4J1XA

Crystal structure of fe(ii)-hppe with alternative substrate (s)-1-hpp
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
193
structure length
193
Chain Sequence
TASTGFAELLKDRREQVKMDHAALASLLGETPETVAAWENGEGGELTLTQLGRIAHVLGTSIGALTPPAGNDLDDGVIIQMPDERPILKGVRDNVDYYVYNCLVRTKRAPSLVPLVVDVLTDNPDDAKFNSGHAGNEFLFVLEGEIHMKWGDKENPKEALLPTGASMFVEEHVPHAFTAAKGTGSAKLIAVNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Epoxidase
publication title Mechanistic studies of an unprecedented enzyme-catalysed 1,2-phosphono-migration reaction.
pubmed doi rcsb
source organism Streptomyces wedmorensis
molecule tags Metal binding protein
total genus 48
structure length 193
sequence length 193
chains with identical sequence B, C
ec nomenclature ec 1.11.1.23: (S)-2-hydroxypropylphosphonic acid epoxidase.
pdb deposition date 2013-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 4j1xA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4j1xA02
1CAUA 4MGZE 2ETEA 4PU4C 3CL1A 2EWTA 1LLIA 1UW8A 5I93A 2CGPA 3D1NI 3D0JA 3TNPB 4HN0A 4E2GA 1B0NA 3KGZA 3KMHA 5FDBA 3UKNA 4NVPA 1RUOA 2EA7A 1Q5OA 1EFAA 2PTMA 2A6CA 3EBRA 2LYJA 3OD0A 4NDWA 3H1WA 4QGMA 3PXPA 4IESA 2IXIA 3SCFA 1ZRFA 4MGYE 3I54A 1JH9A 3SCGA 1HW5A 3IDCB 2ZCWA 2DCTA 1NYWA 2GZUA 1JFTA 4XETA 4FAGA 1CQTA 3BU7A 4JCXA 2XIUA 2PAMA 2XLFA 2EAAA 1ZZ7A 5FLIA 3U3WA 4HVOA 5I91A 3LZZA 1JUHA 2GC0A 4IEZA 4YNIA 4IEQA 4HVQA 3LA2A 3HZIB 2UYAA 2O8QA 2WUSR 3ZHMA 4PU3C 4Q0SA 2XGXA 3DNVB 1SEFA 2PUDA 3DN7A 3FHIB 1XWRA 1XE7A 3JZVA 5E16A 4XF4A 4F8DA 2VQAA 4Q0UA 3U0ZA 4X6QB 1QQBA 1PNRA 3G7DA 3CJXA 1X82A 5JSRA 1YFYA 2AW6A 2LYLA 1JWLA 1OSLA 3H1YA 4META 4Q29A 1ADRA 2LYSA 2B5HA 3OQOA 4I0BA 5JAXA 4J1WA 1WLTA 3QWGA 2D93A 3KGLA 2HSGA 1OI6A 2VPVA 1O4XA 2GC3A 2IXCA 4HN1A 4P9GA 3S8QA 2QVSB 2O49A 5BPXA 4EWEA 2R1JL 1ZUGA 2EVXA 4QM8A 4R8HA 4YSFA 1NERA 3DL3A 3NW4A 3PNAA 3QQ6A 2ICTA 1CJGA 2XI8A 1J3RA 1CGPA 2IV1A 1RTVA 3FJSA 4LEJA 4LTAA 3JXDL 3H50A 3PLQA 4OB4A 5AVPA 4R52A 4Z59A 4ZU4A 1H1MA 5I8SA 2XLGA 1QPZA 5I0TA 3LISA 2F4PA 2IC1A 1FXZA 4UBGA 4FAHA 3N4MA 1RC6A 4X4IA 2KZ8A 3U11A 5FCCA 4XEZA 2XL9A 3USSA 1L1MA 2LYKA 3LFPA 3IIAA 4ZU7A 3DV8A 1EYBA 1H1IA 3F6WA 4ORFA 4ZU5A 3S7EA 4AVAA 4N9IA 4D7TA 3GN5A 2IVQA 3O9XA 4HLTA 2PUBA 2H0VA 4FN3A 1YFUA 2BNMA 2WIUB 3FE5A 4J1XA 1CAXA 5K8SA 2O38A 4Z82A 3NKTA 4QM9A 1LCDA 1I6XA 2UY9A 2CSFA 1QXRA 4IWRA 1YUDA 1GT0C 1BDHA 4I2OA 4PU8A 2PUEA 4KWJA 2D5VA 5T3NA 1WH6A 1ZZ8A 1UCXA 1CAUB 1WIZA 4WBBA 4F7ZA 4XF0A 3MYXA 4IEPA 4AQ6A 4IEXA 5LEJA 2FQPA 1HF0A 4K8FA 4YYOA 3IWZA 4XFCA 3FX3A 4AVCA 2IVGA 1NEQA 1ZAYA 1L3JA 1O4TA 1ZZBA 4X4BA 4I6RA 3FWEA 4LULA 3LOIA 5EFUA 4EWAA 2JVLA 3EHKA 4Z58A 4H7LA 2EBYA 1ZRDA 4KL1A 1JFSA 1YFXA 5BY5A 2ET1A 1YFWA 3RZZA 1VR3A 1UIKA 4YRDA 1AU7A 3FMYA 2HJIA 4IEOA 1RZSA 2GC1A 1Q3EA 1J1LA 2PQQA 4LA2A 2GRLA 2MQKA 4KWKA 1ZVFA 4MGKE 4AXOA 5C6CA 3GBFA 3EQEA 1Y9QA 4FT8A 5BUVA 1NE4A 4B29A 4I0AA 3M70A 3IBMA 3SMHA 3CROL 4IEWA 5D1IA 1ZNPA 1WETA 2IXKA 4BIFA 1QY4A 2D5FA 2ZKLA 1O3SA 3H8UA 5I0RA 2QDRA 3OTFA 5BV6A 1CAVA 4I3PA 4MCXA 5JSPA 1VJ2A 2ET7A 3M3IA 3OMTA 4GULA 3FFQA 3R1FA 3S0MA 1O3RA 3E6CC 1RGSA 2D40A 3F52A 1OMIA 2MNGA 1O5LA 4KU8A 3ZDSA 1QP7A 1ZZCA 1J58A 2Z69A 4MUVA 2XLAA 5I8TA 2GU9A 1UTXA 2Q30A 3H7YA 2PE5A 4XFHA 2JCGA 2XKPA 2H8RA 2IU7A 3FYAA 1TQ5A 4PIYA 4XF1A 4IEYA 2IUOA 4I02A 4XFAA 5JSOA 1I5ZA 2OFYA 2KEJA 2CV6A 2GZWA 3OF1A 3BS3A 1EPZA 2ATFA 4YG4A 2H6BA 4IEUA 4LLOA 4QGNA 2K9ZA 2OYZA 3EUSA 2B9UA 2OZJA 1O7FA 4XFIA 5FPZA 4A2UA 5FLJA 2IVBA 2AWIA 1RPEL 4Q0QA 5FLHA 4F8AA 3MLFA 1SQ8A 4YARA 2FMYA 2OA2A 4EV0A 3KZ3A 2QCSB 1ZRRA 3GN5B 3E97A 1X2LA 3QF3A 1QP4A 1PRUA 2LYRA 3BD1A 2C0ZA 2HKXA 1NE6A 2IXHA 3JXBC 2MPFA 2XKOA 5LEKA 1G6NA 4Z5DA 3CLPA 4OFGA 5FQ0A 4MCTA 1CAXB 2XJ3A 3E5XA 2HINA 4I8TA 3ST7A 1DWKA 2B5AA 3NJZA 4O9GA 4X4EA 1J3PA 1EY2A 5FPXA 2BNNA 4WVZA 3MDPA 4Q0PA 1XE8A 1XRUA 2BGCA 2Q4SA 1IPJA 5CU1A 5JR7B 2ICPA 5CVRA 2IXJA 2CROA 2KEIA 4WZCA 1PRAA 1IPKA 3H3ZA 3ACLA 4X4CA 2WFPA 1SQ4A 1X8EA 2QJVA 3H9AA 3HT1A 4N9HA 5E1RA 2EF8A 2BEOA 2R63A 5I0UA 3KCCA 2FJRA 3ZKCA 1YHFA 1ZZ6A 1FI2A 2XL7A 2CAVA 1LB2A 5J3UA 2Y0OA 4HMZA 3G5GA 2XSDC 3I59A 5KHIA 2OPKA 3ELNA 1ZVVA 4E2QA 4IVZA 1CAWB 3CO2A 5J7MA 4LA3A 2PHLA 4OLLA 1PERL 4GQMA 2CAUA 2BNOA 1NXMA 1QP0A 1CX4A 4RD7A 1DGWA 2D5HA 1LRHA 4AVBA 3RYPA 1GQGA 1DZRA 4JQDA 3R6SA 1CAWA 4XF3A 1UXCA 4MV2A 1O3TA 1ZRCA 4X6RB 2Z2SB 3EO6A 4LUKA 4IERA 4EROA 1DGRA 1U12A 2KEKA 5C8WA 4JVAA 1VPWA 4TLFA 4PU7A 3L1PA 2GAUA 4PIXA 1OFNA 5KHHA 2LYPA 4LUMA 3CECA 2GRMA 1NZCA 1Q43A 4FBFA 1CAVB 4Y42A 1QXJA 1QWRA 4O8BA 2AXZA 3CEWA 4QX5A 3KXAA 5CADA 1Y7YA 2MHFA 1DW9A 1V70A 4CYDA 5HI0A 3TRBA 3L2HA 3SCHA 1X57A 4I09A 4JCYA 3MZHA 1YSEA 2XHKA 3MPBA 4HBNA 1RIOA 3ES4A 1O5UA 3F51A 4PIZA 2P17A 3OP9A 4KU7A 2PYTA 5KHJA 1IC8A 4I6UA 3RDIA 3TNQA 3JXCL 3LAGA 4I6TA 4QXKA 3LA3A 3SXWA 2Q0AA 3KSCA 1PM7A 4HZFA 4QGLA 2PAKA 3B02A 1ZZ9A 4AQ2A 3OCPA 1PMIA 5JCTA 3QYXA 1OCTC 2Q1ZB 5KBFA 3WW4A 2L8NA 2AXVA 1DZTA 1YWKA 1RUNA 1ZPQA 1Y3TA 1QQAA 3D82A 1SFNA 3LA7A 1WA4A 3EJKA 4EWDA 3SHRA 1UIJA 3CF6E 1O3QA 4MGIE 1J3QA 4XFFA 5FQ0B 2L49A 1RZRA 2UYBA 5F1RA 1BDIA 2O4AA 2GC2A 1UPIA 4PJYA 3ETQA 2H6CA 4X4HA 