4J1XA

Crystal structure of fe(ii)-hppe with alternative substrate (s)-1-hpp
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
193
structure length
193
Chain Sequence
b'TASTGFAELLKDRREQVKMDHAALASLLGETPETVAAWENGEGGELTLTQLGRIAHVLGTSIGALTPPAGNDLDDGVIIQMPDERPILKGVRDNVDYYVYNCLVRTKRAPSLVPLVVDVLTDNPDDAKFNSGHAGNEFLFVLEGEIHMKWGDKENPKEALLPTGASMFVEEHVPHAFTAAKGTGSAKLIAVNF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Epoxidase
publication title Mechanistic studies of an unprecedented enzyme-catalysed 1,2-phosphono-migration reaction.
pubmed doi rcsb
source organism Streptomyces wedmorensis
molecule tags Metal binding protein
total genus 48
structure length 193
sequence length 193
chains with identical sequence B, C
ec nomenclature ec 1.11.1.23: (S)-2-hydroxypropylphosphonic acid epoxidase.
pdb deposition date 2013-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 4j1xA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4j1xA02
2PUFA 2F4PA 4YRDA 4WVZA 5JSPA 4MV2A 3GN5A 4HMZA 3N4MA 3IDBB 1QP7A 2LYSA 3QWGA 1OD5A 1Q5OA 4I02A 4IVZA 4GULA 3VK0A 3LWCA 3TNQA 5JCTA 1I5ZA 3QQ6A 2IXIA 4I09A 4IA8A 4X4HA 3GBFA 4O8BA 1ZREA 2XLFA 1ZZ7A 3NL1A 5F1RA 2CGPA 4XF9A 1LCCA 2H6CA 5FQ0B 3UKNA 4F7ZA 5C8WA 3M3IA 4BYYA 1UPIA 4CYDA 4EWAA 3NSTA 2PQQA 1J59A 5CADA 2L8NA 2LCVA 3USSA 2MEZA 3BD1A 1EY2A 4I8TA 1IPKA 1UXCA 3QACA 2B5HA 4MCTA 3CF6E 3PLQA 4I0AA 5I8SA 4EROA 3ZKCA 1CAVA 1HW5A 4HVQA 3RPQA 3JXDL 4Y42A 1LLIA 2KXLA 3MYXA 3O14A 3H3UA 2IVGA 2QJVA 3FX3A 3R6SA 4MGZE 2PUAA 3CROL 4YBAA 4Q0PA 2XJ3A 4LLOA 3OMTA 4JQDA 2AXZA 2H0VA 4PU4C 1PM7A 4YG1A 3S7IA 2BNMA 5K98B 3OQMA 4N9HA 5EFUA 4GHJA 1ZVFA 3UKVA 4KWLA 4WZCA 2HKXA 2BGCA 2Z69A 3TRBA 1LMB3 1L1MA 1ZPQA 2XGXA 4A2UA 1PRUA 4XF3A 2HINA 3PVBB 3ZHMA 5AVPA 4MGIE 1DZRA 3TNPB 2P17A 1ZNPA 2E9QA 1GQGA 3CECA 1ZS4A 1O7FA 4QM9A 2FJRA 4KWJA 2LYKA 1RZRD 2D5VA 2XLAA 2JVLA 2IU7A 2LYRA 4QGMA 1LB2A 3F6WA 2ATFA 4DINB 2OZ6A 3ELNA 4E2SA 2OZJA 3FFQA 3OTFA 3C3VA 2Q0AA 3JXCL 1ZAYA 5BY5A 3OCPA 4BIFA 4IEYA 2XKPA 1O3RA 2O4AA 3BPZA 1ZRCA 5FDBA 3OF1A 3I7DA 2GZUA 4MX3A 1YFUA 5E16A 5JAXA 1OMIA 4E2QA 2EAAA 2GC0A 1J1LA 3H9AA 1VR3A 4AVBA 4OB4A 4XFCA 2EWTA 2EF8A 1LQCA 3JXBC 1WIZA 4LUKA 1O5UA 3JZVA 2PUBA 3H8UA 3BB6A 4YNIA 3LAGA 3H7JA 1EYBA 2KEJA 3I59A 5I0TA 3SXWA 4EWDA 2L49A 5I8YA 2OYZA 4I0BA 2LYPA 2IXKA 4JTOA 3WW2A 4AQ6A 4ZU5A 1RZSA 2AXVA 4B29A 5FPZA 1I6XA 5JR7B 1JUHA 1SEFA 4K8FA 4HBNA 2PHLA 4ORFA 4O9GA 4PU7A 2CROA 1V70A 4AQ2A 4FBIA 3CO2A 2VECA 2V09A 1YFYA 4FAGA 1LRHA 2B5AA 3ETQA 3EUSA 1WETA 2O1QA 4IEOA 1NZCA 5I8TA 1FXZA 4Q29A 4QMAA 4UBHA 1ZRDA 4MH0E 4Z5HA 3BDNA 4PU8A 2KEIA 3FWEA 3MPBA 2UY8A 2BJCA 5BUVA 2PUGA 3ZHIA 2K9ZA 3EJKA 2A6CA 4MUVA 3BCWA 4XFFA 3R1FA 1Y3TA 4IWRA 1UD1A 1Y7YA 5BXXA 3PNAA 4ZU7A 3I54A 4AVCA 1UW8A 3RZZA 2EVXA 2GRLA 3D0JA 2UY9A 1WA4A 3RYPA 2PE5A 1CJGA 5J7MA 4JVAA 1PRAA 4X4GA 4FBFA 3D1NI 1CAXB 2PAKA 1XE7A 1X7NA 1SFNA 2BYVE 2MQKA 1QP4A 4IETA 3F52A 1DGRA 2H6BA 1YHFA 1NXMA 4QX5A 3GYDA 2UYBA 4N9IA 4PIXA 3LISA 3RYKA 4D7TA 1QWRA 1CX4A 2OFYA 1VJ2A 1CAWA 4HVOA 4PJYA 1AU7A 4RD7A 2H8RA 3H1WA 1ZZBA 3DKWA 1RUNA 4QGNA 1ZZ6A 2IXHA 3LFPA 1ZVVA 4MGKE 3SCFA 2CAVA 3M70A 3H3ZA 3DL3A 2EBYA 4LEJA 4P9GA 1JFSA 5D1IA 3IVPA 3KZ3A 3FMYA 3KSCA 4XF4A 5I91A 3H1YA 1QXJA 4MCXA 4Q0VA 3FJSA 1CAUA 2PUDA 2PIJA 1H1IA 3HIFA 3OP9A 1UIJA 4XFHA 2XHKA 1J3PA 4QGLA 4X4EA 1QY4A 2WC2A 3U3WA 3IBMA 5FLIA 3UKTA 3RDIA 4LA2A 1S7EA 3GN5B 1SQ8A 3S8QA 2ZKLA 2Z2SB 1EP0A 4Z5DA 2IC1A 2ETEA 2Q1ZB 3NKTA 5I0SA 3CEWA 5FCCA 3FYAA 1WGPA 3E5QA 5E1RA 4HN0A 1O4TA 3H1MA 1XRUA 2GU9A 3ZDSA 3MDPA 5LEJA 1IPJA 1QXRA 2BNNA 3CL1A 4UXAA 1RGSA 4META 3E6CC 3B02A 1RPEL 3HZIB 4YYOA 2MNGA 5J48A 4WBBA 2QVSB 2DCTA 3U0ZA 1PRVA 2O38A 4HSLA 4BHPA 1GT0C 4ONUA 4Z58A 1XE8A 5FQ0A 2LYLA 3MZHA 3MLFA 2GC3A 3L2HA 4NVPA 4PU3C 4XFBA 1Y9QA 2XIUA 3OQNA 1O4XA 2IXJA 1JH9A 3KCCA 1DGWA 2PAMA 4HSJA 2D93A 3EO6A 5KBFA 4OFGA 4FN3A 4AVAA 1CAVB 1ZZCA 3H5TA 2QDRA 4NDWA 3FZ3A 5EZWA 4YG4A 2AUWA 1Q43A 4EWEA 3BS3A 2Q30A 3LA2A 4X4FA 2IXLA 4FAHA 2OR1L 1LR5A 3E5UA 2QCSB 1X57A 4GQMA 2MPFA 1QQBA 4UBGA 1X2LA 4YARA 3L1PA 2LYQA 4X4CA 3DNVB 3E6DA 3RNSA 2OA2A 1X8EA 1ZX5A 2XL9A 1O3QA 2BEOA 1POUA 3B7HA 2GC2A 4Q0SA 3ROUA 4IEWA 3F51A 4XFIA 3EHKA 3FHIB 2HJIA 2QNKA 2C0ZA 3CLPA 2GAUA 5CVRA 1U12A 3HQXA 2D5FA 2EA7A 4Q0UA 4R52A 1VPWA 2FMYA 1RUOA 1G6NA 4XFGA 2JCGA 2B8MA 4KU7A 4IEQA 4F8AA 2LYJA 2R63A 4Z07A 4X4DA 1OSLA 3SMHA 2CAUA 2OPKA 4IEPA 1BDHA 3QOPA 1RIOA 3UFDA 5BV6A 1WLTA 3D82A 4J1XA 3LA7A 3LOIA 2PPXA 3QYXA 2ZCWA 5JSRA 2AXUA 3OGJA 3BALA 3VHRA 4F8DA 4IEZA 4J1WA 5LEKA 2ICPA 3ST7A 5FLHA 1X82A 1O3SA 5HI0A 1NEQA 2WIUB 1O5LA 1L3JA 3DV8A 4QM8A 3U10A 3S7EA 3WW3A 1CGPA 4H7LA 1NE6A 2AWIA 4O9EA 2D40A 1ADRA 1YFXA 5KHKA 3CJXA 3ES1A 4Z5CA 3SCHA 5LRRA 5KHIA 4IESA 2XL7A 5LRSA 2PYTA 1ZZ9A 1EFAA 1QP0A 4LUMA 2HSGA 3PXPA 5A7LA 1DW9A 1RC6A 3IDCB 5FLJA 1OI6A 4XF0A 2XLGA 3HT2A 2ET1A 3I59B 4IEUA 3E5XA 3FYMA 4IERA 4PIZA 3DN7A 3WW1A 3WW4A 1J3QA 1ZUGA 3LA3A 1EPZA 4HLTA 2R1JL 3D0SA 5BPXA 4X6RB 4Z59A 2XCJA 2GH2A 4I6TA 1DWKA 2MHFA 4EV0A 2CV6A 1J58A 2FQPA 1UXDA 2Q4SA 2Y0OA 4QXKA 1NYWA 4D7SA 2WUSR 2BNOA 3EQEA 4Z82A 3ACLA 1O3TA 4LA3A 2PTMA 