1QQBA

Purine repressor mutant-hypoxanthine-palindromic operator complex
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
338
structure length
338
Chain Sequence
TIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLAVNHTKSIGLLATSSEAAYFAEIIEAVEKNCFQKGYTLILGNAWNNLEKQRAYLSMMAQKRVDGLLVMCSEYPEPLLAMLEEYRHIPMVVMDWGEAKADFTDAVIDNAFEGGYMAGRYLIERGHREIGVIPGPLERNTGAGRLAGFMKAMEEAMIKVPESWIVQGDFEPESGYRAMQQILSQPHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEVHPRLIERRSVADGPFRDYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The role of lysine 55 in determining the specificity of the purine repressor for its operators through minor groove interactions.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Gene regulation/dna
molecule keywords 5'-D(*TP*AP*CP*GP*CP*AP*AP*TP*CP*GP*AP*TP*TP*GP*CP*GP*T)-3'
total genus 121
structure length 338
sequence length 338
ec nomenclature
pdb deposition date 1999-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00356 LacI Bacterial regulatory proteins, lacI family
A PF13377 Peripla_BP_3 Periplasmic binding protein-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 1qqbA01
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1qqbA03
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1qqbA02
1ZGZA 3N0XA 2IVQA 1VKRA 2IPLA 3L6UA 5DCLA 3LOPA 4IILA 3OLWA 2PUGA 5IBQA 8ABPA 5B3JA 4JCXA 3M6MD 5EWLA 3LFPA 4NDWA 4FN3A 3HVRA 2RGYA 4N0QA 5TPZA 1U0SY 3KYIB 4OB4A 2CROA 1WETA 3LUDA 2VUIB 3QQ6A 3QLUA 1EWKA 4N47A 2FN8A 3O1IC 4PU8A 4KPYA 2GI4A 1BDHA 2AWIA 1PNTA 3SCHA 1QMPA 3QYXA 2JRLA 2R4QA 1PHRA 1M5UA 1NXPA 3O1HB 2O20A 2E4VA 2KEJA 3JXCL 3LUFA 3C3WA 5EWJA 1ISSA 1JF8A 3RVMA 1S8NA 1CYEA 3JS5A 4G0ZA 4FE7A 4RZSA 3H5TA 3C3KA 4ETIA 2FLWA 