3C3VA 2WC2A 1UD1A 4X4GA 3RNSA 4FBIA 2PUFA 3DKWA 1RZRD 2BJCA 1GQHA 3RPQA 1ZX5A 1X8MA 3E5UA 2MEZA 2I45A 2K0GA 1ZS4A 1LKNA 4HVRA 1LCCA 3BDNA 4XFBA 1LQCA 3HQXA 4QMAA 4Z5HA 3ES1A 1YLLA 4KWLA 2PUGA 3HT2A 3VHRA 1R69A 3WW1A 4DINB 5BXXA 3H5TA 4L11A 4O9EA 3ROUA 4BH9A 3QACA 1RL3A 3PVBB 2BYVE 4IETA 5KHKA 1UXDA 2XCJA 4YBAA 2PFWA 4Q0VA 1X7NA 5J48A 3H3UA 3I59B 5EZWA 3E6DA 4YG7B 4JTOA 3UKTA 3NSTA 2VECA 2AXUA 5I0SA 3VK0A 3H1MA 3BB6A 1WGPA 2KXLA 1POUA 3H7JA 2AUWA 3WW2A 3RYKA 2PIJA 2GH2A 5LRRA 2O1QA 2PUCA 3NL1A 3I7DA 3CLCA 3UKVA 3OQMA 2V09A 3WW3A 2QNKA 2N7GA 3D0SA 5A7LA 1FT9A 3BPZA 3IDBB 1LR5A 4JTNA 3QOPA 3BALA 4D7SA 2OZ6A 2PHDA 2UY8A 4I01A 5I8YA 1WH8A 5KHGA 3BCWA 3O14A 4MZUA 4Z07A 2E9QA 1S7EA 3OQNA 4MH0E 4IEVA 4X4DA 3FZ3A 3LWCA 4BYYA 2PAEA 2B8MA 4Z5CA 1PRVA 2PPXA 4GHJA 2OR1L 4ONUA 2LYQA 2PA7A 3FYMA 1EP0A 2LCVA 5K98B 2IXLA 4BHPA 3IVPA 1E3OC 3GYDA 1J59A 3B7HA 4X4FA 3E5QA 5LRSA 3S7IA 3ZHIA 4E2SA 4YG1A 3NVCA 4MX3A 4L2NA 2PUAA 1VP6A 3HIFA 3RYRA 4IA8A 3OGJA 4UXAA 3KJXA 4JV4A 3U10A 3UFDA 4HSJA 4XF9A 2KPJA 4HSLA 1LMB3 1R63A 3E6BA 4UBHA 1ZREA 4XFGA 1OD5A
chains in the Genus database with same CATH superfamily
3OYWA 4NAOA 3K4DA 4I30A 3CZJA 3T2PA 2RDSA 2I74A 2JE9A 5LATA 4GB32 2EWTA 3ZN6A 4L9BA 4QDRA 3WUCA 1B35A 1PM4A 3OGRA 4QU2A 4D94A 2JICA 2JD4A 4GWJA 4ER7A 4GWNA 3N36A 3NNLA 4NVPA 3VD7A 1RUOA 2HWE1 1UOJA 2JG8A 4AHZA 1EFAA 2A6CA 4D3WA 1UU6A 1AX2A 2W5FA 4BK5A 5DTQA 2BUKA 2AEZA 2WO3A 3H1WA 1QH7A 1EUTA 1Y4WA 1HDKA 4IESA 4EKGA 3LCPA 1UY0A 5FZOB 4DO0A 4MGYE 1HW5A 3IDCB 1LOFC 2XJQA 2NLRA 5LA0A 1R1A3 3B9IA 5C4WB 1JFTA 1VBA2 4K1ZA 5C3QA 3BU7A 2DUOA 5IHRA 1WCDJ 4QQ2A 4HVOA 3LQCA 3AZVA 5I91A 2XDVA 4LQRA 2JB8A 3WZ1A 2BZDA 2RE9A 5FZOA 1JUHA 1AR71 2GC0A 2WO2A 2XVLA 5G05L 5JZGB 4HVQA 4FOWA 1CR7A 1QJZA 1W9WA 4LOTA 1RITA 4P00B 3VUOA 1NLQA 3ZHMA 2EAKA 4PU3C 3ACGA 3N9MA 2XGXA 4Q0SA 3DNVB 3VKLA 3VL9A 4ZKTB 1QHDA 4AFDA 4B3NA 3WDWA 1YIFA 3VDCA 4F8DA 1LHOA 4YZ1A 3U0ZA 3M3OA 4YM1A 5IK5A 1PNRA 5JPNB 3G7DA 1OLRA 4L92A 5FP7A 2VOXA 3UT0A 1UU5A 1HRI1 1OSLA 3AP6A 4Q29A 2WZPP 4IV3C 4N53B 5JZGA 2LYSA 3J7MA 3OQOA 4I0BA 4ATEA 2MEV2 2W39A 2Q8OA 1YQ5A 1HIXA 3TFLA 3ZOIA 2FDIA 2TUNA 2VCBA 4HN1A 4P9GA 1POV3 3ZVXA 4LKDA 3HQRA 4NOTA 1F5FA 4ZS3A 1R092 4ARYA 1CPMA 3PNAA 4N53A 1LJ7A 1CJGA 5EP9A 1N1SA 1RTVA 1UU4A 3AYEA 4LTAA 2X53S 4GJYA 4TTGA 1GU3A 1UXZA 1D4VB 2P3JA 2VUDA 1AUYA 2VVEA 4R52A 2HEYF 4ZU4A 1XNBA 1U5XA 1L7LA 1XU2A 5I0TA 1RUG3 3CJIC 1E5IA 4Q4V2 3T3YA 4UBGA 3OG2A 2Y6KA 1TNFA 3OBRA 3AL6A 1MS5A 5FY8A 5CEHA 2ZHMA 1STMA 2XL9A 1GQPA 3JQWA 2PHUA 1B09A 1M4WA 2WNEA 1V6MA 4ORFA 1Q8VA 4JDOA 4AEKA 1UYYA 1NCQB 4N9IA 1F2NA 1IKQA 1OF4A 3JD71 5FZ4A 1SDWA 3GN5A 1W9YA 5HPOA 2B9VA 2PXBA 3O9XA 4OMCA 4COYA 1OLME 1JYVA 1TMF2 1JS9A 1POV1 4Y4YA 3VZLA 2VY0A 1CPNA 5IWFA 4P9LA 1O59A 4Y20A 4J1XA 1CAXA 4D7YA 5DT2A 3VZMA 1CJPA 2O38A 2X29A 4Z82A 3N7JA 3VHNA 1FOD3 1CZSA 5JR2A 2Y64A 3JB8A 2WZEA 3WDYA 5DG1A 1QXRA 4CTEA 1PK6B 2JECA 1Q8OA 1YUDA 2VZRA 2AREA 2ZKNA 5L7OB 3DYOA 3ZFGC 4YW7A 4I2OA 3UWPA 1Q8QA 1SLLA 1VBD2 3F2ZA 1RUG1 2DU0A 3LFMA 4KWUA 4FCAA 2D5VA 4R9AA 1WH6A 4YVWC 1UCXA 3QOWA 4S2GA 3W20A 4CE8A 4UFMA 3I2OA 2YROA 4NPMA 1KDMA 1LULA 5BNOB 2Z4FA 5FPLA 2WN2A 4XF0A 3MYXA 4E4DX 4FPOB 4ZY9A 1BLZA 4IEXA 2HWE2 4YM0A 5CNAA 5E89A 2D6KA 5LB6A 4K8FA 5EQUA 3RWKX 3WG2A 4GKYA 5K0UA 5FOJB 5KXEA 3O1UA 3VBOB 3ITQA 2DTWA 2DCJA 4COZA 4HT1T 1LU2A 3FX3A 4AVCA 5IVJA 2IVGA 4XVHA 2NZ9A 1DIWA 5CFDB 1L3JA 1O4TA 2A6VA 2OUHA 4F3JA 4L99A 3AFGA 2ZX2A 4BXFA 2WYFA 4Q2JA 4DE8A 1QJU3 1VMJA 3RS6A 2NM1A 4R9DA 2ZGUA 3THPA 4XJAA 4UWDA 4XC9A 2Q8EA 3RZZA 1RUE3 3VBOA 1YI9A 5JXGA 3AXEA 3MLKA 2GC1A 3NV1A 4ZONA 2VOTA 4G9SB 2OKXA 4MXVA 1PGL1 4GXLA 2EIEA 4IV1B 1AR72 4UFLA 1UZ0A 3VDDB 2GRLA 1JODA 3ACHA 3LEMA 1N3QA 3ZYRA 3GF6A 3MPPG 1K42A 3UETA 2ZGSA 3K4AA 5C33A 5BUVA 1NE4A 1BYHA 3AMNA 1GNYA 1WA6X 2RDNA 3Q8BA 3IBMA 3A22A 4BQ5A 4CCDA 2J22A 2VNVA 2VR4A 2YPDA 5T5JA 4Z92B 1ZNPA 1H8VA 1TG7A 1WETA 1PMJX 2IXKA 4PT6A 2ZGKA 1JU4A 1HRI2 3GHMA 4LBKA 3VDDA 1F31A 1YO8A 2AEYA 1RHI3 4NIDA 5I0RA 2QDRA 3OTFA 4OI4A 5BV6A 3TEWA 2VTFA 2HBTA 2VMDA 1PVC3 2NN8A 1W6OB 3I8TA 2FCTA 4I3PA 3T1LA 2PQSA 5IAXA 1AR81 1YJLA 3OY8A 4K1YA 3O1MA 2FZ2A 5FWEA 1QJU1 2Q8DA 3FFQA 2O14A 3JQXA 3S0MA 4WM7C 1O3RA 3E6CC 1RGSA 5EJ3A 1XYOA 1W04A 1RUE1 2MNGA 4DEVA 4KG8A 1O5LA 3ZDSA 3NAPC 5I8TA 4MUVA 2FDJA 2W92A 5DDJ3 1P8JA 1SCRA 2XXQA 3H7YA 3POWA 1W6OA 2QQPA 2IU7A 5LY1A 4KBBA 4FQ4A 4RHV3 5IVCA 4IEYA 4MGSA 2DCYA 2ZX1A 2KEJA 1JXNA 4HOOA 5F3IA 4YPJA 2CV6A 2VMHA 1PO21 3A7QA 2GZWA 2R16A 2WRAA 2ATFA 3M7AA 4YG4A 2CWSA 2K9ZA 4ER5A 4E4HA 3H0OA 3VZNA 3VD3A 1HV1A 4RSUA 1MS9A 4ZS2A 4IQPA 3VBHB 1YIPA 4WVMB 4YWAA 4A2UA 2XQRA 4HKOA 2JWPA 4CZSA 1A8MA 2IFWA 2VCMA 4JDNA 5FV3A 4Q0QA 4B4PA 4F8AA 4A7ZA 1PNFA 4YARA 1HB4A 2FMYA 2OA2A 2XBO3 3PIJA 3VKNA 5L19A 4DE9A 1X2LA 1KS5A 1PHMA 1NE6A 1ZBE1 2MPFA 2B7YA 2XKOA 5LEKA 3G6JB 1CIYA 3VBHA 3LF7A 3NKGA 3MIDA 4FSJA 2RR13 3UV9A 5T54A 2HINA 1GLHA 1JHNA 4MSVA 1C3HA 3ST7A 4UW3A 1POV0 4GH4A 1SLTA 1ENRA 3IMMA 4CDWC 3BIEA 3MDPA 2D98A 4Q0PA 2D3RA 1XE8A 1XRUA 1Z0HA 2BGCA 4RHV1 5FPAA 5K4LA 4BOWA 3MBWA 1RUG2 3GCXA 5CVRA 3R05A 1GZ9A 2CROA 2GP3A 3IAPA 3Q8FA 