4KU8A 4E2GA 1YWKA 3QF3A 1ZRRA 4XFAA 4YG7B 3OQOA 1QPZA 5KHHA 2IVQA 1R69A 1YSEA 3NVCA 4OLLA 2GC1A 1HF0A 3HT1A 2O49A 2IXCA 2GRMA 2XI8A 4I6RA 5JSOA 4X4IA 3ES4A 3H7YA 1YLLA 4I3PA 1RL3A 1DZTA 1UIKA 3KMHA 1YUDA 1B0NA 1VP6A 4I6UA 3U11A 1QQAA 3BU7A 2VQAA 1WH8A 4MGYE 3OD0A 2B9UA 1ZRFA 3SCGA 2KPJA 1E3OC 1IC8A 1XWRA 4FT8A 4ZU4A 2ET7A 1FI2A 1PERL 1TQ5A 4JV4A 3CLCA 2D5HA 3EBRA 2VPVA 3IIAA 2KZ8A 5J3UA 4JTNA 3SHRA 2CSFA 4JCYA 3E6BA 4KL1A 3NW4A 4XEZA 1CAXA 3KGZA 1GQHA 2N7GA 4YSFA 4MZUA 1CAWB 1JWLA 1BDIA 3IWZA 4HZFA 2XKOA 1RTVA 2PAEA 4XF1A 5KHJA 3S0MA 2IVBA 2PHDA 4X4BA 1WH6A 4HN1A 4L11A 4KWKA 1R63A 1UTXA 2XSDC 1J3RA 4TLFA 4L2NA 3FE5A 2GZWA 4R8HA 1PMIA 4XETA 4BH9A 2IUOA 3E97A 4I2OA 1OFNA 5KHGA 2UYAA 1PNRA 1Q3EA 4PIYA 3KXAA 5C6CA 2PUEA 3NJZA 2IV1A 1NE4A 4JCXA 5T3NA 3O9XA 4AXOA 3KJXA 1CAUB 1RZRA 1FT9A 5I0RA 2I45A 4Q0QA 1LCDA 1X8MA 2O8QA 2K0GA 2ICTA 1LKNA 3LZZA 2KEKA 4IEVA 2PA7A 1ZZ8A 2WFPA 5CU1A 1OCTC 3RYRA 5I93A 5K8SA 1CQTA 3H50A 5FPXA 2AW6A 4I01A 1SQ4A 4X6QB 3KGLA 1YFWA 2PUCA 4LTAA 2PFWA 3G7DA 1NERA 3G5GA 1H1MA 4IEXA 4LULA 5I0UA 1UCXA 4HVRA 1JFTA
chains in the Genus database with same CATH superfamily
1UZZA 1PIV1 5CNAA 5BNPC 4URTA 3RMYA 3TEYA 5DRYA 1SBFA 3IDBB 3OPWA 1QP7A 5GZFA 3QWGA 1V6MA 1PVC2 4DXRA 4E27A 2VOVA 1B35B 2ARBA 1UMZA 2HWD3 3ILNA 1H6XA 3IKWA 4I02A 4LIVA 3ZXKA 3VK0A 1AR61 3LWCA 3MV01 1FPN1 3LEKA 2WIIB 5K9YA 1MS4A 4COWA 4X8NA 4IA8A 3R05A 4X4HA 4CU9A 3GBFA 1ZREA 4RS5C 2XLFA 4UFJA 2PXDA 5AFBA 5JI9A 1ZA4A 5A3PA 2CGPA 1GNYA 2FFHA 3KZ4C 4XF9A 1LCCA 5HCBA 2YB7A 2GSYA 2OVUA 2OUHA 3M3IA 4Q27A 3I2OA 1NLQA 2NMOA 4EWAA 3NSTA 2BZDA 4RR3A 4A3XA 4KI5M 4MHUA 3ZXDA 2E51A 2CDOA 4D6QA 5BNOB 3BD1A 5JUVA 2DUOA 5F5QA 3AKSA 2WA3A 5GAHi 5F3EA 2SBAA 1KEXA 4AWDA 1UXCA 2FMDA 2WDBA 5FO9B 1VE0A 3BI3A 1VMHA 3CF6E 2ZHLA 4DE8A 3AP4A 2ODRD 5EP9A 5ACA3 5C9AC 5ABJB 1DHKB 1PK6C 1CAVA 3U37A 5LK7B 4GH4B 1C5IA 3V0BB 4KG8A 1DQ4A 3B9IA 3MYXA 1GANA 1HB4A 1W6MA 1XYNA 2QQIA 3DYPA 3WQBA 3ZSLA 2CTVA 3VBOC 1S2KA 2ZGQA 1EAH3 4LLOA 2PHXA 3N9QA 1REFA 1W99A 4YZ1A 1HX6A 2SLIA 2VCBA 3D6EA 5FZOB 4CCEA 2BNMA 5A7OA 3MW3A 3BTYA 1HXS1 2AC1A 1SCRA 2YUEA 3LEGA 4N9HA 3VKOA 5LW9A 4GHJA 5FYUA 3WP5A 2YMZA 1OXCA 3L9JT 2BGCA 3TRBA 2ZMKA 3MLKA 1LMB3 2DV9A 1L1MA 1ZPQA 4L0PA 4Q26A 1CESA 1PRUA 4XF3A 4M4RA 1HV1A 4MGIE 2WRAA 4BU2A 1ZNPA 2E9QA 2P3JA 3ZFGC 3CECA 1O7FA 1UYZA 3U4XA 1OVSA 4LKEA 4BDVB 3M7AA 3BTXA 5FOJB 5FYYA 1RHI2 2D5VA 4UW6A 2WNUC 4OMCA 4S2FA 3DXUA 2IU7A 2LYRA 1YJKA 2JKXA 1LB2A 1YI9A 3SLIA 2ATFA 4EKIA 4LO5B 5F2SA 2WWSA 4XCAA 4E2SA 5CFCC 3AKRA 3OTFA 4HANA 3WT3A 1PO13 4YZ3A 2PXPA 4QKBA 3RSJA 3QH7A 3OCPA 2RR12 1EV12 3M3CA 2WNVC 4MXVA 4FPLA 5C3PA 1LAJA 5IVYA 5DQ0A 4P9JA 1XNBA 2E7QA 3UWPA 1UYXA 2VW1A 3I7DA 1SBEA 1GYKA 1QXPA 2VVEA 1ZM1A 2CWSA 4YM1A 3T2TA 1JZ4A 1KXGA 4AFMA 4KBBA 1YI7A 5LBBA 3VGIA 2J7UA 4E2QA 2HWF1 1G8WA 2EAAA 2VVFA 4AZZA 1ULGA 3OGSA 4P9XA 3SH4A 3H9AA 2ZABA 1MEC2 2PXJA 3MLJA 4H55A 4AVBA 3W59A 4BISA 2VEOA 2EF8A 3I3DA 2WFF1 1UPSA 3AP6A 5H9PA 2ZGRA 2BJSA 1UWWA 2NPIA 1U2ZA 2VNVA 4XZUG 2V3CC 3H7JA 1VRBA 1EYBA 3R4SA 4JZRA 1KS4A 3I59A 5KWRA 1XC6A 5FZ6A 1C1LA 1UY4A 2HWC2 2Q1FA 1W2OA 2C4XA 2YC4A 4CDQA 4AQ6A 5C70A 5A3LA 1RZSA 3LE0A 4IV1B 1WMXA 4QPGB 4R4XA 1VBD2 5JR7B 1W3XA 4CDXC 4HBNA 3A9YA 1PX3A 4K8RB 4ORFA 4LNVA 2JXAA 4J25A 1AL0G 2ZX4A 1V70A 4QPYA 3NZLA 1STMA 3PURA 2V09A 3IAQA 5A7WA 1PVC1 5FY5A 3RS6A 4M0HA 3ZXLA 4ATEA 3EUSA 5JDBA 1CVNA 2RMU3 5I8TA 1YEWA 2QZ2A 4L99A 4MH0E 1PM4A 5FPBA 4B8EA 4RHV3 3VDCA 2RS33 3FWEA 4L97A 2UY8A 4EN0A 1YYNA 3NNGA 2BJCA 1G7YA 2YFUA 5A7SA 4MGQA 5JLVA 3PIJA 3AJYA 3EJKA 1UY3A 3BCWA 4PHZA 3UK9A 3GHMA 5IVVA 1QQP2 4ES8A 2LROA 2EXJA 3ME2A 5EYXA 5A6ZA 5DABA 3PNAA 3K75B 2AUYA 4YGDA 5J36A 2WJSA 2BBAA 2WWUA 3KT7A 3RYPA 1CJGA 4RYDA 3NAPC 5DTRA 3P6BA 1PRAA 5J09A 2WUHA 1CAXB 3ZMNA 3THDA 3NNMA 2CYFA 3RMXA 1XE7A 5K7PA 4NN0A 1GQPA 1QJU2 4W6XA 1SFNA 2BYVE 1FNZA 1RVF3 1FMD3 2ZEYA 1RUF2 5A3WA 4UT5A 4GJZA 1VB4A 4PIXA 4XDQA 4N9IA 2FDIA 1VRH2 1AR93 2ZS6B 3I3QA 1NG0A 1CX4A 4CU6A 2I07B 4UW5A 4Q4Y2 2OFYA 5C8CB 1CAWA 1CQ9A 1ZBA3 1AU7A 1I9RA 3CZJA 2H8RA 2A6XA 3J9SA 4RD7A 3DKWA 4OHZA 4QGNA 5A3MA 1W39A 4W65A 1RUD3 2EXIA 3ASIA 3QH6A 1ZVVA 3ZXGA 3B9CA 2QQOA 1W0PA 3PE5A 4M3CA 5K0UA 3DL3A 5CKNA 3LKJA 4P9GA 4D94A 1QJX2 5D1IA 4NPMA 5FZKA 3ZKUA 3K3OA 4BK4A 3KZ3A 1T6BX 2C6SA 3FMYA 1REEA 2WL1A 1ODMA 4XF4A 2EXHA 2JQEA 2VCCA 4XQ4A 4Q0VA 3WR0A 2JG8A 2VUCA 5GZDA 5TSWA 2M4HA 2QZ3A 1AXYA 3HIFA 3FHAA 1CZVA 2L9LA 2Y0IA 1RHI1 5DAVA 1UIJA 3ZPYA 4D69A 4XFHA 2OQ7A 2GALA 2V4AA 2HBUA 1F4AA 3VN4A 3DPRA 5LA0A 1QY4A 1IQAA 3IBMA 2D6KA 5FLIA 3UKTA 4CCOA 1UY0A 1XJAA 2DCZA 3RDIA 5IK7A 4QAWA 4AG4A 3VL9A 1K5MB 2HBTA 1U5ZA 3WINE 1EV11 3HR9A 1PNGA 1I1EA 3S8QA 2HEVF 3KF3A 2ZZQA 4P08A 1EP0A 4AF9A 2ETEA 2Q1ZB 4CUCA 4OI4A 3PMSA 1QIQA 2VC9A 5C3RA 3IIIA 3E5QA 3SX0A 2B39A 3CBNA 2VNRA 3O5SA 3MIGA 1MZ6A 4MXWB 2GU9A 4LJHA 5EQUA 3MDPA 1QXRA 3CL1A 3BN6A 4IL7A 4AVVA 5B2GB 3J7MA 4DEQA 1MEC1 5FKCA 2PQSA 2BFUS 4HONA 1JW6A 4ZPIA 4M4PA 2Q5TA 2BFUL 2EIDA 2A6WA 4LHKA 3OYWB 5J48A 4WM8A 2ZEZA 3NROA 2QVSB 3U0ZA 1WD4A 4HSLA 5FJKA 2JDAA 3SISA 1GP5A 5A3OA 3L2HA 4NVPA 4Y22B 2FDHA 5FXWA 2XIUA 1O4XA 2RDSA 