RMU3 2VQUA 5ABJC 3AP5A 3R4DB 5CIRA 1DYKA 1C57A 2X29A 2YBSA 4WM7A 1FOD2 2B45X 1UZ0A 2B46X 2ZAHA 1HB2A 4PHZA 3HZIB 4LBQB 2IU7A 4RQPB 3VD5A 4E8CA 4QHOA 1YFWA 3MBWA 4LOSA 5E8AA 3OPZA 1DGWA 2YG0A 4Y3OA 4CCMA 4JQRA 4IXLA 4ASKA 2R061 1QY4A 2PXTA 1VMHA 2VZQA 2IXLA 2VZPA 3LEMA 3MICA 3PU8A 5FP8A 5FYBA 1AVBA 3SLIA 1O5LA 1ZZ7A 1QIQA 4PI0A 4C8DA 1CJDA 2WZR2 1OT5A 1WBFA 1BJQA 3OB8A 3VGIA 3ZSMA 2FZ2A 2YUEA 3K2OA 4Y1YA 1RUD3 4AI8A 3O1VA 1VR3A 5C3RA
chains in the Genus database with same CATH topology
5GALA 4AQ6A 1S55A 2ZMLA 2NLRA 4QQLA 4I6TA 3IBMA 4TYSA 5A32A 5T52A 1DG6A 3QH7A 2A71A 1LTEA 3VZNA 1UMZA 4AEJA 4Z5DA 2WIUB 3ZHMA 1WMEA 1X2LA 4R9CA 2IZWA 4WM8A 1ENXA 3NJZA 3S7IA 1NXMA 4BIFA 1WW7A 3MF6A 2AUWA 4YM2A 1QGLA 1XU2A 2ETEA 3P3PA 5FMOS 4Q4V1 5DG2A 1MS8A 4Q4X3 1JH5A 2JICA 4YRDA 1YNAA 1H1IA 1J3PA 1F31A 1G9AA 4I30A 4OUSA 1QKQA 1K5MB 2D40A 5E16A 4F3JA 2JE9A 4YGDA 4COZA 1OPOA 2TBVA 2ZZQA 4N9HA 5EWSA 1FX5A 3JXDL 4IEQA 3N4MA 4JTNA 1S0IA 3V65A 1O3RA 1J58A 1H30A 2XLGA 3FYAA 2EAAA 4YVWA 5DUVA 5B2GB 2WZR1 4KWKA 4Y26A 4XIKA 1KS4A 1CGPA 3LOIA 4JGZC 4PLNA 4KWLA 4LBQD 5JSOA 4IV3B 2JECA 1DQ2A 4M0HA 3IMNA 5JOXA 5C9AA 1RUF3 4TSVA 1ZRFA 1NCQA 4I2OA 3EUSA 4JC1A 1OA3A 2X8KA 2UWBA 4H7MA 4RS5B 4JDNA 4YW4A 1G9FA 1BBT2 2H0BA 3E6BA 2GC0A 4OI0A 1LMB3 3VZMA 1Z78A 2TEPA 4LR4A 1RTVA 2XBO2 2VNGA 3BALA 3WP5A 4Q0QA 1D4M2 4Y1XA 4EN9B 2PUEA 3JBG2 1AR72 1XE8A 2Q5TA 4LO8A 2HEWF 1RIRA 2GRLA 1RGSA 1RUC3 3RYPA 4A7KA 4ISQA 4K40A 2BFUS 4XHBA 1NLSA 2PAMA 3AP6A 3NV3A 1RUE3 4E2QA 1ULGA 1AJOA 1K5MC 1QOOA 4HN0A 3WR0A 3FFZA 1VBB3 1RUI3 4KU7A 1MVQA 1PGW1 4DRRA 3IPVB 1DGWX 1SLIA 1VBA3 2WIIB 4GWNA 2CGPA 4QMAA 4XMIA 1LJ7A 2PHDA 5T5LA 5D8AB 3CROL 3WW4A 3ZHIA 2BUKA 3CLPA 2XLFA 5IK5A 4OULA 