2PLV3 4OUMA 2VW0A 1LHNA 4B7EA 3O1TA 4QKNA 3H8XA 2EXIA 4GWMA 2KEIA 1PRAA 5EFUA 3ACLA 2WFPA 4GAZA 4M3CB 4ZXEA 1BQPA 2WUHA 4UT5A 2EF8A 2BEOA 2WJSA 1XE0A 1DGLA 3NDBB 2ERFA 3K3OA 4XE9A 3ZKCA 2Y26A 2ZACA 3AJYA 4GMP1 2FBEA 1FI2A 4RS5C 3P5BA 1YXWA 2D44A 3WG3A 3I59A 2DBIA 2RJKA 1VLNA 3KZ4C 4M3CA 4N43B 5L9RA 3WP4A 2VCCA 3LD8A 4D6QA 2W1SA 5J7MA 2RR11 5FZ8A 2GN7A 1FOD2 1K12A 4OLLA 3HVDA 3GCWA 3VZOA 3HN1A 4CUGA 2XXZA 4QQLA 5C9AC 3BN6A 5F7UA 1T6BX 1U0AA 5IFTA 1CX4A 4AQTA 1G9BA 2ZHLA 2YU2A 1PGL2 4RD7A 2YFUA 4JHTA 1W2UA 1REDA 2RHPA 4WVVA 2XG3A 3NRUA 1LHVA 2PLV1 3H42B 4N43A 4JQDA 1GYKA 4LR4A 5KC6A 2VM9A 2HWC3 1UXCA 1NY71 2D6OX 1VBB1 4AEDB 5HXMA 3ZYBA 5JXIA 5A32B 2K46A 4EROA 1WZXA 3RG0A 1NG0A 3MIFA 3OOXA 3F95A 1QJEA 3ZXDA 4M4RA 5DSXA 1S0EA 3MIGA 3U14A 2UWAA 1Q8PA 2KEKA 3PDQA 4U2AA 5D8AB 3WCSA 4NROA 3WQ1A 2VO5A 3ZDVA 3ZSEA 4LHKA 3NMBA 1CJDA 2XWJB 4PU7A 1W6QA 3ZFEB 1OFNA 4NWVA 5KHHA 1NZCA 1XPWA 3VKMA 3WLUA 4OQ9A 4AEDA 2BOIA 5A80A 1W0OA 3VBRA 5A32A 1LOAA 1QWRA 3GZEA 1QJU2 3KXAA 1E5RA 3LQXA 1ENXA 5HI0A 4CYDA 2X09A 4KGGA 1T2XA 4C0HA 1DQ6A 3CNAA 1RUE2 1D7PM 4JCYA 4Y1VA 4I3GA 1Q8SA 5FO7B 3MPBA 4Y4RA 3VZKA 1ULGA 1UZZA 1FPN1 3RRDA 4CPBA 2A70A 2FDHA 5J96B 5APAA 4QPYA 5AFBA 4I6UA 1LODA 1GWMA 2VMIA 3K51A 3RDIA 3TNQA 3JXCL 1CZVA 2VZOA 3LAGA 4I6TA 2HWC1 4QPIB 2R073 4QXKA 4YG6A 5ANNA 2Q0AA 3B9CA 1PM7A 5A33A 1BVVA 1RUH3 2W9XA 3K75B 3LPFA 4HZFA 4F83A 5ERLA 4Q4X1 2W1UA 3AL5A 4QQHA 1UY3A 4AQ2A 4DNYA 1W6MA 1PMIA 5KBFA 4N8MA 1QF3A 2BRTA 4P9IA 1GP6A 2AXVA 1RHI2 1YWKA 4AI9A 1RUNA 1GZWB 2GSYA 2RG4A 3VBFA 3PTRB 1MQTB 3SH4A 5GZFA 1BEV3 1R64A 2LUWA 3VBUC 5FR3A 3TEZA 1X36A 3HNYM 2BTVC 1ZBE2 4L97A 3EJKA 2W91A 3K2OA 3TRSB 4ASLA 4BQXA 3POIA 3CF6E 2PXLA 5JXJA 1FMD1 4MGIE 1W8TA 2DYCA 2GP5A 1Z7S1 2ZGRA 4QPGC 5DDJ2 1NA1B 3ILNA 1W8UA 5FQ0B 5CG8A 2QQWA 5FIXA 3FLTA 4Z1VA 4HANA 5F1RA 2O4AA 1GKBA 1TVGA 2JDNA 1UPIA 1UWWA 4PJYA 4ER3A 5DAVA 3WP3A 4FXGB 4RHV2 4BB3A 2WC2A 1JZ2A 4OZOA 4CEYC 4FBIA 2R071 4IXLA 5FYZA 3U1XA 1RZRD 1E5SA 1GQHA 1RVF3 2P3YA 4M3CF 1RUH1 4XJ9A 3RPQA 4EN0A 4HK8A 4XURA 2DVDA 3RWNA 1W6PB 1U5IA 2NP0A 5FZMA 2XPJA 4Y5TA 3V0BA 1QH6A 4KWLA 3A4UA 1K5JA 3VHRA 5CAZA 2WLPA 3WW1A 4DINB 5BXXA 5LA1A 2X5IB 2WNVC 1BEV1 2WNUB 2XBO2 1GZCA 4V2WA 4BH9A 3PVBB 1CZTA 1YNAA 4H2AA 5JUVA 2W68A 4Q0VA 1XSQA 3OUIA 1SACA 3ZFFC 1ASJ1 3KQRA 3E6DA 1K5MC 5F3EA 4BLJA 1IQDC 2HWB3 2RR12 3HBZA 2WLQA 1VRBA 2B39A 2HLEA 4YVSB 5C3PA 5CZKA 1XU1A 1ZM1A 3BB6A 5FZLA 2VZVA 3PJYA 1K3IA 2WNUA 3MEPA 1FNZA 1H2LA 1RUI3 4URTA 4XAAA 5IVYA 4EJRA 3W58A 2VBBA 3ETPA 2PLV2 2PMWB 1JZ7A 5DTMA 1SZBA 4YW3A 4QX3A 5FJHA 1NY72 1VBB2 4RR3B 4WM8B 5EYYA 4UF0B 1BCXA 1O6UA 1OQ1A 1LR5A 4YVSA 4YZ2A 3KCYA 3ZN4A 3WF1A 1VMFA 4XQ4A 2WDBA 2Y33A 2P1BA 2WQ8A 1G9DA 2ZZQA 5KHGA 3P6BA 1G7YA 4Z07A 3A0NA 4AHXA 4XXPA 2FDKA 4IEVA 4X4DA 1MS4A 2XONA 4JC1A 4N7IA 5BNNA 3O1OA 3AP7A 2PAEA 4NIGA 3CQOA 4PF5A 4RR3A 3ALQA 5CKMA 4LBOA 2PA7A 4RFRB 4GJZA 5G04L 5K98B 2V4AA 3LEGA 4G3YC 2WT2A 3GYDA 4XZPA 3B7HA 3HD8B 4QX0A 1J84A 5F39A 4EWDA 4YSFA 4YG1A 3ZXKA 1SFPA 3RYRA 2VZUA 3HIFA 4OUEA 2OXBA 4IA8A 4AGGA 5IAVA 4JV4A 4AGRA 1YRZA 1RUI1 2KPJA 4A41A 5HV0A 1R63A 4CCLA 5LCWL 2ZTNA 3SEEA 1OD5A 4HXCA 1RUF3 4YLZA 1AVBA 1JN2P 1CN1A 1SLIA 2DCZA 2HWC2 1LNSA 4GA9A 4PU4C 4MGZE 3O1VA 3S57A 2O8OA 1UW8A 4PQ9A 1YEWA 4JGZC 1OURA 3J8F3 1EUUA 3D0JA 4Q2FA 2JE7A 2RS51 3IN9A 5E8AA 1B0NA 3KMHA 4NMIA 2DWRA 3EMRA 3T08A 4A6SA 3N9LA 4JRLA 4YW4A 4ISQA 2D7FA 3OD0A 1W9SA 1XXNA 4QGMA 3PXPA 1QOOA 3A0KA 2KM2A 1LOFA 3ZPYA 4CP9A 2XUMA 1ZRFA 4H55A 4CDUB 1U5YA 3SCGA 2PXDA 5F5AA 4KH9A 3DXUA 2DURA 2TNFA 3R0RA 4I0WB 4XETA 4FAGA 2AACA 4FI9A 5DQ0A 3KV9A 4Y5Z0 5JI7A 1SG3A 1ZZ7A 4H3WA 3U3WA 2ODRD 5B2GB 2Q8CA 1PO13 3HEIA 3BIWE 2VCAA 5BNPB 3TELA 2J1UA 4HL0A 3POFA 4BISA 3AYAA 4CU8A 2R072 4MYEA 3HZIB 1RUH2 1ULCA 3GZUC 2O8QA 2WUSR 3N7LA 3J8F1 5ABJC 1WMEA 2F4LA 3POGA 2PXEA 2PUDA 1S2EA 2JKXA 5HCFA 4TN7A 1VBA1 1BK0A 2VQAA 3OBZA 1J1TA 4Q0UA 4X6QB 1QQBA 3MFCA 2EALA 4ER0A 3WD5A 3CJXA 1GR3A 4PBPA 5JSRA 4IV3A 3NNJA 2J1SA 2SLIA 2ZEYA 3APBA 3GM8A 4XQDA 4FPFA 3H1YA 4META 3V0AA 1WUVA 5FZ9A 1BEV2 3TWIA 5A3UA 1WLTA 5CFCC 2D93A 3WEZA 4NO4A 1OUXA 1V6KA 3EYPA 3IIIA 2JD9A 3LIGA 2ZHKA 1S2KA 2VPVA 2R7EB 1N47A 4J25A 1O4XA 3B7MA 4LLFA 5AC91 3BTZA 3QH6A 5BPXA 3AZYA 4EWEA 2Y6JA 2R1JL 1ZUGA 2EVXA 3M3EA 4QM8A 4R8HA 1C8NA 5FZ6A 3MI8A 3MF6A 3DL3A 4EN9B 1WCSA 2DVGA 5FOBB 3M2MA 4Y26A 4A45A 4KGQA 4BQ2A 2WSUA 4RL7A 5A1AA 3GDBA 5FZEA 2IV1A 4W6WA 3JXDL 3H50A 1D4M3 5GLWA 3MLLA 3PLQA 4FOYA 3CJIA 4OB4A 4JGYC 3RGBA 5AVPA 1RVF2 1HXS3 3QFIA 3HQUA 3AJZA 3SKVA 3BI3A 3KVAA 2XLGA 3L9JT 1QZXA 1QB2A 1QPZA 3N9OA 4DUXA 5DMYA 2VOWA 2I07B 4UW5A 1FXZA 2VG9A 1W6NB 3FFZA 4QHZA 5SV5A 1NCRC 2C9KA 2KZ8A 3RJRA 4QKFA 1HJGA 1R083 4KG0A 1EAH3 1DHKB 1R091 4XIKA 4QDQA 3C7HA 3FUOA 1EYBA 1LEMA 3F6WA 1TME3 5FY4A 4S2HA 5F5CA 4AVAA 1D0GA 3ZFGB 1LTEA 2VQTA 2YBSA 4D7TA 4QQPA 4LHSA 4TXWA 5F3GA 3I3EA 4CUBA 2PUBA 3VB9A 3C7OA 5GZDA 2HWB2 2DTYA 3LGRA 4QB6A 4E4ZA 2A6ZA 3KT4A 4UFHA 5K8SA 5FP9A 2VAUA 2ZGPA 3NKTA 1XOYA 2LS6A 4RA0A 1BZWA 2UY9A 3URFA 4CDXB 3I2KA 3O5SA 1RUI2 5FZCA 3S6PA 1UKGA 3ZFGA 1D4M1 1CX1A 3KQ4B 3U37A 1BDHA 3BYWA 4YVWA 5FREA 5FZKA 