4MAAA 1RNLA 5E3JA 1VRVA 2GRLA 1W9HA 2NUBA 1RZSA 1A2OA 1F4VA 2IUOA 5A7LA 1YS6A 2X7XA 3HUTA 4OLAA 4Y42A 4Z4EA 2IU7A 3ILYA 5HQJA 1USGA 4FB4A 1QP4A 4Z5CA 2MYNA 2PL9A 5ED4A 2L18A 1Y7YA 4LZLA 5JNSA 2E4YA 3G5GA 5DLEA 4F12A 4KV7A 4X4DA 1JBEA 4MCTA 3JVDA 1DBPA 1ZDMA 4GPAA 4HNQA 1YK0A 1W25A 3H6GA 4W5RA 3GWGA 4QYMA 1FFGA 4DN6A 4MCXA 2H8RA 2QR3A 3CS3A 3HSYA 3FDFA 1P6QA 4W5QA 2AXZA 1FFWA 2WRZA 5HKOA 3M9WA 1DCMA 1FQWA 1PEAA 1ZS4A 1LJUA 2FVYA 3A0RB 5JNUA 3JVIA 1JFSA 1AU7A 2TMYA 3D1NI 4KK4A 3F6WA 3QX9A 3O1JC 1B00A 1ZVVA 2FKAA 1XHFA 1E6KA 3KYJB 2IPNA 1QQAA 3HZHA 3H5LA 1C0EA 3GBVA 3UFDA 5ABPA 4RXUA 2RJNA 2IV1A 3MF4A 3A0UA 1ABFA 3IPCA 3GN5B 2O38A 2WWVD 4W5OA 3OO1A 3JPWA 4LDZA 3JTEA 2ICPA 2O49A 4NQRA 3FYMA 3VK0A 1JX6A 4Z9AA 2PUAA 3QLVA 3JPYA 3URMA 3NNNA 1Z12A 5KQGA 5FBHA 1HEYA 3IVPA 3HEBA 3RZZA 4TLLB 1YTUA 4W5NA 3UKJA 2WUSR 1RXIA 1ZY2A 1XHEA 4D6XA 3CLKA 4O5AA 2DRIA 3RVNA 4WWHA 4E7OA 5JS2A 1A04A 3OP9A 4MS1A 3U3WA 3DLHA 2F8TA 3RVJA 3FFWA 4EVSA 2Q5CA 5KWSA 2XCJA 5JNRA 4N41A 1ZZCA 5FWXA 2A6CA 2P9HA 1X57A 2HQBA 1RZRA 3KKEA 3OQOA 2RJOA 4YCSA 1NXWA 4MS3A 2PMCA 3SCFA 4WUTA 3OMXA 1ZUGA 5KC9A 3O2JA 3JY6A 4F06A 3C97A 3HO1A 3TD9A 2R63A 1U2QA 1ZN2A 2CHEA 3FFTA 4Z5DA 1JFVA 2WMYA 3LKVA 2VK2A 3SAJA 4LE2A 2IYNA 4YG4A 2FN9A 2LYRA 2B4AA 3F51A 2QV0A 2M1ZA 3MIZA 4PEVA 5BRAA 3TO5A 2D5VA 3RVRA 2GRMA 5FWXB 2ID7A 5IEJA 4RY8A 4MR8A 3MMNA 3D8UA 3H5WA 3QK7A 3D02A 3RH0A 4D6YA 5EWJB 5F64A 4PU7A 1PUXA 2IKSA 2FJRA 2WJWA 3Q15C 1LMB3 1JDNA 1L5ZA 1VLZA 1TVMA 4RSMA 4KMRA 5GOTA 2BNMA 5B3JC 4RDCA 1ZESA 1APBA 4YBAA 4H3KB 3GN5A 1DP4A 1Z17A 2XJ3A 3TRBA 1PRAA 2LBPA 2YHBA 3S99A 1L5YA 1WH6A 1QKKA 1DG9A 1M5TA 4RU1A 1GT0C 2BNOA 1GCAA 3KG2A 2JVIA 3HDVA 3P9YA 5FBKA 3OLYA 5KQMA 3E61A 2EF8A 2JK1A 2WJAA 3IP7A 3OO0A 5KI6A 2AXVA 