1QQBA

Purine repressor mutant-hypoxanthine-palindromic operator complex
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
338
structure length
338
Chain Sequence
TIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLAVNHTKSIGLLATSSEAAYFAEIIEAVEKNCFQKGYTLILGNAWNNLEKQRAYLSMMAQKRVDGLLVMCSEYPEPLLAMLEEYRHIPMVVMDWGEAKADFTDAVIDNAFEGGYMAGRYLIERGHREIGVIPGPLERNTGAGRLAGFMKAMEEAMIKVPESWIVQGDFEPESGYRAMQQILSQPHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEVHPRLIERRSVADGPFRDYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The role of lysine 55 in determining the specificity of the purine repressor for its operators through minor groove interactions.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Gene regulation/dna
molecule keywords 5'-D(*TP*AP*CP*GP*CP*AP*AP*TP*CP*GP*AP*TP*TP*GP*CP*GP*T)-3'
total genus 121
structure length 338
sequence length 338
ec nomenclature
pdb deposition date 1999-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00356 LacI Bacterial regulatory proteins, lacI family
A PF13377 Peripla_BP_3 Periplasmic binding protein-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 1qqbA01
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1qqbA03
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1qqbA02
2LYRA 2J48A 2L19A 2R25B 1XWWA 1E6MA 1T34A 1PUXA 2V0NA 9ABPA 2PUDA 1S7EA 1JLKA 1M5TA 5CNMA 3BDNA 1NEQA 1DW9A 4OLAA 3JVIA 2ID9A 3SAJA 3OO1A 4RY0A 3D02A 3I45A 1ZY2A 2RJOA 3H6HA 3LUHA 1Z17A 4JA2A 5HQJA 3TB6A 2HSGA 1LCDA 3KHTA 5DKFA 2O4AA 3H1EA 2GRMA 4MCXA 1D5WA 4YP9A 3HVRA 4EYKA 3KCNA 1K66A 1FFSA 2LP4Y 5EWJB 3RVQA 3TD9A 4ZMSA 5FWYA 3HS3A 5ABPA 2MSWA 4Q7EA 2A9QA 1D4ZA 1RNLA 1Z12A 4TLLB 1LJUA 3LTEA 1QP4A 4ZJPA 2MQKA 2IPNA 2JVIA 3F6PA 5EWLA 3F6CA 4EGSA 5JNRA 3H5TA 6CHYA 4X4DA 3JVDA 2MSLA 3OM1A 4W5TA 3F73A 4MQEB 2GI4A 1RXIA 1ISSA 1QQBA 3IP5A 1ZN2A 4IRXA 2PKXA 3CKMA 3MF4A 3MMNA 1YIOA 3F7NA 2PUCA 3EAFA 4DN6A 1RZSA 4MYRA 3BS3A 3RVSA 1JDPA 4MS4A 4HYEA 1LJLA 2PE5A 1Z2EA 3MLFA 1A04A 5HSGA 2WRZA 4G0QA 5BR1A 3CECA 6ABPA 3IP7A 2OFYA 3HDVA 1QO0D 3Q15C 3EJWA 3LUAA 2BNOA 4YV7A 2GZUA 3U3WA 1VPWA 2E4XA 3OQMA 1VLZA 3LUDA 3MA0A 2IKSA 3HCWA 4F3TA 2GKGA 3O2SB 2N9UA 4KQ9A 2FXIA 2CROA 3UFDA 5K98B 2JB9A 3W9SA 1J56A 3D8UA 1PRVA 4Q6BA 4JCXA 4YBAA 2WB4A 4MLDA 4OBBA 4MR9A 3CU5A 3LOPA 3SCGA 3NBMA 2FMFA 4E7PA 3QLUA 5JNTA 5EWMB 1MAVA 3KLNA 4G0XA 5TPWB 1SRRA 1NXTA 2RDMA 3KJXA 5PNTA 4PEVA 4MR8B 2IPAB 3CFYA 4IMJB 4FE7A 1QKKA 4LDZA 4LZLA 4UHJA 2W42A 3GBFA 2XDYA 4RXUA 1ABFA 2JK1A 2JVJA 2NZUG 3KLOA 1SD5A 3HV2A 2BNMA 2VK2A 4LDAA 1USIA 5TQ2A 4Z4EA 5FBHA 1DG9A 2I6FA 2MYUA 2PUGA 2B4AA 3M9XA 3RVKA 4PU8A 2JBAA 4YCSA 4PU4C 3E61A 1PNTA 3DLHA 4Z9BA 1UXDA 2PUEA 1JF8A 2WJWA 4NQRA 1D1QA 3Q7TA 3VNBA 3CLKA 4QICA 4O1IA 3K4HA 4MS3A 1MB0A 2QSJA 4LE1A 3C97A 3URMA 2AXUA 4S05A 1NXOA 3KKEA 1TJYA 3O2QB 2NUBA 2FVYA 1DCFA 2PUBA 1R63A 4IVZA 3GL9A 1ZGGA 3GV0A 4Z4HA 1AB6A 1NATA 1VKRA 1NXSA 1UDRA 3P9YA 2PPXA 2KZ8A 3FYAA 2PL9A 1XHEA 1ZAYA 3N8IA 4JASB 3CS3A 3LUCA 4JP1A 2FQYA 4YWHA 3HZIB 2H3HA 1ADRA 1RPJA 4Q6WA 4W5NA 2CSFA 4RKRA 1Z16A 1USGA 4EVSA 4ZMRA 1JYEA 4O5AA 4B09A 4G86A 2IV1A 4IF4A 1SQ8A 1YS7A 2LYQA 1M2FA 1U8TA 3RVMA 4MR8A 2NZVG 4YRZA 2H0AA 4KFCA 1KRXA 3CNBA 4W5RA 4MS4B 2CHFA 3CTPA 4XARA 2M1ZA 1Z18A 3MYYA 4ZYLA 2EF8A 4G0PA 1NXXA 1ABEA 4RXMA 1P6UA 2FJRA 3PXPA 1ISRA 3OLVA 1SXGA 4N0PA 1S8NA 3CG4A 4F8JA 2IVBA 4Z4GA 4JB0A 5HM6A 5C5EA 3EQZA 2KPJA 1JYFA 2L8NA 5KQGA 3HJFA 2LYSA 2BJCA 2FMIA 1GUDA 3DGEC 1HEYA 3KTOA 5TPZD 1SXHA 2IYNA 4NCBA 2L2QA 3O75A 1Y9QA 2R4QA 4ETMA 3BRSA 5FWXB 5IULC 1QMPA 3UK0A 4Z58A 1GCAA 2PMCA 5GOTA 2XCJA 1GT0C 3FFXA 1JL3A 3KSMA 3LFTA 4WZZA 4X4IA 1DZ3A 4FBIA 3D1NI 2AUWA 2AXVA 4HNRA 2QV0A 5A7LA 4EYGA 5B3JA 4NDWA 4W5QA 4I6RA 3SNKA 1F4VA 2FEKA 3LUGA 5CNKA 1TLFA 4X4CA 2CWDA 3CLCA 1PRUA 1ZUGA 2L18A 1LQCA 4MCTA 4X4HA 2XJ3A 2MYTA 3L6UA 5CNIA 4MAAA 2MSKA 3SCHA 3F51A 3LISA 2LBPA 4WXEA 3RVJA 3H6GA 4KK3A 2XSDC 3EQ2A 3I42A 2D5VA 3OQNA 4Z59A 4E7OA 1FSPA 1ZPQA 2HQBA 3VK0A 2MYNA 1B0NA 3Q7RA 4KPYA 5BRAA 1ZZBA 2FQWA 4RK1A 1IC8A 2AXZA 2IVGA 3RZZA 4X4BA 2MYPA 3B2NA 3H1GA 3O74A 4RK7A 5FBKA 4ETNA 1LCCA 4JQDA 4MR7A 5TE9A 3IPAA 2B1JA 3QQ6A 2BGGA 5JNWA 1EAYA 3T95A 1EFAA 4FB4A 4WUTA 5DGCA 1U2QA 3HM9A 1E2BA 1GUBA 1UTXA 5EWLB 1ZZ6A 2TMYA 3GBPA 4MQFB 2H8RA 4ZPJA 1U04A 3RVLA 3UUGA 3KZ3A 4LE2A 3CHYA 5JNUA 1RZRA 4IILA 4MS3B 2E4ZA 2QW1A 2FSPA 3K9CA 1NY5A 3O1HB 4MS1A 4NCAA 2IPMA 2VUIB 4RK6A 4IWRA 1DWKA 3QEKA 1KGSA 1CEYA 3GRCA 1O4XA 4D6XA 3C6QA 2LPMA 3LUJA 4QYMA 2YHBA 3BBLA 3GBVA 4MRMA 1YTUA 1JX6A 3EODA 3C3KA 1R8JA 1DBWA 4KVFA 3O1IC 5BRJA 3KS9A 3LUKA 4Z9AA 1L5ZA 1WIZA 3FMYA 4Y42A 4RKQA 2IPLA 1P8AA 3M6MD 2O49A 3G5GA 1ZITA 3G1WA 4RK5A 1BA2A 2AWIA 2PUFA 1YVUA 4YG1A 1ZZ7A 4ML3A 1RXEA 5JS2A 4G0OA 1DRJA 5I4CA 4MRMB 1JFTA 2OQRA 4P1ZA 1URPA 3NNNA 3B7HA 3G85A 3RH0A 1PHRA 3HZHA 1YMVA 2AW6A 2FEPA 3OMTA 1U0SY 3L49A 1ZVVA 1EWVA 3CZCA 1AB5A 4MR9B 3RVNA 3KXAA 3JS5A 1D2AA 2B5AA 2R63A 1EWTA 1L1MA 1Z25A 3KYJB 4TN5A 4RDCA 4XAQA 1ZZ9A 2KEIA 3VNAA 4F06A 4MQEA 5C5CA 1QP7A 2LYPA 4XXHA 1DCKA 3QK7A 3KG2A 3JPWA 1A0OA 2P4UA 1TVMA 3GA5A 3N53A 4MQFA 3H5WA 4RK4A 4EYQA 1PEAA 2EWTA 4RXTA 4EY3A 3S8QA 