3KHCA 1QQP1 2YFZA 2A3XA 4LORA 4P14A 3RSJA 2PUEA 1LOEA 2ZABA 2PHTA 4KWJA 4QB2A 3WNNA 4ZPIA 4CXXA 5KXBA 2M4HA 4Q8KA 1WIZA 1K45A 1AL23 4QKBA 3R4SA 1R081 2QQMA 2DBNA 4FFFA 1EAH1 1B35B 1UOBA 1A3KA 3EB7A 5DRYA 3K46A 2Y0IA 3QH7A 3N7MA 4QPWA 4WVWA 3U4XA 3T4VA 2RDQA 2VZTA 5FUIA 3FBMA 3ZSMA 3RZLA 3IWZA 2D6PA 1FAYA 4AAPA 1UX6A 1VBD1 1NEQA 4CDQC 1AR93 2E6VA 4P08A 4I6RA 1H8TC 3LOIA 1DBNA 4NHXA 5A3NA 2UWCA 1QGLA 4H7LA 1JMUB 1VBC3 2ZMLA 1HB3A 4FPHA 1OVPA 2YG0A 4LBNA 1C1FA 1HB2A 1V6JA 1VR3A 4YRDA 3B93A 3FMYA 4BM8A 3U78A 1O8PA 3FMGA 2VNOA 4FPEA 4CCCA 1UQXA 1Q3EA 5FXVA 1PZ8A 3N35A 5FBZA 1H6YA 1OSGA 4COWA 3O1PA 4LA2A 4E4SA 4Z8BA 4NHKA 4M00A 3ZR5A 2WA4A 2G9GA 4AXOA 1IGOA 4Q1RA 2HYKA 3J8F2 1W0PA 1Y9QA 1LHUA 3WNMA 3ZKUA 4WM7B 4YZ3A 4PF1A 4IEWA 5KWRA 2Y6LA 3ZM8A 2WINB 3AKPA 4XDPA 1Y7BA 1ZBA3 2ZKLA 3ZMOA 2D97A 3OPTA 4LKEA 4YW6A 1AR63 3ECQA 4OULA 5DUVA 3BVCA 1FATA 1IHMA 1PX3A 1V6NA 5JSPA 4ER6A 4XBQA 4WM7A 2ET7A 3X29B 3PMEA 5AC92 4GULA 3IKWA 4B1MA 4CCJA 5J09A 5FMBA 3UJQA 4AW7A 3NAPA 5CG9A 2YDEA 2D40A 1WD4A 3F52A 1OMIA 1L7QA 5FYUA 1KRIA 1ZZCA 2Z69A 3TB0A 2XLAA 5JOYA 1CD3G 1H0BA 1N3PA 1WW7A 1UTXA 5K9YA 5FKBA 2XMLA 1VIWB 1C1LA 1KGYA 2XKPA 2H8RA 5DN2A 4IE0A 3BOWA 5A3MA 5JWPA 5J37A 1MZFA 1GWLA 1HQWA 3RZHA 3FC0A 3SH3A 2OPWA 4LIUA 5JUWA 1R1A1 2VMEA 4UAPA 1FV2A 3OF1A 2P3KA 3BS3A 1EPZA 1H1AA 4IEUA 2OYZA 1QJX3 3JBG3 4XBLA 2WS93 1QKQA 3EUSA 5AVAA 2B9UA 4IGPA 1WLDA 1ULPA 4PHZA 4QXHA 5L73A 5LK7B 3J7HA 2HCNA 5FPZA 3ZYFA 1X9PA 3SEPA 2E51A 1AR61 1OLQA 4MADA 1H2MA 4KQ7A 4XHXA 4Z2AA 1UOGA 2J7UA 2MXDA 1IOAA 2QBXA 3OBAA 4QX7A 3KZ3A 1NW3A 2PXQA 5JVVA 1QOSA 3GN5B 5LBBA 2P5BA 1PRUA 1UMIA 2C0ZA 2HKXA 4LLOA 4PQQA 3ORJA 5ANQA 2J1EA 4FPJA 4NAMA 4OQ8A 3KS7A 1A34A 4Z5DA 5CIRA 4YZ4A 1HQNA 4DY5A 4Y20B 1CAXB 4CDWA 2XJ3A 3E5XA 1BHGA 4I8TA 4CXWA 4YW2A 5ABJA 4X4EA 1EY2A 1N1VA 1D4M2 1YQ8A 1X9TA 3E1F1 5IVFA 1HN1A 4IE5A 2PXVA 3ZXFA 1QQP2 2IUWA 2Q4SA 3MW3A 5CU1A 4FFHA 4B8EA 1SBEA 1H30A 1XNDA 2G1MA 3KWVA 4FVVA 5L9BA 3ZO0B 1RB8G 3I3QA 4QXCA 1IPKA 1ODNA 1W06A 3H9AA 1R082 1SQ4A 2QJVA 3LOBA 1EAH2 5T5OA 3VDAA 2R63A 2PXUA 1UF2C 5DG2A 2R49A 4RS5A 4ES9A 3POEA 3PUSA 5K0UB 2XL7A 3D6EA 3G5GA 2XSDC 3ZXEA 3ZMNA 1QNWA 3OPWA 3ELNA 1IS3A 3SX0A 2JG9C 2ZX0A 4JHZA 3CO2A 3I2FA 1VE0A 5C9AA 2YU1A 1OPMA 3IPVB 4AGVA 1PERL 4FP2A 3WX5A 4LBLA 2CAUA 3K4ZA 5FP3A 1NXMA 1WW5A 3S5QA 3ZXJA 4URAA 3HBKA 1GQGA 3ZX7A 3DEMA 4YGDA 5FY0A 4XCBA 5J98B 2A7AA 1C5IA 2YXSA 3P1IA 1AL22 3PJQA 4XF3A 4LE4A 2QQUA 1GNHA 2HYXA 2ORZA 5GM0A 3IPVA 1M06G 1AJOA 2Z2SB 3EO6A 1LOGA 1FOD1 3LDRA 1JUIA 4QX8A 3VKOA 1T6GC 1UNBA 2ID4A 2AC1A 4WZFA 3I2HA 3WDXA 5A1FA 5F9TA 3L1PA 2KR2A 3THDA 1NLRA 3C7FA 5EJZB 4LUMA 3CECA 4QWNA 4OZXA 1Q43A 3AVSA 3OUHA 3LKJA 1HKDA 1DDLA 1VBC2 3O0XA 1CVNA 1Y7YA 4O61A 1SMVA 5CADA 4XTPA 3OY8B 2YC0A 4NPRA 3VDBA 4I09A 3ZYHA 3BPSA 3I2IA 4DFSA 4DXSA 3MZHA 1YSEA 5GAHi 4LHLA 4PI0A 3QD6A 5JOZA 1O5UA 2B42B 4PIZA 2P17A 1LGCA 3OP9A 1UY1A 1W2AX 2BERA 2WYSA 4KU7A 4XCAA 5KHJA 3VBUB 5DUUA 3W9AA 2EF6A 5F8PA 3SXWA 3N9NA 4Y33A 3KSCA 1R1A2 1W39A 3B02A 4XOGA 3THCA 5JCTA 3QYXA 1OCTC 2DCKA 2WFF3 1UY4A 4OMDA 1GICA 5D21A 1ZBA2 1DZTA 4IE7A 5DAWA 3WG1A 4FOVA 4A6OA 1AR62 3VBUA 4OHVA 2J1TA 1QQAA 4CEYB 2FHRA 3UNPA 2EXJA 3AX4A 3KV5A 2O0OA 4FPKA 4OYUA 2CU5A 2GALA 4NHLA 5LBCA 4QPGA 1H9PA 3I4IA 1V0AA 1U5ZA 3B01A 1MACA 2F17A 1J3QA 2E7AA 2VOVA 4E27A 5C4WC 4FP3A 5IUQA 4XFFA 2W46A 1RHI1 1HV0A 1RZRA 3BKZA 4CEYA 1BDIA 1JYCA 2LLVA 2ZEZA 2BDRA 1Q56A 5A1LA 4GH4B 1XNCA 2WNVB 3ETQA 1PVC1 4XJUA 3OEBA 3VBSC 3VZJA 4TYSA 4AWDA 1UD1A 4QDSA 3RNSA 4CU6A 3DXTA 1HRV3 2PUFA 5FZGA 2XXAA 4OHWA 1YCIA 1ZX5A 2DUPA 1OF3A 2I45A 3E5UA 4XABA 2AUYA 5GJ6A 5HCAA 3IDAA 1ZS4A 4W50A 1LKNA 4HVRA 4DOUA 2ZGTA 4JZRA 3BDNA 1RINA 1UY2A 1NKGA 2WS92 3WV6A 4UW6A 4HKWA 2GMPA 4Z5HA 2WFF1 5DDJ1 4OI0A 1YLLA 4DRRA 3CHXA 1W3VA 2DVBA 1XC6A 2WNVA 2ORXA 2A6XA 3HT2A 4M0NA 4BZ4A 5IVEA 3AFKA 3AXDA 3H5TA 1DLCA 4MGQA 4O9EA 2BV4A 2X8KA 5FUNA 1Y9MA 2AYHA 4LBQA 5JLVA 5SV8A 2CSGA 4MLOA 3ZFFA 1UXDA 1K5MA 1RMU3 2XJUA 4YBAA 3I59B 1X50A 2YBPA 1BMV1 4RQPC 2VBPA 1W2OA 2ZGOA 1OLMA 3WUDA 4AI0A 3UKTA 2FMDA 4PLNA 3UGHA 4AVVA 2V72A 2AXUA 3DYPA 2DF7A 3Q8EA 3PVOA 1TE1B 3WF2A 4DEQA 2QE3A 2YPJA 4N90A 4AG4A 1S0BA 3ZYPA 2XBO1 3OSDA 4BU2A 3BU0A 3OKZA 2R6QA 1F9KA 2I2SA 1UXXX 1UPSA 1PIV3 3T0DA 4W65A 3AP4A 4MHUA 3M8LA 5FPUA 1OOPC 1D2QA 1FT9A 4HKLA 3BALA 1W2NA 3FLRA 2Y60A 4B4RA 4XZUG 3DPRC 2LRPA 2XR4A 2ENRA 4DZGA 3BCWA 4GQ7A 3LE0A 1S7EA 5FZ7A 3RMXA 3OQNA 5E88A 1RUJ3 1NCQC 4OHXA 1W6QB 1YQ6A 1GBGA 2XWBB 1TZOA 4Z5CA 2OR1L 5FTTC 4BYYA 1RMU1 4AR2A 1VRH3 3VHPA 1JTZX 3VBRB 4JGZB 3WNXA 4K3UA 2IXLA 4BHPA 1E3OC 2CL2A 2FDGA 1E5HA 3CDZB 3J9SA 1WMDA 2WAAA 1OD3A 3S7IA 1C8M3 1SLCA 1S0FA 4E2SA 2PUAA 1VP6A 4YG0A 5FK7A 4LK6A 3UK9A 3ACFA 3OGJA 4CCOA 3PL0A 3KJXA 2JX9A 3U4SA 4D6SA 2R30A 4HSJA 4Q27A 4XF9A 1LMB3 3PUHA 4UBHA 1PVXA 1XQNA 4XFGA 2AZ5A 2BBVA 1PK6C 2V5YA 2WQZC 1NQDA 2ZHNA 3VD5A 1ZA4A 5L7OC 1CAUA 4JGZA 3MGUA 2FFHA 2VXJA 2WA3A 1A6CA 1DYPA 1LLIA 1OFSA 2C1FA 2K2SA 3TOJA 4AFCA 5FWJA 3G0TA 5I93A 1CESA 5F3CA 2CGPA 5A33B 3POJA 3TNPB 1JBCA 2RS33 3WCRA 4L8QA 3QCWA 3ZSKA 5BNOC 1MS1A 4UFIA 3UKNA 5A7OA 3I97A 1DP0A 1W6MB 