3VZLA 1HW5A 1AR63 1REEA 2RJLA 2ZABA 1AX2A 3FBYA 3IPVA 1L3JA 2I45A 1VBD1 4Y24A 3WNXA 2XGXA 4LA3A 4MX3A 1AR91 4SLIA 2PUBA 3MLLA 2G4IA 3IM0A 1GV9A 2VUAA 4Y5Z0 5EYYA 3W59A 2HINA 2QUOA 4XE9A 3RI8A 4RL7A 1PVC2 2A5ZA 1WCKA 3I59B 3PHMA 5C8CA 4PLMA 1RJ8A 4S2FA 5GLVA 3EBRA 3UJQA 1I9RA 3L2HA 4R9AA 4Y20A 3BS3A 3SITA 1RUH1 4Z5CA 2WFF3 1AR82 2YMZA 4IVZA 1FNYA 4RR3A 2B7YA 2D6KA 1JTZX 2VMIA 3AZYA 5BNNB 4FBFA 3VV1A 4XXAA 2D6MA 1PHMA 1RHI1 4GB33 3ZMNA 1MEC3 2Y0IA 4ES9A 5H9QA 4QGLA 4EN8B 4YZ2A 1OQDA 5IK7A 3WCRA 4XTPA 2GNMA 1UD1A 1XYOA 1DQ5A 1VBB1 1QHDA 1OCTC 4FP2A 1HRV3 4NOTA 5GJ6A 4PU7A 3O14A 4YVWC 2WJSA 1RUJ3 1RUC1 1N1VA 2EIGA 5J48A 2GRMA 5CA6A 2F4PA 4GH4C 2CL2A 2OR1L 2GAUA 2QCSB 1KD7A 1S0GA 4FXGB 2BVVA 5DUWA 2A6CA 1J3QA 1H4GA 5JCTA 4MXVA 3QYXA 4X8PA 1WH6A 1UTXA 4RD7A 4AEDB 4YZ1A 3THPA 4N90A 2P3JA 3OGJA 1S0CA 4URTA 3AX4A 2XB6C 1CJPA 3JU9A 2PUFA 5AVAA 3FE5A 3KXAA 4BMEA 1LEMA 2KM2A 1U0AA 1O4XA 1QJZA 1HIXA 4ZU5A 1N3OA 3PVOA 1AU7A 3OQMA 1PK6C 4DZGA 1JH9A 2GH2A 2RS32 3H1WA 2XJQA 4GMP3 1RZSA 1XNBA 1J59A 1X50A 1PMIA 1POV3 4Q4W3 4YW3A 2QE3A 3P3NA 1UIKA 3ENRA 3ZDSA 4RGGA 2BQPA 4DFSA 1D0HA 4Z07A 4L11A 4AI3A 4R9BA 1OOPC 1G86A 2QNKA 2D3PA 2LALA 4AW7A 1JFTA 4FO9A 5T3NA 1PIV1 4HT1T 1NE6A 1CESA 2XJVA 3ZYJB 4AGGA 3N7MA 1RVF1 1NCRA 1XU1A 1Y43B 1DGLA 4Q0PA 2NP0A 3MPPG 3RI9A 1CPMA 2JG8A 1CAWA 1PK6A 4D7SA 1EPZA 2D5FA 3CJIC 2JEMA 4AEKA 1EYBA 1FYUA 2GZUA 1B0NA 3E6CC 4FPLA 4CEYA 1LOFA 3SCFA 5D1IA 3DF0A 1ZVVA 3M2MA 3SCGA 3ETQA 2ZGUA 4HBNA 1LESA 2VOXA 3WD5A 2WSUA 3WQ1A 4FOQA 2PAKA 1LOEA 3SISA 3NAPA 3GALA 1Z7S1 2VW2A 4YARA 5F1RA 4IEOA 4I09A 4XZPA 1NCQC 2VY0A 4K1ZA 2DVAA 1APNA 4ZXKA 1QQP2 1Z7S2 1CQTA 4YW1A 3H9AA 4GULA 5C6CA 1ZUGA 2PYTA 1FI2A 1C1FA 1KXGA 3APBA 4AEDA 