4J1XA

Crystal structure of fe(ii)-hppe with alternative substrate (s)-1-hpp
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
193
structure length
193
Chain Sequence
TASTGFAELLKDRREQVKMDHAALASLLGETPETVAAWENGEGGELTLTQLGRIAHVLGTSIGALTPPAGNDLDDGVIIQMPDERPILKGVRDNVDYYVYNCLVRTKRAPSLVPLVVDVLTDNPDDAKFNSGHAGNEFLFVLEGEIHMKWGDKENPKEALLPTGASMFVEEHVPHAFTAAKGTGSAKLIAVNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanistic studies of an unprecedented enzyme-catalysed 1,2-phosphono-migration reaction.
pubmed doi rcsb
source organism Streptomyces wedmorensis
molecule tags Metal binding protein
molecule keywords Epoxidase
total genus 48
structure length 193
sequence length 193
chains with identical sequence B, C
ec nomenclature ec 1.11.1.23: (S)-2-hydroxypropylphosphonic acid epoxidase.
pdb deposition date 2013-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 4j1xA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4j1xA02
1RZSA 4EWDA 2XSDC 5I8TA 3IBMA 3RYRA 1O4XA 1FXZA 4IEWA 1LMB3 4X4IA 4OB4A 2ET7A 2PUEA 4XF1A 5FQ0B 2OZ6A 5JCTA 2PHLA 2EA7A 1QPZA 1RTVA 2V09A 1NE4A 4IEQA 1DWKA 2GC3A 3CO2A 1EP0A 5FPXA 1NERA 4L2NA 1J59A 1RC6A 4JQDA 1Y3TA 2OPKA 3FMYA 2MNGA 5E1RA 3L2HA 3TRBA 1BDHA 3E5UA 2XL7A 1UW8A 2XL9A 1CGPA 2GRMA 4JTOA 4HSJA 3IDBB 4XETA 3RPQA 4I6UA 4FBIA 5JAXA 1AU7A 3FFQA 4O9GA 3E6DA 4F8AA 4XF4A 2B5HA 2AXZA 2KZ8A 3BB6A 2L8NA 2A6CA 3VK0A 3VHRA 2LYJA 2EAAA 2ICPA 5I8SA 5I8YA 4Z5HA 1YHFA 4I2OA 4X4DA 1ZVFA 4X4BA 4QXKA 4FT8A 5J48A 4MZUA 3QF3A 1X7NA 4BIFA 2PTMA 1ZPQA 4JCYA 3FWEA 3H8UA 4QM8A 5CVRA 3PLQA 5J3UA 2JVLA 5JSPA 2VPVA 4KU7A 4E2QA 4NDWA 4TLFA 3CF6E 1QWRA 1HW5A 3ROUA 1ZX5A 4OFGA 1WH6A 1XWRA 3DKWA 3CEWA 4AVAA 3QWGA 4FN3A 4X4CA 4RD7A 3ZHMA 1X57A 3CLPA 3HT1A 2IUOA 3E97A 4ZU5A 5D1IA 1Q3EA 3JZVA 1DGWA 1X2LA 2CV6A 5C8WA 2JCGA 1I6XA 5KHGA 2CROA 4X6RB 3OTFA 3OF1A 1X8MA 4ONUA 2ZCWA 5I91A 3LA7A 4Z59A 1UPIA 3HT2A 2PQQA 2XHKA 1ZRRA 4K8FA 3DN7A 4OLLA 4A2UA 4D7TA 3NW4A 1LR5A 1PMIA 2O4AA 3OQOA 2WIUB 1SQ4A 4O9EA 1PRUA 5A7LA 4I6TA 4IEVA 4HBNA 1OSLA 3L1PA 2H6BA 3NJZA 1ZREA 3FYMA 3KSCA 3MYXA 5KHJA 1X82A 3DV8A 3EBRA 3GN5B 4Z5CA 3JXCL 1LRHA 4Q0QA 4IA8A 2ZKLA 3WW2A 2DCTA 4KU8A 4IEYA 4I6RA 2D5FA 3SXWA 4AXOA 3LWCA 2KXLA 4AQ6A 1ZZ9A 4HVQA 1JFTA 2PUBA 2PAEA 3WW1A 4I01A 5K98B 1J1LA 2XKPA 2IVQA 3RYPA 1VJ2A 3OQMA 2QVSB 4HVRA 1UXDA 4YG7B 3R6SA 1RUOA 4Z5DA 3KGZA 3ZKCA 4YNIA 1ZZ6A 3NKTA 1R63A 1ZS4A 2GC1A 3H50A 5AVPA 1PNRA 4PIZA 5HI0A 3CLCA 1YFWA 4XF3A 1Q43A 2IVGA 1TQ5A 3M70A 1CJGA 4WVZA 5LEKA 4LA3A 2KEKA 1LB2A 4YG1A 3E5QA 4HSLA 3SCFA 4EWEA 4HN1A 2ET1A 4JV4A 2PUAA 4R8HA 4YSFA 2K0GA 2N7GA 2Q1ZB 3FHIB 1YFXA 3H3ZA 1I5ZA 4P9GA 3FYAA 4PU7A 2GZUA 4JCXA 1ZNPA 4IETA 1LLIA 3BALA 2B8MA 3BCWA 4X6QB 4LUMA 3KCCA 2IV1A 3R1FA 1DW9A 1WIZA 4N9HA 1YWKA 1H1IA 3NL1A 2XLAA 4KWLA 2WUSR 2R1JL 3C3VA 3OCPA 2XCJA 4XFAA 1QXRA 2D5VA 1WH8A 1QQBA 4YARA 2GC2A 3OP9A 4XFHA 1EFAA 5BY5A 1ZZ7A 5BUVA 1O7FA 2GU9A 4HZFA 1CAUA 2BGCA 1O5UA 2KEIA 4IESA 3LFPA 3ES4A 1J58A 4I02A 1IPKA 1VP6A 4KWKA 4E2SA 2AWIA 2C0ZA 2HSGA 1ZVVA 2QDRA 3UKNA 1U12A 4BH9A 2MQKA 4IWRA 4LA2A 3BD1A 5C6CA 4Q0PA 3E6CC 1RL3A 4UBGA 1GQGA 3H3UA 4Q0VA 4YYOA 1UD1A 1SEFA 3E5XA 4HLTA 3N4MA 3D0SA 3USSA 3BPZA 4AQ2A 5I0UA 3GN5A 4QGNA 2P17A 2PE5A 2OR1L 3M3IA 4IEUA 1O3RA 4Q0UA 1OCTC 2FJRA 1R69A 4LULA 2EF8A 2MHFA 1E3OC 2OYZA 1Y7YA 2PUGA 1FT9A 3FZ3A 3U11A 4ZU7A 5I0RA 3U10A 5CU1A 4X4HA 5BPXA 3BDNA 3F52A 4MV2A 2LYKA 2BYVE 2Z69A 4WZCA 3O14A 2PUDA 1UXCA 3KZ3A 2FMYA 2UYBA 3ES1A 2Q0AA 2WFPA 5LEJA 1RPEL 2GAUA 3QACA 1CAVB 4J1XA 1EY2A 3KGLA 4META 1LKNA 1YFUA 1PM7A 2VQAA 4LLOA 4ZU4A 3TNPB 2AW6A 1CX4A 4X4EA 1J3RA 1YSEA 1O3SA 3H9AA 2F4PA 1LQCA 4GULA 3NVCA 4EROA 3PXPA 2CAUA 4WBBA 2O38A 2IXKA 2EVXA 2BNNA 4R52A 4MH0E 4XF0A 5JSRA 1CAUB 2D93A 1FI2A 4MUVA 3EO6A 3UKTA 3OMTA 4I0BA 4MGIE 2R63A 1WLTA 3MPBA 2PIJA 4PU8A 2I45A 1L3JA 2IXIA 2PAMA 2XKOA 5JR7B 2PUCA 4YBAA 3ZDSA 3ST7A 4XFCA 3LA3A 5KHIA 2OFYA 3KJXA 2K9ZA 1ZZCA 2FQPA 3SCHA 3QQ6A 3O9XA 4I8TA 4IERA 1YLLA 2PYTA 1ZZBA 1OMIA 3SHRA 3OQNA 1PRVA 1UIKA 1G6NA 1UCXA 4HMZA 5KHKA 1ZRFA 2QNKA 1SFNA 2QJVA 3EUSA 4XFFA 4LUKA 5JSOA 2LYSA 1CAWA 1UIJA 2O49A 4X4GA 2HJIA 1L1MA 1ZUGA 1JWLA 2BNMA 3ETQA 1XRUA 2XIUA 2XLGA 3TNQA 2PA7A 3LOIA 4I3PA 4I0AA 1IC8A 4YRDA 1EPZA 3KXAA 2PUFA 2BJCA 2KPJA 1BDIA 3B7HA 1RIOA 4QGLA 3IIAA 3RZZA 4NVPA 5BXXA 2B9UA 1DGRA 3LISA 3MLFA 2LCVA 5FQ0A 1XE8A 2XGXA 2H6CA 2IXHA 3PNAA 2EWTA 3CROL 2UY9A 1VR3A 5I0SA 1NXMA 4HVOA 1O4TA 3I59A 1Y9QA 3S7IA 4CYDA 2CSFA 3E6BA 1POUA 5FLJA 5FLIA 1V70A 4KWJA 4IVZA 4F8DA 3FJSA 1GQHA 5KHHA 4QMAA 1YFYA 2PFWA 3CJXA 2PAKA 1OD5A 1RZRA 1JFSA 4FBFA 3H1WA 2ETEA 4PIYA 2BEOA 2IXLA 4BHPA 3NSTA 4E2GA 3H7JA 2GC0A 2UY8A 3D82A 1NZCA 3UFDA 4UBHA 4Z58A 3UKVA 4FAGA 4EV0A 1JUHA 2O1QA 3HZIB 3U0ZA 5EZWA 4MGYE 5FLHA 2BNOA 1QP0A 3CL1A 3RDIA 2IVBA 1WETA 5BV6A 3RYKA 3LAGA 4PJYA 1NEQA 2B5AA 1LCDA 1QP4A 1Q5OA 3G7DA 4XFIA 3F6WA 5CADA 1SQ8A 3FE5A 3G5GA 3DNVB 2LYQA 2IXJA 4QM9A 2E9QA 4KL1A 2GH2A 4I09A 4EWAA 1PERL 4D7SA 3BU7A 5E16A 4Z82A 1VPWA 4IEOA 2Q30A 3QOPA 1ZRCA 4Y42A 2GZWA 4YG4A 4Q29A 4ORFA 4MCXA 5FPZA 1LCCA 2ATFA 4XFBA 3EHKA 3CECA 3RNSA 4UXAA 1J3PA 2Y0OA 