5TPZA 4X4GA 1XHFA 2M98A 3JXDL 4N0QA 3GN5A 3HDGA 2EBYA 2JVLA 2OR1L 1ZH4A 5EWJA 3TRBA 2FN8A 5FWYB 2ZAYA 3SG0A 4CBVA 3ROTA 3OLZA 4W5OA 4Z4CA 4F12A 3KYIB 2A9PA 4UHKA 3SM9A 1OXBB 4ETIA 4QYWA 3FDFA 1FFWA 1DBQA 4RY8A 1NXPA 1ZESA 4HNSA 2PAFA 4OB4A 4YGXB 4N03A 1ZS4A 1C4WA 1W25A 1Y1LA 3O1JC 4MGEA 4MR7B 5HKOA 3HO1A 2L49A 4PICA 3BD1A 4RWEA 4EVRA 1R69A 2PLNA 2E4VA 5ED4A 1CJGA 1E6KA 1Y7YA 1QNLA 1NTRA 1ZZCA 3DLBA 4X4FA 3A3KA 5TQ2B 3CROL 4DQDA 3QF3A 1C0EA 4RSMA 1EHCA 2IUOA 2O20A 2QR3A 5DCLA 5T7BA 4GNRA 4MS1B 3BREA 4YO7A 3HXMA 4GHJA 5JNVA 2F8TA 3OMWA 4L4UA 2ICPA 2LUOA 1RZRD 3DGFC 1LK0A 1NXVA 3O2JA 1WH6A 4L85A 1TM2A 3HUUA 3FYMA 1LLIA 4H3KB 3ILHA 2LYJA 3LKVA 4O8BA 4H60A 4OTZA 4G97A 4F8DA 1F51E 1PRAA 2LIVA 4KRFA 3CG0A 1NERA 1JWLA 3Q41A 1DJMA 3H5LA 5IUNC 3ILYA 3QELA 1BDJA 4WT7A 5IEBA 1XWRA 1POUA 2ID7A 3F6WA 2PUAA 2LCVA 1Z15A 1ZH2A 3MQ4A 5IC5A 2CD7A 1D1PA 2FLWA 5GQSA 1M2EA 3RVOA 1BDHA 2Q5CA 3G7DA 2X7XA 3TMYA 5KC8A 3N0RA 2NT3A 1RIOA 4LRQA 4PZ0A 4NV3A 3IPCA 2E4UA 3OM0A 3QLTA 8ABPA 4N76A 4YARA 4IA8A 2R48A 3FFTA 1DRKA 4RK0A 1WETA 3FMVA 4MPTA 4EYOA 4RU1A 1JBEA 4OLBA 2WWVD 3RQIA 2IOYA 2P9HA 1P6QA 2FQXA 1NXWA 2GBPA 3SCFA 4XLTA 2VYCA 2XI8A 4I6UA 5DTEA 1U2PA 4J1XA 4IGAA 2QXYA 2KEKA 2ZWMA 3HSYA 2WUSR 3ZHIA 2E4YA 3CRNA 4GPAA 5DLEA 3TX6A 5B3JC 3HEBA 4JAVC 2CHEA 1LBIA 4RY9A 4FE4A 1LBHA 2GWRA 4J1WA 4OG2A 3N75A 4O1HA 4YR7A 5EWMA 5IX8A 3DZDA 1RPEL 2GX6A 3T6KA 5IEJA 4XASA 3A0RB 1GLGA 2FTKE 3DBIA 1ZZ8A 3QWGA 3JXBC 1BAPA 2QVCA 3OO0A 4Z4IA 1JH9A 2FLKA 4NICA 1P2FA 3S99A 3OP9A 4HNQA 4Z5CA 1DP4A 3E3MA 4G0YA 3MIZA 1MIHA 4N47A 1E6LA 5KI6A 1USKA 5T3YA 5KWSA 3QEMB 4S04A 1TMYA 2L17A 2JRLA 4WXMA 4RZSA 4Z99A 2AYXA 5IUKC 1WH8A 2R1JL 3OQOA 3N6VA 5BQ3A 1Z26A 4D6YA 3QX8A 3F52A 2BNNA 1CQTA 3R1FA 4I6TA 1DC7A 2FEWB 3R0JA 1H9CA 2IU7A 1OXKB 2FKAA 3GT7A 2DRIA 1E3OC 3T38A 1APBA 3IVPA 2AYZA 1UXCA 2FN9A 4F11A 3LMKA 5F64A 3L1PA 2MEZA 3QEMA 4PYRA 3H5IA 3Q9SA 4IMIB 2O38A 1YMUA 4KZKA 2PIJA 1L5YA 3FGZA 3O21A 4KV7A 4MLCA 5E3JA 1DC8A 5TQJA 4PU3C 2XIUA 4YG4A 2HJ9A 3HUTA 5CHYA 1JFSA 3RVRA 2A9OA 1YS6A 4G0ZA 1K68A 5D2CA 3H1FA 2A6CA 1PNRA 1SXIA 1Z13A 4H3HB 4JCYA 4OATA 3OMXA 2WMYA 4PE5B 5JNSA 3I5AA 5KC9A 1MB3A 3NNSA 3QLVC 3LFPA 4Z5HA 1DCMA 2JBAB 3H5VA 4YG7B 3H75A 1IIBA 2LYKA 1VRVA 3I09A 3OLYA 3A10A 1CHNA 4YLEA 4EUKA 4Z4FA 2JVKA 3IP9A 2IDMA 2IVQA 4PU7A 2KYRA 1QO0A 3H5OA 3GWGA 1GCGA 3GYBA 1X2LA 3N0XA 2PJUA 2GRLA 3EUSA 2FMHA 3TO5A 1ZDMA 7ABPA 3O9XA 2NT4A 4JOQA 5KQPA 2WY2D 1YK0A 2A9RA 4XFKA 2LYLA 3A0UA 3EDCA 4YS6A 3QYXA 4P98A 1FFGA 3LKBA 3BRQA 5TQ0A 1FQWA 3JPYA 1YK1A 2KEJA 2QU7A 2QZJA 4RS3A 4WWHA 2FW0A 3LUFA 2OENG 1JFVA 2E4WA 1QQAA 4G0MA 3QLUC 5FWXA 4QPJC 1JHZA 4GQMA 3OLXA 5JS1A 1HF0A 2PL1A 5IUJC 2YHAA 4RV5A 3MM4A 2JCGA 1I3CA 3N0WA 4LX8A 1LMB3 1JDNA 3IDOA 3JY6A 3ROFA 3SQNA 3QELB 1CYEA 4KREA 2QVGA 3QX9A 5TQ0B 1QPZA 3JXCL 5KQMA 1KMIY 1OSLA 2VUHB 1W9HA 3ZHMA 3BILA 3JTEA 1BDIA 3FFWA 3C3MA 3M9WA 5CNJA 4M88A 3T8YA 2WIUB 3GN5B 1DBPA 3CZ5A 4KK4A 1ZHHA 1MVOA 3HK2A 2HQOA 1Z2DA 1B00A 4KQCA 3C3WA 2HPHA 2FMKA 2RJNA 3Q7SA 4D74A 5TPWA 4DADA 4KNYA 4X4EA 3NHZA 3UKJA 4I8TA 3SY8A 4LE0A 1AU7A 3EULA 4N41A 1OCTC 2R47A 4Z0NA 4Y9TA 2ICTA 1PERL 4EVQA 1KRWA 1A2OA 2WJAA 4FN3A 1QP0A 3QLVA 3RVPA 3IP6A 5KQLA 1BVHA 3EGCA 4Z5DA 4TMYA 1ZGZA 1M5UA 1YSEA 2RGYA 2F8SA 3DNVB 1X57A 2HQRA 3NNDA 4TLMB 1EWKA 1PEYA 5IBQA 3NHMA 3OLWA 2HINA 3ZKCA 4JB2A 4KMRA
chains in the Genus database with same CATH superfamily
1KKUA 2W00A 4MRPA 3AIIA 1TA9A 1Q1GA 3FGPA 3OU7A 3U61B 1N6RA 3KSAC 1VYTA 1NW4A 4I19A 4CQJA 2XJ9A 4FT2A 3IE1A 1D1TA 3PNQA 1NP7A 2FZWA 4LWQA 3A7DA 4W1RA 2HSGA 2BGJA 2Z3WA 2ZR0A 3LDGA 2WZQA 1H0HA 4QSMA 1EG7A 1WB4A 4R84A 4UAJA 2WYHA 2QT9A 2JFWA 3BUSA 1LTQA 3IAEA 3KCNA 1QX3A 4XVQA 5AXDA 1ZK4A 1IOWA 1E7QA 1VMEA 3DV0A 4N49A 5ABPA 2J09A 4G0UA 3DTYA 1E2PA 2YWGA 4WLVA 3RARA 5K8UA 4E33A 2IYYA 3IAUA 4LJ9A 4IQGA 4NX2A 2VAPA 2GCPA 2IPNA 4WCFB 4E07A 5ITSA 4ZZ0A 4Y6GB 1T25A 3D4IA 1GAXA 3F90A 1I80A 4GPTA 2QRNA 5FOTA 3AV3A 4DLRA 1H4SA 3HB4X 4OQMA 2CXQA 2BLLA 4P58A 4GI3A 1RXSA 5DOZA 5LA6B 3SR0A 4XYGA 3MMNA 1D2MA 4O63O 5KJEA 1DJQA 3ZCRA 5I7OA 3SQWA 1C8LA 2OQVA 3C5HA 3KLBA 4RTJA 4D8TA 2EHJA 4UAGA 1YULA 1CR0A 3FN4A 4Q47A 4PYJA 3SZLA 4AJ1A 1P19A 3BWVA 2V0CA 4M1OA 3EW7A 4JJKA 4XZ3A 3HCDA 5E7MA 3ORFA 2XMCA 5IANA 4ERXA 2BNOA 4C0WA 4MKFA 1QZXA 1I3LA 3OQMA 3BVPA 1TVKA 1MMFB 3OIFA 3P2EA 1M34E 1V5FA 2FSFA 1J5PA 2PGOA 3WL3A 2AX4A 4AKHA 1O0BA 3PNSA 1M0EA 2IBTA 1KEEA 2FXIA 2F8MA 4UHHA 3P9KA 3CLTC 2BFWA 5F73A 4BO6A 1R9NA 2PZGA 3FUTA 4NBVA 4TWJA 3SM3A 1G64A 4AS3A 4HS4A 1JAXA 4IRMA 4X92A 2ARKA 4JBNA 5JJCA 3D0QA 1MU0A 1UJBA 1ID1A 2W11A 3PWSA 4CFZA 3BERA 5IAEA 3DAFA 3JV7A 3KLNA 2RKBA 3P0IA 5IKOA 4GD3Q 4B3CA 1XZHA 5L3RA 1Y5MA 3DULA 4ZCSA 2F62A 1L5LA 1EZ1A 2IPAB 3B3JA 1M75A 4B79A 2V7TA 5CDTA 1Z56C 3PJFA 2FE1A 4JBLA 2JVJA 1YE5A 1U11A 1IPHA 1U1IA 4TL8A 2WTAA 2BNMA 4UD6A 3TIVA 3E3LA 3S5UA 5L3QA 1SUEA 1R7RA 3DP7A 3LSYA 4WACA 5EP2A 3M9XA 3WADA 5A5VA 1RXVA 1RPNA 2ZJAA 2AYYA 3PFIA 1ML4A 3DE6X 3A9CA 4UNRA 1LDGA 4C6RA 3R9XA 3NAZA 3BH0A 4PNPA 4ARBA 4H6WA 4JJ8A 4V02A 4CVNA 4Z9BA 3CC8A 3ZCPA 2QMHA 3PHLA 5JVDB 3ETGA 1GO2A 2OQ2A 1JR3D 2AGVA 1SC3A 2PX3A 5DWQA 1EFVA 1OBCA 1PR2A 5E0OA 