1AF9A 1HX6A 3VLBB 2QDNA 4CRQA 1PGL2 4GQMA 1ZS4A 4Z5HA 2ZGPA 4XW3A 2LM3A 1KQRA 1IPKA 5T5OA 3TYJA 1BDHA 3GF6A 4M01A 4LULA 4NR1A 3WDTA 4KBBA 1AYN3 2CNAA 2ZHNA 1IS5A 5D8AA 2O49A 4E4SA 2G9GA 4D69A 1YYNA 4I6UA 1QJU1 1ULFA 2O8QA 5BNOB 3BIWE 3SCHA 1PO22 4PLOA 4QT6A 3AKQA 3GNEA 1CJGA 1QJU2 4X4HA 1GQGA 1OFSA 3AP9A 1TME3 1O91A 2MEZA 3A4UA 5FBZA 1FPN3 5BNOA 1UKGA 3VKLA 4AEMA 3LB9A 4CDUA 2ZHMA 3GBFA 2OUHA 4PIXA 4TZDA 1EAH2 2JENA 2VH9A 1PVXA 1ZYBA 5JZGC 1EV13 1CX4A 2ZGLA 1OHFA 4AFDA 1DGRN 1WA4A 4PJYA 2DCZA 3F52A 3VL8A 1QDOA 1XYNA 2Z79A 4CDUC 2AXZA 2WC2A 2A73B 2BYVE 3RJ2X 4LO6B 3WDYA 4RHV3 3VBRB 1ULCA 5FRAA 4HLTA 2XJPA 4CZSA 1G8WA 4JGYC 3HD8B 1EPWA 4QHBA 2PIJA 2D43A 1QQBA 1CAVB 4FQ4A 2WNVA 2ZJCA 3GN5B 4LTAA 1YIPA 3PJQA 2RJKA 3IVPA 3M3EA 3F6WA 3FZ3A 4I3GA 4QXKA 2ZMKA 3THTA 4QPGB 1DF0A 2AXUA 1DW9A 1DDLA 2RR12 2WT0A 2ZX3A 4Q0VA 2VECA 2HWC1 5DUUA 3VKNA 4YG6A 2LYRA 1LB2A 2FBEA 4XMAA 4IWRA 1POUA 2DTWA 4YGCA 1DZRA 4AQ2A 5CG8A 4BYYA 3NAPC 4CEWB 1BEV1 1SCSA 4WVVA 1VPWA 4X8NA 2RS31 3F51A 1M06G 3FLRA 3VDDB 2Y38A 1ZZ9A 1LHWA 2XJTA 2HSGA 3NSTA 2LYJA 2CY6A 3NWKA 4TWTA 5I8TA 1AR92 2KA3A 4IEZA 4EWEA 2NMOA 3J4UH 4H7LA 1ZZ6A 2BVBA 4I0BA 2VG9A 3AZXA 2B9UA 2HWF3 3R6SA 5ACA3 3ZYRA 1YJKA 1D4M1 3ZMOA 3LFPA 2E7QA 3ZXAC 3OTFA 2PTMA 4OI2A 1KFUL 3ZN6A 1XNDA 4XYXA 1CIWA 3HQXA 4A7ZA 1HRI1 1QJX1 1G9DA 3ZFFA 3U07A 1YHFA 1OOPA 2MNGA 3HWJA 4YLZA 2TNFA 4LE4A 1DQ4A 2RS11 3AKPA 1ZBA1 1QPZA 1IS4A 5H9RA 5J3UA 1YRZA 5KXBA 3HAGA 4P9LA 4PBPA 2Y26A 1H9PA 4JRAA 2XWJB 5EJ3A 4NWWA 1NYWA 4UBGA 3L9JT 5BYNA 1WW6A 2DCTA 3ILFA 1R081 3JQXA 4CP1A 1X8EA 4WM8C 1JN2P 2DFCA 4LBLA 4AG4A 4NHMA 1VAMA 1LODA 1H1AA 5LK7B 1OQ1A 3KD4A 4CDUB 2WA3A 4PDWB 4U2AA 2ZHKA 1MS5A 4A7YA 1XYPA 1GANA 3KZ4C 3RZZA 