1OI6A 3KMHA 4XEZA 3PVBB 2Z2SB 4Q0SA 1CAXB 1CAVA 3HQXA 4IEZA 1ZRDA 3LZZA 3ACLA 2IXCA 1RUNA 3U3WA 2PHDA 5KBFA 1NYWA 5F1RA 4AVCA 2Q4SA 3SCGA 1JH9A 4IEXA 4HN0A 4F7ZA 4JTNA 1CAXA 3OD0A 1YUDA 3F51A 2LYLA 2MEZA 3H1YA 4J1WA 1RGSA 3MDPA 2IU7A 1QY4A 3JXDL 3SMHA 3MZHA 4Z07A 3D0JA 3QYXA 2WC2A 3GBFA 1UTXA 1RZRD 1DZRA 3LA2A 1HF0A 3EJKA 4LTAA 5K8SA 4O8BA 2UYAA 1H1MA 1ADRA 1QXJA 1NE6A 2D5HA 2OZJA 4IEPA 5I93A 2ICTA 3JXBC 3S7EA 1O3QA 1XE7A 1ZAYA 4FAHA 2QCSB 3FX3A 4QGMA 2D40A 1B0NA 5LRSA 1X8EA 2GRLA 1QP7A 2H0VA 5FDBA 2VECA 4MGKE 2KEJA 2XJ3A 1O5LA 5J7MA 4X4FA 4PU3C 3ZHIA 1WA4A 3H7YA 3D1NI 3WW4A 4XF9A 4QX5A 4N9IA 4XFGA 2H8RA 2O8QA 2OA2A 3I7DA 4MGZE 4GHJA 5LRRA 4PIXA 3DL3A 4H7LA 3I54A 3B02A 4DINB 1OFNA 4B29A 2XI8A 1QQAA 5I0TA 1DZTA 2L49A 1CAWB 5T3NA 2LYPA 5EFUA 2IC1A 3BS3A 4MX3A 1GT0C 4MCTA 3IWZA 2CGPA 3H1MA 2AXVA 1IPJA 1CQTA 3HIFA 2PPXA 1ZZ8A 1J3QA 1PRAA 1WGPA 2HKXA 4JVAA 1O3TA 2AXUA 2XLFA 3WW3A 2HINA 3S8QA 4L11A 4PU4C 4LEJA 3S0MA 1EYBA 3IVPA 4BYYA 4AVBA 2EBYA 3IDCB 1S7EA 2AUWA 4GQMA 3OGJA 3ELNA 2CAVA 2LYRA 5FCCA 2MPFA 3GYDA 3I59B 3EQEA 3H5TA
chains in the Genus database with same CATH superfamily
4YW3A 5K0UA 2XWJB 3UESA 3ZOIA 1RUD2 2PXFA 4RA0A 2DCYA 2PHXA 2ZGSA 3CKHA 4XIOA 4MXVA 4CDQC 1LEDA 1PIV2 4CEYB 1FX5A 1AYM1 1D0GA 2OZ6A 2Z5WA 4COZA 1MS1A 2JB4A 4OQ9A 4XDQA 4PCRA 2IZWA 3VKMA 2V09A 2E7TA 5FZ0A 2XOMA 1CN1A 4IEQA 1DIWA 5IVVA 3THPA 5FXWA 2R042 3ZFGB 5JXJA 5FPXA 4CUGA 1NERA 1AR92 3T30A 3ZFEB 4CP1A 4MGTA 4XJ9A 2LM3A 4GB32 4EN0A 1OOPC 1YIFA 4RR3A 1C8NA 4JQDA 1DLLA 4ER0A 1F8VA 5D21A 3OY8B 1SACA 3A9ZA 4COWA 2RV9A 2XONA 1BDHA 1D2QA 2O14A 2XL7A 1UW8A 5FY4A 3VZLA 5DAXA 1PGSA 2J7WA 1SBFA 4M4RA 2D6OX 3VBHA 3C7GA 2L1PA 2JG9C 3AC0A 4ARYA 2HWD2 2E31A 4LHNA 2W39A 5FP3A 1Z7S3 3QH7A 4Y5TA 1I3HA 1FOD2 4F8AA 4MXWA 2B5HA 3BB6A 5JMOA 2D3RA 1A6CA 1UX6A 1MFQC 3BKZA 3VK0A 3LEGA 2PHRA 1US2A 2LYJA 3RMXA 3J7MA 1YQ5A 3K3NA 3VHRA 1CX1A 5I8SA 1CJDA 2TEPA 1YHFA 4GXLA 4W6YA 3ZFGA 2GMEA 3L9JT 1JZ2A 1WLWA 3SEPA 4BJ0A 1G86A 2JICA 4LKFA 4PI0A 3QF3A 1X7NA 3HNBM 3LSDA 1KFXL 1KDMA 1UL9A 2VOWA 3M1HA 4BIFA 1UMHA 5FZ4A 1ZPQA 4QM8A 3PLQA 3GZEA 1H9PA 4NE9A 5FY0A 4AVSA 2VPVA 5FMCA 5ACA3 1EAH3 1QWRA 2P34A 3PHMA 1YI9A 1AYN3 4AI8A 4Y3OA 5HCHA 1YJLA 3GZUC 4OFGA 4XBLA 1VBB3 4QKBA 3CEWA 4ASKA 4WVLA 1OURA 4XC9A 3ZHMA 3CLPA 1LHUA 1W9SA 3HT1A 5FP7A 3ZXFA 4CPBA 3ACGA 4GB33 4AEDA 2HWB2 1Q3EA 4ZXKA 3JZVA 5A7SA 1DGWA 3ZYRA 3O1TA 2CV6A 3NQHA 5KHGA 3MO4A 4BB3A 1OA2A 1A78A 2MEV1 1X8MA 5LBEA 3U07A 2RDNA 3POIA 5FO9B 5I91A 3DXTA 5FPVA 4EZ4A 4CRQA 5KXBA 5KWRA 2FZ2A 1KEXA 3PUHA 1KJLA 2WT0A 1NLRA 1OFSA 3I2OA 3GZDC 2EALA 2VTXA 4FQ4A 2J42A 3K2OA 2ZBJA 1PRUA 1BBT1 1HXS1 3WF2A 2MEV2 2VZQA 3JQXA 3GBGA 2JIJA 5A7WB 5C70A 1OSLA 1ULDA 1REEA 1NXD1 2HEVF 3ZPYA 1SLBA 1ZREA 1D4M3 4ITCA 3ZVXA 3MYXA 3ZR5A 1W0OA 1X82A 4OUMA 1VMHA 1JZ6A 4QKNA 5F5IA 2QQIA 3IN9A 1B35A 4EQZA 1W6NB 1PVC3 1PNGA 1PK6C 1KXGA 2XUEA 3JU9A 1X9TA 3MV01 5FYHA 5FYBA 4N7IA 4G4FA 4GH4B 1ACCA 5FZHA 2BVVA 2WJSA 2PLV2 4IEYA 2FDIA 2BWCA 1NCQC 5FY8A 2QE3A 2ZJCA 1UU5A 4R4XA 5F39A 2PUBA 1LESA 1S0CA 3AKQA 1NA1A 3WQBA 1LTEA 1AUYA 2BJSA 4OHXA 1DLCA 5K98B 1J1LA 5LB6A 3T1MA 3ZIXA 1UXDA 2XXQA 2PHFA 4FPGA 3OEBA 1FOD3 4XPVA 4KI5M 5IVBA 5DDJ3 3WQ1A 1IZ3A 1GZWA 3NKTA 3WDTA 5HBAA 5AVPA 4NHYA 4WVZA 3QH6A 4JDMA 1CJGA 2CGPA 3GF6A 1XNAA 2KEKA 1VAVA 2V5YA 4LA3A 5FXXA 2ET1A 5CNAA 1JS9A 3SH3A 3VBRA 2K0GA 4D7YA 1X50A 3KHCA 1WMFA 4OCTA 1AVBA 5IAXA 4QU1A 1GWLA 3VBOC 3FYAA 4QQLA 4BWOA 4JGYA 2GZUA 4IETA 4XQWA 3ZSKA 4B8EA 4CTEA 1A8DA 1H4GA 2B4KA 3AYDA 4NWVA 5L9RA 3ZN5A 5FOBB 4BMEA 2JECA 4PLOA 1WUVA 2VZTA 2VY0A 3N9LA 1ZA7A 2CWMA 1GOHA 1MS5A 2EICA 4SBVA 1G9BA 3HBZA 3RMYA 5FZ3A 5FYYA 4CU7A 1ASJ3 2G4IA 1CWPA 1ONAA 2R1JL 3Q8BA 1DCSA 3JCIA 4Q4W3 1BEV1 1RXGA 2RHPA 3PUAA 1BBT3 1LENA 4DY3A 4GWJA 4G9SB 2P5BA 4UW3A 2BPA2 1X9PA 3KHBA 3WNKA 4EN8B 2GU9A 2WO7A 1CAUA 5T52A 1PIV1 2KEIA 4UYBA 3WNPA 1XOYA 4AI1A 2E32A 3LFPA 1IPKA 2PXDA 3R4DB 5F3CA 4E2SA 3W5MA 4LO4B 2C0ZA 2HSGA 3ME5A 1ZVVA 2QDRA 1U12A 2VOKA 1F35A 2WZ8A 4WZFA 3AP6A 5F8PA 5ACA2 3OBRA 4Q0PA 3E6CC 1WLCA 2TBVA 3HEIA 1S2EA 2A6VA 1X33A 4GALA 3SH5A 4Z2AA 1WBFA 3VBUA 5IK7A 4RGGA 1XNCA 3D0SA 3VKLA 1JZ4A 4CDXA 1XQNA 3OWQA 2BRTA 4QGNA 1UX7A 1GP6A 2R043 2XXAA 4JRAA 3M3IA 1N1YA 1Q8VA 1E5IA 2C4XA 4Q0UA 4XQDA 5KC5A 4CPBD 2Q8CA 1E3OC 1WWYA 2HWC1 3AVSA 1PO21 3FZ3A 4Y26A 4DXSA 5I0RA 5C4WC 4QU2A 4X4HA 5BPXA 1HB3A 5LCWL 2DTWA 2V72A 3TEWA 4JRLA 1C8M1 2LYKA 2JDYA 2VW0A 4PDWA 3PU3A 1K45A 5DN2A 1MEC1 3O14A 3ES1A 4ISRA 2Q0AA 2A3WA 2R063 2O8OA 5A32B 1CAVB 1PMJX 1LGCA 4J1XA 1EY2A 2R6QA 5T50A 3VB9A 5DRYA 2ZGRA 4NIDA 4ZU4A 3TNPB 3VDDC 3ZYFA 4BXFA 1VB4A 3VD3A 1ALYA 1RUH2 1TE1B 2VTXJ 1YSEA 2QQPA 3U4XA 1UOBA 5GLUA 4Z1VA 3WT3A 3QBQA 4IGOA 1VBD2 5A6ZA 1O3SA 3NVCA 2PXTA 4HPKB 2BNNA 3DPRA 2Q5TA 4R52A 4BA6A 4EWEA 4XF0A 3BOWA 2A3XA 5LA0A 3EO6A 3CHXA 4HK8A 3OMTA 4FCAA 3MGUA 3CZUA 3MW2A 2PIJA 4CCCA 1W3VA 3ZFEA 4M00A 1W6MA 4OUEA 2HWF1 4UFMA 1VBA2 1KGYA 2VGDA 2AACA 3I2GA 3ST7A 5L7OC 3LA3A 1Z7S2 3O0VA 4IXLA 3UT0A 1ASJ2 4OI2A 4XE9A 2OFYA 2UU8A 5KHIA 4WVMA 2FQPA 3BVCA 5L73A 1FMD2 4IGPA 3SCHA 2YFZA 4IERA 1V6IA 4N43A 3O1VA 1ND3A 1ZZBA 3OQNA 