3V0AB 2IXJA 1DULA 4XDPA 2WQ8A 2D93A 3EO6A 5KBFA 1DGRN 4IV3B 2QDRA 2WA4A 4NDWA 4M3CE 1W9WA 1MS0A 3FZ3A 1VBD1 3OEAA 4YG4A 3V65A 1WW5A 4ATFA 2AUWA 4ER0A 1OLMA 2P6HA 3RZKA 4XXAA 1AL23 2JX9A 1RUH3 3BS3A 2Q30A 4X4FA 1UKRA 4G4FA 3GZUC 4XUOA 1IKQA 5ABJA 3PTYA 4HETA 5FFOC 1X57A 4GQMA 5FV3A 4AR2A 4B7KA 4GH4A 4CEYC 1PGL2 3DNVB 3V0BA 2OA2A 2G9ZA 1JHNA 3B7HA 2BBVA 5DAPA 5FYMA 3RZJA 5JOZA 4XFIA 2RMU1 2BOJA 1HRV2 5FY4A 3T09A 3KT1A 1AX0A 2C0ZA 3KM5A 4Q4V2 5CVRA 1U12A 4IXLA 5FZOA 3VD3A 2G19A 2C24A 2EA7A 2Y6HA 4AE2A 1QKQA 3AKPA 1QQP1 4XFGA 3LPGA 5L19A 3KL4A 1RUOA 2VQTA 4KU7A 2VM9A 3CDZB 1G9AA 1AYN3 4Z07A 1OSLA 2BDRA 3SMHA 2Y33A 4IEPA 1CIYA 5H9RA 4QDSA 3O1PA 2IUWA 4BK5A 4XHXA 4BOWA 3I4IA 2R073 4HKWA 2WQZC 2PHWA 3LOIA 4CCDA 5KXEA 5DRTA 5FY7A 5H9QA 4FPCA 3ZFEB 5GKAC 4AI9A 1WKYA 1D4M2 1VBB2 2HLEA 1MS5A 3ZYGA 1QJU1 3T1LA 2GP5A 3BALA 4YPJA 3MIEA 4F8DA 4KQ7A 4J1WA 2A70A 2ICPA 2ENRA 3NNJA 4NHXA 5DN2A 4CP2A 5IUQA 3OUJA 3GBWA 4N53B 4AEDC 1NEQA 2FCTA 2JG9C 1UXZA 5FK7A 1VRH1 4YZ2A 4OVEA 2PHTA 5DTQA 2X09A 3AVSA 4JC1A 2E32A 4L9BA 2D97A 1IZ3A 4Q4Y1 3J8F3 2WYFA 3CJXA 3ES1A 2NN8A 2OPWA 3ZR5A 5CISA 1LOBA 3VBSC 5APAA 2JECA 1H4HA 2XL7A 2PYTA 1O8SA 4XTPA 1OLME 2HSGA 4LHLA 1DW9A 5FLJA 2LTNA 4AAXA 4QB1A 2QQJA 3UT0A 1ULOA 2B45X 2HH9A 5F8PA 1DF0A 1W90A 1QJX1 3HT2A 3W5MA 4D0QA 2FD8A 3TN92 4FXGB 1LULA 3WQ7A 4IEUA 1W9SA 4A3ZA 5F5CA 3LCPA 5EWSA 1H9WA 4IERA 1S0JA 4XACA 1U0AA 4EZIA 5DUXA 2E33A 4CEWB 3MBWA 2DBIA 4PLNA 4WVMB 5L9RA 2QTWB 4OQ8A 1EPZA 4HLTA 5BPXA 4X6RB 4AFAA 3BYWA 4BXSV 1UNBA 3LOBA 4I6TA 3OGRA 4PDWB 1RJ8A 2CV6A 1UXDA 5DUWA 2Y0OA 4XJWA 2QQUA 1W2AX 2BNOA 5FYSA 3WUCA 3ORJA 5DAWA 3ME5A 4IV1A 4QPGA 2PTMA 2WS91 3UGFA 1RJ7A 3Q8FA 4CDUC 1KDMA 5IVBA 5IVJA 3B5LB 4AAPA 3T2QA 3U14A 1DCSA 1WA6X 3M1HA 1BKZA 2RJKA 4YM3A 5GZCA 1GNHA 1YQ8A 3DECA 2IVQA 3MICA 5FZIA 1YSEA 5FP7A 3EYPA 1HF0A 1W6QA 1NLSA 4NRMA 1NY72 4MYEA 5FPLA 2O49A 1IHMA 1QF3A 5FUNA 1JZ8A 1U5XA 3VKNA 4X4IA 3IAPA 1RL3A 1GNZA 2DF7A 3HBKA 1D0HA 4Q1PA 1B0NA 1ACCA 3O1OA 1QH6A 3RZGA 5IVEA 1XNCA 2VQAA 1RYYA 1WH8A 3DKQA 2QQLA 5GZGA 3LFMA 2A6ZA 3SCGA 1E3OC 1DIWA 1PHMA 3OSDA 4UFHA 4FT8A 4FTBA 5CB7A 3KF5A 2GNMA 1PERL 2B4KA 2QFEA 4IE7A 3OY8B 4D6RA 2VPVA 2XBO2 3URFA 2KZ8A 1RUJ2 3UJQA 4PCRA 2JB8A 4UFMA 2V5YA 1HQNA 2W08A 4KL1A 4XE9A 4YVWC 2D3PA 1WCDJ 2PXFA 1HQ1A 1CAXA 1HIXA 2QQPA 3KGZA 5L7OC 3K46A 2JE7A 3ZN4A 1BDIA 3NRUA 4QB2A 1ND2C 3C7OA 1GWKA 1IG3A 3JD73 1RUE3 1XNDA 1PGL1 3PMEA 4X4BA 3JB8A 5IJRA 4XYXA 3ZIXA 2R1BA 4JGZC 2D43A 2XHNA 1POV0 4KWKA 4W6WA 4Z92B 3SR4A 2XSDC 4LPLA 4TLFA 2TUNA 4L2NA 2YBDA 4YW4A 5GALA 4CDUA 4XC9A 1HRV1 1PMIA 1K5JA 2IUOA 4PLMA 5C8CA 1OFNA 4Y24A 2BVVA 1CD3G 1JTZX 2X5IC 1HB3A 4I2OA 1NA1A 2DUPA 2FBEA 1GSLA 2Y26A 4XUNA 2PUEA 5IT6A 4LBLA 3O9XA 3BOWA 3AP9A 3ACIA 3KJXA 1OKQA 2NLRA 2E31A 4QKDA 4EZHA 1W28A 2HWE1 2ZEXA 2GNTA 2VH9A 2BERA 2P3YA 2K0GA 5EV7A 5GJ6A 4CA9A 3BU0A 2PA7A 2WFPA 4AW7A 5F2WA 2AW6A 2ORXA 1EUTA 2R071 5KXDA 1NX9A 1D4M1 1VBB1 1NCQC 2ZHNA 5JOWA 1UXXX 2CSGA 3ZFFC 4PI0A 2XJQA 2PFWA 5JVVA 4ASMB 3MI8A 4IEXA 2D98A 3MIHA 5F5AA 1DDLA 2F6BA 1HRI3 4HVRA 3VDDB 3KS7A 1LHWA 2F4PA 3THTA 5AFEA 4K21A 1NCRC 2RM23 3J4UH 4YRDA 5FUIA 5BNNB 2JE8A 3RJ2X 2QQMA 4HMZA 3N4MA 2NZ9A 2LYSA 5EPAA 2Y6GA 3WCRA 1PIV2 2GDFA 3GM8A 4OHXA 1H8TC 4RGGA 1N1VA 2NQYA 2WSUA 4CP9B 3RWKX 3VV1A 2VOXA 4BQ4A 1US2A 2CWMA 1AX1A 5LA2A 4NOTA 4MXWA 4DQAA 5F1RA 1YC61 5C4WB 3K3NA 4ASLA 3HQRA 4OUMA 1VBE3 4XMAA 4DEVA 5C8WA 2JDNA 2DVAA 3TN91 3RRDA 1RXGA 4Z8BA 2C26A 4CYDA 3P5BA 1VIWB 1XE0A 3HAGA 5KXBA 1TME3 1JS9A 2W1SA 4QQ2A 1MS8A 3AK0A 3AZYA 5DAXA 2LCVA 3VUOA 2XPJA 1BEV2 5IK5A 3TEWA 4I8TA 1IPKA 3QOWA 3ZMOA 5EJZB 4WM7B 4Y22A 5JZGB 4NPLA 3QACA 3V0AA 4MCTA 5FPUA 3CIHA 5I8SA 4I0AA 4EROA 4EZ4A 2VNOA 2NP0A 4IV3A 1RMU3 1W3VA 4HVQA 2BQPA 1TG7A 2VOWA 3ZN6A 1QJY3 3AYCA 3ATGA 4W8JA 1KFUL 2QJVA 2YGMA 1R093 4N43B 1SPPB 3NJYA 4Q0PA 4K1ZA 3UGGA 3OMTA 3I3BA 5C5UA 1LESA 2Z79A 3S7IA 1FOD3 5K98B 2RDRA 3OQMA 4JRLA 3U75A 4RFRB 4ZS2A 3FMGA 1BVP1 1NY71 3ETPA 4NIIA 4QDRA 5FMBA 3VBRC 4KWLA 2Z69A 5BNPB 1S0IA 1DP0A 3A4UA 2XGXA 4A2UA 1HXS2 4D7YA 2J1EA 2HEYF 2VTXA 3AP7A 3T3YA 5AVPA 2YHJA 2P17A 2YGLA 3TOJA 1GQGA 1ZS4A 3I97A 4QM9A 1ODNA 2XG3A 1COV2 2Z5WA 4DE9A 1QDOA 1XYOA 3NV1A 5E6HA 5F5IA 3S30A 3WUDA 4BM8A 2LYKA 4QX0A 4XPVA 4RS5B 2XLAA 1RUJ1 1EPWA 3JBG2 4NO4A 3WQ1A 2KA3A 2OZ6A 3ELNA 4FPGA 4OYUA 1WUVA 3C3VA 2B7YA 3ZFEA 1HJGA 3ZKYA 4Z2WA 5GM0A 3KQ4B 3A23A 2XQXA 4MVTA 4IEYA 4BIFA 4LHNA 5FYTA 4MSVA 2YBKA 3PU8A 4MHRA 1O3RA 3BPZA 4A7ZA 2VD7A 5ERLA 5FAXA 1UN1A 1H2KA 1UZWA 4JGYC 4MX3A 4BQ5A 4DRVA 5T54A 3FLPA 4Y4RA 4A42A 4AFBA 1IS6A 5C9AB 2B42B 1PO23 4Y5Z0 1PK6B 1SLBA 2VY0A 2WT0A 3JUUA 4MGSA 3SEEA 3UJOA 1JYNA 2GC0A 4DB5A 5K0UB 1SACA 1KFXL 4XFCA 3N9MA 5A7NA 1C8NA 2W92A 1GICA 3VBOB 3JXBC 1AYM2 2W94A 1OSGA 3MEPA 4Z1VA 1JBCA 1YNAA 2PUBA 4TWTA 3POYA 2RS53 5M0TA 1H2LA 2P2KA 3H42B 1QOTA 3OBZA 4YFWA 5BYNA 4QPIA 3VBUB 3J7HA 4EWDA 4LKDA 2L49A 4XBLA 3WNNA 4QX3A 4I0BA 2OYZA 1TNFA 4JTOA 1S0FA 2FZ2A 4ZU5A 1XNKA 3AL6A 2K2SA 2Y6LA 4CEWA 4RQPB 3AMPA 5G04L 4WVLA 1I6XA 4AI3A 1JUHA 1NQJA 2W1QA 4BWOA 5A1FA 1DFQA 3AZWA 4PF1A 1MFQC 2VOKA 4YW7A 1OC1A 4PU7A 3ZFGB 1YRZA 