2RDMA 3E3MA 3OM0A 4G0OA 2AXUA 1LCDA 5CHYA 4YR7A 1F51E 5C5CA 3Q7TA 4PICA 1JL3A 3NBMA 2FMHA 3HCWA 2QVGA 3IDOA 4LDAA 1P6UA 4TN5A 4JQDA 1Z2DA 1S7EA 3NHZA 4RK5A 5FWYA 3IPAA 1QO0A 3MQ4A 3G7DA 4Z4FA 3I5AA 3GA5A 1NXOA 1A0OA 3A3KA 3QLVC 4G86A 4MLDA 4WXMA 4YV7A 1FFSA 1JFTA 3T95A 3B7HA 4EYOA 4QYWA 1UXCA 3VNBA 1JYEA 2CD7A 2A9PA 3FFXA 1JWLA 2OENG 4LE0A 5TQ2B 4RY0A 1B0NA 1MAVA 2A9OA 2B5AA 4X4CA 1TMYA 5GQSA 4D74A 1OCTC 4UHKA 1CJGA 3H1FA 2V0NA 1UDRA 3BS3A 4PU3C 3SQNA 2LYJA 4EYGA 1UXDA 4IGAA 3RVOA 2XSDC 1QPZA 2E4WA 4IRXA 6CHYA 1ZGGA 1WH8A 2FQWA 2FTKE 2ICTA 4F8DA 2BJCA 3CZCA 3GYBA 2ZWMA 2EBYA 1TM2A 4FBIA 2PL1A 3CECA 2MSKA 4KRFA 6ABPA 1Z2EA 5JNVA 3H5VA 4N03A 3QLTA 1QP0A 2HJ9A 7ABPA 3C3MA 3EJWA 1OXBB 4WT7A 5IUNC 4HNSA 4F3TA 1BVHA 2KEKA 3K4HA 3BDNA 3OMWA 4EVRA 3CRNA 5IX8A 1E6LA 3BRSA 4MR9B 5JNWA 3GRCA 3KLNA 4MR7A 1IC8A 4M88A 4RXTA 1M2FA 1DBQA 4OLBA 4G0YA 3O21A 3MLFA 4G0XA 1PNRA 4I8TA 1KRWA 4Z58A 1O4XA 4QPJC 1MB3A 3SCGA 1Z26A 3OLZA 2IVBA 4NICA 2JB9A 5K98B 2N9UA 1EAYA 3HXMA 4X4IA 2KEIA 3NNSA 3BD1A 1ZAYA 1QNLA 3NHMA 1ZZBA 3OLVA 1NXVA 3NNDA 5CNJA 1LQCA 3O74A 1D1PA 2FQXA 4Z4HA 4GHJA 1YMUA 3HS3A 1K66A 3MYYA 4FE4A 1RPJA 2I6FA 4RS3A 2MSLA 5KC8A 2FMFA 4XAQA 1SXIA 2FEPA 3SG0A 5JS1A 2CHFA 3H5IA 4TLMB 2AUWA 3O9XA 2O4AA 1DRJA 3JXDL 1RPEL 2A9RA 3GL9A 1DWKA 4EVQA 2L17A 2PKXA 2A9QA 1ISRA 4RK0A 3HK2A 3FMVA 2IPAB 3KTOA 1RXEA 2J48A 2FEKA 4G0QA 2E4UA 2GKGA 1XWRA 4Z9BA 1D4ZA 4JOQA 5TPWA 3T8YA 1MVOA 3LMKA 3O75A 3OM1A 4Q7EA 4RXMA 3GBPA 2AW6A 1ZHHA 4HYEA 5TQ0B 4IMJB 3Q7SA 3KJXA 3Q41A 2JVLA 3KCNA 3FYAA 2QVCA 5IUKC 1ZZ7A 1K68A 3QWGA 3CNBA 4GNRA 2JVJA 4KQCA 2JCGA 4UHJA 3ZHMA 4YRZA 4ML3A 4JB0A 4RV5A 4EYKA 2B1JA 4MR9A 1E3OC 1DC7A 3JXBC 4WXEA 1GUDA 2GBPA 3UUGA 5IUJC 5C5EA 1DJMA 1I3CA 5KQPA 2R47A 2PUCA 