3STWA 5DX8A 1OKKA 2IZ5A 2OXFA 3IB6A 4NY1A 4BCDA 4O1IA 2X42A 4XB2A 5LSAA 2FG7C 4NENB 5CP8A 4RDHA 4HN4B 3AM5A 4EABA 5L8VA 1K9VF 4DRZA 5M5BA 4JFAA 1S9DA 4G5FA 1HYQA 1V9SA 1N5DA 3DCNA 3DOHA 3FIUA 1JG3A 1EUCB 3P9SA 2O8EB 1R37A 1SMKA 1WV0A 2E7ZA 1SVMA 1XEFA 2QLNA 3VPFA 3F7TA 1IUNA 3BMNA 4ZHQA 2YINC 3ZZ1A 3L5KA 3ONDA 5FI1B 3GLHE 1ETUA 3U60B 2YV1A 2BGUA 1SQ8A 1UJ5A 3KYBA 3PBKA 3L1UA 3ESDA 4M38A 5JAMA 3WAGA 3V5NA 3UMYA 3CNBA 2HCRA 3H87A 5DW0A 3IJPA 1QONA 4MS4B 4MTLA 3JQGA 1AQLA 3CNNA 3EXG1 4QUJA 1N77A 3R9IA 3UJ8A 3HYCA 2CKDA 2EP8A 3CKLA 1NULA 1WXEA 4JBXA 1B76A 3CUSA 4UD2A 1FS4A 4CCYB 2VTEA 3T12A 2P5YA 2Q1YA 4UCQA 4C4TA 2P1RA 1HDZA 4E4RA 3KJZA 3EBPA 5FQOA 1CJBA 4DUGD 1ILEA 4Q05A 4UARA 2WNSA 2FPGA 3L8EA 4Q34A 2B4RO 3CLUD 3EA4A 3NYQA 1SIOA 1XCMA 1XVAA 4AN1A 1JJVA 3UK0A 2VBGA 4D9MA 1Z8DA 1JAIA 4FDLA 1VJ0A 1PT5A 2XCJA 1GT0C 1RJGA 2PS3A 3MWFA 4DRYA 2AQHA 5THQA 1HNZB 2AUWA 3MC1A 3EGWA 4U2FA 2HTEA 5LQSA 5BQFA 1T13A 5KDDA 1FUUA 1EX7A 1WSWA 3BA6A 2F1IA 3PE3A 3RTGA 3PENA 4GVLA 4F7WA 1X8LA 1AKTA 2PXCA 1GRNA 2C42A 4MV7A 4Y9RA 1LQCA 3FDIA 2HW8A 5HRUA 1EWQA 1SVNA 2JIBA 3DB2A 2LLVA 3DXZA 3PHJA 3VKGA 1G17A 4EZEA 5FHQA 3SBOA 2YV3A 2YUIA 3VK0A 1SBYA 2V5AA 4JHLA 4KIWA 4I7EA 3SC3A 2G9QA 4ENVA 3DEJA 1FVOA 2NZYA 3SR4A 1MPXA 4QD3A 2ZCUA 1BQ4A 2VA8A 3GZNA 5A4IS 1QH0A 1UJMA 4MWOA 5F21A 1KIMA 1X1EA 1RC8A 2VNJA 1NIPA 1PJCA 4L4SA 3KWJA 3RSFA 3HM9A 4BVLA 1QH1A 1T1EA 1YWGO 2I8AA 3DNMA 2BCGY 2TMYA 3E5MA 4H4DA 2M2IA 4MVJI 5D6NA 3DKRA 4NQZA 4JQCA 4A5SA 1IN6A 4EZIA 2P4SA 2ODWA 3PQCA 4PFQA 3V8MA 1HC7A 4Z53A 4RZIA 4MS3B 1J99A 1SC6A 4EHBA 2FSPA 3FWZA 5K09A 3GG2A 1IE3A 1KPHA 4MS1A 3SGLA 1TYEB 1Y9EA 3IPRA 4CM8A 1Y5LA 2Y0EA 4OJTA 1TZKA 4JYCA 1NDQA 1EK5A 5ALHA 3AWDA 1PWYE 1TRHA 1U02A 3C6QA 4UUBA 3MSCA 1AZSC 2QMEA 4KFSA 3SQLA 1FP4A 1IHOA 3A26A 2XCTB 2ZT6A 3C3KA 4ENSA 3MINA 3P7MA 3LX6A 3N0VA 2W8ZA 3O1IC 5F12A 4FXPA 3UMBA 4ENUA 2D5AA 5BRJA 1DS6A 1WIZA 3DCIA 1DX4A 1X1SA 1LW6E 4OXRA 3HZRA 1BX3A 3AR5A 3K9FC 4C0LA 2C61A 1DV2A 1NNI1 2O49A 4KVGA 3A9ZA 4GM4A 4YG1A 1ZZ7A 2JLBA 1E5TA 3MGKA 3R5SA 2HRRA 3U4QA 2FR1A 4MRMB 2OQRA 3H4VA 2Z4RA 3KKNA 3SXUA 3UOWA 2EBFX 4AG3A 1LF0A 4Q4LA 5IAAA 2QG9A 1XZIA 2CLIB 1ZVVA 1IXZA 1NUUA 2Y2UA 3M4JA 1TM5E 2Q0XA 3OURA 2H2GA 1P8JA 1Z25A 2I34A 4GE0A 2R6HA 2HPVA 3DJFA 3E2PA 4NPAA 3VPXA 1QNFA 2EKQA 3ZDYB 1AS2A 4A2PA 1DV1A 1GA6A 1H3NA 2Y2VA 3ZWVA 4UZSA 4QZVA 3U4QB 1DQSA 1DCKA 1YR1A 4OREX 1AD2A 3KG2A 2RAUA 1XCPA 3PUZA 4FU0A 1P1KA 3L1IA 3M5CA 4GLBA 4QUEA 1JBQA 5CPFA 3LI2A 1P45A 4DWJA 3DZJA 1QG2A 4ZVNA 4EJ2A 4K9SA 3ZV3A 5LU8A 2EOAA 4N0QA 2RHWA 2C7VA 4MWCA 1ZUHA 4P2BA 3WRXC 1JB1A 4PYLA 5KIAA 2JGRA 1KMNA 3CX4A 3GDWA 4RENA 4QSHA 1G8GA 1HRDA 1NL3A 2HADA 4US0R 3TGLA 4GX0A 4D46A 4DA6A 2N75A 3GJSA 4HFMA 4DFDA 2WFZA 2CUNA 4LJ4A 4ZQGA 5KWSA 2IZOA 4YAOA 1IG3A 2ICAA 4C04A 4EJ0A 4XSHA 1UBHS 3OZRA 5DGDA 3UHFA 4D43A 2O2CA 1FJ2A 2Y8EA 1LSUA 1L5FA 4F9TA 1E61A 3O9ZA 1NOIA 5JBNA 1PL0A 3S1SA 3USZA 4XGNA 1T1RA 4XGKA 3WBBA 2J3EA 4IOKA 1KZGB 5AXAA 2G5GX 1USUA 4F91B 3R8XA 3B9BA 4L57A 3LF1A 4DLTA 5TQ2B 2JJMA 1Q77A 3VYTB 1C0EA 3VPBA 2HREA 3U3KA 1AKVA 1UAAA 2QRKA 1YZTA 2Y1LA 3PWKA 4DUZB 1ORRA 1UR5A 1YZQA 3ZCSA 5AESA 1CLEA 1T5SA 3DO6A 4U3JA 5H3HA 2B92A 4PCVA 4BRZA 1FTGA 4O2BA 1X1BA 1K8ZB 2P0EA 2X15A 1P9OA 5FA5A 2PJDA 2DTXA 2YASA 3KKKA 3HUUA 1EDBA 2QM7A 1KOJA 2IE0A 2I66A 2XUDA 4G97A 1T6NA 5EPOA 1H69A 4DLPA 4FFNA 2BMFA 1MQSA 4G1VA 5GY7A 1M6HA 2RGXA 3H5LA 3PWTA 1NG9A 3WQQA 5ALNA 3OM9A 3MBIA 4II7A 1T2AA 2ZJ4A 3GI1A 2JI6A 3W3AD 4Y2UA 1LS6A 2Q6KA 2WG0A 3CZQA 4E21A 5J9FA 1NWCA 1EWRA 3ZK8A 5BV1A 3V1UA 2I6UA 2XTJA 3JZDA 4I66A 3WDSA 4DC9A 2Z6QA 2HIHA 5IABA 1QZUA 2VZEA 2OZKA 2P78A 1YDEA 2VSOA 5DPMA 3TQSA 3OX4A 1H2ZA 4A1FA 5ITZA 3NEJA 4EPTA 4NV3A 3QLTA 3RW9A 3ZDDA 1VCMA 4HWRA 1D0IA 4FKZA 1SUWA 4BE9A 1YL6A 1PYDA 4KUGA 4CM1A 3MB8A 1I6KA 1Y3AA 5B2FA 1YB1A 3K4PA 1OPRA 3T52A 2IOYA 2J8ZA 1L5HA 4WW0A 3BQ9A 4EQ6B 3PXUA 2Q4RA 5P8WA 4EMTA 2VPWA 3A9TA 3MFYA 1HE2A 1YNOA 2B20A 5LYJA 3T9DA 4DNOA 5IM4F 1XO1A 3K5PA 4PBTA 1MIOB 1G8MA 4R8LA 3GAFA 1QH8A 1SU6A 3NTUA 3VVCA 2A14A 3GZTB 5IM5A 2EF1A 3H9JA 5BQ5A 3N75A 5KCMA 3Q7IA 2ZIEA 5REQB 1JR6A 2DWCA 4QXOA 3DW3X 2JH8A 1YS4A 1LPBB 2CFCA 3A0RB 1BAPA 1I2AA 3OO0A 4OSPA 1WBDA 5CURA 5FAKA 4YRRA 3RUPA 4LNUB 4G89A 3NU1A 1G21E 2C9CA 3I9MA 1IWPB 2X4IA 4I14A 4YN3A 1A71A 4WOCA 5A6SB 3UWKA 1FW6A 5J5AA 2MINB 1XQ1A 3O8QB 3EXFA 1J4AA 3INGA 4BJ3A 5KTMA 1CUSA 2QD2A 3FUXA 2FZEA 1YOBA 2GBGA 3PNPA 4HEA1 5F52A 5BVGB 4D6YA 2I71A 3MS7A 4D9KA 1AURA 1OBHA 5F9FA 1ZA2A 1WABA 3WL6A 5KYNA 1H9CA 3LVFO 3LCVB 4CW7A 3GT7A 1L8OA 3GU3A 5ENVA 2WUDA 1LWNA 1SXJA 4RD1A 2QA5A 1T4MA 1FFAA 2P6UA 3VTKA 2Z98A 3B3GA 4RL4A 1YMUA 4KZKA 2PIJA 5G0SA 3N5CA 3ZU4A 4AROA 1BXGB 1Z6QA 1O4WA 1JFSA 3JQFA 1SJ9A 2C8LA 3P20A 2PZEA 2QLTA 2ZAIA 3ND5A 1Z13A 5G1OA 3WWZA 1SURA 3SHFA 1HKUA 4HYQA 4M36A 4W9RA 3PJGA 3AFOA 5D51S 4CKEA 1TT5B 2VZ8A 1MB3A 4HZIA 3TE7A 4DT1A 1P2VA 2BKVA 2J9FB 2WFMA 5TT1A 4BGVA 1H94A 3TQRA 1KKLA 1UC9A 1EBFA 2DWPA 4IX1A 5KYTA 1CHNA 4IXWA 2A92A 1JIUA 2JVKA 4WLNA 1GA1A 3AYZB 3HO8A 4I5IA 4FKMA 4L4XA 4NYIQ 2RGWA 1ORIA 2WSLA 5IKMA 1G55A 3DL2A 1NP6A 4YRLA 4UQLA 3GZDA 3ZYZA 2WYWA 1X2LA 3P2OA 5C5IA 3RU9A 5JYCA 