4PDWA 1XU2A 5FR3A 1JYVA 4FBIA 1OUXA 1UYPA 2MEV2 4LK7A 4XTMA 2VECA 4GZ9A 4QQLA 1A78A 1K12A 2TNFA 4XABA 4XW3A 4P14A 2WNUB 2B5AA 4QHOA 5FZCA 3JXSA 4CDWC 3C2UA 3AB0A 4ZONA 4IEOA 4E4ZA 1NZCA 3GCWA 4QMAA 4Y4YA 1ZRDA 5JUWA 4ZXKA 4Z5HA 5JWPA 3IN9A 3SKJE 5CAZA 2CDPA 1OBNA 2WAAA 3MPBA 1XB9A 2AR6A 4QU1A 5BUVA 2PUGA 2HWD2 2WNVB 5A70A 3ENRA 5DDJ3 4UAPA 3ZHIA 4MUVA 4RSUA 2A6CA 4NHKA 1VBE1 5IAXA 1XNAA 4WM8B 5FZAA 2IWGB 4KBZA 5BXXA 3I54A 4AVCA 5CBLA 2PXEA 1H2MA 4RGAA 2EVXA 2GRLA 5J7MA 2VBBA 1BEV1 4QWNA 3VHPA 3H3LA 3ZPXA 2WO1A 3ACFA 3IDAA 2PAKA 3M3EA 2JEMA 5IHRA 1WW7A 1X7NA 2BGPA 4GWNA 4GB33 2OS2A 3WNPA 3OY8A 5JOXA 2PHRA 3ACHA 3DYMA 1QJFA 1JMUB 2IVIB 3O0VA 3F52A 4IETA 5FYZA 1NXMA 2WT1A 3POBA 2E7AA 2UYBA 4MGTA 3ZYFA 3WF1A 4R9DA 3RYKA 3SKVA 1QWRA 4KWUA 1S55A 1LU2A 1OF4A 3WNLA 2W2IA 5ACA2 1PGW2 3TEPA 1X9TA 4R9BA 1BK1A 4HVOA 1FATA 4PLOA 3HWJA 2ADEA 2WT2A 4PBOA 4YGEA 1RUNA 1Q8SA 2A6YA 4JAAA 4C0BA 1POV1 5D8AA 4XXPA 4TXWA 4QX1A 1GWMA 4CDXB 4CXYA 3SCFA 1EAH2 2HWB3 3M70A 4GIQA 5E89A 4F3JA 5CA6A 1W8UA 2G9GA 1T2XA 2CGOA 1ASJ3 4LEJA 1MQTC 1JFSA 1VBA3 3CZUA 1FX5A 4XJ8A 3UESA 2P5BA 1Q8PA 4P9YA 4COUA 5I91A 4CCMA 3LD8A 3H1YA 2VQ0A 4MCXA 4RA0A 1COV1 3KHBA 1HB2A 5IATA 1SG3A 4XURA 3GZDC 3AVRA 4BZ4A 3PHMA 5F3GA 5T5OA 1JZ5A 4RN5A 3FUOA 4ARXA 1G86A 3JBG1 1J3PA 1OPOA 4QGLA 4CXXA 4DXTA 2WC2A 3O0WA 5C71A 3FLTA 1S7EA 3GN5B 2E26A 2R49A 4LE3A 1KJRA 4XUTA 1Q8OA 4L92A 4AI1A 4Z5DA 4QXHA 3NKTA 2D6MA 4XIOA 4BLJA 1NQDA 3CEWA 3BUCA 3VDDA 3A9XA 2V5DA 1D2QA 5FCCA 1PO12 5DG1A 4HN0A 1AXKA 1O4TA 3H1MA 4IGOA 3W21A 5BNNA 1SLIA 2HYKA 4S2HA 3ZDSA 3CJIB 5J1XA 2ADDA 2BNNA 4UXAA 5A32A 1DU3D 3VBFA 1PZ9A 1R083 2YV8A 1FNYA 3E6CC 2FHRA 1US3A 4CP9A 3HZIB 3CNAA 4LKSA 3WXPA 2GNDA 3GJAA 2A6VA 1AYM1 4S2DA 4XJ9A 5C4WA 3WNOA 2A5ZA 2ZX3A 3OUIA 1QNWA 1CWPA 4ONUA 3W58A 1B35C 1N1YA 2W68A 2ZOEB 2PMWB 3WVJA 4PU3C 1OOPC 2BTVC 1VMJA 1U5IA 1VALA 1JH9A 2WKKA 3NJXA 1RXFA 2PELA 2PAMA 4NRQA 4QX2A 4A41A 4OFGA 4YGCA 1AR73 3JU9A 5EHDA 3VL8A 3I3MA 1H30A 1LGCA 1Q8VA 1XSRA 1Q43A 4ZZ5A 4ER5A 4ET7A 4EWEA 2YC2A 1V6IA 4WM7A 5JZGA 3LA2A 3FFZA 3NNLA 2G4IA 3V56A 2WAOA 2MEV1 1UOJA 1Z7S3 4TLGA 1XPWA 4N90A 3MFAA 5FYBA 1K42A 4DXSA 1I3HA 4BQ3A 1P8JA 5BNOC 4UBGA 3RNSA 3L1PA 2LYQA 1O91A 1SLTA 3E6DA 1Z78A 2XL9A 2BEOA 2XUEA 1POUA 3N7JA 4HFSA 4Q0SA 3QD6A 4B4PA 3F51A 4N43A 1SPPA 4W6YA 3TRSB 3ZSKA 2XJSA 1YIFA 2HJIA 3EHKA 3OUHA 3OOXA 4YG0A 3VDBA 5ABJC 1W6QB 2GAUA 1YCIA 2RS13 2HWD1 2HWC3 3HQXA 4G3YC 2D5FA 1ULEA 1UAIA 2RMU2 3K51A 4GMP3 4PT6A 2NYYA 1G6NA 5AVAA 3VD7A 2ZGNA 2UWBA 3WF4A 2I2SA 4IEQA 4RHV2 2LYJA 2RS32 4YG3A 1TMF3 4E8CA 3KT4A 5BNPA 1YO8A 3T0BA 4CTEA 4OHWA 4M01A 2BPA2 5FO7B 1HN0A 1BDHA 3QOPA 4P5YA 4RFT0 3SH5A 5BV6A 1WLTA 4Q4X3 3QFIA 1JU3A 1RUG3 5FZEA 3UYJA 4XVHA 4QQOA 3H0OA 1J83A 4IDZA 3ZYBA 4E4DX 2Q8EA 4RS5A 5LEKA 4CCNA 3FLRA 2AZ5A 1AVBA 4LQRA 4O61A 2A3YA 1WLCA 1H4GA 1X82A 4XBNA 5GLWA 5HI0A 1UL9A 1B09A 1LOGA 2JDHA 1SHWB 4O7XA 2DURA 1H8VA 5GZEA 3U10A 4KG0A 5DMYA 3ZX7A 5ACA1 1NE6A 1PGW1 5JXIA 1RVF2 2D40A 1FMD2 2RJ2A 1OA2A 1R64A 4R4ZA 1TVGA 1MACA 4CDUB 4Y5SA 5FYVA 5KHIA 3VBHB 4AEJA 1ULPA 3AC0A 4Q1RA 1EFAA 4LUMA 4R9CA 3RI9A 3WHUA 4LO4B 1EAH1 1NA1B 1S0BA 1ZBA2 2DVFA 2E7TA 2VW2A 1UZYA 2ES3A 5C9AA 3BPSA 1N3PA 1PK6A 4TSVA 5J96B 2GMMA 1RUD2 2UURA 4CEYB 5CFDC 1X50A 4OI2A 1LEDA 1DQ2A 4QT6A 1QGLA 4XQWA 3ACGA 3N35A 3C7FA 3VBOA 2WN2A 4PIZA 1GUIA 3DN7A 3KVBA 4FPYA 4J6GA 5FZFA 4EN9B 2RHPA 3VKMA 1J3QA 1ZUGA 1SZBA 1E5SA 3D0SA 1PMJX 1OQ1A 2FDGA 1ENSA 2UWCA 5JI7A 1OLQA 1DWKA 1POQA 1W03A 2JICA 3VBUA 4DXZA 4QXBA 5FWJA 5F3CA 2WUSR 1H2NA 3EQEA 3QLQA 4OUSA 4Z82A 5FZ1A 1O3TA 3VDAA 2VR4A 1S2EA 4GXLA 4RQPA 3PUIA 2Q8DA 2CU5A 1V6KA 2QBXA 4NE9A 4ZS3A 3R0RA 1PO11 3ZFGA 3DF0A 5HXVA 3QF3A 3VZMA 3I2HA 1DGLA 3ILFA 1DYKA 2WS92 3OWQA 1OKOA 2JD4A 4GQ7A 5LWBA 1CX1A 2WNUA 3NVCA 4OLLA 4CRQA 3AM2A 2GC1A 3O1VA 1VAMA 4AEDB 1QU0A 3APBA 2JG9B 2GRMA 2XI8A 4I6RA 2R063 3HQUA 5CFCA 3GZCA 4FPKA 1FV2A 1DZTA 4XJZA 3MGUA 1UOBA 3U11A 1M4WA 1UX6A 1Q56A 5C3SA 2HCSA 2WNVA 2Q8OA 3VBSB 4CE8A 1ZRFA 3THPA 2W5FA 4NHMA 1E5IA 4ZU4A 4ZXEA 1RUI3 4CZSA 2YBPA 4LBJA 3VLBB 2VZUA 4EQZA 3N36A 1BLZA 1ND3C 1UMHA 3CQOA 3SNMA 3IPVA 1W06A 3UL2A 1KS5A 5SV8A 2R043 2RVAA 1AZDA 2ARAA 3E6BA 1OF3A 3NW4A 4XEZA 3DM5A 1MVQA 3AJZA 2HCNA 3R09A 1Y43B 2J42A 2VCAA 3KV4A 3ZN6B 4MZUA 2OQ6A 3N7MA 3LQXA 1F5FA 2P34A 2YFZA 3S0MA 1MZ5A 1PVXA 3RZLA 4OI0A 3P3NA 1WH6A 1Z7S1 2DTWA 1DQ1A 2PXTA 1Y9MA 2ZGSA 1AL22 3WNKA 1RUH2 1UTXA 4AHXA 1V0AA 2JWPA 1MPXA 2ZX0A 3ZXEA 4XETA 4BH9A 2JENA 3E97A 5A80A 5I0DA 5KHGA 3ZOIA 2UYAA 1SMVA 1Q3EA 4R9AA 3KXAA 4A7KA 3K4ZA 5T3NA 1LODA 1UX7A 2RG4A 4A45A 2PLV3 1GFF2 3WSOA 4BQWA 4CDXA 4ITCA 1CAUB 1RZRA 1FT9A 1MZFA 4RHV1 1DYPA 2RS31 3WG4A 4TTGA 3POGA 4Y26A 4AGGA 2ZJCA 1LCDA 4DMIA 2O8QA 4LITA 3DUIA 2KEKA 2CY6A 1WCKA 3ZLIA 2ZHKA 1OCTC 3AFKA 3POIA 5I93A 3A21A 2HWE2 3I49A 5EXOA 4B1LA 1VPHA 4I01A 2AEYA 1S0CA 2ZGTA 1WW6A 3KGLA 4AHYA 1LENA 2PUCA 4LTAA 3UETA 5FP8A 3G7DA 1UOGA 2HEWF 1H1MA 2HFZA 4LULA 5I0UA 3WHTA 2R072 3JB4C 2AEZA 3QCWA 4EN6B 4YLZA 1ZBE3 3IB3A 2VGDA 4WVZA 3GN5A 1J1TA 2XJUA 1RVF1 1FMD1 3F95A 3ZDVA 3AKQA 3O7OA 1Q5OA 3ZPOA 4OHYA 2OUJA 3UGHA 4CPBD 5CKQA 