3O1OA 5DQ0A 2W5FA 1F15A 1PRVA 1RIRA 1UIKA 2YUEA 1G6NA 4JGZC 4W4ZA 2D98A 1NZIA 1ZRFA 2RS13 3SLIA 4AI2A 2FDHA 1Y43B 1ND3C 4D3WA 2XR4A 1QZXA 2RS12 4GH4A 1QJX1 4MHRA 1IS4A 1L1MA 2WFF3 3DXUA 4LBLA 4WM8C 4HT1T 4A4AA 4N7UA 3M3OA 1XSRA 1IC8A 5F6KA 5G05L 2PUFA 2RS33 1L7RA 3OJBA 1TG7A 2VW2A 1ZM1A 3VHOA 5FZIA 4QGLA 5JVVA 1XU2A 4NVPA 2R061 3LISA 1C5HA 1O8PA 4ZY9A 1XE8A 2XGXA 5FXVA 2EWTA 3CROL 1HN1A 5A3NA 1V9U3 4HVOA 5H9SA 2I74A 3IT8A 3N9OA 3NV3A 3V65A 3WW4A 4ET7A 2PXUA 3S7IA 4NHLA 2B39A 3GALA 2CSFA 4L8QA 5FKBA 3NNFA 3E6BA 4CYDA 1HB2A 4N53C 5FLJA 2CU5A 4I3GA 3WP6A 4DMIA 1V70A 4IVZA 5KHHA 3TRSB 1GQHA 5A3LA 3K77A 5A6QA 1QJU2 4QMAA 1SLLA 1BQPA 3POYA 2ETEA 1VMFA 3WD5A 4E27A 4LNVA 4AAXA 1OUSA 2JDHA 2P2KA 2UY8A 1MZ5A 1S2KA 2NYYA 2DTYA 4NRQA 3ZMNA 5HCFA 1HRV1 3NNJA 4WM7B 3UFDA 3VWSA 4Y20B 2ZACA 2A70A 2Q8DA 3ASIA 1R092 3FHAA 1CPMA 4J25A 4UBHA 4Z58A 1JMUB 2J7MA 3UKVA 3SISA 1LHWA 1FPN3 1GZ9A 4S2GA 1ZBA1 1JUHA 1W28A 2O1QA 5F5AA 3RDIA 1XNKA 2IVBA 3AL5A 4IE6A 3Q8CA 3U75A 3I2IA 3OGVA 1DQ2A 3WDVA 4MGQA 4XMAA 4P00B 3OD4A 1RUE2 1BLZA 1FAYA 2QQNA 2B5AA 1COV3 3VL8A 4QDQA 3WNMA 5LA1A 4GWIA 4CDUC 2WA4A 3BN6A 4RHV2 1UWWA 2GH8A 1RHI3 2KM2A 5F6LB 3PDQA 4XMIA 2D97A 3GJAA 2B45X 2XUMA 1YIPA 5GLVA 5SV5A 3U37A 3TEZA 2D44A 1PERL 5FWEA 3BU7A 4Q1PA 5A3MA 4YM0A 5E16A 4Z82A 1WKYA 4MYEA 5FJHA 4ES9A 3KL4A 1N3OA 2YBPA 4KNCA 3QOPA 2GZWA 2NZ9A 5HXVA 2Y33A 3IMMA 4AE2A 4AHYA 2WZR2 4K3UA 2DBNA 5FWJA 3A7QA 4ORFA 2GN3A 4XUTA 3HPNA 1QJX2 1H8TB 4ER7A 3I3BA 2PXLA 1DP0A 1ND2B 3CECA 4K21A 2FDKA 2Y0OA 4QDSA 2VVFA 4EN6B 3OGRA 4XEZA 2AR6A 4AI3A 4K7JA 4Q0SA 2A6ZA 3R4UA 4IEZA 4JDNA 3B7MA 1H1AA 3VBSB 3H8XA 4I0WB 2V73A 3O1UA 3SCGA 1JH9A 2DYCA 2RM23 3KM5A 3O1RA 4JTNA 3N36A 1R083 3F51A 1IS3A 2MEZA 2JG8C 1W8WA 2ZKNA 3C7EA 4EN9B 5C8CA 4YZ4A 3SX0A 1R082 2YYOA 3RZKA 3AYCA 1ASJ1 2ORZA 4E8DA 5GAGi 3AP9A 4IDZA 4CEWC 1HF0A 4M3CE 4PI2A 4YM1A 3TN92 4O8BA 4NIGA 2UYAA 1H1MA 1QXJA 2WS93 2OZJA 1DF0A 4QT6A 4E4HA 2NP0A 4IEPA 4Q4V2 3MIFA 4GB31 4RQPC 4Q1RA 3S7EA 3VBOA 1ZAYA 4FAHA 4LO7A 4PF5A 4NRMA 4COVA 4QGMA 4UWDA 1VLNA 1B0NA 3KT7A 3E1F1 3D3AA 4IV1C 5IVFA 1IQAA 2OKXA 4CCDA 1AL23 1UO9A 3NJYA 2KEJA 3KQRA 1SFPA 2XJ3A 1XU1A 2CL2A 1E5SA 4PLNA 4QQPA 1WA6X 3K46A 1EPWA 4X4FA 1NY72 2DVDA 2E63A 2WSVA 2Y8KA 5K4LA 1WA4A 2WDBA 1BZWA 3D1NI 1RUD1 3KZ4C 5FYVA 5CKNA 3ZPXA 4CSWA 5GKAC 1RUC3 2FCVA 2C5DA 4OMDA 2HWE2 1PGW1 1LAJA 4LLFA 3RI9A 1HN0A 4MGZE 2ZX2A 5DUVA 2JE9A 1SHWB 2D3PA 2FHRA 3I54A 3KT1A 3NAPC 4JGZB 2XI8A 4LBMA 4MXWB 3MPPG 4PBPA 3AK0A 4Q2FA 3K3OA 4B29A 2L49A 1CAWB 4YZ2A 5T3NA 2P6HA 1UY2A 5EFUA 2HLEA 1JHJA 5T5OA 3SR4A 1H2KA 1PVC1 1TMF2 2AUYA 4BHPA 4TYSA 2A6YA 3IWZA 3GJBA 5FZMA 3H1MA 4WM8A 1B35C 3OUIA 2WFF2 2A6XA 1ZZ8A 2HKXA 1PRAA 1O3TA 2R1DA 3OSDA 4GH4C 3MEJA 2VVDA 4BQ2A 1AYN2 2W1QA 4PU4C 4LEJA 3S0MA 1POQA 1Y9GA 1RVF2 3BIWE 3B9IA 1W03A 3EB7A 2XJPA 1AR83 5FY5A 2JDAA 1UF2C 3ELNA 1MACA 2CAVA 5FCCA 1UY4A 3CU7A 3GYDA 5JXIA 1I5PA 4M4PA 3NNLA 4QPGA 4FXKB 2W1UA 5ACA1 3HQUA 1OT5A 1ND2C 1RUF2 1WMDA 4EWDA 5JR2A 1H8TA 3IBMA 1RINA 1NY71 2WN2A 2ET7A 3A4UA 2BFUL 2PHLA 1YI7A 4LOSA 2W1WA 4YW1A 3LPFA 4BDVB 1OPOA 3NJXA 3HAGA 4Q4Y2 2VUDA 1X36A 3O0WA 4HKWA 1DWKA 2V3CC 4FPLA 3CO2A 2Y6HA 1UKGA 2ZGMA 4MHUA 2CSGA 3KCXA 3DPRC 4AGRA 3A22A 3AMMA 4E2GA 3PUSA 1BVP1 2EXIA 4JC1A 4IV3A 3TN91 1LU2A 2ZMLA 4XTMA 4L0PA 1URXA 2LALA 5FP4A 3VD7A 2MNGA 3M3QA 5E1RA 5A7PA 4AG4A 4ASLA 5LK7B 5LWBA 1R1A1 3R05A 3TRBA 1NA1B 4Q4X2 2W87A 4UT5A 3R0RA 3U14A 3V56A 5A70A 1W6OA 2GRMA 4JTOA 1S55A 4D8MA 3IDBB 5DUUA 1U2ZA 1VIWB 4XETA 3RPQA 4FBIA 3J8F1 5JOXA 5DZGA 1IG0A 3FFQA 1H0BA 3J7HA 4AK3A 2E26A 3E6DA 1ZYBA 5GZDA 5CFDA 2AXZA 3VBSC 3O12A 1RUI2 4Y4RA 4TSVA 3I4IA 2FMDA 1I1EA 5BNNA 5I8YA 5GJ6A 4Y4YA 4I2OA 4GJYA 1LOCA 1ZVFA 2F17A 4Z92B 4FT8A 5J48A 2WLQA 4R4ZA 1CZSA 3C8XA 1BK1A 2PTMA 4YG0A 2IWGB 3N35A 1W8TA 1ODNA 4JCYA 3VHNA 5J3UA 2ZX1A 3VZKA 5JSPA 1JI6A 1LULA 1KQRA 1H6XA 1W6PB 1AZDA 5SV8A 2BOIA 1DYKA 2VUCA 3LIHA 5JZGA 1WW4A 3DKWA 2ZHNA 1QNWA 2D43A 1UY3A 3QWGA 4X4CA 2W47A 4FFFA 4RD7A 3TWIA 5BNNB 1JYNA 3U78A 2CDOA 4K9SA 2JDPA 1PHMA 2V4VA 1W9WA 3C7FA 1X2LA 4YW4A 4EKGA 2JCGA 1HRV3 2R0HA 2XVKA 3WLUA 4QPIA 1JYXA 3T0DA 2YDEA 2DCJA 3KV9A 2UWCA 1TME1 1PO12 4CP9B 4DXTA 5ABJA 3ZFFA 2JKBA 4E9KA 1R64A 1BBT2 3LA7A 4CDQA 3K4DA 4N8MA 4LMFA 4NPLA 1HB4A 3KV4A 3HT2A 2EIDA 4MG2A 3ZIWA 2PQQA 4A2UA 4OLLA 3X29B 1VB2A 1LR5A 1WD4A 2XDVA 2O4AA 3OQOA 2WIUB 1EV12 3JD73 3T09A 5A7LA 1QQP1 2YROA 4IV1B 4XURA 4IEVA 2QTWB 4HBNA 2H6BA 5EXOA 3WP5A 3ZSEA 1G9CA 3NJZA 3UWPA 1UY1A 3EXUA 1V6KA 1HV0A 1W6NA 5DMYA 4YM3A 4YVSB 2HCNA 5DXDA 3DV8A 3O1MA 3EBRA 2ZGTA 5ABJB 5DTQA 1W99A 3JXCL 2WQZC 4Y5SA 4E4SA 1QNYA 5IVCA 2ZGQA 4TN7A 2GMMA 5A6YA 3W21A 2X10A 3AP7A 4NN0A 3VV1A 3WW2A 2DCTA 4KU8A 5H9QA 4AFDA 5HPOA 2D5FA 1F5JA 3V0BA 2KXLA 2VZSA 2VOXA 5CFCB 5L9VA 3AMNA 3WV6A 1VBB1 4I01A 4Y22A 5FFOC 4LE3A 3EYPA 4A6OA 4AR2A 1VJ2A 1OC1A 5HXMA 4P08A 1W05A 1W8ZA 1ZZ6A 1CD3G 3MUY1 1MS9A 4CDWB 2QBXA 2RS11 3MF9A 5AC92 3FLTA 1GP4A 4DXRA 4NHMA 1SPPB 4XF3A 5DT2A 1YFWA 4LO8A 4DE9A 3M70A 4RGAA 3CIHA 3E5QA 5JXGA 3SCFA 1OLQA 1AR82 3VKOA 4JV4A 4AHZA 4FTSA 2N7GA 1K5MC 1OSGA 1RUJ2 1ZBE2 5DPNA 1MR5A 3A0KA 