1QVAA 1QGDA 4B6PA 2VYVA 5EPEA 4DCVA 3RTEA 3MQFA 1XZCA 2DFTA 2VPYA 2QQEA 4HXFB 2AT1A 4YB8A 4GR9A 4D4LA 3LKBA 3BRQA 4P81A 1ZX1A 1MRNA 2CVOA 4ENTA 1RKBA 2XTZA 3Q3HA 1QQAA 3ZDCA 1ZMBA 2PWPA 5IBPA 4QXAA 3TX2A 2GBIA 1JIKA 4PWZA 1A5AB 1T6YA 2H31A 4R0NA 1NDUA 3F3YA 3S6JA 3VU1A 4E5DA 2JK0A 5L3SA 5ICSA 3A25A 1YMQA 4REMA 2XBLA 2OZLB 4PYOA 2CXSA 3SIWA 1MENA 4QKQA 2MR6A 1HT0A 1J21A 1RXCA 3LT2A 5AK6A 5A05A 4Z7OB 5EJEA 3GLUA 1US8A 1ZHFA 5CLLA 3TBFA 2BJVA 5FPQA 3G82C 1XZLA 2J33A 2O4UX 1TM4E 4WFKA 2PFGA 1OAAA 1PRYA 2QLBA 1B00A 2W6CX 1UMKA 1TEHA 3HH8A 4XQ9A 1AXRA 3IVRA 4EECA 2HD4A 5BW8A 5C31A 4X97A 4B44A 1Q83A 1DAPA 3FHJA 1AU7A 2BGIA 3FMPB 1V3QE 1A50B 2OCKA 2VHZA 2NV6A 4F2PA 3EX7C 4OGKA 1Z7BA 3NHYA 4E51A 4CGZA 1A2OA 2OO5A 2CYCA 2D1RA 1RI3A 3NAGA 2Y0PA 4WMLA 4Q03A 2X4LA 1DOAA 3CUKA 4EJFA 4P8RA 1E18A 3GEHA 1NW8A 1O08A 1YDWA 3CW2A 1VPLA 3K9LA 3N2LA 4HTAA 3RE1A 4ATNA 4DV4B 2I6SA 4GSLA 2XE4A 3VUEA 3UVEA 4R8RA 3A04A 1UQUA 1HSZA 1XWIA 1S9HA 2LTAA 3AUSA 4DMGA 5A2QA 4ZVVA 1WXGA 2FZLA 3OO1A 1ZISA 1XRSB 5J23A 1GQYA 2RJOA 3I64A 4BLVA 4HX5A 3MAGA 4M53A 4EW1A 4D26A 5C51B 2RHCA 2HCSA 3I8XA 3HVRA 2J31A 4RQBA 2QPTA 2V45A 1CBUA 3EQ7A 3KQYA 4DCSA 2BEUB 4GYYA 3HGMA 2J9XB 4HRVA 4P34A 3RVQA 1JLHA 3CEJA 1Z83A 2CLEB 3TMAA 1PSDA 4F4FA 4IWXA 2DULA 5MFPA 1A7JA 1AVTA 1P4GA 1V4NA 1ZRNA 3FUWA 3NC0C 3OCCA 4QOSA 2M6RA 1IN5A 5AM3A 2GWHA 3L6DA 4AU1A 1VE7A 3BK2A 4O2AB 4FDUA 6CHYA 2JATA 4LZPA 3OOHA 4GX1A 2ECFA 4OSOA 4TT8A 5FJJA 1TPZA 5K3DA 1EP3B 1Y3IA 3NO4A 1ISSA 1QQBA 3DOOA 3NKLA 3O92A 3AF6A 5K45A 2D5CA 2ZVQX 4ZQBA 4TSKA 1TW3A 2L82A 5HJEA 4TZ6A 2RGBA 2WD7B 2DCUA 1ZQ1A 1ZAKA 2D8MA 2A4KA 1UMCA 4CETA 1FSZA 3RVSA 4F93B 5JIBA 3IPXA 1XPUA 3FKQA 2HMUA 3ZE7A 3VJMA 4CT0A 1N6LA 1XTKA 5HZMA 5IU6A 1B0PA 2YYZA 4KLCA 3CECA 3NCTA 4DZZA 2OFYA 3HDVA 4LNHA 1HZZA 1N57A 4Y2SA 3H8SA 2PTHA 2E4XA 3QMVA 4OB6A 1BCRA 1RM5A 1W0KD 3BWDD 4ZO4A 5DBOA 2BLNA 2X14A 2C2KA 3ZLVA 2R97A 3MTEA 1PBTA 2JG3A 2GAIA 3O8DA 1CETA 1V4VA 3D8TA 4NBUA 3ZI0A 1QTQA 2VJOA 4Q6BA 3O91A 2CZGA 2Q41A 1L1FA 1LF5A 4X1IA 5G02A 4E7PA 1H2YA 2GS9A 4NNOA 4TMVA 5LP6C 4Q9NA 5FAXA 5TY0A 1DC3A 3ZOZA 1TVKB 1KSJA 3TNDA 3GGSA 1NI3A 4MR8B 4BFSA 2BGWA 3BMOB 4LZLA 4WNIA 1G6HA 1YUNA 1Z6AA 5LMUB 4PX2A 1S96A 2JK1A 2NZUG 5D1HA 4B8WA 3GFBA 2W4MA 2G4LA 4Q3OA 2ZXUA 2APJA 1YIAA 3Q40A 1WDLA 3KFLA 2IDKA 4Q3LA 4RHXA 3U9LA 1MZVA 1P44A 4AY5A 1LY1A 2B4AA 2W2NA 3C74A 2V7QD 5DMHA 1GCUA 5NLLA 4KR6A 4PO8A 2PT7A 4HBZA 4IP0A 3AVWA 2W98A 1XAIA 4CMHA 1VHJA 3LQ2A 3OY2A 4BU0A 1IZ8A 3KV3O 5JEDA 5KNBD 4FMDB 3GPBA 3KEFA 1DQNA 2C5EA 2W6QA 3RGWS 1X9HA 4KQ2A 3RYFB 5AW8A 2I2DA 4RF3A 4ZZ2A 5K0SA 1U98A 1IHXA 1LVGA 4DLKA 2RARA 3S1AA 4QTYA 1F3OA 3LQKA 1TO1E 4GMHA 5JC1A 4QYTA 2OY0A 1LDMA 1MJNA 2G9RA 2NUBA 3JR3A 1SCUA 3X1WA 5A7HA 2LWIA 5AUQA 1FDIA 3FUUA 4G6ZA 2O52A 2R1ZA 1E2IA 1VKRA 2JGFA 3MTJA 4BTEA 5HNKA 4LF8B 4L02A 3UWPA 3VH1A 4IH1A 3RI3A 3S27A 5HZGA 1HH4A 3QEAZ 3PCTA 3URKA 2WYIA 4OQDA 5EIAA 3WV4A 3QKIA 1VI5A 2J3MA 1UZLA 2Q3DA 4QJBA 1QV7A 3OU2A 4O8CA 4EW2A 2WJZB 3FCOA 4Q3CA 3JARB 3RRZA 3GLIB 1UIRA 4KFCA 3ZNQA 2QYTA 4GOJA 1DIAA 5FPYA 3LC2O 4AAYA 5HBGA 3GRKA 4OL0A 5M7EA 1C80A 3GEIA 1D2CA 1ABEA 1MKYA 1IQUA 1OUMA 5A1TA 2FJRA 3EEOA 3ER8A 3UGTA 3BC1A 1UKEA 3GFSA 3MILA 3V8QA 2IYPA 1A8QA 2VNSA 3DBLA 1G5QA 2WAOA 2WT9A 2JLXA 5C5EA 3N3AC 3NC4A 2WB2A 1I7NA 4EB6B 2OGZA 5CRIA 3HMQA 3P9XA 4JH0A 3O75A 2UYGA 1UUFA 1NBMD 2DJ5A 2ODPA 3GUHA 4PGAA 3WXBA 1F8FA 3AUAA 4A1OA 3NOQA 1UQRA 4FYJA 4IGKA 4X65B 2RGGA 4K0KB 1NQWA 3EWNA 4Y6OA 1YHYA 5DM4A 3V1KA 2IS2A 1JL3A 1TA0A 3RG8A 2CBXA 3R3XA 4JIGA 4HNRA 4YC7A 5LP6B 1UWKA 3DH0A 3N7TA 4LZZA 3WL8A 4JUDX 4LJ8A 5H3LA 2P7HA 4WADA 4ZODA 3LQ4A 4PSUA 1OY1A 4HQ6A 4MCTA 1HQYE 1U8FO 2G83A 2MYTA 3OEEA 3EEBA 1J9ZA 4FDVA 3LNTA 1NLYA 1UKAA 1PNOA 2G36A 3GELA 3KQTA 4PGGA 2XSDC 1G63A 1YA4A 2CHVA 2RH4A 3EQ9A 1RFLA 2O8NA 1DBRA 3CEPB 4ZAWA 5DOVA 3FFAA 4RFSB 1JG2A 1BMFD 4XUCA 5BUQA 1X8KA 3RZZA 2PLFA 2ZJOA 2H4YA 2WJHA 3HB7A 4OKNA 2VJYA 4QUBA 5DTIA 2DEUA 4OXXA 4A5OA 4DMMA 2V3CC 2JI9A 3C7KA 3IPAA 4K81B 2E2WA 2XQKA 4HV4A 5CCEA 4BY9E 4FB4A 4Q3EA 1W59A 3G2MA 3O9MA 4CMEC 1R3DA 1JI3A 1NVBA 1Q0HA 2HJGA 2J9ZB 4IDOA 1MH1A 2HM7A 3L1HA 4LBZA 2WQ6A 1C7IA 2TRSB 3ZDQA 4R1MA 4UATA 2OR3A 4W9NC 3RSHA 2HY7A 1XZMA 2QORA 4DA9A 2ZAGA 1H5NA 2H1CA 3NZEA 3Q1LA 4B3SB 4JC8A 1ZVJA 3OCUA 4IWRA 4R16A 1QYWA 1RRMA 3P4YA 4OM7A 3W1WA 1O4XA 1TCUA 1JHXA 1LCIA 3L1KA 4B71A 3QVMA 1ENZA 1GRRA 4BQSA 2ID8A 3MMXA 1BWRA 2AWOA 1GIAA 4EAQA 4W6ZA 3GB9A 4YCJA 1CZKA 3NGMA 3OT1A 1HLDA 3KS9A 5E3IA 7ADHA 5I9NA 1RRCA 5FL7A 3QU5A 3C7AA 4BTVA 3ZJUA 5G41A 3T1YB 4I1IA 1N4DA 3OQVA 1A9RA 1FNMA 1ZITA 3IQEA 1ULHA 4TGLA 2O7NA 3EGXA 4PXAA 3I2YX 2P27A 2AFIE 1SQFA 3VOBA 3ZGLA 1IN8A 4J1QA 1NN0A 1OPXA 4NMXB 4R6WA 1GTRA 3GLQA 4UBOA 1PHRA 5LDGA 3OPQA 2C9ZA 1OZGA 2X76A 3OPNA 4LV6A 2C99A 4NAVA 3BXOA 1VIYA 3S29A 3U0VA 2PA0A 1D2AA 1OE0A 5SY4A 2R8ZA 2YWEA 5KB3A 2BSAA 1ZZ9A 1QR6A 2QUJA 4MKZA 1K88A 5KWVA 2R65A 4GE3A 5ISMA 3RS4A 5CMLA 4RM3A 5FOUA 2GPJA 4LF5B 5CUQA 4BE4A 3CN7A 4DIEA 3FTQA 1KI2A 3OTHA 3QGMA 1CZOA 4PYIA 3PVZA 1CUFA 4NS1A 4WOBA 5JJKA 1YS9A 2EL9A 4C30A 3V6LA 2A9VA 1GNPA 2FOIA 3BJRA 4NFLA 3DBHB 3EPRA 5JXHA 3TRKA 2A9PA 1GN8A 4KMMA 