3DN7A 4XBLA 3W58A 4I3PA 4C1XA 1ZREA 1N1YA 1ZX5A 1CR7A 1E57A 4IEPA 2VULA 1LOCA 4XJ8A 4EROA 4AE2A 2MPFA 1NEQA 3TN93 2LYLA 2C1FA 3O0WA 4GKXA 2PE5A 4IV3A 2FJRA 3FJSA 3NV4A 3MGUA 3LCPA 1HRV1 3MPBA 4KGQA 5L73A 5AFBA 4Q1RA 3ROUA 3WINE 3KT7A 2H6BA 4HANA 2AW6A 3AXDA 3H5TA 3ACLA 1W6PB 3AJYA 4O9EA 3SXWA 2IVGA 3ZSJA 4CP2A 1F8VA 5ACA2 1R1A3 4X6QB 4W6XA 4CDXA 4JDOA 3O0XA 4XXPA 5HI0A 2R1DA 1ASJ3 1GZ9A 2CWMA 2WS93 3VUOA 2PUCA 3ILRA 5FO7B 3RJRA 1AJKA 3FMGA 3ZSEA 1NOVA 4QPGA 4AWDA 1W2UA 4QM9A 1VIWB 4FVVA 3BODA 1OD5A 3O5SA 4FOYA 4LBNA 2XJ3A 3ZVXA 4XJAA 2XVGA 1AYM3 5IT6A 1POV1 2PPXA 4LLFA 4Z58A 1S7EA 1MS9A 2B5HA 2GNBA 1GYKA 1FMD1 3WZ1A 3C3VA 3L1PA 2ZKLA 1MEC2 1BXHA 1FATA 3NV1A 2R062 4Z2WA 4CDWB 2CGOA 3VBOA 2QJVA 4RR3C 4E9KA 1U5IA 1BDIA 3I7DA 4LBKA 2DVFA 3BTAA 5CFCA 1X7NA 3SH3A 5IUQA 4FBIA 1FAYA 2XVLA 4Y1VA 2JD4A 4AFAA 1NY71 4XJUA 4JRLA 2LYPA 1Y9QA 5C8CC 2HWE1 2YPJA 2FMDA 2AH2A 2HWB2 1T6GC 1X8MA 3H7YA 3ZXJA 1MEC1 1VBC3 1PM7A 4AFMA 1WBLA 4P9XA 3OQOA 4PCRA 4AVCA 5JI9A 1YIFA 3BOPA 4QX5A 2X5IC 3IDEA 3HMYA 4PDWC 4CEYB 4WM7B 3VK0A 3I54A 4YW5A 5SV8A 3CECA 1CQ9A 2AGSA 3LGRA 3WW1A 1HKDA 3B5LB 5I0SA 5JSPA 2WKKA 1AUYA 5CB7A 4LBOA 5GLTA 4G3YC 2E63A 1PZ8A 2D5HA 2PQQA 1ULEA 1HQWA 1IKPA 1Q8VA 3INAA 3I8TA 2DVDA 1YFUA 5CFDC 3N7KA 3EHKA 4FAHA 4XF4A 2OUJA 5ACA1 1K5MA 4Q4W1 1FPN2 1DBNA 3FBMA 3BPZA 1VAKA 2RM21 4S2HA 5FLHA 2A6VA 3MZHA 1R1A1 1OMIA 4QU2A 4X4EA 3E5UA 2NM1A 1J1LA 1O4TA 4WZCA 3NKGA 4GXLA 2WLQA 3CJIB 4OUMA 2IUOA 1AR73 1PO12 5BUVA 2RS33 4PU8A 1Z0HA 3B01A 3IN9A 5GZEA 3HR9A 3KCCA 4Q0SA 1AYN2 4EN0A 3E5QA 4FSJA 3TBDA 3JCIA 1TEIA 1LKNA 4Q0UA 4C91A 4HKWA 2JG9B 4LNVA 3D0JA 3O0VA 2MHFA 1RINA 3AJZA 3CJXA 5BPXA 4NPRA 4C0BA 3ZIWA 1RUF2 3LA2A 1YI9A 4MV2A 4CEYC 4MZUA 2E