1YFXA 3FHIB 1I5ZA 1FMD1 3LE0A 4E8CA 4JCXA 3BALA 2B8MA 1GKBA 3BCWA 1V6MA 5FZ6A 3UGGA 4YZ5A 1GSLA 2R30A 1Z0HA 1VBE3 3KCCA 3IDAA 2IV1A 5L7OB 4XHXA 4YVWA 3VGIA 4WM7C 2FBEA 2RJKA 4TZDA 2LLWA 1VRH3 1A34A 4Q4Y3 2J1RA 1YWKA 5F5CA 1H1IA 1KITA 2BW8A 1FYUA 5FAXA 5H9PA 1K42A 4OHWA 1OVSA 1RYYA 4FP2A 4Y5Z0 3ZN6B 4Q27A 1QXRA 4FPEA 2IFRA 3IB3A 1WH8A 3RG0A 1QQBA 4DE8A 3KF5A 3Q9OA 3USUA 3VBUB 4CU9A 3A9XA 2GC2A 1O59A 4QPIC 4FFIA 3AFGA 4XFHA 1BKZA 1VBD1 2GN7A 5FZKA 2BGCA 3VBHB 4AEDC 1HKDA 4IESA 3B69A 4K8RB 1GFF2 1GWKA 2YBSA 4I02A 4EZHA 1VP6A 2AWIA 3UKNA 1ZBA3 4N43B 4IWRA 4QD2A 1QJX3 4LXLA 3BD1A 5CA6A 2NM1A 3DUIA 1VAKA 3VBFC 2YPJA 4AZZA 2ARAA 4C0BA 3N7LA 4GWNA 1SEFA 4LHSA 4HLTA 1C8M2 3M4FA 3N4MA 3ALQA 3BPZA 5I0UA 1NUKA 4W65A 2P17A 4CCKA 4FPKA 3RZHA 5IW0A 2BGOA 1R69A 1WCQA 3ACFA 4H7MA 4LULA 2EF8A 2MHFA 2WYSA 3GBWA 3ZO0B 2PELA 5EIYB 3NDBB 3VLBB 3U10A 5CU1A 3W5NA 4BQYA 4XJWA 1QHDA 5ISLA 1UXZA 4YFWA 3HNYM 3FMGA 2X09A 3WNOA 1LOGA 5IATA 2OIIA 3A0NA 5J36A 2A6WA 4LK6A 4WZCA 4CCMA 2UYBA 4IUGA 1UQXA 2GMPA 3TELA 2ZGUA 2CY6A 2GAUA 3AMQA 3IDEA 5JUVA 1Q8QA 4XJAA 2SLIA 4META 1G7YA 3HOBA 1YFUA 4BXSV 1G9AA 1PM7A 2JB8A 4IL7A 1NCRB 2BBVA 1AR71 2VBDA 3VDCA 4QX1A 4JKLA 1CX4A 2W0XA 2VO5A 1GNYA 3DKQA 2J22A 1O8SA 3RZGA 2VC9A 1FNZA 3POEA 4TXWA 1QJFA 2VEOA 1P8JA 1UZ0A 4K6BA 3ZFFB 5JLVA 3H8RA 2H0BA 1LQCA 4IV3C 1GQPA 4DZGA 4AL9A 1JUIA 4LBQD 4NPRA 3VBRC 3MW4A 4GD4A 2XB6C 4LOTA 4RN5A 4DEQA 1W06A 3MLJA 2D93A 4MUVA 3FBYA 1Q8SA 1WD3A 5FMOL 4JQTA 5FO8B 1AL0G 4PLMA 2XKOA 2R072 3CZJA 1EV13 1PZ9A 2DVAA 2QQVA 2PUCA 2VQTA 3S57A 4DO0A 2G9FA 2VMDA 1CIWA 2DVGA 3ZFFC 2P3KA 2J1TA 2FDGA 3VDDB 1OH4A 3AYEA 4B4QA 1XNBA 1FPN1 3N3HA 4YFZA 4UW5A 1IS6A 2DFBA 5K0UC 3POFA 3POWA 2DURA 3N9NA 3O9XA 3HN1A 1NW3A 4QPGC 5FP9A 3M9LA 1RUJ1 1ZBE1 3VZJA 3SHRA 4GWMA 1XNDA 4NWWA 3GCWA 2WNVC 5DG2A 3VD5A 1AHSA 4MADA 4XCAA 4N90A 5KHKA 4V2VA 3RJ2X 3G0TA 2PHUA 1RHI1 3JXSA 5FV3A 2NMOA 2LYSA 2A1XA 3U1XA 3WY6A 1GV9A 5G04L 4X4GA 2HJIA 3GHMA 3A21A 2ADDA 2BNMA 3DECA 3CQOA 1XRUA 1ULOA 3ETQA 4XJ8A 3KV5A 4YRDA 1EPZA 2GNTA 3INAA 1L7QA 4XUQA 5HV0A 3MHZA 1C1LA 3WG3A 5B4XA 5A7NA 1CQ9A 2KPJA 1G8WA 2AZ5A 3LSEA 4P14A 5K0UB 1RIOA 3H0OA 4OI1A 1UOJA 1WW6A 1VBA3 1YYNA 2RJ2A 3MICA 2NLRA 5LY1A 3RZZA 2QFEA 5BXXA 4BK4A 2B9UA 1DGRA 4M0HA 2PLV1 3K75B 5CFDC 3MLFA 5KXCA 2YXSA 1CZVA 4P9XA 1RUC1 2H6CA 4RHV1 1AYM3 2RS32 3KF3A 3S5AA 2DWRA 2PXKA 2FFHA 3PU8A 4P5YA 4OUSA 5FXZA 3UGHA 4LT5A 3WG4A 1RUE1 4AGGA 3OBZA 2W95A 2Q1FA 3PMEA 3IAPA 5DDJ1 5EPAA 5FLIA 4KWJA 4F8DA 2XHNA 4QDRA 4YGCA 1FNYA 5CZKA 3GZCA 2W68A 1ZBA2 4UFLA 3UJOA 1OD5A 1RZRA 1GMMA 2VZ1A 2WAOA 3CDZB 2BEOA 2IXLA 4PIYA 4IV3B 1W2OA 1UKRA 1KS5A 2W46A 5FTTC 1K5JA 3VBFA 5FR3A 4B7KA 1JOPA 2OUJA 1XSQA 4IGQA 4Q8KA 1SLIA 1GP5A 2VMCA 1QU0A 3J7NA 4LK7A 4LKEA 4B4PA 3AP4A 3T1LA 2AEYA 4YW7A 1JZ7A 1IG3A 1UXXX 3RWNA 3HZIB 1QJU1 2LUWA 3DEMA 4QHZA 4TTGA 2HH9A 5FLHA 1KDKA 4DB5A 2D7FA 3HBKA 4NIIA 4AFAA 1JH5A 5BNOB 3PUIA 5JIUA 1OVPA 1QP4A 2CWSA 2ZX4A 3KV6A 5EP9A 4W8JA 4QX8A 5A1AA 5L36A 1K5MB 2P37A 2HYKA 3AYAA 1OOPB 1SQ8A 3FE5A 3G5GA 2VXRA 5ERLA 1F31A 2LYQA 1MZ6A 1RUD3 2PXJA 4KL1A 2GH2A 2HYXA 4I09A 4D7SA 4Y22B 3VKFC 4JDOA 4QX2A 1HDKA 4IEOA 4OZXA 3Q8AA 4HKOA 1VMJA 3LDKA 1ZRCA 4LIVA 4IE4A 4D6QA 3FUOA 1N1TA 1W3XA 2BZDA 3SC7X 4MCXA 2JDZA 2DCZA 2VNOA 5GLTA 1LCCA 2JX9A 5CKQA 3AFKA 5FREA 3UYJA 4PDWB 1K5MA 1KD7A 3EHKA 4BQ5A 3WNNA 5JIAA 4C1XA 1OI6A 2RS51 3LKJA 2ZOEB 2RMU3 2ZGPA 2VD7A 2CTVA 2Z2SB 3PVBB 2XG3A 3RJRA 1CAXB 3WVJA 1QXPA 3BYWA 1SDDB 2A75A 3LZZA 1RUNA 1ZRDA 1AXKA 2Q8EA 3OBTA 2PHDA 2EIBA 1NYWA 3NAPA 1ENSA 2ZHMA 2Q4SA 4XUOA 4Y1XA 3WF1A 3KQ4B 5F2SA 1W8NA 4HN0A 5IK5A 3WF4A 3J8F2 4CDUA 5FRAA 1CAXA 5FYCA 3TB0A 1YUDA 2Q8OA 3H1YA 4W6XA 1Q8PA 3MDPA 2IU7A 2ARXA 3MZHA 2WN3A 2BGPA 3AZVA 3D0JA 4ZS2A 1R1A2 5GLZA 4BU2A 1UTXA 2DVBA 3F2ZA 4H2AA 4QXBA 3EJKA 5K8SA 1ENXA 3ZXKA 5GAHi 1VBA1 4GMP3 2D6MA 1ADRA 2RR11 1POV1 2AH2A 2D5HA 5I93A 4FOYA 2R1BA 1ST8A 3IZOA 1GOGA 2HFZA 4OVEA 1VBD3 2BVBA 1JOJA 2QCSB 3VD9A 1S1AA 1V0AA 5A7OA 5LRSA 2VZPA 1HRI3 1X8EA 5J09A 1SDWA 2GRLA 3LEKA 5FUPA 1K3IA 2VECA 4AI9A 2ZEXA 3M3CA 3V64A 1IGOA 2QQMA 4RQPB 4E4DX 5AFBA 1XJAA 5TSWA 4PU3C 3W9AA 2YGLA 1IPSA 3WG1A 5F3IA 1AR72 1NQDA 1QQP3 4XF9A 1RUF1 4AQSA 4QX5A 3AXDA 1WCDJ 2O8QA 2OA2A 1UAIA 2WAAA 5HCAA 1U5XA 4GHJA 2YHJA 3MLLA 4CUCA 5A3WA 5J1XA 1LHOA 2F4LA 1OFNA 3B02A 2F6BA 4DINB 5FPBA 4Z8BA 1QQAA 2HWB3 4D6RA 4WM8B 2LYPA 2OQ7A 4B3NA 3U4SA 2J1EA 4QB6A 1D7PM 1N47A 2OQ6A 3LF7A 4YGEA 1Q56A 3HMYA 1JN2P 1H2NA 4MCTA 4UFKA 2VMIA 1PO22 4LBQB 3FL7A 4QXCA 2PXPA 1DDLA 1IPJA 1CQTA 2WFF1 3ZXLA 5J96B 2PPXA 3BGAA 1SZBA 4LHKA 2AXUA 1GLHA 2A7AA 3AX4A 3MIBA 2ARBA 5E89A 1BCXA 2YB7A 2GNMA 1S2BA 3GCXA 3CMGA 2WLPA 4CXXA 1S7EA 1F4AA 4GQMA 3OGJA 4CP0A 3L2YA 4JGZA 4JZRA 2ZEWA 3WEZA 1VBC1 2Z79A 1JOBA 4EN7B 4N43C 2VTFA 1BMV1 2DU1A 1HIXA 3R6SA 3GDBA 3ILFA 3A23A 4CXWA 3BUCA 3KLSA 4CCLA 1UYYA 5K9YA 3WG2A 1E57A 4S2FA 1DQ4A 1FXZA 1LMB3 4XF1A 4OB4A 1AL21 2PUEA 3MIGA 4NMIA 2Y34A 5C5TA 1IQDC 3C7OA 5JCTA 2IVJA 2RS53 2JKXA 3M2MA 5FYTA 2YC0A 2EA7A 3NAPB 1QPZA 4B7EA 1POV3 3JBG1 1NE4A 2GC3A 2GP3A 1OHFA 2A73B 4A42A 3ACHA 1MQTA 1QMJA 4LE4A 1YQ2A 1H9WA 1GICA 