3N8IA 1D1QA 2OQRA 3KS9A 3LKBA 3QF3A 1T34A 1XWWA 2MEZA 2E4XA 3EQZA 3H1EA 3HUUA 4MR8B 4EGSA 2KZ8A 1LK0A 1NTRA 3SY8A 4Z0NA 1AB6A 2BGGA 1Y9QA 3RQIA 3ROFA 2FXIA 5DTEA 1YSEA 4B09A 2HQOA 5T3YA 2QU7A 3H75A 4YS6A 4ZPJA 5TPWB 4YG1A 4IWRA 1ZZ9A 3S8QA 3RVSA 1NY5A 3IP6A 1C4WA 2ID9A 2M98A 4NCAA 1TLFA 5TPZD 1NXSA 3HDGA 1Z13A 1LBIA 3QELA 2LYSA 2PUFA 3KSMA 3QEMB 3N75A 1BDJA 2GWRA 4P98A 2W42A 2LCVA 3G85A 3HV2A 2QXYA 3W9SA 1ZZ6A 5KQLA 4ETMA 1ZITA 1SRRA 1NEQA 4MPTA 1HF0A 3CROL 2PUBA 2PUDA 2IPMA 2QSJA 4I6RA 2NT4A 3BBLA 4IF4A 3RVQA 1EFAA 2AYZA 3LUGA 4Q6WA 4QICA 1OSLA 3GBFA 1ADRA 2LIVA 4EUKA 1M2EA 4TMYA 3DBIA 1Z25A 4RWEA 4I6UA 4X4EA 3QEKA 3RVKA 5IULC 2F8SA 4ZMRA 3UK0A 4S05A 2YHAA 3LUHA 1YK1A 2PJUA 1R63A 4RK1A 1E2BA 2EWTA 3I09A 3EUSA 3OQMA 3MM4A 3EULA 4RK4A 5TQJA 4YG7B 5TQ2A 4E7PA 1EHCA 2CWDA 5TE9A 3KXAA 2FQYA 4J1WA 2OFYA 4MS4A 4RKRA 3IP9A 3OLXA 2JBAA 3O2QB 2VUHB 4O8BA 3LISA 1CQTA 3MA0A 4JB2A 1KRXA 4DADA 3EAFA 1ZH4A 3OQNA 2FMKA 2LYPA 2LUOA 2QW1A 3F6CA 4MRMB 3BREA 5IC5A 4G0MA 2WB4A 4X4GA 3RVLA 9ABPA 5I4CA 2JVKA 4O1HA 4OTZA 1QP7A 1EWTA 2PPXA 3F52A 4GQMA 2KYRA 3EODA 4ZMSA 5HM6A 2NZUG 4W5TA 1JHZA 1LCCA 1YIOA 1RZRD 2LYQA 1DCFA 4XLTA 2FLKA 4ZYLA 2LP4Y 4KZKA 4KQ9A 4RKQA 4JAVC 1GLGA 5JNTA 3QELB 4MS4B 1PRVA 1E6MA 2QZJA 3Q7RA 3B2NA 4KK3A 4L85A 3DGFC 1TJYA 1KMIY 1U2PA 5T7BA 2GX6A 2PLNA 3GT7A 4MGEA 1BDIA 1L1MA 1VPWA 3BILA 3LUCA 4MR7B 2PUEA 3SM9A 4ZJPA 4N76A 3PXPA 4MS3B 2LYKA 1PERL 2LYLA 1SD5A 1NERA 1QQBA 1LLIA 2JBAB 3EQ2A 4KNYA 3QX8A 4JA2A 1GUBA 3TMYA 1H9CA 4ETNA 2XI8A 3CLCA 1ABEA 1OXKB 2XIUA 3KLOA 1U8TA 5IEBA 1D5WA 1R8JA 2HINA 1DC8A 2FW0A 1LJLA 4MQFB 4PYRA 1KGSA 2BNNA 1P2FA 5TQ0A 4X4BA 4LX8A 1D2AA 2AYXA 1POUA 1ZH2A 4Y9TA 4RY9A 4PZ0A 3R1FA 4YLEA 3LUKA 3VNAA 4JASB 1BAPA 1SQ8A 3ZHIA 2IDMA 3IP5A 