3R3VA 1J39A 3GD7A 4JC4A 1E0DA 5JHGB 2PSHA 1XLUA 4MO9A 4HHEA 3O1LA 1HDOA 3ICPA 3ZHXA 5BV0A 1STOA 1EE1A 2RKOA 2VHEA 4IS3A 5BNWA 3GQBA 3NHAA 4AI6A 4PHGA 1YVPA 4D3FA 4MR7B 2GEFA 2VRCD 3UYKA 2IELA 2PQ0A 1RE1A 2M32A 4U7TB 5JZ9A 1JQKA 4Y2GA 3PC8A 3DZGA 2IIQA 2CLCX 3PDIB 1BEUB 2QLFA 5ETJA 3RHTA 3UOGA 4E5KA 1XMVA 1V71A 2FB9A 3U1BA 5A5EA 1VECA 1VMIA 2IHVA 4O0LA 4RCZA 5KWJA 1N32B 1HFWA 5GZ3A 4Q66C 1ZOOA 1U99A 2JA2A 2ZS7A 3ROZA 3RSCA 2XXAA 1NMXA 4JS0A 1E6UA 4YCNA 5ITVA 4KR2A 2F8TA 1T3SA 4W63A 3E9NA 4TV9A 4ZRDA 1LK0A 1T8YA 1PTKA 4JI7B 1KXJA 2R6CA 1P61B 5AHRA 1LLIA 2JGEA 1W581 2W4QA 4ZI3A 4ZDKA 2RIPA 3PPXA 1J9EA 1CNEA 4GOMD 1Z3IX 2AFHE 4OSEA 4DT1B 1QFJA 4J0KA 5JC8A 2PUHA 2J9RA 4Z8YA 2GBLA 2Q2WA 2PNFA 3QXGA 4BMNA 1IJKA 1TJ5A 2WE7A 2XECA 1D2EA 1GU0A 1PS9A 3FYUC 3I9KA 1XD9A 2VP9A 3N2ZB 4YMVA 721PA 2CJPA 2Q5CA 2ZQYA 1DU4A 1VJCA 2FUCA 3PXBA 1X1QA 3BWXA 5K3BA 4UQOA 3L0DA 2ZWPA 1SCDA 2IU3A 2BKUA 4DDTA 4IA8A 821PA 5DLDA 121PA 2Y4NA 3PZBA 2ZIXB 3I37X 2ZBVA 2QPLA 5AWFC 5LOVB 4AKIA 3MJ4A 4F97A 4XWYA 4YMGA 1ETHA 3RQIA 3UWDA 3HXQA 4UFNA 2C5FA 4BFVA 4A0RA 4WQMA 3PQ2A 4BRWA 4WZBB 2J5BA 2I6GA 1TJ3A 1RYZA 1ELOA 2NZ2A 4BLQA 3RC2A 3TX6A 1SUCA 4DG5A 5CA0F 1E9SA 2P2ZA 4K2HA 4OVKA 1LBIA 4BKMA 3E4CA 3LK7A 1PKEA 3F2IA 4OHRA 3WAJA 3ETCA 4CM4B 3NVMB 2E85A 2ZROA 5LWQA 2EEZA 5DTMA 4MKXA 3EARA 3OE7D 2PS0A 1QFZA 2PFKA 2C3OA 2AEJA 2PX2A 1XTZA 1KJZA 2PXBA 3B1FA 4KHZA 5FUWA 3UCFA 3AETA 2Z43A 3IH5A 2QNRA 3FYTA 4G8CA 1CUUA 2WSYB 4LUCA 3SQOA 1KEPA 3GP3A 4DLXA 3MJTA 2W2LA 4JP8A 1YV9A 2B21A 1JKJA 2FU5C 2G1JA 2G17A 2I2WA 4RAQA 3ONNA 4ARIA 3CRW1 3HXLA 1V1JA 3SN6A 2Q0SA 4EJSB 5JO0A 4D3ZA 1F8UA 5E7IA 3M2TA 3EZ7A 4UNNA 5C1OA 4DWWA 1WH8A 1XU4A 3ODGA 2MOKA 4KW7A 1NYQA 4NE2A 2FEWB 4KE6A 1AZWA 1S1MA 2FETA 3T38A 1XTTA 1J0CA 3BZBA 1YRAA 1NYTA 1VM6A 1LPMA 5IAOA 1JMYA 3LMKA 1KXZA 1T1SA 4TMKA 3BK1A 2DFPA 4U6SA 2QMQA 1K1EA 2XNCA 4YMIA 4YP6A 2Q7DA 3WTCA 2XIUA 4LI3X 3N6RA 2A3NA 1JDSA 4NIMA 1OQAA 2JGIA 1KEVA 1UBTS 4WZBE 3ST7A 8AT1A 1MHPA 4YUYA 1P1JA 2VWHA 4FNOA 4L2IB 1GZSA 3ECSA 3Q0EA 3I5AA 3LLCA 3BXZA 5DHFA 2P2NA 4RQAA 3WNCA 1SZDA 1YR6A 1ST2A 3FM9A 1KYTA 1S8AA 1Y3BE 1XL1A 5HILA 1XT6A 1MC5A 1KIFA 3QUAA 1W85A 2QN2A 4LYGA 4YAIA 3ADDA 5LMZA 1X6VA 2MSDB 3Q10A 4DQUA 1OYYA 3M83A 5DX1A 1LK5A 4MRRA 2R8RA 1G8KA 3CY6A 2CL5A 3LVRE 3UMSA 4Q39A 2Q46A 4NTZA 4M0DA 1K92A 4E4TA 2FPRA 1GT91 2NU9A 4QBGB 3DMYA 3V55A 3GZCA 1V4BA 1P1HA 2BTQA 4M0FA 1XCLA 1X74A 5LBIA 4DJAA 1VE6A 3CONA 4EFLA 1M1YA 3Q3CA 2Z9CA 3NUGA 4OXYA 4UPDA 2NM0A 3DBHA 4J0FA 4Z2YA 3RK1A 2QJFA 5BMVB 1CEEA 2ZK7A 1ND5A 4CM3A 3CX8A 5LIPA 4G23A 5CFPA 4UBJA 3ET5A 3EMKA 2R3SA 1VPDA 4Q15A 4L1KA 4ESHA 4OI4A 4BB5A 4EKYA 3PKZA 2HJRA 2VDUE 4HTFB 4TVOA 1N5IA 3LDAA 1MJGA 1OLSB 4G2NA 2Z08A 1D2HA 4RA9B 5CX4A 3LOQA 1XZQA 3UXEA 4RV5A 5CDUA 1KI6B 3IT3A 3FB4A 4DSUA 3ZXUB 1CYEA 4C3VA 3T7TA 3G0CA 3W5AA 4MHTA 1GTVA 1NF8A 2VHJA 2Q9AA 2VUHB 1W4LA 3ZHMA 4UXJA 1SHLA 3JWGA 4EA7A 5JECA 3K0EA 2XI4A 4EDHA 3NTVA 1TAQA 3PRKE 4HPXB 4QREA 1R0LA 3KEQA 2FX2A 1L6IA 2JCBA 2PKEA 4LRYA 4JI2B 1F9AA 1NR7A 2O0HA 3DL0A 1IBRA 2PXXA 2I7VA 4GFDA 2VJNA 1Z39A 2MJLA 1AGPA 5GV8A 4G5XA 2FMKA 3UGKA 4KO1S 5CGZA 3RB8A 4MYHA 2PFSA 3TUJC 3UXMA 1LX6A 4JT9A 3WRYC 4I8TA 5E2IA 3F74A 3PJRA 2ZZMA 3AF5A 3ZLBA 2POQX 4V0OA 1PERL 2CYAA 2ZYAA 3AEQB 4O33A 3AZPA 2X9VA 2IYSA 1W0JA 4RORA 4YJ2F 3X44A 3IEVA 1HDGO 1K3TA 5G1NA 4UBIA 1ZGZA 2AD5A 4X93A 3RM3A 1DGQA 1EVQA 2IITA 3PL5A 2NU7B 3VSAA 5BT9A 3B1VA 3NM4A 1NMYA 4BO3A 4QYIB 4KMRA 2M9MA 1AKNA 5EJ6A 1OKKD 1P4HA 3GJ8A 3EVEA 4YCLA 1Z8HA 3WRXA 2B8EA 2VA9A 1RYDA 1XQWA 1AG9A 4GGMX 1WP4A 3KZXA 3U44A 3WKAA 4ZTZB 4OLAA 3OFKA 3E7DA 4M1WA 5FPKA 3QM1A 2QK4A 4BFZA 4EEZA 3Q8MA 3HFGA 2ZRMA 3H1EA 3ZWOA 4GR5A 1UL1X 1UBUS 4EYKA 5FOQA 1A8SA 4FPXA 3TD9A 4DLAA 2GILA 1Z0DA 1C3XA 2HH9A 3DLPX 5B37A 4DVGA 1Z36A 2PMFA 3P9RA 1NVFA 1SEVA 4KZPA 4C1NA 5DSZA 2EZUA 2XADA 2A94A 4NECA 5ED0A 1RDFA 2P3QA 2JFHA 4B80A 3OQJA 4P80A 1CDEA 3T4UA 5B36A 1V8DA 3ROXA 1Z5VA 2AXPA 2WUFA 4DHWA 1JLLA 3F6PA 1PW7A 2GVNA 3RHFA 4LRTB 3WRYA 5FUXA 4XD2A 5I7FA 3D8NA 4BUJA 3QKRB 2P6RA 3PHGA 1TFUA 2QGNA 2ROQA 3I5MA 3O3MB 3THOA 3NOXA 1FP7A 4JR2A 1EXDA 1U94A 3I2KA 3AVOA 4MV6A 1RWMA 1XZJA 2D3WA 2ZJ3A 4HDMB 4BZQA 4F56A 1V8BA 1QYDA 1Y81A 2BFOA 4UNIA 1AGYA 1U2GC 1JXOA 2UZ3A 3QHQA 3OT5A 4MS4A 4BB6A 3TRFA 2PV0A 4C4SA 1Y5RA 4JLAA 3MLFA 4M76B 2CV1A 1A9SA 3VPSA 1DX6A 2B9VA 3VMFA 5BR1A 1KFKB 2LR0A 2PBFA 3I1IA 1R4AA 3DJYA 3KL2A 4YUAA 5JCZA 5JOQA 4DV6B 2OCXA 4E5NA 4DMKA 4PO9A 3ILVA 2NXEA 4QLOA 3W6OA 1VPWA 3BH6A 1VA4A 1O57A 1PWHA 1RXUA 3D4NA 1OWOA 3W79A 3PYXA 3DTVA 4IDGA 1WZNA 1RQ7A 1WXXA 2P0YA 4EI8A 1ZL2A 3A6FA 4QFDA 4UTXA 1I7PA 2FFAA 4A9AA 3G8AA 4KFRA 4JCXA 1LNZA 3LZCA 2WQ7A 1H2AS 5CDSA 2NO4A 3R5JA 4Y6QA 3TXYA 3LP6A 3PGMA 3HLTA 2ZIGA 2G1AA 1QXSA 3RAFC 2AF3C 3GN1A 4ND6A 2CNLA 1XNHA 4IAOA 2I6TA 4IPTA 1MOSA 2I1WA 5JAOA 1OH8A 4RXUA 1ABFA 1I6LA 3BPSA 2JH3A 1FUIA 4UUOA 5AXCA 1L7MA 4TWIA 3VZPA 3FPLA 2HSJA 4M4SA 4OQFA 4X1IB 4LPKA 2O59A 4JZYA 2OILA 2P2SA 2WJ4A 3JYQA 1NF3A 3LDUA 3UK1A 1D5CA 2HUPA 1IVNA 2NQ2C 4XUEA 3RVKA 3OTQA 1Z5UA 4LCJA 4K9OA 1U2GA 3GA7A 4ENRA 4ITUA 3OCVA 3THXA 3M6LA 1RCTE 3E61A 1GTZA 3LP5A 1DSSG 2C29D 1B26A 1UXDA 1KO5A 