2Q1MA 1QIQA 4KBBA 5EHDA 3VBOB 3VDAA 5JMCA 1H2LA 5JOZA 1M06G 2VMEA 1J59A 2BTVC 2A5ZA 1QJY2 5D2AA 2FCUA 1UZWA 1WZXA 1Y3TA 2DU0A 4YW5A 4HETA 1VRH1 2Y64A 4FPFA 3ENRA 4HOOA 5LY2A 4F3JA 1RUJ3 1ZBE3 3L2HA 4UAPA 4EYUA 5BNPA 2HEWF 3E5UA 4XACA 4ZZ5A 3AKPA 1CGPA 1QOSA 2BQPA 2XJRA 3FFZA 5FPLA 3VDDA 4JHZA 4HSJA 1L7LA 1ODMA 2R49A 2VMGA 4I6UA 5JAXA 1AU7A 2JDNA 5EV7A 5LZ6A 1RXFA 5BYNA 1UPSA 1EUUA 1N1SA 1RUG1 3O0XA 4XF4A 4AF9A 2KZ8A 1PMHX 5CFCA 1XXNA 4CP2A 1LGNA 4XVHA 1C3HA 3GUUA 3NZLA 1O6UA 2EAAA 2XBO1 4KMQA 2LNMA 1PM4A 2R7EB 5C4WA 1PIV3 3VBRB 2ZMNA 4X4DA 1JXNA 2WA3A 4X4BA 2AC1A 4QXKA 5FYIA 2V4AA 3D5OA 3VBHC 4AEDB 3WNXA 1CJPA 1K12A 5KC6A 1DQ6A 2AGSA 2DUPA 1UN1A 3ZN4A 4AEJA 4JQRA 4C1WA 5CVRA 4CDXC 2JD9A 2DVFA 5D8AA 3AJZA 2WZPP 3T3YA 4FPOB 1NCRA 4EE2A 4AI0A 4NAOA 4E2QA 4TLFA 5GZCA 3CF6E 1HW5A 3ROUA 1VBC3 2WNEA 3AZZA 3OG2A 5IWFA 2L9LA 3FHQA 1PGL1 1WH6A 1G9FA 4XAAA 5FJKA 1V6LA 1XWRA 1HV1A 3ACIA 4BE3A 3BTZA 5IVYA 2Y6FA 5JOYA 1ENRA 3I2HA 2IUOA 1GWMA 3ZN6A 4I30A 3ITQA 1JYWA 3PJYA 4CZSA 5C8WA 1W2UA 1JODA 3DYPA 3P3NA 2CROA 1F9KA 4IW3A 4X6RB 4ER6A 1MEC3 4PHZA 1RUI3 2UURA 3BI3A 1UYPA 2ZCWA 3LFIA 4K1YA 3QLQA 2WS91 4UF0B 3Q8FA 4Z59A 2QQKA 4RS5B 4IQPA 1SLAA 4D7TA 5JOWA 1ZRRA 4K8FA 3DN7A 5BNPB 1HRV2 3NW4A 4DQAA 4C8DA 2HBTA 4O9EA 1SQ4A 1NLSA 4FXGB 4MVTA 3P3PA 2RDQA 4I6TA 5FMBA 3WXPA 1PO11 1SBEA 1VBE2 3H8OA 4K20A 4MOAA 4QB1A 3FYMA 3KSCA 2WT2A 5FZ8A 1MQTB 3GN5B 3AP5A 2BERA 1LRHA 1W6OB 4L92A 2VH9A 2W2IA 4HANA 4IA8A 1B09A 4QKFA 4RGKA 3T4HB 4AQTA 3URFA 5DUWA 4NIHA 4XBNA 1QH6A 1DQ5A 1PGL2 5FMDA 4URAA 1BYHA 5JXHA 4I6RA 2R062 5A3PA 2PN5A 3SXWA 1E5HA 1JU3A 3LWCA 2XPJA 1CONA 1JFTA 3KS7A 4YGBA 3WDXA 3A9YA 5D8AB 4X8NA 5IAVA 4ES8A 2R16A 4XUNA 5L9BA 3GM8A 3S5QA 1GU3A 3RYPA 2OVUA 3ZYBA 3HR9A 5DAVA 4HVRA 4YG7B 3FLPA 3WF0A 2JG8A 4Z5DA 2R073 1UZVA 2D6LX 3FLRA 2W9XA 3B94A 3KGZA 2RJLA 3MUZ1 3P5BA 2PXBA 4FPHA 4Q8LA 2Y26A 4LQRA 4XW3A 5FZOA 4CVUA 1VPHA 4ATFA 2GC1A 1GANA 5APAA 2E51A 4CU8A 1F5FA 3H50A 1PNRA 4PIZA 4FOVA 2WWUA 4YLZA 5FYMA 5HI0A 1Q43A 2IVGA 2QDNA 4BLIA 5LEKA 1W0PA 4YG1A 4HSLA 2CNAA 1RUG2 1Y9MA 3D6EA 4FOQA 4HN1A 1KS4A 1QDCA 2PUAA 1WW5A 3FBMA 4QPIB 5A3OA 3Q8EA 2ARCA 1PK6A 4W6WA 3H3ZA 1W2TA 2EF6A 2EIGA 3DYMA 3M8LA 3OBAA 4O65A 4R9AA 3DF0A 4D94A 5T5JA 1IKQA 3NXHA 1W2NA 4AFMA 3ILNA 4Q4X1 3WP3A 4YM2A 2YGMA 2XVGA 5C8CB 3MIDA 5T5PA 4FTEA 2JE7A 4HFSA 4Y1ZA 3O5SA 3SKVA 3R1FA 2JENA 1JYTA 1DW9A 1ULFA 3DPRB 2ZAHA 2FCTA 3WNLA 1V9U2 3QFIA 4BMBA 1RUE3 3NL1A 2WUHA 1GZTA 2J1SA 2XLAA 4KWLA 3WCRA 2WUSR 5F37A 3C3VA 3RZMA 4YG3A 5HCBA 4CU6A 2XCJA 4XFAA 5HV4A 5AVAA 1W6MB 1XYNA 4BQWA 4A7YA 4HPKA 1ULCA 4W50A 5CKMA 4YARA 5IHRA 2VNRA 4YVWC 1EFAA 4JAAA 5BY5A 1O7FA 4HZFA 1H30A 1O5UA 3GZAA 2VVEA 1WLDA 2BBAA 3KVAA 3ES4A 2P3IA 4NO4A 1AXZA 5C9AB 1ULGA 1BJQA 2P6CA 4KWUA 3SNMA 2VL4A 4DRRA 2VMFA 5C6CA 1OUXA 1RL3A 1VBC2 5GZFA 4A44A 3HJRA 3PTRB 4Q4V3 4XZUG 2VW1A 2WSUA 4Q0VA 4YYOA 5ANQA 5A3UA 4QB2A 2WABA 5C3PA 1S0IA 4GAZA 3T08A 4AQ2A 4JKMA 1AYN1 1OA3A 2ZGKA 3PURA 3NJVA 4N53A 2RDSA 5DAWA 2PE5A 1IOAA 2E53A 5E8AA 1O3RA 1LU1A 1R1A3 3OPWA 2W1SA 2JDKA 1OCTC 2FJRA 3LDBA 4QPYA 4Y1VA 5CFDB 5IYYA 2RG4A 2D6NA 2OYZA 2EIEA 1Y7YA 1IS5A 3IKWA 3MFAA 4Y1UA 4L9BA 2EXKA 5DZFA 3P6BA 3UK9A 5IT6A 5C3SA 4OBMA 2VCMA 1QEXA 2J7UA 3F52A 4MV2A 3MIHA 2WQ8A 4P9LA 2BYVE 3BOPA 5T55A 1T6BX 2FMYA 3JQWA 3KZ3A 1KFUL 4DEVA 5LEJA 2WFPA 2YV8A 1RPEL 2A71A 1CR7A 4UFJA 1R093 2JQEA 4MGSA 1OLME 1PGW2 5FZGA 1HQNA 2XJVA 4YGDA 2AW6A 4X4EA 1J3RA 4UFIA 4YZ1A 3AZWA 4U36A 5F7UA 1O91A 3I2DA 2D3SA 3NRUA 3WQ7A 3H9AA 2F4PA 4GULA 4QX3A 3BTXA 1H8VA 3HN3A 2CAUA 4GKXA 4WBBA 4OHYA 4IE5A 2IXKA 4GMP0 4RR3C 1H6YA 2NMNA 3ZSMA 3OGSA 2VBPA 5JSRA 1BEV2 1CAUB 2ZAAA 3WP4A 4A6SA 3UKTA 2YFUA 4MGIE 5B2GB 2OXBA 1WLTA 1QKQA 1UZYA 1LHNA 1L3JA 2IXIA 2PAMA 5JR7B 3WR0A 2ZZJA 3OY8A 4CEYC 5FK8A 3ZDVA 3ZDSA 1N1VA 5ABJC 1SLTA 5FZ9A 3C7HA 2OPWA 3F95A 1NG0A 3LEIA 2BDRA 2ZXQA 4WV8A 4B1MA 1YQCA 2PQSA 2YMZA 3AZXA 3QQ6A 4I8TA 1MVEA 2GALA 1YLLA 4GA9A 2JDMA 5FZCA 1OMIA 2B42B 3TEYA 2ODRD 2JWPA 1O4YA 3B9CA 1NOVA 3AMPA 2LLVA 4V2WA 1WCKA 3AXEA 3POGA 4FVVA 1SFNA 3V0AB 3EUSA 2YBDA 1DG6A 1H4HA 1TVGA 2VE1A 4LUKA 4XFFA 4BQXA 2RMU1 1UIJA 2ZTNA 3ABZA 3HNMA 2O49A 4S2DA 1V00A 3WF3A 4XOGA 1ZUGA 1JWLA 3AMHA 3NO8A 4KBZA 1BXHA 1D2SA 1HLCA 3T4VA 2PA7A 3LOIA 1Q8OA 2WZR1 3I3MA 2GNBA 1DULA 1DGWX 1HRI1 1TMF3 2Y38A 4PQ9A 3ZMOA 1AR61 5DTRA 5BNNC 2XWBB 4P9IA 1EUTA 3WHTA 2X8KA 3B7HA 2ZPXA 4LPLA 3OYWA 4OHZA 3TFLA 3PUQA 1JW6A 5FQ0A 2LCVA 2UWBA 5GZEA 1CVNA 4Y20A 3T0AA 4GMP1 2RDRA 1VR3A 1NXMA 2DFCA 3KD4A 3OPZA 3MW3A 4Q4W1 1Y7BA 3UL2A 3WOGA 4QPGB 1Y9QA 4S2HA 1V6JA 3MV11 1SBDA 3GNEA 4A7KA 2WWSA 2WINB 4QKDA 5A1FA 1POUA 2ZGOA 5E6HA 2K2SA 2E7AA 3OOXA 1XNTA 2JIGA 3VUOA 3FJSA 1VBE1 3DCQA 1MVQA 4RS5A 5FYSA 1AJKA 3AKRA 1YFYA 2BP6A 2QQJA 3THTA 2PAKA 4JGYB 4FBFA 3H1WA 1PNFA 3CJIC 3OYWB 1R091 3H7JA 2GC0A 3D82A 4HK9A 1HQLA 5JI7A 5LATA 1OOPA 2XJSA 2YBKA 2YZ4A 5T54A 4BCUA 1LNSA 4L99A 3ORJA 2RR13 2BWAA 4FTBA 2VMHA 1AX1A 1STMA 3JUUA 1GZCA 1POV0 3B3QE 1DZQA 2BNOA 4MGYE 5EZWA 4AFCA 1RMU2 1WETA 4XUPA 5DDJ2 4HONA 3RGBA 5BV6A 4HKLA 1QJZA 1LOFC 3LAGA 4A41A 4PJYA 2HWB1 5A7QA 1DFQA 4DS0A 4YVSA 4Q4W2 1ND2A 