4MYRA 4Z4IA 3Q9SA 1DCKA 4O1IA 5EWMA 4KFCA 3TX6A 2FMIA 5CNKA 4OG2A 4YARA 3H5OA 4YO7A 2R1JL 3TB6A 2L8NA 1YVUA 1JH9A 4HNRA 2NT3A 2OR1L 4YP9A 5HSGA 4NV3A 1MB0A 2PAFA 4RK7A 1CEYA 3DGEC 1JDPA 4Z5HA 4YWHA 1NATA 2FSPA 4P1ZA 5D2CA 2GZUA 3DZDA 3DLBA 2P4UA 4XXHA 4MLCA 4X4FA 1AB5A 1YS7A 4MRMA 5DGCA 4S04A 2HSGA 4LRQA 1CHNA 4OBBA 4Q6BA 3EDCA 2WY2D 4IVZA 2H3HA 5FWYB 1Y1LA 2E4ZA 1QO0D 1R69A 4MQFA 1GCGA 4Z99A 2FEWB 4LE1A 1BA2A 1DRKA 3HM9A 2PIJA 1URPA 2XDYA 2IOYA 3A10A 5PNTA 1ZZ8A 1X2LA 3ZKCA 3N0RA 4CBVA 3F73A 3R0JA 2L19A 4KREA 3H6HA 4XFKA 5BQ3A 1P8AA 5BRJA 1Z18A 1NXTA 4Z59A 2L49A 3I45A 3C6QA 3LTEA 1WIZA 4IA8A 4X4HA 3N0WA 1Z16A 4L4UA 3CFYA 4RK6A 3I42A 4Z4CA 1USKA 4MQEA 1MIHA 4PE5B 2MQKA 4XASA 3BRQA 3FMYA 4KVFA 4F8JA 3FGZA 4F11A 4G97A 5BR1A 2LPMA 4EY3A 2HQRA 4DQDA 1SXGA 3CZ5A 2CSFA 3OMTA 4EYQA 3CKMA 3CG4A 3M9XA 1USIA 2ZAYA 5DKFA 3O2SB 3LUJA 3KHTA 1J56A 3CTPA 2IVGA 2H0AA 4OATA 1UTXA 3KZ3A 1SXHA 3LFTA 1NXXA 3HZIB 3N53A 3T38A 4MS1B 3CG0A 3F6PA 4XARA 3SNKA 3N6VA 4G0PA 1PEYA 2NZVG 5EWLB 4I6TA 4NCBA 4JCYA 1FSPA 4Z4GA 1IIBA 1Z15A 3H1GA 4JP1A 3T6KA 2R25B 3CU5A 4YGXB 2R48A 4IMIB 2MYTA 2KPJA 2MYPA 1DW9A 3LUAA 3HJFA 3ROTA 3GV0A 3G1WA 3K9CA 3RVPA 2L2QA 4MQEB 2PE5A 4H60A 4J1XA 3DNVB 1RIOA 1LBHA 2HPHA 3QLUC 5CNMA 3F7NA 1DBWA 3L1PA 1PRUA 1DZ3A 3EGCA 4N0PA 2MYUA 4WZZA 5CNIA 1JYFA 3ILHA 5EWMB 2WIUB 1U04A 3QEMA 3L49A 1JLKA 1YMVA 1EWVA 4H3HB 2MSWA 2VYCA 4PU4C 1ZPQA 3CHYA
chains in the Genus database with same CATH superfamily
1E2EA 2I1VB 2IPLA 2QSZA 4L4XA 4K9MA 3V8QA 1RJEA 3BEOA 3FCOA 1UODA 3IVGA 2HHHB 2IITA 2Q5LA 3I3SR 2ADFA 4PC3A 1KAEA 2LNDA 3OT5A 1H3NA 2QUJA 2XCIA 3Q3EA 1JHOA 1PW7A 2OZVA 1A9SA 3LUDA 1PZFA 2NXEA 2VUIB 2XQJA 2YX1A 1JV2B 2X3YA 2ZQ5A 4QTZA 1GP2A 4Q3CA 5CH3A 2Q3BA 2V7GA 4MIYA 4F91B 