4IVZA 4GULA 5LBFA 3WOGA 3BGAA 2XVLA 3NAPA 3ZSMA 1AR91 3NXHA 4I30A 3LDBA 3RJRA 4BJ0A 5HPOA 2IXIA 5IVCA 4I09A 4BQ1A 3J8F2 3KB5A 1OFSA 3ZSEA 3ZXFA 1ZBA1 1ZZ7A 1K5MC 3CJIA 4GJYA 2A75A 3D3AA 3VD5A 3UKNA 1BBT3 1RUD1 3N3HA 4Q4W3 3VZOA 4JGZB 4BYYA 1UPIA 1W8OA 3ABZA 4DNYA 2VVDA 5A1AA 1E5HA 1J59A 5CADA 3B93A 3VWSA 2MEZA 2X5IB 4NWWA 4QPIB 4YW3A 1F8VA 1EY2A 2ERFA 1N47A 4TN7A 1PZ7A 3ZXAC 3WDTA 1LOFC 2VJXA 5JIAA 3NV2A 1JZ3A 1CPNA 2B5HA 4LHSA 2H0BA 4DUWA 3PLQA 2VQUA 1DLLA 2YC0A 3P3PA 3ZKCA 1QJZA 2R7EB 1JOPA 4LBOA 2JKBA 3RPQA 2ZAAA 2A7AA 5HBAA 2IVGA 3AKTA 1TNRA 3WF3A 1VBC3 4CPBA 4ISQA 1HKDA 4AEMA 4Y33A 3G0TA 5EYYA 2XJ3A 4ISRA 3KD4A 4BPZA 5DTMA 1NCQB 4FOYA 2LUWA 1PM7A 5L73A 3ZFFB 3AFGA 3ZYRA 2LRPA 1C57A 3J7LA 1RUC3 4OI1A 3NKGA 2BRTA 5JMOA 3UKVA 4WZCA 4Y5TA 2HKXA 4A7YA 4EQVA 1NCRB 2JDUA 4YW5A 3MIBA 4AI0A 4FFHA 1F4HA 5KXCA 2HINA 3PVBB 4DS0A 4Y1YA 3ZVXA 1DZRA 3TNPB 4EYUA 1H8TB 5IW0A 1BVVA 3VZJA 5EJ3A 1BMV2 1OA3A 4FFIA 4ARYA 2EIBA 1V9U3 4AVSA 4XUQA 2X10A 2JVLA 1CPMA 5B4XA 3F6WA 3HOBA 2FCVA 3IM0A 4DINB 3AP5A 2OZJA 3FFQA 1JZ2A 5LB6A 4YVSC 1W6OB 2VMDA 5LY1A 1DYOA 1XU1A 5IK4A 2Q8CA 1C8M3 4Y20B 1ZRCA 1BJQA 1W8FA 5DAQA 2YXSA 1AL21 1RUH1 2QUOA 3PTRB 3WP4A 1IS4A 1UZ0A 4ER3A 5JPMB 5FZLA 4BIOA 5JAXA 3POFA 4S2GA 3JD72 1RUE2 4D6SA 5D8AB 1SLLA 3N9NA 4CSWA 4XJUA 2ZX1A 5F7UA 1SBDA 1GV9A 3VBHA 5AC93 4N53C 3PU3A 5LASA 1O8PA 2DCJA 1XYPA 3I2JA 2WNEA 4AGRA 2XONA 3DXTA 1TZOA 2E63A 1LQCA 4LUKA 1WIZA 1W2UA 3I3EA 4LIUA 3JZVA 1F15A 3BB6A 3N9PA 2C5DA 1CIWA 3ZO0B 4CEYA 2ZACA 4DPNA 2KEJA 4DZGA 3WDYA 2R0FA 2K46A 5CIRA 3VBRB 2VMIA 4LO6B 5I8YA 3T1MA 3N7LA 1AYN1 2LYPA 2IXKA 2CNAA 2KR2A 3RWNA 4Y1ZA 1R1ZA 4AI8A 1KRIA 4YM2A 4JKKA 5FPZA 5FBZA 1XBFA 2EALA 2PHLA 3HD8B 1DLCA 4E4HA 4NJ4A 3EB7A 4INDA 4XZPA 1QNYA 2DYCA 3MW2A 3KV9A 2DUQA 4OUEA 3W5NA 3PUHA 2ZEWA 1YFYA 3MUZ1 3NV4A 4FQZA 5FUPA 1LRHA 1JYCA 2R16A 1HRI2 3C8XA 3THCA 2O1QA 4BMBA 1DGWX 2VUAA 2RM22 2WZR3 4Q29A 2VZRA 3WP3A 1BYHA 3AMHA 3K4DA 3BDNA 1JODA 4PDWC 3WQ0A 2J1VA 1C1FA 3J8F1 4FFGA 5A32B 1JYXA 3VBFB 3WDWA 2YPDA 2WLPA 3OBAA 4A6SA 1IGOA 1PNFA 5CEHA 2K9ZA 3OG2A 5GLTA 4XFFA 3R1FA 1NKGA 4AEDA 2JG9A 1Y7YA 2QKDA 1AJOA 1WMDA 2HYXA 4Q4W1 4NIHA 3M9LA 1WZXA 1Y9GA 4UOJA 3RZZA 2VTFA 1W6PB 2GMPA 2WO3A 1VBE2 1AR83 1WA4A 3D0JA 2PE5A 1W0OA 3LSDA 5FZ4A 3SEPA 5IFPA 2DTYA 4X4GA 3LQCA 2VNGA 3VBSA 4OMDA 1REDA 4K7JA 1PIV3 2VCMA 1C4RA 1GZWB 4FSJA 2W1WA 3LIHA 3AXDA 5LCWL 1W8HA 5DUVA 3ZYHA 1QP4A 1LTEA 4CU7A 1VAKA 1YHFA 5D2AA 1ULDA 1D2SA 1G9DA 5T50A 3T4HB 1AR63 3NV3A 4RR3C 4C1WA 1FPN3 5A3TA 4HKOA 2P1BA 2B9VA 4XIKA 5FMCA 1VJ2A 1RMU2 3W20A 4CU8A 1Y7BA 1HDKA 1HV0A 3H1WA 1QJY2 1ZZBA 2RE9A 2XXZA 3LDRA 1LHVA 4GKXA 1ZZ6A 3C7HA 2EF6A 2P3IA 1R092 3LFPA 2IXHA 3GDBA 4MGKE 1W05A 3C7EA 2AGSA 3PVNA 1R1A3 2EBYA 4OZOA 2J7WA 4E8DA 1FOD2 3RFRA 5JXHA 3IVPA 2WINB 2W0XA 3K2OA 1BK0A 5ANQA 4CDWB 5LK5A 2W91A 2GN7A 5FMOS 1QXJA 4MOAA 4SLIA 1BMV1 3FJSA 1CAUA 5FMOL 1H1IA 2PIJA 3LFIA 3OP9A 1HQLA 4QX7A 1C3HA 4B1MA 5FZ9A 3X29B 4EJRA 3HNMA 2W3JA 4XAAA 3T2PA 2DWRA 4X4EA 2CHHA 4BQ2A 1OQEA 3AXEA 3WD5A 2C9KA 1XXNA 4AK3A 4QKFA 5HCAA 5CKMA 4P9IA 3JCIA 2OT7A 5FZHA 2ZKLA 2Z2SB 1V6OA 1F35A 5G05L 2IC1A 1W9YA 5T55A 3S5QA 2VBDA 3WF0A 1KGYA 5L36A 5E1RA 1UO9A 3M2MA 3JD71 2XJPA 1RUE1 5LEJA 4Y1VA 1RGSA 4META 5HV4A 1AF9A 2ORZA 3B02A 4YVWA 3RVHA 3TEXA 2W1UA 4YYOA 1UU5A 4ASKA 5L7OA 3IT8A 2JB4A 4LBQB 3VB9A 4WBBA 1AX2A 4AI2A 2DCTA 3D8CA 1PRVA 2O38A 1ND2A 1W04A 4BHPA 1LCLA 3ZYJB 3FBMA 4COVA 4Z2AA 4NIAA 2LYLA 3MZHA 3MLFA 1PX4A 2GC3A 3DEMA 3KV5A 1Y9QA 3AYEA 4JGZA 4XFBA 3KCCA 1DGWA 3BVCA 1ULCA 4AVAA 3H5TA 2YU1A 3ECQA 4JHTA 1XSQA 3HVDA 4FQ4A 5EZWA 1AHSA 4UFKA 1D0GA 2RS52 2X5IA 3HBZA 3LDKA 3FUQA 1BZWA 3B7MA 3MV11 4NIDA 2VU9A 1W8TA 2WZEA 2VBPA 3WG2A 5FYHA 1QHDA 4C1XA 2PHFA 4CCKA 3H8OA 2ZXQA 4I3GA 1FV3A 5A33B 1S0GA 3U78A 2QCSB 3VZLA 1JYTA 2X29A 3EMRA 3PUQA 4NAOA 2HWF3 1QQBA 2AH2A 2E53A 4YARA 2QDNA 2XDVA 4X4CA 1HRI1 2FDJA 2OKXA 5JOYA 1O3QA 2GC2A 2RM21 3GJBA 3ROUA 4CDQC 1JUIA 3BOPA 3GXUA 4IEWA 4K3UA 4QQPA 1FYUA 2WFF3 4SBVA 5JXJA 1UYYA 2BUKA 1QEXA 4K6BA 4JHZA 1G9BA 1NCQA 1W8ZA 1TE1B 3M3OA 5FY9A 3MO4A 5B4NA 1CZTA 3ZFFA 2AYHA 1YXWA 5CFCB 4R52A 1SFPA 4H3WA 1RINA 2FMYA 1QB2A 2OW4A 3SITA 4IE0A 2WR9A 2Y60A 3EXUA 4D8MA 2B8MA 3GZTB 2BU9A 4F8AA 4IGQA 4LORA 4RL7A 4YFZA 1NCRA 4LKFA 1EUUA 4C8DA 3J7NA 4X4DA 2VXJA 5GLVA 3H8XA 5DDJ2 1QOSA 1RIOA 3AL5A 2KD7A 3D82A 3IZOA 1H8TA 3JQXA 1HB1A 1GZTA 2YZ4A 2PPXA 2XH6A 2ZCWA 3PUAA 1TME1 3IPVB 2AXUA 3B69A 3OB8A 2QQNA 3OGJA 3VHRA 1PGSA 1V6JA 2QQKA 2VOTA 4IEZA 3ST7A 5FLHA 2JIJA 1PVC3 1Y4WA 1UQXA 2W46A 3VKFC 2WIUB 3AZXA 5LZ6A 3D5OA 3DV8A 4NHLA 2O0OA 4QM8A 3RG0A 3S7EA 1OOPB 2ZGMA 4H7LA 3FL7A 1W6OA 1YJLA 4GB32 4O9EA 1WLDA 1T6GC 1ADRA 1MZEA 3F2ZA 1RMU1 4KGGA 3R4DB 5KHKA 3T2OA 4Z5CA 4JQRA 4Y20A 5LRRA 3LB9A 4O65A 1QJY1 1S0EA 4AFCA 4IESA 5LRSA 3NMBA 3RZHA 5A3UA 4FTSA 1R091 2YU2A 3SC7X 1QP0A 1Q8QA 4A4AA 1KITA 2ZGOA 5A7LA 2PXQA 1VMFA 3CKHA 3LEMA 3PJYA 3AMQA 1RC6A 3IDCB 5E88A 1OI6A 2WQ4A 1R1A1 2BGOA 2XLGA 3DYOA 1FOD1 1OT5A 2XMLA 2I74A 2XVGA 3IDEA 4U36A 2EICA 4GMP0 4Q2JA 4CXWA 4E4SA 3E5XA 2XUMA 4YZ5A 2HWB2 2Z4FA 2VW0A 4QXCA 4CUGA 3A7QA 4H7MA 3Q8BA 3TWIA 1ASJ2 