4XFIA 3J7LA 2C26A 5FBJA 5LA9A 5C4WB 3ME2A 5I0DA 3DNVB 4RFRB 1W04A 1OPMA 2IXJA 2E9QA 4QM9A 4CEWB 2NQYA 2QQWA 4H14A 2X5IC 2PLV3 3DM5A 5FZ1A 3UV9A 3PE5A 1NT0A 4Q4X3 1ZRIA 2W08A 2C9AA 2WNVB 4LBNA 4QQOA 5KXDA 4WVVA 4XXAA 3ZXEA 2JG8B 1AR62 4Y42A 1V6NA 5IK8A 2XXPA 1RUOA 4YG6A 4DUXA 1QJY3 5FPZA 1QJU3 4FPCA 1BVVA 2QQLA 3PMSA 2BUKA 1W0NA 2A3YA 2ATFA 1I9RA 5LBCA 3H3LA 1J3PA 2TUNA 4C90A 3RZLA 1NCQB 1G9DA 1OQ1A 1C5IA 1MS3A 3HQXA 2WNUB 2IXCA 3J26N 4DFSA 1MPXA 4YW2A 1XE0A 5C5UA 1AF9A 1OA4A 3PVOA 4UFHA 4F7ZA 2PXVA 3KCYA 5DAPA 4V1PA 1NLQA 4YVSC 2B9VA 5EJ3A 1C28A 2GDFA 1CPNA 3WZ1A 1QY4A 3SMHA 4Z07A 1LECA 2HBUA 4EKIA 3GHNA 2VCCA 3QYXA 2FDJA 2WC2A 1RZRD 1DZRA 1FV2A 1NA1C 2WO1A 3IMNA 2XBO3 3LA2A 5FK7A 3ZPOA 1VRH2 1NCQA 3M3EA 2LS6A 4OZOA 1NE6A 2ICTA 2VXJA 1RVF3 4HRAA 4HL0A 1A8MA 3WUCA 3NMBA 1DQ0A 5F2WA 3JBG3 3FX3A 4K40A 4KH9A 4RQPA 2ZX3A 2D40A 3TEXA 3KB5A 4CXYA 3JBG2 2XVLA 5FDBA 2KD7A 3GZTB 4QQHA 3SKJE 1AR93 5FBZA 5ANNA 5JUWA 4A3XA 1ZA4A 4CEWA 3ZSLA 5J7MA 4ZPIA 2GSYA 3ZHIA 5FUIA 2X05A 2OS2A 1S0JA 1HJFA 2ORXA 1XPWA 2VQUA 1ND3B 2YC4A 3LFMA 3NKGA 5F5QA 2Y6LA 5FZDA 1C4RA 4INDA 5IVEA 1OBNA 5DAQA 1MZEA 3JD71 2ZA9A 5E88A 5CYYA 2VULA 3J9SA 1AXYA 2JD4A 4AEMA 4H3WA 1MEC2 5I0TA 4IE0A 5DABA 1WMXA 4LBQA 3BTYA 1QDOA 1R1ZA 1DU3D 5FZ7A 4Q2JA 1SCRA 2QKDA 2PXQA 4OI0A 3AZYA 2X5IB 2IC1A 5KXEA 4MX3A 3VZNA 1GT0C 3I2KA 2OW4A 4CDWC 3LPGA 2J1AA 1MZFA 1S0GA 3SEEA 5JWPA 4Q5OA 5JZGC 3R09A 3WW3A 4GKYA 1PVC2 1WCUA 4AEKA 3RS6A 4R9CA 3IVPA 5EJZB 4AVBA 4BYYA 2EBYA 3ATGA 3IDCB 3N9PA 4XQ4A 3BU0A 2AUWA 1LCLA 4AFBA 3N7JA 1COV1 3WDWA 2MPFA 2WYFA 2BOJA 3JD72 4DRVA 2E33A 3J4UH 1LOAA 4UF0A 2WNOA 2WWJA 2QQOA 4RHV3 5C33A 4JVAA 1JTZX 4ZU7A 1RZSA 2C9KA 2XSDC 2DBIA 5I8TA 1LGBA 1WCSA 1OQDA 3IAQA 3RYRA 3ZFGC 1O4XA 4IEWA 2QZ3A 2VU9A 4X4IA 3HVDA 4LBOA 5FQ0B 4DPNA 3PTYA 2HEYF 2XJUA 5LASA 3THDA 2FD8A 2PHTA 2AENA 1ULPA 3T2OA 2PHWA 3IPVB 2DDUA 3MBWA 3VBSA 1RTVA 1SCSA 1VAMA 5FMOS 2VZVA 3SH4A 3W59A 1EP0A 1D0HA 1F4HA 1UNBA 2B7YA 3M7AA 4LITA 2VOVA 5A1LA 4XXPA 2JG9A 2XQRA 2AREA 1A3KA 4L2NA 4LKSA 1QF3A 4O61A 4PT6A 3WUDA 1RC6A 4XJUA 3ZYJB 1PX3A 1SMVA 2RR12 4MO3M 2OPKA 5FZBA 4OMCA 4ER5A 4G3YC 2OT7A 1NCRC 3FMYA 2VZOA 5IFTA 3MI8A 2D6KA 4NHXA 4D0QA 1GR3A 2E6VA 5FP8A 1DQ1A 5EWSA 3UNPA 1R081 2XL9A 5K7PA 2MEV3 5CG8A 1UMZA 3G6JB 3TN93 3H42B 4CDXB 5JPNB 4WVWA 5EYXA 4C91A 3ZSJA 4AVTA 4NUBA 1FMD3 4TWTA 4O9GA 2VQ0A 5FYUA 2P4EA 2ZZQA 1AX2A 2LW8A 3ZYGA 3T2PA 4C0HA 1W6PA 4L97A 4OI4A 2L8NA 5CFCC 2A6CA 2RS52 2YPDA 3J8F3 4Z2WA 4Y24A 4ISQA 1LOEA 2ICPA 5AC91 3UETA 4Z5HA 3MIEA 3BTAA 2Y60A 4R9DA 5FPUA 1H8TC 2RE9A 5FO7B 1XYPA 2DV9A 4MZUA 4FPJA 5JPMB 1TNRA 2QUOA 3ZXJA 1MS4A 2HWD3 5A6XA 1VBB2 2EAKA 3FWEA 5DRTA 3H8UA 3RSJA 2R0FA 2JVLA 4CCOA 3N7MA 1VALA 5JZGB 4XIKA 1UMIA 4KU7A 1CIYA 4NDWA 1HXS3 2VNVA 3AB0A 3ZYIB 4LO6B 2CGOA 1ZX5A 3T2TA 3DGTA 4Q26A 1J1TA 4ATEA 4QX7A 3WQ0A 3HQRA 4XHBA 1E5RA 4AVAA 2FDFA 4FN3A 1S0EA 1MQTC 1X57A 2WZEA 3E97A 4ZU5A 3POBA 4LBJA 5D1IA 3W20A 4LBKA 1I6XA 2C6SA 4RR3B 3WHUA 4A45A 3OTFA 3BIEA 3CBNA 3OF1A 2ZEZA 2QQUA 2VAUA 4LR4A 1QQP2 4ONUA 2VCAA 3RWKX 4BLJA 4TLGA 5M0TA 2ZS6B 1EV11 1UPIA 2JXAA 5C9AC 2XHKA 3IIIA 1RMU3 2LROA 3WSOA 4CCJA 1PMIA 4B1LA 3USUB 4RYDA 2ZMKA 1C1FA 3UGFA 1JYCA 1OKQA 4NROA 2D6PA 4AW7A 4CDQB 5A3TA 1S4CA 1TZOA 1WBLA 3KT4A 1W39A 3TAYA 4EJRA 4QQ2A 1LODA 4R9BA 3ZKUA 3L1PA 1JYVA 1T2XA 4BM8A 4ASMB 1FATA 5KHJA 4XAEA 4NHKA 4IV1A 3SQOA 3DYOA 4Z5CA 1M4WA 3NV4A 1HQ1A 4N53B 5L19A 1DHKB 1WMEA 3OB8A 3VZMA 4Q0QA 4CDWA 3I2FA 5EQUA 1CZTA 2WNUC 5J98B 4CCEA 2ZKLA 2RS31 3HWJA 4ZHNA 4NPMA 1AJOA 1OXCA 4AWDA 5FZLA 1XC6A 5IUQA 4EQVA 2J1UA 5IK4A 4AXOA 2CDPA 2O0OA 4AQ6A 1ZZ9A 4HVQA 4PDWC 1QOTA 2PAEA 3WW1A 4KGQA 3P1IA 4QPWA 1ENQA 2JEMA 2WIIB 2IVQA 2XKPA 3I3DA 5F32A 4ER3A 3OQMA 2QVSB 1SPPA 2W3JA 3S6PA 1V6OA 2G9GA 3ZKCA 1PO13 4NRPA 3NV2A 1EAH1 1RUF3 2MXDA 1R63A 1ZS4A 1CESA 2R32A 2RMU2 3NNGA 4NAMA 3CLCA 1RUI1 1TQ5A 2P1BA 2EXHA 4NR1A 1LB2A 4AHWA 4OYUA 4DUWA 4FSJA 4R8HA 4YSFA 1PZ8A 2VBBA 2Q1ZB 2JJ6A 1YQ8A 4AOCA 2WNUA 1AR63 3N9QA 2GP5A 4P9GA 4PU7A 1WW7A 1C57A 5BNOC 5IVJA 4BIOA 1ZNPA 4XDPA 5J37A 1LLIA 1NAEA 1UOFA 4DUVA 4CCNA 3RRDA 2GNDA 3N7KA 1Z7S1 4X6QB 1RJ7A 4X8PA 4LUMA 3T0BA 4E4ZA 4P5HA 4P02B 3TYJA 2JE8A 4FFGA 3AKSA 2HWF2 4FP3A 4P9YA 4CP9A 1YCIA 1WIZA 3AJYA 4N9HA 4OULA 2NPIA 2R071 3TBDA 1HQWA 2YU2A 1AR91 1XBFA 3OCPA 4JX0A 2R041 1NQJA 4QHBA 1YJKA 2D5VA 2CHHA 2IFWA 1Y4WA 1REFA 2WO3A 4Q4Y1 5FY9A 1OD3A 4QHOA 2LTNA 3OP9A 4UW6A 1ZZ7A 1D4VB 2XXZA 3OUJA 5BUVA 3K4AA 1AL22 3FC0A 3ZYHA 1OF3A 1APNA 1C8M3 2Z42A 4MSVA 4WVMB 1RUH1 3T2QA 4DY5A 1J58A 3RVHA 4KWKA 4OHVA 4JGYC 5A80A 1B35B 3MFCA 4BH9A 2MQKA 4LA2A 3B01A 3KWVA 1HJGA 2I2SA 3B93A 3K4ZA 1OQEA 4UBGA 3O1SA 2Y6GA 1GQGA 2WZR3 3H3UA 3MEPA 2WRAA 1UD1A 4AGVA 3E5XA 5D8AC 3POSA 4RSUA 3USSA 1QGLA 2RM21 4FQZA 3GN5A 1KJRA 4DIQA 1QB2A 2OR1L 1TEIA 2DUOA 4FOWA 4IEUA 1MS8A 4OQ8A 2HWC2 4CA9A 3NV1A 5DSXA 1YQ6A 2ERFA 2VUJA 3U11A 4AYUA 4HG6B 2PUGA 1FT9A 3NNMA 4SLIA 3RFRA 1VRBA 1LOFA 4BQ4A 1YNAA 3VN4A 2YG0A 2RM22 3BDNA 4ARXA 1AR73 2Z69A 4M3CF 2PUDA 1UXCA 2G9ZA 4UOJA 3JB8A 2HWF3 3ZXDA 3QACA 4LJHA 3TEPA 3KGLA 1F2NA 4H55A 1MS0A 1LKNA 4J6GA 4D69A 1XYOA 5FYZA 