1W8HA 2E26A 2EA7A 2J1VA 2PTMA 3DUIA 4JQTA 4A42A 3MUY1 5C7GA 2WO7A 4NR1A 3M4FA 3EBRA 4ASKA 2LYJA 1UMHA 1RUJ1 4NDWA 3RZMA 1YYNA 1ND3C 4HK9A 4D0QA 2JXAA 1NZIA 2VTXJ 3VBFB 3SCFA 1PGSA 4FOQA 1VRH1 2PXFA 4BK4A 1S0JA 2YYOA 5CFDC 4TZDA 2XJRA 4BQ1A 1UL9A 5H9QA 4OCTA 5FK8A 3ZYGA 5EHDA 4DIQA 1AXKA 5A3LA 2DCTA 1WWYA 5DZGA 1C8M1 1NYWA 2GZUA 2VL4A 4M0HA 2YBDA 1NX9A 2BVBA 1CQTA 2VOKA 4JCXA 1YJKA 2PAMA 3D3AA 2XLFA 4INDA 2EAAA 5DXDA 4AK3A 2ARCA 4EQVA 4MG2A 1KITA 2R063 2RMU3 3LZZA 1QXPA 2JDYA 1PVC2 4C0BA 4IV1C 2JDMA 4IEQA 3BTYA 1KD7A 2VW2A 3LA2A 4XW3A 1N3OA 4DXZA 3R09A 2BQPA 1SEFA 3DN7A 2RS31 1OH3A 1WCQA 3JZVA 5C5UA 2PHRA 2V73A 3MUZ1 4Q26A 1US3A 1WLWA 5FY1A 3R4UA 2WFF2 3C7GA 4OVEA 2NYYA 5HCHA 3QBQA 3OPZA 2AW6A 2LYLA 3W5NA 5IVBA 4GIQA 5F32A 1JWLA 5CFCA 3V0BB 2RVAA 2BOJA 4QX2A 4Q4Y3 4R9CA 1ADRA 2B5HA 2IFRA 5LBFA 3KGLA 3PURA 1OI6A 2RS13 2IXCA 1BMV2 3AK0A 1RIRA 3S8QA 2QVSB 1NCRB 4FPCA 3MW4A 1UMZA 4QB1A 1JOBA 3INAA 1JYWA 3AP5A 1W05A 4LO8A 3NW4A 3Q9OA 4JGYA 4PI2A 3WR0A 1J3RA 4KNCA 1CGPA 4LEJA 3FJSA 3AVRA 5JXHA 3H8RA 3B94A 2WAOA 3A9XA 3V65A 2BWCA 3AZWA 3Q8CA 1H1MA 4GD4A 4BA6A 2WKKA 1DYOA 1NCRA 3LISA 3NO8A 3KL4A 1U2ZA 1JYXA 3WNPA 3N4MA 4AHWA 4X4IA 4LBQD 4NPLA 3MEJA 1LECA 5FCCA 4FQZA 1KXGA 4IDZA 4XEZA 3OB8A 4LKSA 5FYIA 4K21A 2EIGA 3LFPA 4ZU7A 5FYTA 4Q8LA 2VEOA 3PVEA 1KJRA 4ZU5A 4QU1A 5D2AA 3S7EA 2G4IA 3I2DA 1S0DA 3HWJA 3CBNA 1RVF1 3GJAA 4CRQA 1KDKA 2IVQA 4HLTA 1RMU2 2YUEA 1ULOA 3A23A 5BNNB 4FN3A 1AZDA 1GSLA 2PELA 2ZBJA 2ZMKA 4CP0A 3RI8A 3PU3A 3JU9A 4FFGA 3KHBA 1JYTA 3IAQA 2ZAHA 2Q5TA 1SDDB 1ZRCA 1CIWA 5TSWA 2YC2A 2J7MA 4IE4A 4DPNA 3W59A 3HMYA 4QM9A 5FZAA 1KS4A 5EWSA 4E9KA 1LCDA 3I3BA 4DXTA 2QZ2A 1OBNA 5A3TA 3OEAA 1QJY3 5DPNA 1ENQA 2UU8A 2VD7A 2YGLA 4RGGA 4CDQB 3S5AA 5FYBA 1PIV2 2AGSA 5T3NA 1ZZ8A 2B4KA 2B45X 1G9FA 1H8TB 5KXCA 4EQZA 1SBFA 4WBBA 2WQ4A 1RUD3 2HWB1 1VAMA 5T50A 1IS4A 4F7ZA 4AHYA 5IT6A 4PCRA 5A7QA 2FQPA 3ZR6A 4PLOA 1HF0A 2VVDA 4YW5A 1MZ6A 2EIBA 4MOAA 4QX1A 4CDQA 4YYOA 2ZX3A 4XQWA 1RUJ2 4XYXA 5FY9A 1QMJA 1F35A 3I3DA 2BU9A 1G86A 1GP5A 1H8TA 4XMAA 3WQ7A 1VRH2 3NNFA 1ZAYA 1HN0A 2RDRA 4JCKA 1ZZBA 4X4BA 2VGDA 4WVLA 1MZEA 1REFA 4GKXA 2GNDA 3ON7A 4LULA 4CP9B 4K6BA 4NJ4A 4CU7A 4EWAA 2JVLA 5A6YA 1IZ3A 4GB33 3THTA 4C1WA 2EBYA 1C8M2 5FRAA 3DECA 1ZRDA 4KL1A 1JYIA 1JFSA 2ET1A 1YFWA 1UIKA 3MFAA 2D6MA 5HBAA 4N7UA 1AU7A 2HJIA 2V4VA 1OQEA 3KV6A 4HETA 2WT0A 4IEOA 1RZSA 3WG4A 4KI5M 1QJY1 3DCQA 4X8NA 3PMSA 5F6KA 1DG6A 1J1LA 3UYJA 4AAXA 2MQKA 4H7MA 4JKLA 4A44A 4KWKA 1ZVFA 2CWMA 3GBFA 1RUD1 3EQEA 4SLIA 3WF0A 3ZIWA 4FT8A 1EV13 4MXWB 4LKFA 2RS32 4CUCA 3O1RA 1DCSA 4I0AA 3M70A 2D6NA 3CROL 1WBFA 4P5HA 3ZKYA 3OD4A 4TWTA 3AM2A 1QY4A 2WWUA 4V1PA 5D8AC 1W8OA 5DUXA 2D5FA 4IV3B 4NUBA 1Y43B 5A70A 1RUF1 3H8UA 4G4FA 1O3SA 2LW8A 3ZFEC 1CAVA 3V0AB 3AKTA 5FO9B 3A9YA 4AEJA 5C3OA 4MCXA 1JH5A 2XH6A 3B5LB 1QIQA 4MXWA 1CQ9A 3WNLA 4E8DA 1KEXA 3ILRA 2W0XA 4AI8A 3M3IA 4EYUA 3OMTA 2HEWF 4W6XA 5JPMB 2E7QA 1UYZA 2BGPA 2G9ZA 4LBMA 4XXAA 2R062 5HXVA 1DQ4A 1J58A 1SLBA 4RFT0 4FPLA 1JZ4A 2YGMA 2Q30A 2PE5A 4XFHA 4BPZA 2JCGA 1H6XA 4D69A 5L36A 3FYAA 3GZDC 1TQ5A 3I2GA 4XF1A 2P6CA 1SPPA 3CJIB 4I02A 1HQ1A 2MEV3 5T55A 1EV11 2W2IA 4QPIC 1AYM3 5LBEA 3NROA 3TN93 5LY2A 4YGCA 4HRAA 2H6BA 2WNOA 4FTBA 3VLBB 2PN5A 4GWIA 2R1DA 1VPHA 3LEKA 1ND2C 3V56A 1PO11 1MR5A 3CZUA 4XFIA 4O7XA 3ME5A 1W8WA 2NMNA 4Q4Y2 1W28A 5GZEA 1AJKA 1NUKA 3W5MA 4AOCA 4AFBA 2G9FA 2VZ3A 2ZA9A 3MLFA 3K48A 1SQ8A 1MQTC 4Y1YA 2VZQA 5CYYA 4EV0A 4C91A 2RS12 5E6HA 2QCSB 1OPOA 1ZRRA 1JU3A 3E97A 3QF3A 5C6CA 4OHYA 2A75A 2VZPA 5C8CC 3ZN5A 4M4PA 1BXHA 2E32A 3MHZA 3CLPA 5FZ1A 5IVVA 2D6LX 4OFGA 1OHFA 4XIOA 1DGRN 2B5AA 4GZ9A 1NA1C 5DZFA 1XNKA 3NJZA 4AI1A 5LZ6A 1J3PA 2BNNA 4WVZA 4EZHA 5C5TA 1DYKA 2C6SA 1I9RA 5DAPA 1IPJA 3GHNA 4YVWB 3RVHA 2IXJA 1JOJA 2XUEA 3ZXLA 5AFEA 4LO7A 3AMHA 3OGVA 3TN91 4WZCA 5KC5A 2JG9B 3H3ZA 4N9HA 4X4CA 1OKOA 5CKQA 3WINE 5LW9A 3GNEA 5E1RA 4YW1A 3WXPA 1C5HA 3SITA 5I0UA 3WDUA 1WKYA 1S2BA 4QXBA 2ZX4A 2VMGA 4C90A 1RUC3 4Q5OA 4A7YA 2FJRA 1YHFA 2OUJA 4NHYA 5FJKA 5FY7A 1ZZ6A 1HXS1 4ES8A 4EKIA 2CAVA 2X5IC 3T2QA 1PX4A 1MEC3 4P02B 2JG9A 3FHAA 4P9YA 3N9QA 3GXUA 1W2TA 5KHIA 2RJLA 2VUCA 2ARAA 5JMCA 2OPKA 5H9PA 1ZVVA 1VBE3 4IVZA 1PGW1 4LPLA 3D5OA 2PHLA 4BQ4A 1APNA 3AZXA 1OVSA 1TME1 2OW4A 3VL8A 2W08A 2XJSA 2BNOA 3PHMA 1QJY2 1AYN3 1DGWA 1UYPA 3W21A 3JUUA 5FZIA 4AVBA 3DKQA 2DVAA 5FMCA 3BTAA 2QQJA 3R6SA 4AE2A 1RJ8A 1OQDA 3AKSA 3AZZA 3KT1A 1D2SA 1RUD2 2BFUS 2DFBA 1S0IA 1W8NA 1POQA 3MIHA 4WM8C 4X6RB 2GMEA 1UOFA 4LUKA 1LHWA 4IERA 1DGRA 2DFCA 2VBDA 3PUQA 1U12A 4PDWC 4W4ZA 3T1MA 3Q8AA 4YFZA 3WOGA 3FUQA 2GNMA 1LCLA 5C8WA 3M9LA 1LOBA 3IDEA 1VPWA 3ENRA 3RMYA 4PIXA 1RUF2 1GZTA 2LYPA 1XB9A 1MEC1 2GRMA 1DULA 4XPVA 1MVQA 4MHRA 5FZ0A 1AR73 4Y42A 1TEIA 2J42A 2HBUA 1F15A 1AL21 1COV3 1QXJA 3AB0A 2VW1A 4O8BA 2CNAA 1OC1A 5IW0A 4AVSA 1VBE1 3RZJA 4JRAA 3GBWA 3TRBA 1ONAA 5JOXA 3SCHA 3O0VA 1E57A 3NAPB 5CB7A 2Y34A 2YHJA 2A73B 2YB7A 2KA3A 3IT8A 2Y6HA 1RIOA 3ES4A 1AYN1 3F51A 2YV8A 3UESA 1HRI3 1AR91 4ITCA 1IC8A 1CWPA 3RQ0A 1ZYBA 1IG0A 1W9FA 3LIHA 4NRPA 2XJTA 3LA3A 1EV12 2D43A 2VXRA 3D4KA 1VBC1 3ATGA 5FFOC 4S2FA 2UURA 5HV4A 2ZAAA 