1LHNA 1VBA2 4HG6B 2O8OA 4K20A 3WW4A 2DVDA 2WZPP 4NWVA 5F37A 3LA3A 2R1JL 4Z59A 2XCJA 5K0UC 1QH7A 3VKLA 1J58A 1GMMA 2FQPA 1D7PM 4HL0A 3VBRA 2Q4SA 4A6OA 1CN1A 2GN3A 2WSVA 2ZAHA 4QXKA 1NYWA 4OULA 2AREA 4XHBA 3VHNA 1JOBA 2J22A 2JG8C 5LBCA 3OGVA 3LF7A 3ZN5A 4NIGA 4E2GA 4QHZA 4ZKTB 1YWKA 2R6QA 2CGNA 3MHZA 3VBUC 4XFAA 4YG7B 3OQOA 2EIGA 1GP4A 3DPRC 1YQCA 1QPZA 3NAPB 4JX0A 4Y3OA 5KHHA 4COZA 1R69A 3VHOA 3RZMA 4RQPC 3WNMA 2WO7A 1X33A 4GWMA 4NMIA 1K3IA 3HT1A 4M00A 2YYOA 1W8NA 5JSOA 3PL0A 3ZIWA 2OX0A 4NPRA 4UW4A 3H7YA 1YLLA 3HJRA 3KMHA 1YUDA 3FN9A 1VP6A 1FAYA 1PO21 1QQAA 1RHI3 1ALYA 1APNA 1LOCA 3LGRA 4UF0B 3POWA 5FP9A 5FP3A 3MEJA 2VTXJ 4MGYE 3OD0A 1R082 2B9UA 3AMNA 5CYYA 3WG3A 2RDNA 2KPJA 4ER6A 2LALA 3OJBA 1AUYA 1F31A 4KGQA 2ET7A 1FI2A 3LPFA 4XUPA 3WG1A 3ZYPA 2RV9A 4FXKB 4JGYA 4JV4A 3CLCA 2RR13 1EV13 1W6PA 3IIAA 3SHRA 5C5TA 2RS51 3PJQA 1IPSA 1WW4A 4YW6A 3U07A 1H9PA 3T30A 4ER7A 2FZ1A 1E57A 1KQRA 1QDCA 2BVBA 2R32A 5FZ0A 5CFDB 1GQHA 2N7GA 1GZWA 3ALQA 1LHOA 4WM8C 3O12A 2MXDA 1AR72 2XJTA 2XKOA 1RTVA 4GD4A 1DG6A 4HZFA 1O4ZA 2IVBA 2VMFA 2JDMA 3B94A 4FPFA 5KHJA 1O4YA 2PHDA 3B01A 1N1SA 4HN1A 2VMGA 5JPNB 2D6OX 3MFCA 1WD3A 1MEC3 3FE5A 4YM0A 3VD4A 2LNMA 4BCUA 1BXHA 1Z7S2 3ILRA 4HOOA 2ZTNA 3NJZA 4CP0A 5C3OA 2IV1A 1NE4A 4JCXA 2IFWA 3TFLA 4LR4A 3RI8A 3A0NA 3B3QE 3POEA 1GWLA 1DBNA 2BP6A 4H14A 4NRPA 4MO3M 1GOFA 3LSEA 5I0RA 4FOQA 5ANNA 2P6CA 1D4VB 4Q0QA 1F5JA 4QHBA 1KD7A 4WZFA 4GH4C 1NZIA 2RS12 4XMIA 3LZZA 5DDJ1 4PQQA 3AX4A 4B4QA 5CU1A 1VBD3 5K8SA 4PQ9A 2WLQA 3H50A 4OZXA 4CDWA 5ISLA 2JIGA 3H8RA 4P9WA 3AYDA 4WVVA 2DVBA 4LBQD 4FPEA 1HJFA 1TMF2 2J1AA 4X6QB 2DU0A 5CZKA 3HMYA 2ZGKA 4AFDA 3SH3A 3FHQA 1WCUA 4LK6A 3G5GA 2FDKA 4LO8A 4Q4X2 5FPVA 1RUG2 2WNOA 3QOXA 1JFTA 1ST8A 1N1TA 5FZMA 2PUFA 3K4AA 2RJLA 5J98B 5LY2A 3T4VA 1MS1A 3VZKA 5CG9A 5JSPA 2PXKA 4MV2A 3GF6A 4GB31 4TYSA 2XXQA 2VZ3A 2Y38A 5DPNA 1H6YA 1HQWA 1ND3B 1OD5A 1WBFA 2X53S 5FZ8A 4M0NA 4C91A 3A9ZA 5FZBA 3TNQA 3U1XA 3MIFA 1I5ZA 3QQ6A 2OIIA 4LLFA 4QKNA 4V2VA 1QQP3 2PHUA 1O59A 3WY6A 1LJ7A 4NHYA 3IMMA 2Y64A 4O8BA 1NUKA 2VE1A 4QX8A 3D4KA 2VUJA 3LEIA 2QQVA 4FPJA 3HEIA 3NL1A 3R4UA 2UWAA 1AR92 2H6CA 5FQ0B 4NR1A 4F7ZA 2YROA 4W4ZA 1OD3A 4FPOB 2PXBA 1L7QA 2HWB1 3CU7A 2PQQA 1WCQA 2YG0A 4HK9A 3ON7A 5EIYB 5A3NA 1QJU3 3V64A 5IVFA 1ASJ1 5JCTA 1VBA1 2L8NA 4LBQA 4LOTA 3USSA 2VZVA 1RUF3 2ZGPA 3CJIC 4FP2A 5FJHA 4YW1A 3KVAA 3Q9OA 4GKYA 2FDFA 3OBTA 2V73A 1VRH3 4LOSA 1IKPA 2ZBJA 3N9OA 5KC6A 4YWAA 1HN1A 1LGNA 2W95A 1OPMA 2WWJA 3I2GA 1W2TA 4Q4Y3 4Q2FA 1HW5A 3WP6A 3AZVA 3JXDL 4P00B 1MQTA 4Y42A 1LLIA 1SFYA 1O6UA 1W6NB 2D7FA 2KXLA 5GLUA 3O14A 4CCCA 3H3UA 4B7EA 5C3QA 4QPWA 3FX3A 3R6SA 4MGZE 2PUAA 5FREA 4K40A 3QBQA 4AGVA 4AOCA 3CROL 3DCQA 4YBAA 1G9FA 1UU4A 3AYAA 2LLVA 3WDXA 4BMEA 4QD2A 4CCJA 4JQDA 2AXZA 2H0VA 2VMCA 4PU4C 2VMEA 5A33A 4YG1A 3KHCA 5FIXA 1QJX3 5T5PA 3USUA 3GZDA 4PBPA 5L9VA 2VG9A 5EFUA 5FZ7A 5BNQA 1ZVFA 3ZSJA 1PMHX 5HV0A 4IGPA 5JR2A 4P02B 4NROA 1IQDC 1UU6A 3NO8A 3OEBA 4AVTA 4A44A 4DFSA 4IV1C 4QPGC 3WV6A 1E5RA 3G6JB 4AQSA 4HPKB 5A6XA 1XQNA 4FP3A 4LE4A 3ZHMA 4EN8B 5F9TA 1MVEA 5F6KA 1R081 5A6QA 3CHXA 2R062 2D6NA 1TEIA 2FJRA 4KWJA 4LBMA 4Q8LA 4AL9A 4UYBA 3WX5A 2X8KA 4ZHNA 2ARCA 1RZRD 4ES9A 1BCXA 2PXLA 1JU4A 4QGMA 1QOOA 2VMHA 2VZTA 2RR11 2XXPA 3M8LA 2WS93 2JJ6A 2DU1A 3MPPG 3Q8AA 4YW2A 2R0HA 1RUI2 4JQTA 2Q0AA 3JXCL 5JXGA 4EKGA 1ZAYA 1YQ2A 5BY5A 2D3SA 4L8QA 2ID4A 1AR71 2C1FA 2KM2A 3AMMA 3POJA 2JDZA 2R042 3I8TA 2XKPA 4HK8A 2O4AA 4IQPA 5DXDA 5FDBA 2G9FA 1W9TA 3OF1A 4XBQA 1SLCA 2VAUA 5HXMA 1ZRIA 1U5YA 1B35A 2GZUA 1A8DA 2DFBA 2DFCA 4JKMA 5LA9A 1OOPA 2WN3A 1RB8G 1QMJA 1YFUA 2JD9A 3KCXA 5E16A 5FPAA 1OMIA 1LOEA 1ENQA 2ZPXA 1GBGA 2LM3A 2XJVA 4OBMA 1J1LA 2BWAA 2YBSA 1VR3A 4OB4A 2EWTA 3HPNA 4B4RA 3BKZA 4YZ4A 3AZZA 3FBYA 2VO5A 5F32A 2RS11 2HWC1 1O5UA 3ZR6A 3H8UA 3MF9A 1AXZA 3ZYIB 2IZWA 2ZHMA 4V2WA 3LAGA 2F4LA 2PLV2 3HN1A 4YNIA 4GMP1 2DDUA 3CMGA 2YY1A 5EJ1B 3SXWA 5I0TA 3VBHC 5BNOA 4FVVA 1A34A 1TMF1 5C8CC 5IK8A 4FOWA 1RIRA 4MADA 3WW2A 4BB3A 1NA1C 2VZOA 2AXVA 2ZMLA 3RQ0A 1NW3A 1PZ8A 1LU1A 3PDQA 4B29A 4X8PA 1SEFA 4K8FA 1JI6A 3SQOA 4C90A 4Q4X1 1RUG1 4HRAA 1AYN2 3VZNA 4O9GA 4BQXA 1GU3A 3HNYM 2CROA 4XOGA 1RITA 2IVJA 2RDQA 5FXXA 5F6LB 3TAYA 2Y6JA 1GR3A 4AQ2A 2VZQA 1HRV3 3CO2A 2D44A 1DZQA 2VL4A 4Q4V3 4FAGA 4XQDA 5FY1A 3ETQA 1WETA 1L7LA 1ZBE2 1FXZA 4UBHA 4DIQA 4PU8A 4YVSB 2KEIA 2HWE3 2EIEA 3C7GA 5FYCA 2XOMA 2VZ1A 1WLWA 4K9SA 4YVWB 2V4VA 2JDPA 1WBLA 1GLHA 3KCYA 2QE3A 2EAKA 5L7OB 1Y3TA 4IWRA 5K4LA 1UD1A 4EK9A 4ZU7A 1I5PA 1ND2B 3K48A 1D4M3 1UW8A 1V6NA 1VBB3 2UY9A 4NAMA 4UF0A 1JHJA 1BBT2 4JVAA 4Y1UA 4Q4W2 4F83A 5FBJA 3D1NI 4FBFA 1RUF1 3GUUA 5FK8A 5FZGA 5FOBB 3U4SA 3I2DA 3L2YA 3I2FA 2XVKA 5FKBA 2J1RA 1SCSA 2P37A 3WNXA 3MUY1 1ZA7A 2MQKA 1ENXA 1DGRA 2PXVA 2H6BA 4FI9A 4QX5A 2XB6C 3GYDA 3LISA 4FPHA 4G9SB 1UZVA 4D7TA 3NJVA 4P5HA 4DUXA 5CFDA 3BIWE 1UF2C 4YG6A 5GLZA 2W87A 3S5AA 2GMEA 5IFTA 2BW8A 4WV8A 4PJYA 4XAEA 4P9LA 3I2KA 1YIPA 3ZXJA 4PI2A 4XILA 3TN93 4KMQA 5IWFA 1VBC2 4FO9A 3OPTA 4V1PA 1ONAA 4M3CF 2CAVA 3N9LA 1ENRA 1W8WA 3H3ZA 4IV3C 4W50A 4B3NA 3T0DA 1V6LA 2JDKA 3A22A 4HT1T 3GGLA 1RUC2 3WLUA 1QZXA 4WVWA 5DZEA 