2JIZA 4U2EA 1E6EA 4MIEA 2VUUA 2G5TA 1ZMBA 4MI1A 4AW9A 3EY9A 3I6ZA 1TJ5A 4UEOA 1JZQA 1Y3FE 4LK3A 2A14A 2Z3WA 2B36A 4QPNA 3OUTA 3RUHA 3WJ1A 2WU0A 4QUGA 5DE3A 1YAHA 1J8QA 2JI6A 5JQWA 3HNOA 3KE8A 1JDUA 4ND8B 1WW2A 2Y05A 4YUZA 5BN1A 2ZITA 3SXJA 2VKQA 4E1VA 1MA3A 5BQFA 1VCNA 5JS8A 1T3TA 1OAKA 4Q9DA 4QVIA 1X14A 2X1MA 1F4VA 2IUOA 2G5PA 4LZZA 2C4NA 1G18A 5CEFA 3JQ6A 3QE2A 2AJLI 4HLCA 3AEXA 2GEDA 2HXSA 4ZQIA 1UP4A 2VDLB 5DLEA 1E1CA 1DV1A 3HCOA 4EA7A 2JLZA 2O8DA 3WGYA 3DXFA 2I65A 1SIBE 4WW0A 1P9WA 4W8HA 1E4EA 2B1GA 4XM2A 1N7HA 4Q34A 1PIWA 4RNCA 3FDFA 3VVCA 4E2XA 1FFWA 3T5MA 2AL7A 4MVYA 3U4DA 4K8RB 3VGPA 4B80A 2JLYA 4XJTA 3U7FB 1HX7A 3ZDEA 4HEA6 5TGZA 2CSXA 1XTKA 2Q2NA 4Y6QA 4ZVOA 1JKJA 3FSEA 1RYNA 5E1OA 1E6KA 5FV7A 3ISTA 4F5WA 2IY8A 3NHKA 4JQZA 2GD6A 2IF2A 4M8KA 1JKXA 4MWOA 4I4CA 2VJQA 4GGOA 2QN6A 2GUGA 1UJNA 2GA9A 4NYIR 4H7FA 2RJNA 4QLAA 5E9AA 3C3CA 4OP3A 2AF4C 3DOHA 1P1CA 2W83A 3GJZA 5FAKA 2F43B 2Z1MA 1ZCAA 3OU2A 1WULS 1A5TA 4WY2A 5L6LB 2ZB2A 1RQNA 1WUHS 3B20A 2OK7A 2WHPB 4F3CA 4R98A 1GSAA 3LC2O 3M1YA 4RF4A 4JEHA 6REQA 1A77A 2MDTA 2YV3A 1D04A 1GKLA 3C4VA 1MX1A 4IIXA 1HEYA 2AI3A 1L5FA 1V9CA 4B34A 1Y6GA 2XMSA 3MYRA 1G7CA 3C87A 3U40A 3RZZA 3D6NB 2WYUA 3JARB 3TOXA 4E08A 1IMJA 1JXQA 4WK4B 2O2CA 4R9VA 2D6FA 3VH3A 4DC1A 3A25A 2RG7A 2Z2JA 3H2IA 3V4VB 1DWQA 5A1JA 1HRKA 4GOKA 2DQ4A 2J09A 3IUYA 1T24A 4PS0A 2PXBA 1QIEA 1W6RA 3O38A 5AW7A 1MX3A 2QJOA 5JYDA 2XCJA 3IQIX 4TL8A 5T8KA 2HA6A 3JASA 1AS3A 3AVUA 4YP5A 1RZRA 3D5EA 5DK6A 2UVPB 4GM1A 4RIHA 3TRHA 2P1RA 1PDOA 1USUA 3MXTA 1T35A 3O2JA 5L53A 1Y37A 1KR5A 1BX1A 1O4VA 1QDUA 2PXXA 3BMNA 4C0SA 1XXLA 4K7JA 2HZBA 3FFTA 5COAA 1Y8RB 4P4GA 3BB3A 2JFHA 5FBZA 3T5BA 3TQOA 2Q1WA 5U9CA 2B5OA 1ZZEA 3CEMA 3DYIA 4HYTA 2VK2A 3LZ6A 5DHUA 3DMGA 