1FP2A 1Q7GA 1CFJA 4W1QA 2F7SA 4ZEMA 4FZVA 2P68A 3DEHA 1Z0AA 2VNKA 5L7YA 3VQTA 4DR6B 1AHIA 2Z04A 1ACMA 4Q12A 4RIIA 1NQXA 2GN1A 2YN2A 5JATA 3EXG2 4A6PA 4QL3A 3D59A 1T8SA 1IC6A 3E6AA 1KDYA 5AW0A 3JYLA 1CXZA 4IX9A 1DCFA 1ZD9A 1GFIA 2PBZA 3C8UA 3FR7A 2AI1A 3JSAA 1ZGGA 2GDJA 3MPOA 1NW5A 4O2LA 2BDUA 4IDPA 3VKVA 2XUIA 1Z5PA 4K46A 3VKUA 4NARA 1XHEA 3T3GA 1G2QA 3QW4B 1Y6JA 1YR2A 1CJMA 2GTPA 3FKSA 4K9RA 1PJ2A 4C6SA 1DEOA 2PO5A 2FSGA 3BEOA 3DDOA 2HC9A 1YS7A 2HWYA 2LYQA 3ZVNA 4MR8A 5KVAA 3GK3A 4ZXPA 3CT6A 2WLTA 3DO5A 5KO2A 3ESYA 3EGVA 2O3JA 4P5PA 3MYYA 3EIFA 2IV7A 4UMEA 2P1DA 3EG5A 5HS4A 1ISRA 2H2WA 4OHUA 4N0PA 1NC1A 4ZOLB 2PRSA 4JB0A 1ZIDA 3I1YA 3QPUA 3IC5A 1CERA 2YX1A 3RRBA 1GR0A 2KPJA 1MF7A 2PGAA 1R74A 3OEHD 4R05A 2BMWA 4BNTA 4BQNA 1KAHA 2ZVPX 3N2YA 3KTOA 4IIJB 1KFCB 1L7AA 5TPZD 1BCRB 4NCBA 5BQOA 3TQCA 2D2VA 3LQ1A 3M7IA 2HV8A 2RH5A 1EVYA 2L42A 3DKPA 4LAFA 5GAJA 5DHRA 1G42A 1GLVA 2BP7B 2FAXA 1LBTA 2WYVA 3DLIA 4BHTA 3A6JA 4LXYA 4P3XA 3HUEA 4X4IA 2ZYVX 4B7XA 2WTNA 5A7LA 4FGLA 4YFVA 1HT3A 1PR4A 5EFOA 2DECA 2I7DA 4HEA6 5JS8A 3CUWA 3QTBA 3MN1A 1Q5PA 2PEZA 3TDMA 4GG1A 2BYTA 3NGXA 1HWYA 2H4FA 3DUFA 3TPZA 4F4CA 1U3VA 3WKDA 1WDWB 5KNBH 4GM1A 5IZCC 3SBDA 5DTRA 3HEMA 1PR5A 4KQJA 5B58C 2X0DA 1W19A 2Z5VA 4MVJP 4B0OA 2GAJA 2GM9A 4JBIA 4MEBA 5LD2B 4KPYA 1EFDN 3SOZA 4D99A 1QU2A 1E4EA 3H1GA 5FBKA 4GEGA 4JQDA 1DZIA 3WV5A 3VU9B 1J0DA 4FP9A 1M8GA 1UM9A 3CH4B 5B3LA 3C7DB 5BWLA 4MQFB 1T1GA 1YAJA 3BJIC 3UAXA 1MVNA 2J3DA 3GDHA 3RVLA 3ZTYA 5CCBA 1XMJA 2YFKA 3EIEA 4FGUA 4C03A 4WDRA 2G40A 1ZD3A 2QTBA 3KWFA 3T54A 4M0CA 4JV5B 2FPWA 4P54A 4DW8A 3AESB 1MT3A 1Y1KE 4CF7A 1ESNA 2C1EA 3T0GA 2IJGX 3EWAA 2C4WA 4K87A 4OBMA 3SE0A 2G5CA 5M29A 4KXWA 2ASEA 3JZFA 1POWA 3C1AA 1HE3A 2J5RA 4JQYA 4CQNA 4O02B 2FFRA 3WIOA 1F6BA 4N3AA 2XGGA 4UE2A 2QRJA 1R64A 4L5BA 3COYA 3GAAA 3GLHB 4X0EA 5AHWA 3ETJA 2IY7A 2VATA 1TCCA 1LW7A 1KJ8A 3FBGA 4L07A 5GIOE 4MW0A 1JMKC 3AVPA 4QDOA 4LYFA 2ST1A 4X7MA 3ZE6A 4AIIA 2ZUBA 1UMDA 2ZYGA 5BW4A 1XE3A 1C0KA 2BCJQ 4RKWA 1PL6A 2E1RA 2JEOA 3T3PB 5I4CA 2YXNA 1HLPA 3ZU5A 3T5AA 1YOVA 4ND8A 4OH7A 4WL0A 2VTVA 2ZRAA 3MS2A 1F06A 3CIFA 4Q1AA 3BL5A 1VJRA 4H59A 4PG8A 3J81k 3KYJB 2R63A 2QRVA 3S68A 4YECA 3BB3A 4MPRA 5AW6A 1NVGA 2P90A 3MD9A 1JQEA 4FYHA 2KBFA 3SEAA 3U62A 3H2BA 1E1RD 3O31A 4ZDJA 4MPDA 2QS9A 1PEAA 2VHQA 4I4NA 4EY3A 5TGZA 3DR5A 1O96A 3U4DA 3LSTA 1RYMA 4J91A 3WB0A 4GKJB 2NNWB 2XCSB 4EG1A 3IIIA 4NWIA 1GQFA 1YDHA 3FSJX 3UJNA 2R85A 3SHVA 1X92A 1PZXA 4GXQA 5HQTA 5J2UB 3TAXA 1TM7E 1Z4JA 3BEDA 3B8HA 5FLXA 2C7RA 4OGGA 1IBLB 1V16A 3T4PA 3AUXA 3EIXA 4Q93A 7AT1A 1DBQA 5DGIA 1TVCA 1EFRA 3JWEA 1I2ZA 1A7AA 3OCXA 2QTNA 4J49A 4KVAA 4YGXB 2FEXA 1LSJA 1M34A 4DR3B 1QX4A 1DXHA 1CY6A 2HHCA 5CB4B 2KJQA 2K2WA 3NV7A 3UBTA 1T2FA 2PLNA 5DNYB 1B6SA 1I5OA 3DAPA 1U3TA 3LBFA 4LOLA 5BRNA 5MFZA 4H3VA 1LRJA 4Y98A 5BO5A 4R3NA 5U4QA 421PA 3L4JA 5C52B 4GRIA 1KZYC 1XRRA 3R77A 1DVRA 4XX0A 3SHWA 1PLKA 4W1PA 2REBA 5FUYA 3BREA 1MX5A 2CLFB 3TLKA 3CSSA 4E13A 1MBZA 2UU9B 3HACA 4QXQA 2EZ8A 4HXYA 1B6RA 2VF7A 3OMWA 5TLSA 4QGGA 4KE8A 5E4YA 5EZ5A 3UJ3X 4DJDC 4PAQA 5IXJA 3G5TA 3GN2A 3U1TA 2UVPA 4BQPA 4ND7A 2GNOA 5B1EA 3I30X 2NSJA 6REQB 4UM7A 3DT6A 2RHMA 4HYTA 3D8BA 2P79A 2PIDA 1L5NA 2VUUA 3PIDA 3CG0A 5DTJA 5I8ZA 1M3SA 1PJ3A 1GYRA 1BDJA 2F9LA 1V1RB 1OT3A 1OZ0A 5K51A 4DJJA 2OCBA 2R44A 3PX2A 5DBEX 2HA4A 1DAGA 3B6IA 3Q3GE 4O4IF 3VAZA 5JALA 5HZKA 2CEKA 4RF4A 3L6OO 3SYLA 4XD7A 1XTQA 3K2EA 2ATEA 2DLNA 4FUTA 2ZIFA 2EYQA 4A0HA 5BWBA 1US8B 3E84A 3IULA 1N7IA 4LRQA 3EVCA 1S6YA 4HN9A 4X1KA 1A76A 4YARA 2H1IA 2V54A 3PF9A 4WVLA 1YQGA 3DBRA 3OSUA 5EGSA 1BW9B 4RU1A 3WK6A 1TCBA 2VAMA 4KO3S 1QAQA 1ZBQA 3IT0A 4I6UA 1K8RA 1U3DA 1XUOA 1M2OA 1Y3DE 1PSZA 3VZBA 2HL6A 2ZJYA 5DLEA 4YRQA 1Z74A 4FINA 2Q2VA 1FY2A 4QATA 3LYUA 2PXQA 1LBHA 4II2A 1XNGA 4GZMA 4OG2A 4M9XA 4J43A 2X0RA 4FFRA 1YQEA 1BRMA 2YIVX 4BNVA 4CLDA 3GJ0A 3CEAA 5BWMA 1RPEL 3IHKA 4TS4A 1PV4A 2ZRJA 4F5YA 1L9KA 2B61A 3D7SA 3K1ZA 3AONB 5LYJF 1UPBA 5IM4A 4RTOA 4FZJA 3O95A 4NHOA 4HVTA 1A2KC 2O3SA 3I9V6 3HCPA 3KD3A 1SUBA 4BC1A 2VP3A 1NUAA 2D1SA 4OHZA 3ZHVA 3ZU2A 3U16A 3PGA1 4FX2A 1O9BA 3I34X 5ARCA 3FDZA 4S04A 3MERA 3EY9A 2OA0A 3D9QX 3B7WA 4C0JA 1VYHA 2LE0A 3R0JA 4HDNB 5KOIA 4ZU6X 2VZ9A 1VIVA 2HSEA 3E8MA 4LZWA 4WK2B 3TLYA 4DMCA 3HU1A 2YVUA 1GZHB 5L6LB 3W5IA 4CTKA 4NMHA 3DVAA 2O23A 3V32A 3NKVA 2ERYA 5AQ1A 5AVJA 2J32A 4URHA 1QDLB 2HWXA 2WMNB 5DRYA 1F0YA 1MO4A 2LZ0A 1SRQA 4PYRA 5FO1A 3DHWC 1OX4A 3SDZA 2OP0A 1PWEA 1PQYA 5JSZA 3COWA 1TUEA 3PDHA 1T4BA 1EJ2A 2DFDA 2G9VA 2Y92A 3IB3A 5EZYA 5EUMA 1FJGB 1PZHA 3T0FA 3UA4A 5BSFA 5I6DA 3N58A 4GQBA 2Y6UA 2DH6A 5CB8A 3ANYB 2VH1A 3DFMA 1GPH1 1TJNA 2OC9A 1PT9A 4UMFA 3FRHA 2HLDD 4XW2A 1T3HA 3H5VA 4DPMA 3KSDO 2CSUA 4BCCA 3I09A 1OT5A 2G72A 1VLJA 4LY6A 1DC6A 3NPAA 3IP9A 4L0DA 2HIAA 2UUBB 4QGSA 1I51A 3PPIA 1PK7A 4AG5A 4ADSG 3ENQA 5BXYA 3IXLA 2HLNA 3OCWA 1OH5A 3JD2A 1DIHA 2GD2A 1H3FA 4D9BA 3R75A 2ORYA 2CV0A 1NQ5A 4GGPA 1ZDMA 4TRRA 4ZAVA 2G7ZA 3O9XA 5EXSA 4NV1A 5CW1A 4IUBS 4B5KA 7ABPA 1PJAA 2Q6IA 3K2BA 1EHIA 2PT6A 3BAFA 4Q4AA 5ALRA 4V0KA 2I65A 2LYLA 4N39A 2EDAA 2MSEB 1G3RA 2P2CA 4YMLA 3A2KA 4OQPA 5HEKA 4XJXA 1WMBA 2HT1A 2KEJA 2GEDA 1CF2O 2JJ2A 