5BNQA 1UX7A 3LFIA 4HG6B 1PO12 3WW4A 2L8NA 1A8DA 2XHNA 4K40A 3VD9A 3O0WA 3GUUA 2WR9A 3VBSB 2Z79A 2RJ2A 5IYYA 3ZPXA 3ABZA 1SFNA 4LBJA 2PHWA 1N1YA 1GOFA 1COV1 4UOJA 2BJSA 3J7LA 4FFIA 4NWWA 3T0AA 4CDUC 5FYYA 3LA7A 1WA4A 3J7NA 5C4WA 1ST8A 4WV8A 1UIJA 2JDKA 1QJFA 2VQUA 1OXCA 2J7WA 2JQEA 2CGNA 3ACIA 3CIHA 5FBJA 4M01A 1O4YA 2XB6C 1UAIA 3RI9A 2QKDA 3SLIA 1ZBA1 4XUQA 4CDWB 3VBSA 3SISA 2B46X 1HB1A 2GC2A 2QUOA 4CEWC 2E33A 5ABJB 4IGOA 1S0CA 5A7NA 3U75A 4X4HA 1GANA 4X4GA 5BNPC 3POYA 5FPBA 2AH2A 3DKWA 3JD73 1AYM2 1NT0A 3K77A 1UZYA 1X8MA 4EE2A 2MEZA 3TN92 3LB9A 2K0GA 5GALA 2R043 2W1WA 4DXRA 2E31A 1RXFA 4RQPB 1W8FA 2ADEA 3CMGA 1V6IA 4KBZA 1MFQC 2WWSA 4RGKA 3LSDA 2PUGA 2QTWB 2ZGQA 5GZGA 2VU9A 4UFKA 1VALA 2Y6GA 1HXS2 2BWAA 2LNMA 2JKBA 2VNRA 2OX0A 2DV9A 2WZR3 4L11A 4RS5B 2WT1A 5FUPA 5J1XA 2NMOA 3QACA 5T5PA 2BYVE 3ZXAC 3D8CA 4IETA 4RQPA 2LTNA 2Z42A 2XCJA 1WW4A 2ARXA 4CUAA 1OOPB 1X7NA 3WF3A 2P4EA 1QJX1 3JBG1 1CONA 2WS91 2BP6A 1PGW2 4YG7B 3C7EA 4FXKB 5DZEA 3NSTA 2VECA 3K3NA 2LROA 4JKMA 5FMDA 5C9AB 5I0SA 1TME2 4BQ3A 2PXPA 3OGSA 2HWF3 3DPRB 1W90A 1F5JA 2P6HA 3H7JA 5ISLA 2AUWA 1GNZA 2GMMA 3ZYJB 1D0HA 2GH2A 5LRRA 4EZ4A 2O1QA 3HR9A 4P9XA 1O4ZA 4LITA 1SHWB 1OOPA 1HX6A 3TEPA 2GNTA 2Z5WA 3I3MA 3I7DA 3CLCA 2R041 3OQMA 1SBDA 1QU0A 2V09A 2WN3A 1ZRIA 3AC0A 5EYXA 5A6XA 1F4HA 3OJBA 5ACA3 1W0NA 5A7LA 3D0SA 3BPZA 1LGBA 1NQJA 2JDZA 4P9JA 3DPRA 3QOPA 4IE6A 2BFUL 4D7SA 2CYFA 3VV1A 2OZ6A 3ILFA 1RUC2 3ZYIB 5I8YA 4NIHA 1WH8A 1NCQA 1DQ2A 5FKCA 3FLPA 1YQ2A 4E8CA 2E9QA 2WZR1 3B69A 1MEC2 3O1SA 1V00A 3LWCA 5FYCA 4M3CE 1PRVA 2PPXA 4GHJA 4ONUA 2A1XA 2H0BA 2LYQA 2W47A 2CDOA 4HPKB 3FYMA 1EP0A 2LCVA 1VBE2 1MPXA 3T0BA 3GZCA 3IVPA 4AF9A 4X4FA 5FYMA 4LE3A 3LDKA 3ZHIA 2C9AA 3WP6A 3NVCA 3RJ2X 4L2NA 4XJ8A 2HWF1 4XTMA 5J36A 4LT5A 3SKJE 1PK6A 5EV7A 5FP4A 3UFDA 5L7OA 1AYN2 1LESA 4NN0A 4CDXC 3FHQA 3E6BA 4XJZA 2JENA 1ZREA 2D3PA 1ND3B 1AR92 2ARBA 2CY6A 1AF9A 4HPKA 1VAVA 4L0PA 4QQOA 1LENA 2ETEA 5ACA1 3MV11 3CL1A 5BNOA 4NE9A 4ATFA 2SBAA 1S4CA 4FTSA 1AR83 3D1NI 4HN0A 5GLTA 4RGAA 4E2GA 1LU1A 5FDBA 3KGZA 1V6OA 4A3XA 1B35C 4UFJA 1H4GA 1ODMA 1Q5OA 3OUJA 4FO9A 4LMFA 4NRQA 2W52A 3ZSJA 1ND3A 2JG8C 5CFDA 1DQ0A 2ILMA 2C24A 2R0FA 3ZLIA 1LGNA 2VE1A 5FZHA 2IXIA 2BW8A 4XHBA 1COV2 1NOVA 2R0HA 3BGAA 3LPGA 4ZZ5A 3I54A 1JH9A 1MS3A 5FP8A 4YM3A 4DQAA 2ZCWA 3POBA 4HFSA 2ZS6B 1PO23 4QPGB 2X05A 5A6QA 2NQYA 2XIUA 3HJRA 3N9PA 3WSOA 3ZIXA 5A7WB 5CKNA 5CBLA 5FLIA 1XNTA 5DAQA 1W9TA 2VUAA 3OGGA 4IV1A 4AFMA 3UGGA 1JZ6A 3PVNA 4C8DA 5IK8A 4AZZA 3UGFA 5F37A 2PXTA 2JDAA 4IEZA 4YNIA 2AENA 3DF0A 3VD4A 3AYCA 1WMFA 4XUNA 1URXA 2W3JA 1AL0G 1DFQA 1OT5A 2UYAA 4CP2A 2CGOA 4XJWA 5DAXA 3SC7X 5FZFA 3FHIB 2DDUA 2NPIA 1XWRA 1XE7A 3QLQA 1ZBE3 4XF4A 1US2A 1YI7A 5E16A 2QQIA 5H9RA 5A7WA 4BLIA 1LAJA 2GN3A 4XUOA 1X82A 2E63A 1YFYA 3PIGA 5C70A 3WP5A 1BK1A 2A3YA 2ZPXA 2QFEA 4EZIA 3S30A 5JAXA 1DF0A 4J1WA 3QWGA 3NJXA 2Y6FA 5JZGC 2HSGA 4YG3A 2ZEWA 4LBQB 2GC3A 3ZFFB 1QJX2 3JBG2 1K5MB 2O49A 1BJQA 3NNGA 3B3QE 4FPGA 2A6YA 4NHMA 1ULFA 2EIDA 3J4UH 4X8PA 1NERA 4DUWA 1XSRA 3QQ6A 5GZCA 2ICTA 3WDVA 2XI8A 4FPYA 4LK7A 3NJYA 4N53C 3MF9A 3MLJA 2PHXA 1AX1A 3JD72 3UJOA 4Z59A 4GMP3 5I8SA 3LEIA 1W99A 2OVUA 2R042 2F4PA 2IC1A 4FAHA 4CXYA 1RC6A 3KV4A 2CHHA 4AYUA 1L7RA 3KB5A 4BQYA 1W8ZA 2XVGA 1DLLA 3IM0A 4QD2A 3U11A 4ASMB 5JIUA 3O7OA 4WVMA 1JI6A 3USSA 5LA2A 1L1MA 2LYKA 2GH8A 3IIAA 2AR6A 3WT3A 3DV8A 1H1IA 3T09A 5F2WA 2WZR2 4IUGA 1OA4A 4BE3A 1OA2A 2P37A 1JYNA 3GZTB 1HRV1 1ACCA 2C4XA 3AKQA 3NJVA 2ZMNA 1C4RA 4J6GA 2JDPA 2H0VA 1PZ7A 1YFUA 5BYNA 3PU8A 3WVJA 1AXYA 2A3WA 2VNGA 2BNMA 2WIUB 4ZXKA 4DRVA 3FE5A 1VBB3 1FX5A 1GUIA 5B4NA 2D3SA 2HWF2 2BVVA 5CA6A 1ULDA 1VAKA 1HLCA 1I6XA 1ZA7A 2CSFA 4QHOA 4AVTA 4BDVB 4IWRA 1KQRA 1HQLA 1DGWX 3HN3A 1GT0C 1DQ5A 4DB5A 1W3XA 3KF3A 4PU8A 4R4ZA 4GALA 4YM2A 5FYHA 5GLUA 5K7PA 4XAEA 5ACA2 3HNMA 3O12A 1CAUB 1IS5A 3BUCA 1OKQA 2VTXA 1KFXL 4IEPA 3POSA 1BBT3 4AQ6A 4JDMA 1DU3D 5LEJA 3AMQA 3WQBA 1PMHX 3WDTA 1PZ9A 1FPN3 4XFCA 5EXOA 1JW6A 5K0UC 2GDFA 1OA3A 3FN9A 3NXHA 1PIV1 3CU7A 3N3HA 5F5QA 1G9CA 4AFAA 3FWEA 4SBVA 2A71A 3A9ZA 4FTEA 3EHKA 4Z58A 1QEXA 4P5YA 4QT6A 5A7SA 2EXHA 3DM5A 5I0DA 2A5ZA 1YFXA 4Q4X3 5BY5A 1FV3A 2VJXA 1WMXA 3V64A 2J1RA 4U36A 5FY5A 5IK7A 4BWOA 1O91A 1LOCA 4Y24A 4DY3A 3VBOC 1JHJA 3WNOA 5DTRA 5FPVA 2PQQA 1UYXA 4S2DA 4YZ5A 4TSVA 1VMHA 1JZ8A 4MGKE 2JJ6A 2Y38A 1AR82 1I1EA 1UO9A 4YGBA 4B29A 3ASIA 1NLSA 2C26A 2V5DA 2ADDA 3AMMA 2WWJA 1BBT1 1XYNA 3ME2A 5D8AA 3SMHA 5D1IA 5EJ1B 4CA9A 3GJBA 1FMD3 4BCUA 4LXLA 4BIFA 2W94A 1Z7S3 3KT7A 3ZFEA 5JDBA 1YQCA 5LASA 1S55A 2BGOA 4A7KA 5CFCB 5FXWA 3VDDC 1AX0A 4IL7A 1VJ2A 2YC4A 2TEPA 5FXZA 1OH4A 2E7TA 1O8SA 2PXJA 1IPSA 5C71A 3R1FA 1PO22 1SCSA 1WLCA 1Z78A 4DUVA 3GALA 1ND2B 2DVFA 1LEDA 4KU8A 5JIAA 1QP7A 3NV4A 2XVKA 3GZDA 1MS8A 2GU9A 2P2KA 2JDUA 4JGYB 4DMIA 2Q1MA 3NNMA 1H2NA 4PIYA 4QPIA 2L1PA 4RN5A 2KD7A 2IUOA 4XFAA 5JSOA 3T2TA 2OIIA 4LO5B 1I5ZA 2OFYA 5L9VA 1GV9A 1WCUA 2BBAA 3TEXA 2QQVA 4B4QA 5C8CB 4Y5SA 1ND2A 4QGNA 4XUTA 2ZXQA 4Y22B 5GAGi 1ASJ3 1YC61 2IWGB 2R061 2ZOEB 2QQLA 2OZJA 2RMU1 4LJHA 1GZWA 1O7FA 4XDOA 4JAAA 1NAEA 1MQTA 4MVTA 2ZZJA 2OT7A 5FLJA 2IVBA 2VULA 5KXDA 