3SAJA 4E5NA 3M4NA 5LQKA 3UO8B 4JC4A 5LN1A 3A11A 4P4UA 1STOA 1TJNA 4Y1RA 5H59A 3WLHA 3IEXA 3UFXA 2FWNA 1VHTA 5ALVA 1M6WA 4A26A 5JFTA 4KXMA 1B74A 3CXUA 3O4IA 4KN6A 2XCTB 2D5LA 5GMOA 4LHEA 1UKZA 1ZESA 2HNKA 3S5JA 1C3OA 4PYMA 4ZKDA 1APBA 2C3OA 1SZPA 3H11A 1SXJC 2ATVA 4JBGA 5JBIA 2VI5A 3LH5A 3ZI7A 1U9JA 1EFLA 4YAUA 2DUNA 2ZJFA 4O33A 13PKA 2BCGY 1KKLA 3D6JA 1TEXA 2WKWA 2X5NA 3P71T 3E9YA 3FD8A 4J0IA 4RTJA 4M55A 3TTWA 1KSJA 3AFHA 3BVPA 3IHLA 4XVHA 1SUAA 2DFLA 3LP5A 4I1VA 4J2HA 1J42A 1KARA 1EXVA 3FLAA 1D09A 2YDYA 1E4OA 5EHIA 4OGLA 3QYFA 3RCBA 1BMFD 4A4DA 3BERA 4OYHA 4JVMA 2OCGA 4YMIA 4Q18A 3STWA 4DA9A 1YBVA 1YFJA 2XUHA 1NVAA 3A9SA 4WZAA 1RW4A 5EIHA 4MHOA 1X39A 2JHCA 4GI5A 1VL0A 4CIDA 3NHBA 4P5EA 1QO0A 3F1KA 4IX9A 1PT9A 1ZG3A 4Z4FA 2GEUA 1OFUX 2BEWB 3L1HA 3CJTA 4NKRA 5HBRA 4GE0A 3TNJA 4K1LA 4LOHA 4MIOA 5FTNA 3JQPA 5TQ2B 4YHHB 2XMRA 1DFIA 2VS1A 4H08A 4IWNA 3UM9A 1HDZA 3DNPA 3NC1C 4BPRA 4NJEB 5JJIA 2FYTA 3R6TA 1NUSA 3SEQA 5EE9A 2WVJA 4J7XA 1UF9A 5BN5A 3RVOA 2DULA 4IRXA 4RA6A 3AMVA 5JD3A 2F1IA 3QOFA 3D31A 1T1EA 5B55A 4WOPA 2DWCA 2NV6A 2HBRA 3ZZUA 4Z53A 1PZNA 1WG8A 4IOLA 4LF5B 3C6YA 1R4MA 2XAUA 1SK9A 4JK3A 4HEQA 3T7JA 3TUJC 3MTQA 3P4YA 5CIWA 3WI7A 5KYUA 6ABPA 1H4QA 4P33A 3G9XA 4PZZA 4TRMA 5CFLA 4ER7A 3MT8A 4E31A 4K9LA 2R84A 2HD4A 3OZRA 2CLEB 3W4KA 1MO3A 1ZXBA 3JALA 4LMPA 4AWAA 4DDVA 5JCOC 3BDNA 5K4GA 3MRSA 3AR5A 1T0HB 2IYVA 4HDMA 1QVZA 1E3EA 1GFIA 2CUNA 3BEDA 4FYMA 1JFRA 3H83A 3ZWMA 2DX7A 4A6PA 1VL2A 2N46A 3KUCA 5KTOA 3MLFA 3PQ6A 2OFFA 3V3KA 2G1JA 1F1JA 2JGNA 1MB9A 1VKZA 3OPVA 1I3LA 4OFXA 1WOYA 2CLOB 2A5JA 4R2LA 3BTUA 2PX2A 3EASA 5LOVA 4MRRA 1FFXA 1PGNA 1U1GA 1Y34E 1Y82A 2XTNA 4ZHQA 4E94A 4EJSB 3DDUA 3EW9A 4DMLA 3R20A 4XSHA 3UJAA 4FE4A 3ZW7A 3HWX1 2UXDB 4JQYA 4RZUA 4ASUA 