3W34A 4DC0A 1WBBA 4CLEA 1S8FA 1JLSA 2KI5A 3ENNA 1JKFA 3RBXA 1MIOA 2QVZX 3O8OA 1UAYA 2C3UA 4CXMA 2O14A 2DPXA 4JENA 5B1YA 1I6MA 1GM5A 2GAFA 4HPJB 1H9BA 1PJ4A 1A9XA 3BSYA 3IRUA 4F1JA 5JH7F 2A1TR 4YAKA 2X3FA 2WU3A 4K7JA 4ZK6A 4CLRA 2IEGA 1L4GA 1AKQA 1VJ1A 2DPYA 2K2QB 3QELB 4UUQA 3EQ8A 2BFNA 1UKZA 4WN9A 1MG0A 4E88A 2XRZA 2YHUA 3DMPA 3AKZA 2IHBA 2X0JA 4PAOA 5TXGA 1QTRA 1IZ9A 3BZUA 4E22A 1W9HA 5KQMA 1AUVA 1U1FA 1SKUA 3JTEA 4U7HA 4J0GA 2V4UA 5ITZB 4JBYA 3SQXA 1NI5A 4G26A 3GBSA 4YJKA 1PQWA 2BONA 3GIDA 3BE4A 5I01A 3TW6A 1UJCA 2BFDA 2QD4A 2N42A 3R6DA 3RVBA 3V8PA 2DJIA 1I7SB 4ER7A 4FDAA 2VDJA 4L0CA 3D4LA 4D74A 4X4EA 3CGWA 4BP3A 4B6RA 2Y1OA 2UYOA 3HB9A 4MQ4A 3M6AA 4CIAA 2ICTA 1EA5A 1JG7A 2OHFA 4A6EA 3NDJA 2JGLA 4U8GA 4ILKA 2Q4DA 1DEKA 1EDZA 3COZA 1UJNA 2QY9A 1ZZGA 3LCJA 3RJ9A 4OO3A 2O7VA 1N5RA 1B14A 1R6AA 1XXHA 2HQRA 1YIDA 2WHXA 5CTJA 2R1VB 4ZU1X 3K96A 4TSRA 4D8XA 3T1TA 2NVOA 1G8AA 1NFQA 3NWEA 4EA8A 2J48A 2L19A 1CRZA 1N3BA 1W49A 3E2IA 2C8KA 4AZVA 5CHEA 3VPCA 5AW7A 3TFOA 5CNMA 2JJYA 3E82A 2VJDA 1KH1A 1TQHA 2ZI7A 3EQ6A 3HP1A 1XTUA 2EBUA 1KDOA 3ITEA 2ZYHA 1PR0A 3LY9A 4WNYA 4COKA 5B7PA 4N48A 3FPEA 1Q19A 4WXRA 3P9NA 1KIAA 2FH5B 1TCAA 1BVRA 3I9JA 4LK2A 1C7QA 1NRJB 1YJ5A 4DLYA 4NONA 1PJLA 2HA2A 5TX7A 1V6SA 1BG6A 3B5JA 5KS2A 1C4KA 4N0EA 1ZM9A 4BJ5A 4X85A 3QFRA 4Y8VA 2JVIA 2IT1A 2F9MA 3MWJA 1PV2A 1QYRA 2JDID 2P4HX 2Z2KA 3RIYA 4FLEA 3U2QA 1E2UA 3KQVA 3V4SA 3IKVA 3TNLA 4B6SA 5JNRA 2P9FA 2HQSA 3DLCA 3S2UA 5CLFA 2ZI4A 3PV0A 1PZFA 2EWWA 2H2IA 3B1YA 4U1RA 5CYFA 1KVRA 1E59A 1T0HB 5KAMA 1MDFA 4G3XA 4P4GA 3T1QA 1M83A 4Y18A 1NPDA 4ENQA 5JY6A 3N8KA 3PFHA 1L7PA 3PXXA 1SKBA 1U4NA 4DN6A 3BS3A 4JUBA 3TS1A 1E3WA 1GZ7A 2IRWA 2G76A 4JGIA 2AA3A 4JBGA 4B75A 3I12A 3L79A 2P6OA 3OPYA 5HMMA 4V1CB 4HI0E 5LVAA 3A9WA 5JMWA 1HR0B 3ZLTA 2GFQA 5FXMA 3LUAA 4OFBA 4W9MC 4REQA 1YRHA 1SHZA 1VLZA 3BULA 3VYWA 3H84A 2R11A 2J0VA 4L7QA 3UMGA 2EW2A 1OLUA 2FOLA 4M6WB 3UFDA 1QJ4A 4QPZA 3V9AA 3D8UA 4CKBA 4CL8A 4YT4A 2JHPA 2E4AA 1V45E 1OJ7A 1PJZA 1HDIA 1MQ9A 2CFOA 3AI1A 2YNMC 4MR9A 4N7RA 1GDTA 2QMUA 2B5OA 3WO1A 4P35A 3W3AH 4D02A 3L7DA 5BN4A 4PBRA 3VR4H 4PEVA 1T5OA 1E1QD 1MABA 3RYHA 4Q9LA 5K5EA 1GUZA 4IIGA 5EAIA 4OX9B 3HV2A 2GHIA 3CCBA 3G68A 2VK2A 3AFHA 4X00A 1HUQA 4QTTB 4AL4A 2EP7A 3OCYA 3OOEA 4I4TB 1W1WA 5TMEA 2ABWA 3IKMB 5LKRA 5KPDA 3DTVD 4H4CA 4DBLE 1Y89A 2WKWA 1P0PA 3AUFA 3PA8A 4RZXA 4ZJUA 4PG5A 1RQNA 1TW2A 3HYLA 5ALYA 2JAHA 4ITVA 4CF3A 4NQRA 1KBOA 3QLJA 4BX9A 1SO8A 4U2EA 1I4EB 1PNVA 3C48A 2Q1SA 1YI1A 4RC9A 1F1BA 3GO4A 4TLBA 4XQGA 1XK7A 1H8HD 2BHRA 3RWOA 4ZKDA 4PYQA 3AERA 3E7XA 4J0JA 3MAJA 4OA8A 5KREA 2QSJA 4LE1A 1CR1A 4YALA 2ZUFA 2PZ8A 2W8BB 5CAEB 3HWRA 1T3TA 1YBAA 2GYYA 1O95C 5G3ZA 4RDXA 2R60A 4HB3A 1M1YB 5JDCA 5LQCA 3CR8A 1JXAA 4H15A 4IV8A 4Q9IA 1Q1NA 3HBNA 2DXIA 3F4BA 4FR5A 2DC1A 1UDRA 2IODA 4MJXA 1CZNA 3LKDA 4LVOA 1XMSA 2JGDA 4JASB 4PCLA 4YWHA 2NSDA 3TR6A 1TF5A 3TR0A 3WJ2A 1O89A 3NQ41 2OOKA 4GRDA 5CB4F 4OL9A 4WY2A 1XQYA 4Z3KA 4BOYA 1GCOA 5GTDA 3OZDA 5JLAA 3AF4A 3KZNA 3I3OA 1U5CA 1Z7GA 3E15A 3V4RA 2OYRA 1KVSA 2CFTA 1P6UA 4RXMA 1E5XA 4IIEA 4NHEA 5E7QA 1II0A 4BQQA 1IAQA 1TM1E 2I6XA 4R8MA 1U2DA 4U5QA 4YO8A 3TSYA 3NBUA 3PYMA 3ZCUA 5EMMA 5C3UA 3KLMX 2NPIA 3CEHA 2I55A 4MCHA 5A4MS 1CUJA 1H4TA 3QE2A 4CCAA 4C6HA 4UPEA 3IV9A 1YBFA 2OZPA 4GMXA 1K4MA 1VKHA 3H6KA 3TTWA 5CLGA 1MH9A 4Z58A 4C0XA 4YRKA 3LC0A 4K9MA 2FWPA 3SI7A 4XQCA 2VSQA 3GW8A 3H19A 5KYKA 2DM6A 3L07A 2VF5X 4FXOA 4G1EB 4HGPA 4ILEA 2HSWA 4KWHA 5CX1B 2WWYA 3U7FB 2QV0A 3LC7O 3NAMA 3EH2A 4ZCQA 1BDMA 2O5VA 1ZGCA 3K0HA 1IQ0A 5CNKA 5AJWA 3VR2A 3FSGA 3MLAA 3NDRA 4J1NA 3W6PA 5K7SA 3GVHA 3T5PA 1PJBA 2H5LA 5DGTA 1VKZA 4GUDA 1EDEA 1I4OA 4DQ0A 2LBPA 3ZVKA 2AW3A 2QTTA 3I32A 1Q22A 2OSBA 1FDRA 5F3DA 3T7CA 2IW1A 2FF5A 4PC3A 4UCFA 4DJTA 4E7OA 3THYB 3O82A 3DE3X 4MZXA 2OM6A 3QVKA 4GYJA 1IC8A 1EEHA 2NP6A 1N92A 2D2IA 3MRVA 1PJTA 5EMJA 4N5HX 4YTEA 1KP2A 2E1PA 2UVQA 2ZYDA 2V7QA 2J7WA 3V1MA 3ITNA 3HM2A 5EWLB 2VG8A 3GBPA 2ZBUA 4K88A 3VWSA 1SUIA 4OHCA 3CHYA 1A9OA 1S2DA 3NANA 5EMNA 4NCAA 3EF0A 1OI4A 1C8BA 1I4DD 3HJUA 3R6TA 4EA6A 3OZEA 1WZ2A 3MT7A 2C5HA 3E53A 3AT1A 2CLOB 3TI7A 4C4AA 5A5DA 4KN6A 3QU2A 1JHUA 3WMXA 2H59A 1RVDA 1ZOSA 1Z8NA 4YACA 1WX1A 3IEMA 3FZYA 4PFJA 1OH7A 3BMCB 3OJEA 4LS3A 5IZ4A 4HFJA 4NI5A 1X1TA 1B8NA 4EJMA 5KYGA 4RKQA 1M2KA 3V48A 5KYWA 2I76A 2O2YA 5TEWA 4HATA 1EK6A 4DLVA 5I9IA 4E1BA 5AM0A 3TM4A 3EXHA 2QUKA 3IHWA 3UV6A 1Z47A 1ENPA 3EUWA 3QQ5A 4ML3A 3IVGA 2W6ID 3BFKA 3S7ZA 2DVMA 4AJHA 3JAMA 3CVVA 2LV8A 4QX6A 1O9GA 3B7HA 1DC5A 4EZBA 4TXLA 4YJ3B 5EJ8A 2N3ZA 1YNSA 6LDHA 1BKDR 3HA2A 1EE9A 3FMIA 2R6DA 2Q6TA 1ZONA 3JS5A 3WLJA 4WBNF 1L1MA 5B6PA 2O8CA 1GKYA 2DH5A 3QVSA 4WOJA 3CYFA 1Z2NX 1RJWA 4M99A 3FKSD 5I9TA 1IBCA 1G7RA 1YR7A 5JE8A 3JQ7A 1TVMA 2XGMA 4I3HA 4ZYXA 2IYEA 1C7FA 4RXTA 4G65A 3K92A 1ZICA 2BF7A 3PUIA 5A03A 1OW3B 2CZCA 1G98A 2NUAB 2FQ1A 2JHCA 4GL2A 3AESA 4D9NA 2BFEB 1PK9A 4D9CA 4Z4CA 3WRVA 4LDQA 1FLVA 3ZJTA 2C2BA 3J7TA 3TD2A 1JHMA 5ER9A 4UAUA 1X70A 3R23A 3WK7A 2BM9A 2P3LA 4IIJF 2XR1A 1OYVA 5KWEA 2A1UA 1QTNA 1RR6A 1MRZA 4Y30A 1RJ9B 1SUAA 3O1JC 4PF1A 3BTOA 3VYVA 4XDHA 3BD1A 1N2HA 2BSXA 2IEYA 1PEKE 4NABA 3E9QA 5AFSA 1TGVA 1EJ0A 2ZUWA 