5FTTC 3KSCA 3WF2A 1JH5A 4EN7B 1UKGA 3GALA 1JZ6A 2CL2A 5T52A 1LOAA 1DQ0A 1KJLA 2R061 1ULFA 1WMFA 2Y6FA 1L7RA 5IYYA 1JYWA 2PUDA 4OQ9A 5FP4A 2ILMA 5FXVA 3HN3A 4LMFA 2ZGUA 5DUUA 1K45A 2GP3A 4QB6A 2XHKA 2E6VA 1IS5A 4Q8KA 3U3WA 3GZAA 1RUI1 4LA2A 4AYUA 1V9U2 4LBKA 2Y34A 1SQ8A 2PXUA 3IMNA 4N8MA 2R041 4IW3A 4H2AA 4JDOA 5I0SA 3ITQA 2DBNA 5FO8B 5SV5A 3FYAA 1A3KA 1WGPA 3WEZA 4HXCA 2GH8A 1Z0HA 4IE5A 1XRUA 4QU2A 1CONA 1C8M2 4I0WB 4BLIA 1W2NA 1JYIA 1IPJA 1ND3A 5DZFA 2JE9A 1NXD1 1GKBA 3MLLA 1LEMA 4RGKA 3O1RA 1N3OA 3ZFEC 1LECA 1RPEL 2VXRA 4RR3B 4AEKA 2Q1MA 2ARXA 1KDKA 1VB2A 4YGBA 1G9CA 2MNGA 5L9BA 3RGBA 4OCTA 4BQYA 4HKLA 2XBO3 1GT0C 1RUJ3 1UOFA 4Z58A 1XE8A 2R30A 5AC92 4UI9L 5FQ0A 3BIEA 2PLV1 1DQ6A 2G1MA 3OQNA 1SDWA 3BTAA 1JOJA 3NNFA 5A1LA 4HSJA 4BE3A 1OHFA 1X36A 2BV4A 4AHWA 4FN3A 4QDQA 1CAVB 1ZZCA 4BA6A 2A73B 2XQRA 5DZGA 5FYIA 3INAA 4XJAA 1DQ5A 2DCYA 2XXAA 2L1PA 5A7QA 2BOIA 1W6MB 1MR5A 5F3IA 1J84A 2AENA 1UMIA 3I2IA 3WCSA 3PVEA 5C7GA 1GP6A 2IXLA 4FAHA 5E8AA 3K77A 1HLCA 2OR1L 1GZCA 1LR5A 3E5UA 2NM1A 3TEZA 3O0XA 2MPFA 1LNSA 4AXOA 1X2LA 1OVPA 2P3KA 4QPIC 3T0AA 4Q4V1 1W6NA 5DSXA 1X8EA 1ZX5A 3OKZA 1ZBE1 2J1TA 1W9FA 5FMDA 5FXZA 5J37A 1OURA 4UW3A 3FHIB 4KNCA 4Y1XA 1JN2P 2QNKA 3HNBM 2C9AA 4IE4A 5LBEA 4CEWC 3CLPA 2ZMNA 2X05A 1C5HA 4JRAA 3A0KA 2ZA9A 4CP1A 4Q0UA 3NQHA 1VPWA 2UU8A 2TEPA 2WZR2 4JDNA 3S57A 2VZSA 1BQPA 2JCGA 1IG0A 1YQ6A 4QQHA 2R63A 4FTEA 4OHVA 3TBDA 3GNEA 2CAUA 2OPKA 3NWKA 3J26N 4HPKA 4URAA 1BBT1 3UFDA 3O1MA 4DRRA 4J1XA 4N7IA 3OD4A 3LA7A 4JGYB 5LA1A 3QYXA 2F17A 1NT0A 5JSRA 5KR7A 4IUGA 2DCKA 1UY2A 2O14A 4ZZ8A 1AR82 2XJRA 1H1AA 4DOUA 2XWBB 1YQ5A 4EE2A 1K5MA 5DG2A 1O3SA 1TME2 2WABA 2A3XA 3Q8EA 1O5LA 4N7UA 1L3JA 4Q5OA 3WW3A 1CGPA 1WCSA 3S6PA 1GOGA 3GZEA 1W0NA 2AWIA 1GOHA 1YFXA 2W39A 2PN5A 5FZ3A 3SCHA 1AR62 5FY0A 1FPN2 1ZZ9A 2ZZJA 3T08A 1OA4A 1VBC1 1M06G 5C33A 2EXKA 3PXPA 1LOFA 4IE6A 2V72A 2D6LX 2Y8KA 3JQWA 2LLWA 4XF0A 3PVOA 4JCKA 3WDVA 2WBKA 4KH9A 3NDBB 2VZPA 2ZGLA 1BEV3 1RUC1 2ET1A 3E1F1 3OYWA 2TBVA 4GAZA 4U2AA 5CG8A 3I59B 4FCAA 2D3RA 4CCLA 1R1A2 3FYMA 4LO7A 3DGTA 5HCFA 5A7PA 4CDQB 1JZ7A 4FOVA 5FWEA 3WW1A 1OH3A 5DT2A 1OUSA 2GNBA 2JDYA 1MS9A 4COYA 2VUDA 2AACA 5D8AC 1JXNA 5F39A 1N3QA 3KLSA 4LT5A 1AJKA 2GH2A 2MHFA 5D21A 4EV0A 2LS6A 2A1XA 1S1AA 5FZDA 5H9SA 1V9U1 4K1YA 1V00A 4D7SA 1S4CA 5A7WB 5LATA 2WO2A 5T5JA 2P4EA 2A3WA 3ACLA 3FC0A 2OXBA 1VAVA 2R1DA 2VULA 4JKLA 4LA3A 3TB0A 3M4FA 1POV3 4KU8A 1C28A 3OBRA 2J1UA 1ZRRA 4ZY9A 1XNTA 4JDMA 4XDOA 1ZYBA 1C8M1 4GA9A 1HXS3 3N7KA 2W52A 5FRAA 3KWVA 1IS3A 4DO0A 1S0DA 3GBGA 4LXLA 1GZ9A 2IFRA 2IXCA 5FY8A 1VLNA 2WYSA 4UWDA 5JMCA 3ES4A 1OH4A 3LIGA 1COV3 1XOYA 4I3PA 3O1TA 1UIKA 4YVSA 1IOAA 4I6UA 1WWYA 3BU7A 3WDUA 2J1SA 5GAGi 3P1IA 3OGGA 3VDDC 3JBG3 5AC91 3BODA 3TELA 2QQWA 2XBO1 3PUSA 5IAVA 1IC8A 1XWRA 4NUBA 4DY3A 1CZSA 5BNNC 1H0BA 1PO22 5HCHA 1NLRA 1F9KA 1TQ5A 3KV6A 3POSA 1SLAA 2DVGA 3ZM8A 4AHZA 1S2BA 2D5HA 2Z42A 3EBRA 3M3QA 4GALA 3BTZA 3VBFC 5J3UA 3MIDA 4JTNA 2D6PA 1UY1A 2CSFA 4JCYA 2YDEA 2YPJA 4N53A 4YSFA 4DY5A 1CAWB 1JWLA 3IWZA 1MQTB 4BXFA 4CUAA 5C4WC 2PAEA 4XF1A 1OLRA 4FFFA 4L11A 2XR4A 5JIUA 4PF5A 4MLOA 4DUVA 3VD9A 1QJEA 1R63A 4D3WA 4XCBA 1J3RA 4CVUA 3O1SA 3UV9A 4AQTA 4LBNA 4M3CB 2GZWA 3OPZA 4R8HA 5T5LA 3USUB 3O1UA 1AYM3 1LGBA 1PNRA 3TYJA 2HWF2 3GCXA 4PIYA 3W9AA 5C6CA 2LW8A 2J7MA 2B46X 4WM7C 1OQDA 5JZGC 2WZR1 2BWCA 3MF6A 2JG8B 1X9PA 2ZX2A 2WFF2 1A6CA 3GHNA 1A8MA 2I45A 4C0HA 3WZ1A 4TZDA 1URXA 1X8MA 1LHUA 2ICTA 1LKNA 3KQRA 4IEVA 2ZKNA 3DPRB 1ZZ8A 3Q8CA 2NMNA 2FCUA 4UFLA 3RYRA 1CQTA 2XWJB 5FPXA 2Y6KA 4N43C 4UFIA 4WVMA 1WMEA 1MS3A 1CJPA 1BHGA 2WZ8A 1SQ4A 1CR7A 4MG2A 3B00A 5A6YA 1YFWA 2W47A 2MEV3 1AR81 1NOVA 2W9XA 4E9KA 1SDDB 4CUBA 5KC5A 3UNPA 4GWIA 1NERA 3MW4A 3PIGA 1CJDA 4GWJA 1NAEA 1UCXA 2A71A 1F2NA
chains in the Genus database with same CATH topology
1UZZA 1PIV1 5CNAA 5BNPC 4URTA 3RMYA 1SBFA 3IDBB 5GZFA 1QP7A 3QWGA 1V6MA 1PVC2 4E27A 2VOVA 1B35B 2ARBA 1UMZA 2HWD3 3ILNA 3IKWA 4I02A 3ZXKA 3VK0A 1AR61 3LWCA 1FPN1 2WIIB 5K9YA 1MS4A 4COWA 4X8NA 4IA8A 3R05A 4X4HA 3GBFA 1ZREA 4RS5C 2XLFA 5AFBA 5JI9A 1ZA4A 2CGPA 3KZ4C 4XF9A 1LCCA 5HCBA 2GSYA 2OVUA 2OUHA 3M3IA 4Q27A 2NMOA 4EWAA 3NSTA 4RR3A 4A3XA 3ZXDA 2E51A 5BNOB 3BD1A 2DUOA 5F5QA 3AKSA 2WA3A 2SBAA 4AWDA 1UXCA 2FMDA 5FO9B 3CF6E 2ZHLA 3AP4A 5ACA3 5C9AC 5ABJB 1DHKB 1PK6C 1CAVA 5LK7B 4GH4B 1C5IA 3V0BB 4KG8A 1DQ4A 3B9IA 3MYXA 1GANA 3ZSLA 1W6MA 1XYNA 2CTVA 3VBOC 1S2KA 2ZGQA 1EAH3 4LLOA 2PHXA 1REFA 4YZ1A 1HX6A 2SLIA 3D6EA 2BNMA 3MW3A 1HXS1 1SCRA 2YUEA 4N9HA 3VKOA 4GHJA 3WP5A 2YMZA 3L9JT 2BGCA 3TRBA 2ZMKA 3MLKA 1LMB3 2DV9A 1L1MA 1ZPQA 4Q26A 1CESA 1PRUA 4XF3A 1HV1A 4MGIE 1ZNPA 2E9QA 2P3JA 3ZFGC 3CECA 1O7FA 3U4XA 3M7AA 5FOJB 1RHI2 2D5VA 4UW6A 2WNUC 4S2FA 2IU7A 2LYRA 1YJKA 1LB2A 1YI9A 3SLIA 2ATFA 4LO5B 2WWSA 4E2SA 5CFCC 3AKRA 3OTFA 4HANA 3WT3A 1PO13 4YZ3A 3RSJA 3QH7A 3OCPA 2RR12 1EV12 3M3CA 2WNVC 4MXVA 4FPLA 4P9JA 1XNBA 2E7QA 2VW1A 3I7DA 1SBEA 1GYKA 1QXPA 2VVEA 1ZM1A 2CWSA 4YM1A 3T2TA 1KXGA 4AFMA 4KBBA 1YI7A 3VGIA 4E2QA 2HWF1 1G8WA 2EAAA 2VVFA 1ULGA 4P9XA 3SH4A 3H9AA 2ZABA 1MEC2 3MLJA 4H55A 4AVBA 3W59A 2EF8A 2WFF1 1UPSA 3AP6A 5H9PA 2ZGRA 