2VQAA 4LLOA 4ZONA 5FZOB 2TNFA 4RL7A 3BPSA 3CJIA 4BQ1A 5BNPC 3RI8A 1DGRN 4HXCA 4IE7A 4LHLA 4M3CB 4RS5C 4XYXA 2QZ2A 3OUHA 1LJ7A 2X29A 2FZ1A 4EROA 5GZGA 1UYZA 3ZKYA 3PXPA 2UWAA 2BFUS 2O38A 1OH3A 2EVXA 2JG9B 4DXZA 5FOJB 2ZGNA 1U5ZA 4JCKA 4K1ZA 4MH0E 3ETPA 1PZ7A 1YEWA 3ECQA 1UYXA 1FI2A 4COYA 3GZDA 1DYOA 4PF1A 4D6SA 2YU1A 3FN9A 1VE0A 4I0BA 2R63A 5AC93 3GGLA 1V9U1 4Q4V1 5C9AA 3MPBA 4PU8A 2EXJA 2I45A 5CB7A 4CUAA 1SLCA 2Z4FA 1RJ8A 1BK0A 2VJXA 4ZKTB 1GNHA 1YO8A 4YBAA 4URTA 4BOWA 5IFPA 3RZJA 5L7OA 1AX0A 3HD8B 3QOWA 4XFCA 4F83A 5CAZA 1OF4A 5GM0A 2AEZA 4YWAA 3QOXA 3ZYPA 1YC61 3ZFEC 4CUBA 3KJXA 2K9ZA 4FI9A 1ZZCA 3WX5A 2ES3A 4A7ZA 5CIRA 1QH7A 1J84A 2BU9A 2PYTA 2DUQA 2P3YA 3WDUA 3WINE 1AR81 5FZFA 1UCXA 4HMZA 2RVAA 3LIGA 1W9YA 3W58A 3EMRA 2QNKA 2K46A 2QJVA 1UOGA 5JSOA 1D4M2 2G1MA 1CAWA 1TNFA 3KVBA 3O7OA 3I3EA 5FUNA 2C24A 1XB9A 1JHNA 1EAH2 1SFYA 2JDUA 4LIUA 1FV3A 5LW9A 1U0AA 5FZAA 2XIUA 2XLGA 1GOFA 3TNQA 4I3PA 4I0AA 1LHVA 2Y0IA 4BPZA 2SBAA 3KXAA 4JKKA 3S30A 2ADEA 1RITA 3I2JA 3N9MA 1YXWA 1REDA 4LO5B 5LBFA 3D4KA 2OUHA 2BJCA 1BDIA 5BNQA 3RQ0A 4COUA 3NROA 2ID4A 3IIAA 4XTPA 5LBBA 3VBFB 2KA3A 2WR9A 5FPAA 4AAPA 3I49A 1QOOA 4CEYA 2VR4A 1OKOA 2HWC3 3OEAA 4GQ7A 3PIGA 2IXHA 2ILMA 3PNAA 2XJTA 1S0FA 2UY9A 3I8TA 4Y1YA 5C71A 2G19A 1DYPA 3MF6A 5EYYA 4MLOA 5I0SA 1O4TA 4GIQA 2ZHKA 3I59A 3ZM8A 3LGRA 5F3EA 5FY7A 5FZEA 2J1VA 5DG1A 4XABA 2WT1A 2P3JA 5CG9A 1RB8G 1BEV3 3ZR6A 1RMU1 1HX6A 1US3A 3FUQA 2B46X 1GNZA 4UW4A 2VM9A 3CJXA 1H2MA 2PFWA 3B00A 1JFSA 1HXS2 5FY1A 2V5DA 1W9FA 1UU4A 4EK9A 1IKPA 1GBGA 1OLMA 3NSTA 4XCBA 3AKTA 1ULEA 3K48A 1NZCA 1OLRA 4CE8A 1SG3A 5FKCA 2WQ4A 5A7WA 4YVWB 2WS92 2XJQA 3NWKA 4M3CA 2ZHLA 4NJ4A 4FAGA 4EV0A 5C3QA 3AVRA 1W90A 1TME2 3K51A 1W2AX 4KG0A 5H9RA 2OX0A 5LK5A 3U0ZA 3CL1A 1QP0A 3R4SA 4XILA 5FIXA 2AYHA 5T5LA 5CEHA 1W8OA 3RYKA 5A33A 4LKDA 3VD4A 1NEQA 2CGNA 2YY1A 3C2UA 4PQQA 1LCDA 2DCKA 2BV4A 4KQ7A 4QAWA 1Q5OA 2WKKA 4BZ4A 3LB9A 5A32A 3G7DA 3POJA 5GLWA 3LQXA 5C3RA 5KR7A 3F6WA 1RUC2 4Y33A 5CADA 2M4HA 2VCBA 5F3GA 3WCSA 3UJQA 3V0BB 2Y6JA 3OPTA 2Y6KA 4YW6A 3VDBA 2WBKA 1N3PA 4EWAA 1W8FA 3I3QA 1U5IA 1VPWA 2Q30A 2VZUA 4XZPA 5LA2A 3D8CA 1W8HA 2VOTA 1BHGA 2C1FA 3GXUA 4YG4A 1HRI2 1PX4A 1W8UA 2XH6A 2XMLA 2IUWA 3LD8A 4Q29A 5C8CC 5BNOA 1Z78A 1O4ZA 5IJRA 2VZRA 5DTMA 1GUIA 4XFBA 1D4M1 2W52A 2XBO2 1UZZA 2KR2A 1RHI2 4UXAA 3KMHA 3PJQA 4YNIA 3RNSA 1RUG3 2XQXA 3TOJA 2X5IA 3V0AA 3JB4C 4CDUB 4GZ9A 4QX0A 4ZZ8A 1CAVA 1NX9A 1PK6B 3ACLA 3VBUC 3ZXGA 3U3WA 5KBFA 1FOD1 1LOBA 5F1RA 4M0NA 3OGGA 2W92A 4U2AA 4AVCA 5AFEA 4JHTA 4P9JA 4IEXA 3VL9A 2WO2A 5JI9A 2HWD1 3PIJA 2HWE3 2W91A 3OD0A 4B4RA 2LYLA 4J1WA 2PXEA 1RGSA 2LRPA 5DUXA 4AVVA 5CISA 3JXDL 1FPN2 4WM7A 2WL1A 3CNAA 3GBFA 2ZABA 4LTAA 1TME3 1KRIA 2YC2A 3QD6A 3VHPA 1JBCA 2E7QA 4UI9L 1QJY1 3CJIB 4KG8A 4NOTA 3ZX7A 3LEMA 3JXBC 2I07B 4PBOA 1O3QA 1XE7A 4BISA 1JZ3A 4FPYA 4FFHA 4EZIA 1S0BA 2X53S 3MLKA 4ZS3A 1YRZA 1W9TA 1RUH3 4DOUA 3LDRA 1JYIA 2ZEYA 3IPVA 1PVXA 1QP7A 2H0VA 2VNGA 5GALA 1JZ8A 1NKGA 3OKZA 1U5YA 2ZX0A 4MGKE 4LORA 4AHXA 4YPJA 5C3OA 3ZLIA 3ZXAC 1O5LA 1LEMA 2CYFA 3BODA 1AYM2 1IHMA 4DNYA 3IM0A 3LOBA 5A33B 3ON7A 3H7YA 5CBLA 4XBQA 3QCWA 3SITA 1UY0A 4N9IA 4XFGA 2H8RA 3I7DA 4XDOA 1DGLA 1BMV2 5LRRA 3LQCA 3AM2A 3DL3A 4PIXA 4XJZA 2PMWB 4H7LA 2DF7A 1COV2 4M01A 4FO9A 3APBA 1DZTA 4RFT0 2IVIB 4QWNA 3THCA 1S0DA 1JZ5A 1RVF1 1W6QA 1N3QA 1T6GC 1GYKA 1QJEA 3BS3A 2W94A 5C7GA 3I97A 1DBNA 4P9WA 3B5LB 2VG9A 2AXVA 4O7XA 3WDYA 5F9TA 5JDBA 4BK5A 3PL0A 1HB1A 3HIFA 2NN8A 4YZ3A 1J3QA 1WGPA 2ENRA 2VUAA 4KGGA 3LCPA 2XLFA 1TMF1 5B4NA 2HINA 4QXHA 2HCSA 3S8QA 4L11A 3VZOA 4A3ZA 1EYBA 1GZWB 1J83A 4GJZA 3PVEA 5EJ1B 3VKNA 2WNVA 2VZ3A 3O1PA 3ILRA 1JU4A 1PO23 5DZEA 2LYRA 4BQ3A 3AL6A 2ZGLA 1UU6A 4NIAA 3I59B 1W6QB 3EQEA 2HWE1 3PVNA 4ZXEA 3H5TA
chains in the Genus database with same CATH topology
4YW3A 5K0UA 2XWJB 1RUD2 4RA0A 4XIOA 2DCYA 2PHXA 2ZGSA 4CDQC 4MXVA 1LEDA 1PIV2 4CEYB 1FX5A 1AYM1 1D0GA 2OZ6A 2Z5WA 4COZA 1MS1A 4XDQA 4PCRA 2IZWA 3VKMA 2V09A 2E7TA 1CN1A 4IEQA 1DIWA 3THPA 2R042 5FPXA 1NERA 1AR92 3ZFEB 4CP1A 4XJ9A 2LM3A 4GB32 4EN0A 1OOPC 1YIFA 4RR3A 1C8NA 4JQDA 1DLLA 1F8VA 3OY8B 1SACA 4COWA 1BDHA 1D2QA 2XL7A 1UW8A 3VZLA 1PGSA 1SBFA 2D6OX 3VBHA 2JG9C 2HWD2 4LHNA 2W39A 1Z7S3 3QH7A 1I3HA 1FOD2 4F8AA 4MXWA 2B5HA 3BB6A 2D3RA 1A6CA 1UX6A 3VK0A 2PHRA 3VHRA 2LYJA 3RMXA 5I8SA 1CJDA 2TEPA 1YHFA 4GXLA 4W6YA 3ZFGA 2GMEA 3L9JT 1WLWA 1G86A 2JICA 3QF3A 1X7NA 3LSDA 1KFXL 1KDMA 1UL9A 2VOWA 3M1HA 4BIFA 1ZPQA 4QM8A 3PLQA 4AVSA 1H9PA 2VPVA 5ACA3 1EAH3 1QWRA 2P34A 3PHMA 1YI9A 1AYN3 4AI8A 1YJLA 3GZUC 4OFGA 4XBLA 1VBB3 3CEWA 3ZHMA 3CLPA 1LHUA 3HT1A 3ZXFA 4GB33 4AEDA 2HWB2 1Q3EA 4ZXKA 3JZVA 3ZYRA 1DGWA 2CV6A 5KHGA 1OA2A 1A78A 2MEV1 1X8MA 3U07A 5FO9B 5I91A 1I1EA 2FZ2A 4CRQA 5KWRA 1KJLA 2WT0A 1NLRA 1OFSA 2EALA 4FQ4A 2ZBJA 1PRUA 1BBT1 1HXS1 2MEV2 3JQXA 3GBGA 1OSLA 1ULDA 1REEA 1NXD1 2HEVF 3ZPYA 1SLBA 1ZREA 1D4M3 4ITCA 3ZVXA 3MYXA 1W0OA 1X82A 4OUMA 3IN9A 1B35A 1W6NB 1PVC3 1PNGA 1PK6C 1KXGA 3JU9A 4N7IA 4G4FA 4GH4B 2BVVA 2WJSA 2PLV2 4IEYA 2BWCA 1NCQC 2QE3A 2ZJCA 1UU5A 4R4XA 2PUBA 1LESA 1S0CA 3AKQA 1NA1A 1LTEA 1AUYA 4OHXA 5K98B 1J1LA 3T1MA 