2AWIA 1HRV2 4AI3A 1RPEL 5FLHA 3N7KA 4EK9A 1EPWA 3PUAA 4P9WA 2JE8A 1WBLA 2W95A 3SR4A 2IZWA 4B7KA 2EXKA 3A21A 5C8CA 4K20A 4CP1A 1QP4A 2LYRA 3BD1A 3USUB 2IXHA 3L2YA 5JI9A 3JXBC 4Y22A 1IKPA 4HONA 3RFRA 1G6NA 5LWBA 2HWD3 2XJVA 2FDFA 2ZGMA 4D8MA 2WSVA 3AP9A 4K8RB 5F5IA 1NA1A 5FQ0A 4MCTA 1UN1A 4K7JA 1W03A 4R4XA 1DWKA 1GP4A 3VBHC 4XMIA 3MIEA 5LA9A 3MW2A 4O9GA 4EN8B 4Q4Y1 5FPXA 1X33A 3IZOA 4QHBA 5HCBA 4Y1UA 3TAYA 4Q4W3 2UWBA 4GH4C 1MVEA 2CTVA 5JR7B 3USUA 2ICPA 2RS11 4BMEA 1N1TA 3OBTA 2R32A 3J26N 4D6RA 3SH5A 4R9BA 5M0TA 1W6PA 2WBKA 4B1LA 4OHZA 5CISA 3HT1A 3NV2A 1X8EA 2ZGNA 2RM23 4GMP0 1JZ5A 4ET7A 3M1HA 1WD3A 4A4AA 3NV3A 2VMFA 3KCCA 1A78A 2X5IA 5FMOS 3M3CA 2QQOA 3VHOA 3NZLA 1ENSA 3LDBA 3JCIA 1LB2A 5J3UA 2ZGLA 2Y0OA 4HMZA 4DS0A 3H3LA 3ZPOA 3I2JA 3TEYA 4UI9L 1V9U3 2PXKA 2HWD1 1H2KA 5DRTA 1IS6A 2EICA 4E2QA 4C1XA 1CAWB 3HPNA 5A6ZA 2YY1A 4LA3A 4PDWB 1MZ5A 1QDCA 2RS53 2VZ1A 2P3IA 4GQMA 3RZGA 4OUSA 2ES3A 4MGTA 3ZXGA 5FZ3A 5GKAC 4JKKA 1QP0A 4Q4W1 3MO4A 4NIIA 5C3SA 2CDPA 1WCKA 2YBKA 2D5HA 1LRHA 4W8JA 1AXZA 4AI2A 2VZSA 3MIBA 3RYPA 1DZRA 2GNBA 4CU9A 4WM8A 1QNYA 4UF0A 4QAWA 1CAWA 5FYVA 3GZAA 3BODA 4MV2A 4UW4A 4NIAA 1O3TA 2VC9A 4N43C 1XBFA 2JEMA 2RM21 2WO1A 3AKRA 3BOPA 4PDWA 1G9AA 1BBT2 2FCVA 3MV01 1KFUL 3HNBM 5EPAA 2LALA 1QOTA 3KD4A 1C28A 5DABA 5DUWA 2OQ6A 2YZ4A 1UZWA 4JVAA 4LIVA 5T5LA 4TLFA 5F2SA 1FPN2 3OWQA 2GAUA 2R1BA 4CCEA 2WIIB 4ZZ8A 4COUA 4CCMA 5C3RA 4KMQA 4BQWA 4XUPA 4EN7B 3WQ0A 2JIJA 4Z2WA 4FBFA 1CAVB 1G8WA 2PHFA 1V9U1 3T4HB 5JOWA 2G19A 3M3QA 2AXZA 3CEWA 4QX5A 4XBNA 4V2VA 4AEDC 4CCKA 4UYBA 3VBRC 2MHFA 1DW9A 1V70A 4Q4X2 2QQNA 3L2HA 1X57A 3PE5A 1VBA3 4PLMA 2XHKA 4HBNA 1DQ1A 3AYDA 5A3PA 3DGTA 2WL1A 3HOBA 3MICA 2PYTA 1ALYA 1I5PA 4LOSA 1RJ7A 1SFYA 3WHUA 4ISRA 5FO8B 5IATA 2VVFA 4CPBD 2F6BA 4GB31 1SPPB 1UKRA 2VMCA 3GGLA 4QGLA 3FL7A 3SNMA 4CSWA 2PAKA 1ZZ9A 2JDHA 4EN6B 5AC93 3I49A 1FMD2 3OCPA 1XNAA 2C5DA 2VQ0A 2A6WA 1Z7S2 1BKZA 2Q1ZB 2RMU2 4H14A 1REEA 4XACA 2XJPA 5FXXA 1Y9GA 3PUIA 2XOMA 3LSEA 2J1AA 4AQSA 4CEWB 1DZQA 4CCNA 1ZPQA 1Y3TA 3D82A 4NRMA 1FNYA 1VB4A 3WF4A 2FCUA 4CDUA 3RZKA 2DU1A 3VBFC 5JMOA 2ZJCA 2HCSA 1BVP1 3SHRA 2HH9A 3T2OA 1O3QA 2HFZA 4BMBA 3UL2A 3ZSLA 2L9LA 1TNRA 4CEWA 2DUQA 4IW3A 2L49A 1I3HA 1R093 4CVUA 2ZEXA 2UYBA 1KJLA 5BNPA 1JZ3A 4AEMA 5FZBA 4LO4B 2H6CA 3JXSA 3P3NA 4MO3M 5B4XA 3C3VA 1F4AA 1RXGA 2LLWA 4Q1PA 4QKDA 2BJCA 2XXPA 4Y3OA 1JOPA 3IB3A 3GBGA 1FYUA 4Q4V3 2W87A 1LCCA 4XFBA 1LQCA 1ASJ2 2QDNA 2FZ1A 3HQXA 1GFF2 4RYDA 3C8XA 4QMAA 3ES1A 3KVBA 5FZDA 1J83A 1R69A 3NQHA 5GLZA 3QOXA 2WZ8A 5IK4A 2RV9A 1PNGA 4IGQA 5A3OA 1V6LA 2XQXA 3ROUA 3PTYA 4PBOA 4XILA 2MEV1 3FBYA 4ZHNA 1RL3A 5FMOL 4COVA 1AYM1 4AL9A 5FYSA 1QQP3 4LHNA 5KHKA 2W1QA 3VWSA 1H9WA 2JIGA 2PFWA 5FAXA 2HWD2 3NWKA 3H3UA 1XJAA 4K9SA 5T52A 5J48A 4JX0A 1TMF3 1GOGA 4LO6B 4Y1ZA 5EZWA 3CKHA 3T30A 2X10A 4JTOA 4BIOA 2VH9A 3VGIA 1NXD1 2IVJA 2VUJA 1VB2A 2OS2A 3VK0A 3H1MA 4YFWA 3VKFC 1GWKA 1OUSA 1POUA 1QDOA 1WGPA 2KXLA 2LM3A 3R4DB 3IMNA 4Q4W2 4XDQA 5IFPA 5EIYB 4Y1XA 3H8OA 1ULEA 2BPA2 3WW2A 1AHSA 1MS0A 2PIJA 4TLGA 3RYKA 1GOHA 2PUCA 1H4HA 2WNUC 3P3PA 1HJFA 3NL1A 1F8VA 4BXSV 5LK5A 2QZ3A 3WNKA 1W6NA 1VBD3 3KM5A 2JB4A 5A7PA 3UKVA 3WW3A 4Q4V1 2QNKA 3EXUA 2N7GA 2Y8KA 4BJ0A 2RM22 5A3WA 3IDBB 3TBDA 5KR7A 1RYYA 4JTNA 4JQRA 4A3ZA 1WW6A 4OBMA 3TYJA 1S0GA 1XYPA 3B00A 2PHDA 2UY8A 2IVIB 4I01A 4YVSC 4OI1A 3WY6A 2HWE3 2FD8A 3O14A 4MZUA 1UZVA 4MH0E 2HEVF 4LNVA 3VN4A 3FZ3A 2V3CC 2B8MA 5H9SA 1V9U2 2YMZA 4YGEA 3BTXA 2WABA 3KCXA 3OYWB 3SQOA 5BNNC 1C57A 1TMF1 4W6YA 5IJRA 4RR3C 1J59A 2OQ7A 2Q1FA 1GMMA 2TBVA 3E5QA 3DYMA 3ZN6B 5LRSA 2RS52 1IG3A 4MX3A 5GLVA 3HAGA 3C2UA 4OI2A 3U07A 2P34A 1R1ZA 1RUC1 3AMPA 4UXAA 4CDXA 2E53A 3KF5A 3JB4C 3U10A 1S1AA 2QQKA 4O65A 4ARXA 1IQAA 4HSLA 2JG8B 1SLAA 5F6LB 3KLSA 3WHTA
chains in the Genus database with same CATH topology
3OYWA 4I30A 2I74A 2JE9A 4GB32 2EWTA 3ZN6A 4L9BA 3WUCA 1B35A 4D94A 4QU2A 2JICA 2JD4A 4GWNA 3N36A 4NVPA 1RUOA 2HWE1 2JG8A 4AHZA 1EFAA 2A6CA 4D3WA 1UU6A 1AX2A 2BUKA 3H1WA 1QH7A 1HDKA 4IESA 3LCPA 4MGYE 1HW5A 3IDCB 1LOFC 2XJQA 2NLRA 1R1A3 3B9IA 5C4WB 1JFTA 1VBA2 4K1ZA 3BU7A 2DUOA 1WCDJ 4QQ2A 4HVOA 5I91A 3AZVA 3WZ1A 2RE9A 1JUHA 1AR71 2GC0A 2XVLA 5JZGB 4HVQA 4FOWA 1CR7A 1QJZA 3VUOA 1RITA 2EAKA 3ZHMA 4PU3C 4Q0SA 3VL9A 2XGXA 3VKLA 3DNVB 4ZKTB 1QHDA 4AFDA 4B3NA 3WDWA 1YIFA 4F8DA 1LHOA 4YZ1A 3U0ZA 3M3OA 4YM1A 1PNRA 5JPNB 3G7DA 1OLRA 4L92A 2VOXA 1UU5A 1HRI1 1OSLA 3AP6A 4Q29A 2WZPP 4IV3C 4N53B 5JZGA 2LYSA 4ATEA 3OQOA 4I0BA 2MEV2 2W39A 2Q8OA 1HIXA 2TUNA 4HN1A 4P9GA 1POV3 3ZVXA 4NOTA 1F5FA 1R092 1CPMA 3PNAA 4N53A 1LJ7A 1CJGA 1N1SA 1RTVA 1UU4A 3AYEA 4LTAA 2X53S 2P3JA 1D4VB 2VVEA 1AUYA 4R52A 4ZU4A 2HEYF 1XNBA 1U5XA 1XU2A 5I0TA 1RUG3 3CJIC 4Q4V2 4UBGA 1TNFA 3OBRA 1MS5A 2ZHMA 2XL9A 3JQWA 2PHUA 1B09A 1M4WA 2WNEA 1V6MA 4ORFA 1Q8VA 4JDOA 4AEKA 1NCQB 4N9IA 1F2NA 1IKQA 3JD71 1SDWA 3GN5A 3O9XA 4COYA 1TMF2 1POV1 4Y4YA 3VZLA 2VY0A 1CPNA 4P9LA 4Y20A 4J1XA 1CAXA 4D7YA 3VZMA 1CJPA 2O38A 2X29A 4Z82A 3N7JA 3VHNA 1FOD3 3JB8A 3WDYA 5DG1A 1QXRA 4CTEA 1PK6B 2JECA 1Q8OA 1YUDA 2ZKNA 2AREA 5L7OB 3ZFGC 4I2OA 1Q8QA 1SLLA 1VBD2 1RUG1 2DU0A 4R9AA 4FCAA 2D5VA 4YVWC 