2NPIA 3H7JA 1EYBA 3R4SA 1KS4A 3I59A 5KWRA 1C1LA 2HWC2 4CDQA 4AQ6A 5A3LA 1RZSA 4IV1B 4QPGB 4R4XA 1VBD2 5JR7B 4CDXC 4HBNA 4ORFA 4LNVA 2JXAA 1AL0G 2ZX4A 1V70A 4QPYA 2V09A 1PVC1 3RS6A 4M0HA 3ZXLA 4ATEA 3EUSA 5JDBA 1CVNA 2RMU3 5I8TA 2QZ2A 4L99A 4MH0E 4B8EA 4RHV3 2RS33 3FWEA 4L97A 2UY8A 4EN0A 1YYNA 2BJCA 1G7YA 5JLVA 3AJYA 3EJKA 3BCWA 3UK9A 3GHMA 1QQP2 4ES8A 3ME2A 2EXJA 5EYXA 3PNAA 2AUYA 4YGDA 5J36A 2WJSA 3KT7A 3RYPA 1CJGA 3NAPC 1PRAA 5J09A 1CAXB 3ZMNA 2CYFA 3RMXA 1XE7A 5K7PA 4NN0A 1QJU2 4W6XA 1SFNA 2BYVE 1FNZA 1RVF3 1FMD3 1RUF2 1VB4A 4PIXA 4XDQA 4N9IA 1VRH2 1AR93 2ZS6B 1NG0A 1CX4A 2I07B 4UW5A 4Q4Y2 2OFYA 5C8CB 1CAWA 1CQ9A 1ZBA3 1AU7A 1I9RA 3J9SA 2H8RA 2A6XA 4RD7A 4OHZA 3DKWA 4QGNA 5A3MA 1W39A 4W65A 1RUD3 2EXIA 3ASIA 3QH6A 1ZVVA 3ZXGA 3B9CA 1W0PA 4M3CA 5K0UA 3DL3A 3LKJA 4P9GA 4D94A 1QJX2 5D1IA 3KZ3A 3FMYA 1REEA 2WL1A 4XF4A 2EXHA 4XQ4A 3WR0A 4Q0VA 2JG8A 5GZDA 5TSWA 2QZ3A 1AXYA 3HIFA 2Y0IA 1RHI1 1UIJA 3ZPYA 4XFHA 2GALA 3VN4A 3DPRA 1QY4A 1IQAA 3IBMA 2D6KA 5FLIA 3UKTA 5IK7A 2DCZA 3RDIA 4AG4A 3VL9A 1K5MB 1U5ZA 3WINE 1EV11 3HR9A 1PNGA 1I1EA 3S8QA 2HEVF 2ZZQA 1EP0A 4AF9A 2ETEA 2Q1ZB 4OI4A 3PMSA 3O5SA 3E5QA 2B39A 2VNRA 3MIGA 1MZ6A 4MXWB 2GU9A 3MDPA 1QXRA 3CL1A 4IL7A 5B2GB 1MEC1 2BFUS 1JW6A 2Q5TA 2BFUL 2A6WA 4LHKA 3OYWB 5J48A 4WM8A 2QVSB 3U0ZA 1WD4A 4HSLA 3SISA 3L2HA 4NVPA 4Y22B 2XIUA 1O4XA 3V0AB 2IXJA 2D93A 3EO6A 5KBFA 1DGRN 4IV3B 2QDRA 2WA4A 4NDWA 4M3CE 3FZ3A 1MS0A 1VBD1 3V65A 4YG4A 4ATFA 1WW5A 2AUWA 4XXAA 1AL23 2JX9A 1RUH3 3BS3A 2Q30A 4X4FA 1UKRA 4G4FA 3GZUC 1IKQA 5ABJA 3PTYA 4HETA 5FFOC 1X57A 4GQMA 1PGL2 4B7KA 4GH4A 4CEYC 3DNVB 3V0BA 2OA2A 1JHNA 3B7HA 2BBVA 5JOZA 4XFIA 2RMU1 1HRV2 3KT1A 1AX0A 2C0ZA 3KM5A 4Q4V2 5CVRA 1U12A 4IXLA 2EA7A 4AE2A 1QKQA 3AKPA 1QQP1 4XFGA 5L19A 1RUOA 4KU7A 1G9AA 1AYN3 4Z07A 1OSLA 3SMHA 4IEPA 5H9RA 4XHXA 4BOWA 3I4IA 2R073 4HKWA 2WQZC 2PHWA 3LOIA 5KXEA 5H9QA 4FPCA 3ZFEB 5GKAC 3ZYGA 1D4M2 1VBB2 1MS5A 1QJU1 3T1LA 3BALA 3MIEA 4F8DA 4KQ7A 4J1WA 2A70A 2ICPA 2ENRA 4CP2A 5IUQA 3GBWA 4N53B 4AEDC 1NEQA 2JG9C 1VRH1 4YZ2A 4OVEA 2PHTA 4JC1A 4L9BA 2D97A 1IZ3A 4Q4Y1 3J8F3 3CJXA 3ES1A 2NN8A 1LOBA 3VBSC 2JECA 1H4HA 2XL7A 2PYTA 4XTPA 2HSGA 4LHLA 1DW9A 5FLJA 2LTNA 2B45X 1DF0A 3HT2A 1QJX1 3TN92 4FXGB 1LULA 3WQ7A 4IEUA 3LCPA 5EWSA 1H9WA 4IERA 1S0JA 1U0AA 5DUXA 4CEWB 4WVMB 4PLNA 1EPZA 4HLTA 5BPXA 4X6RB 4AFAA 3LOBA 4I6TA 4PDWB 1RJ8A 2CV6A 1UXDA 5DUWA 2Y0OA 4XJWA 2BNOA 3WUCA 4IV1A 4QPGA 2PTMA 2WS91 1RJ7A 1KDMA 3B5LB 3M1HA 1BKZA 2RJKA 4YM3A 5GZCA 1GNHA 3MICA 2IVQA 1YSEA 1HF0A 1W6QA 1NLSA 1NY72 4MYEA 2O49A 1IHMA 1QF3A 1U5XA 3VKNA 4X4IA 1RL3A 2DF7A 1GNZA 1D0HA 4Q1PA 1B0NA 1QH6A 1XNCA 2VQAA 1WH8A 5GZGA 2A6ZA 3SCGA 1E3OC 1DIWA 1PHMA 4FTBA 4FT8A 5CB7A 2GNMA 1PERL 2QFEA 3OY8B 2VPVA 2XBO2 3URFA 2KZ8A 1RUJ2 3UJQA 4PCRA 2V5YA 1HQNA 2W08A 4KL1A 4XE9A 4YVWC 2D3PA 1WCDJ 1CAXA 2QQPA 1HIXA 3KGZA 5L7OC 2JE7A 3ZN4A 1BDIA 1ND2C 3JD73 1RUE3 1XNDA 1PGL1 3PMEA 4X4BA 3JB8A 3ZIXA 4XYXA 2R1BA 4JGZC 2D43A 4W6WA 1POV0 4KWKA 4Z92B 2XSDC 5AFEA 4TLFA 2TUNA 4L2NA 5GALA 4YW4A 4CDUA 1HRV1 1PMIA 2IUOA 4PLMA 5C8CA 1OFNA 4Y24A 2BVVA 1CD3G 1JTZX 2X5IC 4I2OA 1NA1A 2DUPA 2FBEA 1GSLA 2Y26A 2PUEA 5IT6A 4LBLA 3O9XA 3BOWA 3AP9A 3KJXA 1OKQA 2NLRA 2HWE1 2GNTA 2VH9A 5EV7A 2K0GA 5GJ6A 2PA7A 2WFPA 4AW7A 2AW6A 2R071 5KXDA 1D4M1 1VBB1 1NCQC 2ZHNA 5JOWA 3ZFFC 2XJQA 2PFWA 5JVVA 4ASMB 3MI8A 4IEXA 2D98A 3MIHA 1DDLA 2F6BA 1HRI3 4HVRA 3VDDB 3KS7A 1LHWA 2F4PA 3THTA 4K21A 1NCRC 2RM23 3J4UH 4YRDA 5BNNB 3RJ2X 4HMZA 3N4MA 2NZ9A 2LYSA 3WCRA 1PIV2 2GDFA 4OHXA 1H8TC 4RGGA 1N1VA 2NQYA 2WSUA 3VV1A 2VOXA 2CWMA 1AX1A 4NOTA 4MXWA 4DQAA 5F1RA 5C4WB 4ASLA 4OUMA 4XMAA 1VBE3 5C8WA 2DVAA 3TN91 3RRDA 4Z8BA 4CYDA 1VIWB 3HAGA 5KXBA 1TME3 4QQ2A 1MS8A 3AK0A 3AZYA 3VUOA 2LCVA 2XPJA 1BEV2 5IK5A 4I8TA 1IPKA 3ZMOA 4WM7B 4Y22A 5JZGB 3QACA 3V0AA 4MCTA 5I8SA 4I0AA 4EROA 2NP0A 2VNOA 4IV3A 1RMU3 4HVQA 2BQPA 2VOWA 3ZN6A 1QJY3 3AYCA 3ATGA 1KFUL 2QJVA 2YGMA 1R093 4N43B 4Q0PA 4K1ZA 3OMTA 1LESA 2Z79A 3S7IA 1FOD3 5K98B 3OQMA 4JRLA 3FMGA 1BVP1 1NY71 3VBRC 4KWLA 2Z69A 5BNPB 1S0IA 3A4UA 2XGXA 4A2UA 1HXS2 4D7YA 2HEYF 3AP7A 5AVPA 2YHJA 2P17A 2YGLA 3TOJA 1GQGA 1ZS4A 4QM9A 2XG3A 1COV2 2Z5WA 1XYOA 1QDOA 3NV1A 4BM8A 3WUDA 3S30A 2LYKA 4XPVA 4RS5B 2XLAA 1RUJ1 1EPWA 3JBG2 4NO4A 3WQ1A 2KA3A 2OZ6A 3ELNA 4FPGA 1WUVA 3C3VA 2B7YA 3ZFEA 4Z2WA 5GM0A 4BIFA 4MVTA 4IEYA 4LHNA 4MSVA 1O3RA 3BPZA 4A7ZA 5FAXA 1UN1A 1H2KA 4MX3A 4JGYC 4DRVA 5T54A 3FLPA 4AFBA 1IS6A 5C9AB 2B42B 1PO23 3UJOA 1PK6B 1SLBA 2VY0A 2WT0A 3JUUA 2GC0A 4DB5A 5K0UB 1SACA 1KFXL 4XFCA 1C8NA 1GICA 3VBOB 3JXBC 1AYM2 1OSGA 3MEPA 4Z1VA 1JBCA 1YNAA 2PUBA 4TWTA 3POYA 2RS53 1H2LA 2P2KA 4YFWA 1QOTA 5BYNA 4QPIA 3VBUB 4EWDA 2L49A 4XBLA 2OYZA 4I0BA 1TNFA 4JTOA 1S0FA 2FZ2A 4ZU5A 1XNKA 2K2SA 4CEWA 4RQPB 3AMPA 4AI3A 1I6XA 1JUHA 1NQJA 4BWOA 1DFQA 3AZWA 2VOKA 4PU7A 3ZFGB 1YRZA 4PDWA 1XU2A 4FBIA 2MEV2 4XTMA 2VECA 4QQLA 1A78A 2TNFA 4XW3A 4P14A 2WNUB 2B5AA 4CDWC 3C2UA 3AB0A 4IEOA 4E4ZA 1NZCA 4QMAA 4Y4YA 1ZRDA 4ZXKA 4Z5HA 5JWPA 3IN9A 5CAZA 3MPBA 2AR6A 5BUVA 2PUGA 2HWD2 2WNVB 3ENRA 5DDJ3 3ZHIA 4MUVA 4RSUA 2A6CA 4NHKA 1VBE1 4WM8B 2IWGB 5BXXA 5CBLA 3I54A 4AVCA