3ZIXA 1UXDA 2PHFA 4FPGA 1FOD3 4XPVA 5DDJ3 3WQ1A 1IZ3A 1GZWA 3NKTA 3WDTA 5HBAA 5AVPA 4WVZA 3QH6A 4JDMA 1CJGA 2CGPA 3GF6A 4LA3A 2KEKA 1VAVA 2V5YA 2ET1A 5CNAA 3VBRA 3SH3A 4D7YA 2K0GA 1X50A 1WMFA 1AVBA 3VBOC 3FYAA 4QQLA 4BWOA 4JGYA 2GZUA 4IETA 4XQWA 3ZSKA 4B8EA 4CTEA 1A8DA 1H4GA 3AYDA 4NWVA 3ZN5A 5FOBB 4BMEA 2JECA 4PLOA 1WUVA 2VY0A 4SBVA 2CWMA 1G9BA 1MS5A 3HBZA 3RMYA 1ASJ3 2G4IA 1ONAA 2R1JL 3JCIA 4Q4W3 1BEV1 2RHPA 1BBT3 1LENA 4DY3A 4G9SB 4UW3A 2BPA2 4EN8B 2GU9A 5T52A 1CAUA 1PIV1 2KEIA 4AI1A 3LFPA 1IPKA 3R4DB 4E2SA 4LO4B 2C0ZA 2HSGA 1ZVVA 2QDRA 2VOKA 1U12A 3RJ2X 5ACA2 4WZFA 3AP6A 3OBRA 4Q0PA 3E6CC 1WLCA 2TBVA 2A6VA 1X33A 4GALA 3SH5A 1WBFA 3VBUA 5IK7A 4RGGA 1XNCA 3D0SA 3VKLA 4CDXA 1XQNA 4QGNA 2R043 4JRAA 3M3IA 1N1YA 1Q8VA 4XQDA 4Q0UA 5KC5A 1E3OC 4Y26A 2HWC1 3FZ3A 1PO21 5I0RA 5C4WC 4QU2A 4X4HA 5BPXA 2DTWA 4JRLA 1C8M1 2LYKA 2VW0A 4PDWA 1MEC1 3O14A 3ES1A 4ISRA 2Q0AA 2A3WA 2R063 2O8OA 5A32B 1CAVB 1LGCA 4J1XA 1EY2A 2R6QA 5T50A 2ZGRA 4ZU4A 3TNPB 3VDDC 1VB4A 1ALYA 1RUH2 1TE1B 1YSEA 2QQPA 3U4XA 4Z1VA 5GLUA 1O3SA 3WT3A 3QBQA 1VBD2 3NVCA 4HPKB 2BNNA 3DPRA 2Q5TA 4R52A 4EWEA 4XF0A 3BOWA 2A3XA 3EO6A 4HK8A 3OMTA 4FCAA 3MGUA 3MW2A 2PIJA 3ZFEA 4M00A 1W6MA 2HWF1 1VBA2 2VGDA 3ST7A 5L7OC 3LA3A 1Z7S2 3O0VA 4IXLA 1ASJ2 4OI2A 4XE9A 2OFYA 2UU8A 5KHIA 4WVMA 2FQPA 5L73A 1FMD2 3SCHA 4IERA 1V6IA 4N43A 1ND3A 1ZZBA 3OQNA 4JGZC 1PRVA 1RIRA 1UIKA 2YUEA 1G6NA 2D98A 1ZRFA 2RS13 3SLIA 4AI2A 1Y43B 1ND3C 4D3WA 2RS12 4GH4A 1QJX1 1IS4A 1L1MA 2WFF3 4LBLA 4WM8C 4HT1T 4N7UA 3M3OA 1IC8A 5F6KA 2PUFA 2RS33 3OJBA 2VW2A 1ZM1A 3VHOA 4QGLA 5JVVA 1XU2A 4NVPA 2R061 3LISA 1C5HA 1XE8A 2XGXA 2EWTA 3CROL 1V9U3 4HVOA 5H9SA 2I74A 3IT8A 3V65A 3NV3A 3S7IA 4NHLA 2B39A 3GALA 2CSFA 4L8QA 4CYDA 3E6BA 4N53C 3WP6A 5FLJA 4DMIA 4I3GA 1V70A 4IVZA 5KHHA 3TRSB 1GQHA 5A3LA 1QJU2 4QMAA 1SLLA 1BQPA 3POYA 2ETEA 4E27A 3WD5A 4LNVA 2UY8A 2P2KA 2NYYA 1MZ5A 1S2KA 2DTYA 3ZMNA 5HCFA 1HRV1 4WM7B 3UFDA 4Y20B 2ZACA 2A70A 3ASIA 1R092 1CPMA 4UBHA 4Z58A 3UKVA 3SISA 1LHWA 1FPN3 1GZ9A 4S2GA 1JUHA 1ZBA1 2O1QA 3RDIA 1XNKA 2IVBA 1DQ2A 3WDVA 4XMAA 3OD4A 1RUE2 3VL8A 1FAYA 2B5AA 1COV3 4CDUC 2WA4A 4RHV2 2GH8A 1RHI3 2KM2A 5F6LB 4XMIA 2D97A 2B45X 2XUMA 1YIPA 5GLVA 5SV5A 2D44A 1PERL 5A3MA 3BU7A 4Q1PA 4YM0A 5E16A 4Z82A 4MYEA 4ES9A 1N3OA 4KNCA 3QOPA 2GZWA 2NZ9A 5HXVA 4AE2A 4AHYA 2WZR2 4K3UA 4ORFA 2GN3A 1QJX2 1H8TB 4K21A 1ND2B 3CECA 2Y0OA 2VVFA 4EN6B 4XEZA 2AR6A 4AI3A 4K7JA 4Q0SA 2A6ZA 3R4UA 4IEZA 4JDNA 3B7MA 1H1AA 3VBSB 4I0WB 2V73A 3SCGA 1JH9A 2DYCA 2RM23 3KM5A 4JTNA 3N36A 1R083 3F51A 1IS3A 2MEZA 2JG8C 2ZKNA 4EN9B 5C8CA 4YZ4A 1R082 2YYOA 3AYCA 1ASJ1 3AP9A 4CEWC 1HF0A 4M3CE 4YM1A 3TN92 4O8BA 2UYAA 1H1MA 1QXJA 2WS93 2OZJA 1DF0A 4QT6A 2NP0A 4IEPA 4Q4V2 3MIFA 4GB31 4RQPC 4Q1RA 3S7EA 3VBOA 1ZAYA 4FAHA 4LO7A 4PF5A 4COVA 4QGMA 1VLNA 1B0NA 3KT7A 4IV1C 1IQAA 1AL23 2KEJA 3KQRA 2XJ3A 1XU1A 2CL2A 4PLNA 4QQPA 1EPWA 4X4FA 1NY72 2DVDA 2E63A 2WSVA 3WX5A 5JDBA 1WA4A 1BZWA 3D1NI 1RUD1 3KZ4C 5GKAC 1RUC3 2C5DA 2HWE2 1PGW1 4LLFA 3RI9A 4MGZE 2ZX2A 5DUVA 2JE9A 4MXWB 2D3PA 2FHRA 3I54A 3KT1A 3NAPC 4JGZB 2XI8A 4LBMA 4PBPA 3MPPG 4Q2FA 3AK0A 4B29A 2L49A 1CAWB 4YZ2A 5T3NA 5EFUA 5T5OA 1H2KA 1PVC1 1TMF2 2AUYA 4TYSA 2A6YA 3IWZA 3H1MA 4WM8A 1B35C 2WFF2 2A6XA 1ZZ8A 2HKXA 1PRAA 1O3TA 2R1DA 4GH4C 2VVDA 1AYN2 4PU4C 4LEJA 3S0MA 1RVF2 3BIWE 3B9IA 2XJPA 1AR83 1UF2C 3ELNA 1MACA 2CAVA 5FCCA 3CU7A 3GYDA 4QPGA 4FXKB 5ACA1 1ND2C 1RUF2 1WMDA 4EWDA 1H8TA 3IBMA 1RINA 1NY71 2ET7A 3A4UA 2BFUL 2PHLA 1YI7A 4YW1A 1OPOA 3HAGA 4Q4Y2 1X36A 3O0WA 4HKWA 1DWKA 4FPLA 3CO2A 1UKGA 2ZGMA 3KCXA 3DPRC 4AGRA 3AMMA 1BVP1 2EXIA 4JC1A 4IV3A 3TN91 1LU2A 2ZMLA 4XTMA 1URXA 2LALA 4AG4A 4ASLA 2MNGA 3M3QA 5E1RA 5LK7B 1R1A1 3R05A 3TRBA 1NA1B 4Q4X2 3R0RA 3V56A 1W6OA 2GRMA 4JTOA 1S55A 3IDBB 5DUUA 1VIWB 4XETA 3RPQA 4FBIA 3J8F1 5JOXA 5DZGA 3FFQA 1H0BA 4AK3A 3E6DA 1ZYBA 5GZDA 5CFDA 2AXZA 3VBSC 3O12A 1RUI2 4TSVA 3I4IA 2FMDA 5BNNA 5I8YA 5GJ6A 4Y4YA 4I2OA 4Z92B 1LOCA 1ZVFA 4FT8A 5J48A 2WLQA 4R4ZA 1BK1A 2PTMA 4YG0A 2IWGB 3N35A 4JCYA 3VHNA 5J3UA 2ZX1A 3VZKA 5JSPA 1LULA 1KQRA 1W6PB 1AZDA 5SV8A 1DYKA 5JZGA 1WW4A 3DKWA 2ZHNA 1QNWA 2D43A 3QWGA 5BNNB 4X4CA 4RD7A 3TWIA 4K9SA 1PHMA 1X2LA 4YW4A 2JCGA 1HRV3 2R0HA 2XVKA 3WLUA 4QPIA 2YDEA 2DCJA 2UWCA 1TME1 1PO12 5ABJA 3ZFFA 2JKBA 4E9KA 1BBT2 3LA7A 4CDQA 3HT2A 3ZIWA 2PQQA 4A2UA 4OLLA 3X29B 1VB2A 1LR5A 1WD4A 2O4AA 3OQOA 2WIUB 1EV12 3JD73 5A7LA 1QQP1 2YROA 4IV1B 4IEVA 4HBNA 2H6BA 5EXOA 3WP5A 3ZSEA 1G9CA 3NJZA 3EXUA 1V6KA 1HV0A 1W6NA 4YM3A 4YVSB 5DXDA 3DV8A 3EBRA 2ZGTA 5ABJB 2WQZC 3JXCL 4E4SA 1QNYA 2ZGQA 2GMMA 3AP7A 4NN0A 3VV1A 3WW2A 2DCTA 4KU8A 5H9QA 4AFDA 2D5FA 1F5JA 3V0BA 2KXLA 2VOXA 5CFCB 3AMNA 3WV6A 1VBB1 4I01A 4Y22A 5FFOC 4LE3A 1VJ2A 1ZZ6A 1CD3G 1MS9A 4CDWB 2RS11 5AC92 3MF9A 3FLTA 4NHMA 4XF3A 1YFWA 4LO8A 4RGAA 3M70A 3E5QA 3SCFA 1OLQA 1AR82 3VKOA 4JV4A 4AHZA 4FTSA 2N7GA 1K5MC 1OSGA 1RUJ2 1ZBE2 1MR5A 3A0KA 1YFXA 3FHIB 1I5ZA 1FMD1 4JCXA 3BALA 2B8MA 1GKBA 3BCWA 1V6MA 4YZ5A 1GSLA 2R30A 1Z0HA 1VBE3 3KCCA 2IV1A 5L7OB 4XHXA 4YVWA 3VGIA 4WM7C 2FBEA 2RJKA 4TZDA 1VRH3 4Q4Y3 1YWKA 5FAXA 1H1IA 1KITA 2BW8A 1FYUA 5H9PA 4OHWA 4Y5Z0 4FP2A 3Z