2G1PA 1QQ5A 4MVJE 4AKGA 2EW8A 1YOVB 2RGAA 3G2NA 2UYCA 5KNLA 4IJ5A 5LU9A 1KFJB 3BSSA 3EEQA 3SF8B 3E22B 3V7NA 1EHCA 4QJ4A 4H6VA 3D4PA 5K0LA 4F9EA 4KEAA 4GNRA 1PD0A 1X1CA 1UXKA 4ARUA 1JHRA 2Q9CA 5BXQC 1NQTA 1QJCA 1GR1A 4BJ1A 4OOEA 4HLQB 4QTUB 1JDVA 1NN5A 3BD7A 4KXXA 3RABA 3O2JA 4EHFA 4RD3A 1LJ8A 1YDFA 2A8YA 4QNRA 5CXSA 1TUBB 2AN4A 1PX2A 2A9JA 1WL8A 2ZE5A 3KXDA 1E5LA 2PHZA 3I53A 1PW5A 4N40A 2JGAA 1L4BA 3LD9A 4F86A 5CG1A 1WZIA 5KTYA 5I8WA 4QLBA 1ZVQA 2F00A 2XW6A 1JWLA 1L4MA 1P77A 1TIPA 1WZEA 3H2JA 2ZULA 3ILYA 1CY1A 3CVOA 4WEQA 2BGRA 1POUA 2NO5A 4XIJA 1N2OA 1FEZA 3H11A 5T5QA 3QVJA 4OCZA 1ECLA 1TTQB 1D1PA 2OSVA 1CRLA 4IFTA 4JLVA 5FDFA 4H17A 1OA0A 2H2AA 3G5LA 1K7SN 4J1TA 3SIRA 1UM9B 1U1EA 1A9PA 2DFVA 1HZZC 2E4UA 3IPCA 5FBRB 4OLJA 2GVZC 4F0JA 1U5BB 1L9XA 2Q45A 3THXB 3M3HA 1TAUA 1OYOA 4H1VA 1QIJA 5EHXA 3LIPA 1U65A 1KTIA 2CZQA 2IYFA 1HTBA 5DCWA 2Z1DA 3U3MA 4D9HA 1HL7A 5DTEA 3BHNA 1JP7A 1AMNA 3NCHA 2ZWMA 1ULZA 3HSYA 5FR2A 3V4LA 4Z7QB 1XVIA 2CVQA 4E2ZA 1S8OA 3ACDA 1SFRA 2Y99A 3LXMA 3WMFA 1RRVA 4PZEA 4ASUD 4RY9A 2J08A 3ZU3A 3QFCA 2CNWA 4AMUA 4J1WA 2X6RA 3MCWA 4KE9A 4WI1A 1XL0A 4I1VA 1MHTA 1EEXB 1I5RA 5IX8A 2NUAA 2QX7A 4IVPA 1DIGA 5HGJA 4W7IA 1QTIA 4NH4A 1MFQC 5HE8A 1E89A 2FTKE 3HNRA 1UMDB 1G5HA 2CDRA 2F67A 2RMKA 2Z1NA 2J7KA 2OGSA 1N0IA 5K3SA 3IOBA 4GMFA 3LIIA 5ICFA 3U26A 2ZM5A 1NKTA 3KALA 1S2IA 3ZJYA 1YTLA 1NAHA 1VSUA 5DX0A 1P18A 5BW5A 1Z4NA 2E6KA 4S1WA 4HUQB 3WFJA 4KNWA 3LCUA 2VF4X 4HKTA 2QNBA 2W5UA 5DYGA 5H9WA 4GICA 5JROA 3I9V1 4PO3X 1F12A 4EHAA 1RI1A 1A3CA 3TKLA 1UP4A 1WQ1R 5I9LA 2ZUTA 2A0UA 4ROTA 5FLEX 1APBA 2Q9BA 2OV3A 4F11A 4CMIB 2AIRA 3HJRA 2RHOA 1C50A 1V9LA 3Q9SA 1NPYA 1FTQA 1ONPA 1F8GA 3CJQA 3VO2A 1JECA 1R0BA 5CA0A 2OC4A 1GCIA 3FYHA 3H1FA 2RB4A 2GRUA 5JFTA 1BS9A 4LI0A 3K53A 3LWDA 1U2RA 4Z5HA 3UTCA 1VHDA 1ADBA 3H05A 1OFHA 3JQQA 1K2WA 4LBWA 4Q4CA 3TE6A 3NGLA 4XX1A 1PVVA 4LY9A 1G7TA 4UBNA 2HCFA 4KGDA 3QOXA 1QQ7A 2P9EA 1GXSB 4G01B 3FGNA 1VJGA 4WK6A 5JJ5A 1NU6A 3QE4A 1K5HA 2JEYA 3WQRA 4QT4A 4NZMA 3EHEA 3W9UA 1G5IA 1XNRB 1A27A 4V0SA 4F8EA 1SIUA 1AQYA 3UAGA 4PNEA 1XRMA 2P9ZA 1DWOA 4R5HA 4RPJA 1G291 5IYZA 1N5LA 2OWEA 2ZYUX 1K86A 4XFKA 2IUUA 1SCUB 1XKTA 3JZAA 4BV2A 3C14C 5H82A 1W94A 2B30A 2O1WA 1YFLA 3JPYA 3RC8A 3L40A 4L5AA 5BSVA 4WWHA 3MT8A 3P97A 2NYRA 1EP1B 2VDWA 3F9CA 3PC3A 4YJ3A 5AI8A 4AECA 5FWXA 1LVUA 1N2CA 1VKOA 4NYJQ 4EO4A 4XQEA 1HTTA 2PL1A 2H2DA 1SBTA 1KEKA 2C7PA 1W46A 4EPYA 3MM4A 2VCYA 4FI3C 4CF6A 2KBEA 3SS7X 5JD4A 4EG4A 3HY4A 1VB3A 3KJHA 4MUEA 1BGWA 2GFHA 1LGYA 5GJBA 4M3NA 4XCXA 3JXCL 4OUDA 2Q9UA 4M87A 3W2TA 1DAFA 3N2IA 4QPNA 3BILA 5T41A 3M6VA 1TAHA 3KZ1E 3FOCA 1KTVA 1TJ4A 4L51A 1VKNA 3T8YA 2I78A 4MKIA 3WSTA 1HYGA 1E66A 1KY5A 1OREA 2G8NA 4IDHA 3VPAA 2JD0A 4I50A 1JRLA 1EGHA 3NBYC 1VIAA 3LQRA 4F6RB 2RJNA 2CFIA 2AZMA 5AICA 2YWBA 2IP2A 4N41A 3PIIA 3M0EA 3LU1A 1MABB 3RYHB 2YYSA 4O1MA 4Z0NA 3TZKA 1Z68A 3C87A 1U8CB 3R0VA 3J81A 2QX6A 2GHTA 2B0JA 2OBFA 1GFZA 4Z5DA 1U7ZA 3OETA 5J2TA 4EG6A 4NV0A 3VDRA 3A6KA 1MW8X 1Y8QA 2RGYA 5E9QA 2F8SA 2DU8A 1DEAA 1C7ZA 1YR3A 3H1PA 1T6XA 2BV3A 4QFMA 1YUBA 3BN3A 4ECAA 3R9WA 1NLMA 4CV3A 4ZCTA 2HCBA 4MULA 1JAHA 4FNMA 5FUMA 4CQLB 1ZI9A 1ZN8A 1J97A 3EFBA 3QVGB 4D79A 3VSCA 3AVTA 5DIZA 4JC5A 3CLRC 1Z63A 1V96A 2CJWB 3BMCA 3RT7A 4GHWA 3G9TA 2GESA 4F04A 1WHSB 2XNDA 1Z17A 3ANSA 1YAHA 3MCAA 1PYOA 4YP9A 1N1GA 2H5EA 1W85B 2PXHA 2R8PA 5DIFA 3U7EB 5A3QA 5E7JA 5LB4A 3DVRX 1IULA 1UBNA 4YUWA 5BVGA 4JB3A 1YRQA 3KTDA 4BFWA 3HDHA 2IXTA 5BSUA 5HMLA 1F0KA 3TF5A 3GFVA 1JWAB 1MD9A 2VPTA 4F5EA 2AXNA 2B2NA 1K4KA 2XB9A 4GF5A 4H08A 4RZ2A 5I48A 1UEJA 2ECQA 2ZSAA 3GLVA 3B2QA 5EWLA 1VG0B 2Y67A 5K0TA 1Z4LA 4I8IA 3N3BC 3ZY2A 1C41A 2R5FA 5BN5A 1T0IA 3VVLA 5LBTA 4DSAA 5HP4A 4D25A 4NU0A 1MOQA 1U6IA 2ZWOA 3IGFA 5EP3A 1QUFA 2BEUA 3D64A 2XF2A 2M6KA 2PKXA 4B8ZA 2ZJ0A 3OEWA 4B17A 5E4FA 1H2XA 4L73A 16PKA 3QOFA 2CJYA 2C95A 3PJDA 4P83A 3GNSA 2Q3CA 3EPKA 3BS4A 1DTSA 5HIJA 4EG0A 4YJFB 4UJ5A 3JX9A 3F7MA 3IP7A 4Z1OA 1NSYA 3F6EX 5I8PA 2C4HA 3TRDA 5KYWB 2X9NA 2GZUA 4FFOA 4S35A 4D45A 2PUJA 5HF8A 2X5JO 2QAGA 2B37A 2JL1A 2CROA 1KOGA 3DAHA 4RIEA 3IAAA 3UV7A 1K6MA 3E23A 3HB0A 3WQBA 1ZR2A 4WPGA 2X77A 5H16A 1SD1A 2AI2A 1RM0A 3GLKA 3HXKA 5HYVA 4NZYA 3SCGA 2HO4A 3BHIA 4X84A 2AG1A 1P91A 4OGLA 5FWDA 1CK4A 2QMOA 5EWMB 1ML3A 4KITB 3WGZA 1X86B 5LZ2A 5PNTA 4LQ4A 3CFYA 1QDUA 3VO1A 3ZV5A 1RE0A 3PPWA 2FMUA 3QE3A 4G8JA 4CJXA 1KP9A 4H7HA 3AL3A 4W5OA 3SX4A 3T99A 2XZOA 4DM4A 4I1RA 4UVIA 2I6FA 4COOA 1FS6A 2QN6A 2GJKA 4BTLA 4WZAE 3U31A 2OZLA 3LC1O 2JFBA 2P91A 2WNIA 4NL4H 2XTAA 1ECGA 4AY4A 3BE5A 4QU5A 3AR3A 4TYMA 5G1PA 3VNBA 5C7IO 1O6BA 1M1ZA 3TZCA 4B7UA 3IUYA 3BTVA 2B1GA 2KLHA 4KXVA 5DP1A 5IPFA 3KZOA 2B8WA 1GL6A 2WF5A 2PYZA 2PH5A 3CRRA 4AUKA 4KPEC 4BGUA 4GMDA 3B36A 1OROA 1G9TA 1E4OA 3KO8A 1T2CA 3AIOA 1ZJ5A 2XYVA 4I6GA 3U3RA 2QAIA 3RVPA 3D2CA 2ZSDA 4Y2PA 4YY3B 2FR0A 2PL9A 2FSUA 3N8IA 4EEXA 1ZAYA 1L7NA 2I2BA 2PQMA 3N8GA 4RBNA 2LXNA 3WJ1A 1DO8A 1FFXB 3G7UA 4Q6WA 4FGJA 1B6TA 2MMCA 3KDSE 2AMVA 3T4EA 3L2OB 4R68A 1Q3KA 4IF4A 2HN9A 2EQBA 1HY3A 2Q5EA 1KRXA 2G7MC 1VE5A 3OZFA 2LVBA 2PSDA 5EKDA 1EK1A 3H0EA 1A97A 5E95A 1IN4A 2WT4A 4X3OA 3IOMA 2M1ZA 1SPBS 1Z18A 4BASA 4ZYLA 3I73A</