1WH6A 1UCXA 4S2GA 2YROA 1KDMA 1LULA 5BNOB 4XF0A 3MYXA 4E4DX 4FPOB 4IEXA 2HWE2 4YM0A 5CNAA 5E89A 2D6KA 4K8FA 5FOJB 3WG2A 4GKYA 5K0UA 5KXEA 3VBOB 2DTWA 2DCJA 4COZA 4HT1T 1LU2A 3FX3A 4AVCA 2IVGA 2NZ9A 1DIWA 5CFDB 1L3JA 1O4TA 2A6VA 2OUHA 4F3JA 4L99A 3AFGA 2ZX2A 1QJU3 3RS6A 2NM1A 4R9DA 2ZGUA 3THPA 4XJAA 3RZZA 1RUE3 3VBOA 1YI9A 3AXEA 3MLKA 2GC1A 3NV1A 4G9SB 1PGL1 4MXVA 4GXLA 4IV1B 1AR72 3VDDB 2GRLA 1N3QA 3ZYRA 3GF6A 3MPPG 2ZGSA 5C33A 5BUVA 1NE4A 1BYHA 3AMNA 3IBMA 5T5JA 4Z92B 1ZNPA 1H8VA 1WETA 2IXKA 2ZGKA 1HRI2 3GHMA 4LBKA 3VDDA 1F31A 1YO8A 1RHI3 5I0RA 2QDRA 3OTFA 4OI4A 5BV6A 1PVC3 2NN8A 1W6OB 3I8TA 4I3PA 3T1LA 1AR81 1YJLA 3OY8A 4K1YA 2FZ2A 1QJU1 3FFQA 3JQXA 3S0MA 4WM7C 1O3RA 3E6CC 1RGSA 5EJ3A 1XYOA 1RUE1 2MNGA 4KG8A 1O5LA 3ZDSA 3NAPC 5I8TA 4MUVA 5DDJ3 1SCRA 3H7YA 3POWA 1W6OA 2IU7A 4KBBA 4FQ4A 4RHV3 4IEYA 2DCYA 2ZX1A 2KEJA 1JXNA 2CV6A 2VMHA 1PO21 2GZWA 2R16A 3M7AA 2ATFA 4YG4A 2CWSA 2K9ZA 3H0OA 3VZNA 1HV1A 4RSUA 1MS9A 4IQPA 3VBHB 1YIPA 4WVMB 4A2UA 4HKOA 4CZSA 1A8MA 2IFWA 4JDNA 4B4PA 4Q0QA 4F8AA 4A7ZA 1PNFA 4YARA 2FMYA 2OA2A 2XBO3 3VKNA 5L19A 1X2LA 1KS5A 1PHMA 1NE6A 1ZBE1 2MPFA 2B7YA 2XKOA 5LEKA 3G6JB 3VBHA 3NKGA 3MIDA 4FSJA 2RR13 3UV9A 5T54A 2HINA 1GLHA 1JHNA 4MSVA 1C3HA 3ST7A 4UW3A 1POV0 4GH4A 1SLTA 1ENRA 4CDWC 3MDPA 2D98A 4Q0PA 2D3RA 1XE8A 1XRUA 1Z0HA 2BGCA 4RHV1 4BOWA 5ABJC 5CVRA 1RUG2 3R05A 1GZ9A 2CROA 4OUMA 4V1PA 4XDQA 2PLV3 4B7EA 2VW0A 1LHNA 2EXIA 4GWMA 2KEIA 1PRAA 5EFUA 3ACLA 2WFPA 4M3CB 1BQPA 2EF8A 2BEOA 2WJSA 1DGLA 2ERFA 4XE9A 3ZKCA 2Y26A 2ZACA 3AJYA 4GMP1 2FBEA 1FI2A 4RS5C 1YXWA 2D44A 3WG3A 3I59A 2RJKA 1VLNA 3KZ4C 4M3CA 4N43B 3WP4A 5J7MA 2RR11 2GN7A 1FOD2 4OLLA 3VZOA 3HN1A 4QQLA 5C9AC 1U0AA 1CX4A 4AQTA 1G9BA 2ZHLA 1PGL2 4RD7A 1W2UA 1REDA 2RHPA 4WVVA 2XG3A 1LHVA 2PLV1 4N43A 4JQDA 1GYKA 4LR4A 5KC6A 2HWC3 1UXCA 1NY71 2D6OX 1VBB1 4AEDB 5A32B 4EROA 3RG0A 1NG0A 3MIFA 3ZXDA 5B2GB 5JWPA 1S0EA 3MIGA 3WCSA 2UWAA 1Q8PA 2KEKA 4U2AA 5D8AB 3WQ1A 3ZSEA 4LHKA 1CJDA 2XWJB 4PU7A 1W6QA 3ZFEB 1OFNA 4NWVA 5KHHA 1NZCA 3VKMA 3WLUA 4AEDA 1W0OA 3VBRA 5A32A 1LOAA 1QWRA 1QJU2 3KXAA 1ENXA 5HI0A 4CYDA 4C0HA 4KGGA 1DQ6A 3CNAA 1RUE2 4JCYA 4Y1VA 4I3GA 1Q8SA 5FO7B 3MPBA 3VZKA 1ULGA 1UZZA 1FPN1 3RRDA 2A70A 5J96B 4QPYA 5AFBA 4I6UA 1LODA 2VMIA 3K51A 3RDIA 3TNQA 3JXCL 3LAGA 4I6TA 2HWC1 4QPIB 2R073 4QXKA 4YG6A 2Q0AA 3B9CA 1PM7A 5A33A 1BVVA 1RUH3 4HZFA 4F83A 4Q4X1 4AQ2A 4QQHA 4DNYA 1W6MA 1PMIA 5KBFA 1QF3A 4P9IA 2AXVA 1RHI2 1YWKA 1RUNA 1GZWB 2GSYA 3VBFA 1MQTB 3SH4A 5GZFA 1BEV3 2LUWA 3VBUC 1X36A 2BTVC 1ZBE2 4L97A 3EJKA 3TRSB 4ASLA 3CF6E 1FMD1 4MGIE 2DYCA 2ZGRA 1Z7S1 4QPGC 5DDJ2 1NA1B 3ILNA 5FQ0B 5CG8A 3FLTA 4Z1VA 4HANA 5F1RA 2O4AA 1GKBA 1UPIA 4PJYA 3WP3A 4FXGB 4RHV2 2WC2A 4CEYC 4FBIA 2R071 4IXLA 1RZRD 1RVF3 1GQHA 3RPQA 4XJ9A 4M3CF 1RUH1 4EN0A 4HK8A 2DVDA 3RWNA 1W6PB 1U5IA 2NP0A 2XPJA 3V0BA 1QH6A 4KWLA 3A4UA 3VHRA 5CAZA 2WLPA 3WW1A 4DINB 5BXXA 2X5IB 2WNVC 1BEV1 2WNUB 2XBO2 1GZCA 4BH9A 3PVBB 1YNAA 2W68A 4Q0VA 1SACA 3ZFFC 1ASJ1 3KQRA 3E6DA 1K5MC 4BLJA 2HWB3 2RR12 3HBZA 2WLQA 2B39A 4YVSB 1XU1A 1ZM1A 3BB6A 3PJYA 3MEPA 2WNUA 1FNZA 1H2LA 1RUI3 4URTA 4EJRA 3W58A 2PLV2 4YW3A 1NY72 1VBB2 4RR3B 4WM8B 5EYYA 1BCXA 1OQ1A 1LR5A 4YVSA 4YZ2A 3KCYA 3ZN4A 4XQ4A 1G9DA 2ZZQA 5KHGA 1G7YA 4Z07A 3A0NA 4AHXA 4XXPA 4IEVA 4X4DA 1MS4A 4JC1A 4N7IA 5BNNA 3AP7A 2PAEA 4PF5A 4RR3A 3ALQA 4LBOA 2PA7A 5K98B 4G3YC 2WT2A 3GYDA 4XZPA 3B7HA 3HD8B 4EWDA 4YSFA 4YG1A 3ZXKA 3RYRA 3HIFA 4IA8A 4AGGA 4JV4A 4AGRA 1YRZA 1RUI1 2KPJA 1R63A 2ZTNA 1OD5A 1RUF3 4YLZA 1AVBA 1JN2P 1CN1A 1SLIA 2DCZA 2HWC2 4GA9A 4MGZE 4PU4C 2O8OA 1UW8A 4PQ9A 4JGZC 3J8F3 3D0JA 4Q2FA 2JE7A 2RS51 3IN9A 5E8AA 1B0NA 3KMHA 2DWRA 4JRLA 4YW4A 4ISQA 2D7FA 3OD0A 1XXNA 4QGMA 3PXPA 1QOOA 3A0KA 2KM2A 1LOFA 3ZPYA 2XUMA 1ZRFA 4H55A 4CDUB 1U5YA 3SCGA 4KH9A 2DURA 2TNFA 3R0RA 4I0WB 4XETA 4FAGA 4Y5Z0 5JI7A 1ZZ7A 4H3WA 3U3WA 1PO13 3BIWE 5BNPB 4HL0A 3AYAA 2R072 4MYEA 3HZIB 1RUH2 1ULCA 3GZUC 2O8QA 2WUSR 3N7LA 3J8F1 1WMEA 2PUDA 5HCFA 1VBA1 2VQAA 4Q0UA 1J1TA 4X6QB 1QQBA 3MFCA 2EALA 3WD5A 3CJXA 1GR3A 4PBPA 5JSRA 4IV3A 2SLIA 3APBA 4XQDA 4FPFA 3H1YA 4META 3V0AA 1WUVA 1BEV2 3TWIA 1WLTA 5CFCC 2D93A 4NO4A 1V6KA 2ZHKA 1S2KA 2VPVA 1N47A 1O4XA 3B7MA 4LLFA 5AC91 3QH6A 5BPXA 3AZYA 4EWEA 2R1JL 1ZUGA 2EVXA 3M3EA 4QM8A 4R8HA 1C8NA 3MI8A 3MF6A 3DL3A 4EN9B 1WCSA 2DVGA 5FOBB 3M2MA 4Y26A 4KGQA 2WSUA 4RL7A 2IV1A 4W6WA 3JXDL 3H50A 1D4M3 5GLWA 3MLLA 3PLQA 4FOYA 3CJIA 4OB4A 4JGYC 5AVPA 1RVF2 1HXS3 3AJZA 2XLGA 3L9JT 1QPZA 2VOWA 2I07B 4UW5A 1FXZA 2VG9A 1W6NB 3FFZA 5SV5A 1NCRC 2KZ8A 3RJRA 1R083 4KG0A 1EAH3 1DHKB 1R091 4XIKA 3FUOA 1EYBA 1LEMA 3F6WA 1TME3 4S2HA 4AVAA 1D0GA 3ZFGB 1LTEA 4D7TA 4QQPA 2PUBA 5GZDA 2HWB2 2DTYA 3LGRA 4E4ZA 2A6ZA 3KT4A 5K8SA 2ZGPA 3NKTA 4RA0A 1BZWA 2UY9A 3URFA 4CDXB 3O5SA 3S6PA 1RUI2 3ZFGA 1UKGA 1D4M1 1BDHA 4YVWA 5FREA 1QQP1 4P14A 2A3XA 3RSJA 2PUEA 1LOEA 2ZABA 2PHTA 4KWJA 5KXBA 4Q8KA 1WIZA 1AL23 3R4SA 1R081 1EAH1 1B35B 1A3KA 2Y0IA 3QH7A 3N7MA 4WVWA 3U4XA 3FBMA 3ZSMA 3IWZA 2D6PA 1FAYA 1UX6A 1VBD1 1NEQA 4CDQC 1AR93 2E6VA 4I6RA 1H8TC 3LOIA 1DBNA 2UWCA 1QGLA 4H7LA 1VBC3 4FPHA 2ZMLA 4LBNA 1C1FA 1VR3A 1V6JA 4YRDA 3B93A