4N54A 3OWXA 5EKXA 4JYMA 2WF9A 4KXQA 1PR1A 3L7LA 2IU4A 2OV3A 1SXIA 4M8LA 4CU2A 3GK3A 3PNLA 2OSBA 2GN6A 5KMGB 1BQ3A 1E6WA 1X7YA 2X1HA 2WUFA 3FWNA 5DGTA 3GL9A 4DQVA 5IXSA 3PE4A 2GRJA 2RHMA 2DT5A 1QKIA 5HTOA 3ZV5A 3ITEA 2DOKA 4R7TA 1U0HC 4BNTA 1M6VA 4UHBA 1XXHE 2AN3A 3GRRA 3OJOA 1K7YA 1MVOA 4AF8A 2W11A 3GBPA 3TQRA 5GADl 5ALJA 2YFHA 3HWRA 4IMJB 1DJOA 5IAAA 1E1DA 4PFSA 5CJ2A 1TLTA 1SIWA 3HA5A 3L79A 4E2ZA 3DDCA 3A31A 5EXPA 2HC9A 3C8ZA 5FBRB 1M76A 3C7DB 2ZGVA 3T1OA 1A7KA 4G9EA 4IH1A 5CW1A 3TO5A 3TOVA 4DB4A 2ZI9A 2CL6X 4EJSC 3AO0B 4HFMA 4ROTA 3RW9A 4M7PA 2ZSFA 4MCHA 3CUWA 2A0FA 4IY1A 5EZYB 1TDJA 4W1RA 5B64A 3NBAA 3HO8A 4JV5B 1DELA 2EJCA 3N2YA 3IR5A 4A0FA 2BMEA 4G36A 2OHOA 1LK0A 1I8TA 2A33A 1QKJA 2B1IA 2FWPA 3BX1A 3EWAA 3PC4A 3UJ6A 5KMGA 1VLVA 2FZCA 4OOEA 3GJ0A 3HB1A 1EHYA 4RKFA 4YS6A 4ZPJA 5TPWB 3TIIA 2NO4A 4QM7A 2ZRJA 1WNTA 2D4HA 2ID9A 2VHJA 2AVDA 3OKZA 2YCLA 4DXHA 1Z13A 3OY2A 4DJEC 1AHPA 5KTMA 1WXQA 2VTBA 4K0KB 2ZT5A 1QLHA 1NC3A 1A8UA 1AZSC 1TJ4A 1ZITA 3ZDYB 4JXJA 4K26A 1UBHS 3L0YA 3WL4A 2I62A 2AEJA 2YWRA 3GAMA 3TLGB 4AJEA 4M99A 1V41E 4CEIA 1W581 1TMKA 3WKDA 3DBIA 4KXNA 3SHOA 2A88A 1QR6A 2H63A 3M3PA 5LFAA 5FT9A 1MEOA 2HCBA 5EZSA 1DO2A 4MP3A 3SFZA 2FWMX 1N2CA 1U9IC 1KQ3A 2B5WA 3INTA 3KKZA 3KZMA 1WTCA 3QITA 1C9EA 5FLYA 5TQJA 3CC8A 3K73O 3P2JA 4LHSA 1G7TA 1U2SA 4IIHA 4MWTA 2JLBA 4OHCA 4J1WA 5FPYA 3SZUA 3H2ZA 4BNVA 4NE7A 1KKUA 5LNK1 3Q12A 3JATB 1SVWA 3QFSA 3EIEA 3HBJA 5IC6A 5THXA 2GZDA 2Q8NA 3DOJA 4RJ2A 1IQRA 2BFEA 5JIBA 3RC2A 1CZRA 2KYRA 4JBHA 3GELA 5ALZA 3G7SA 2BV3A 1SKYE 4JLSA 3H5AA 4Z7JA 1JHMA 1T6XA 1N2ZA 1XYGA 4Y1EA 3A2KA 5EHGA 3KJQA 1XTUA 3NAQA 3HJRA 1PRVA 1X7ZA 2V58A 1G63A 2IK8A 4KDRA 4N0MA 1V4VA 4WWHA 4HQLA 2WU4A 2D1QA 1M6HA 1M9NA 1EFHA 3CCBA 2PUEA 2B4QA 3OF5A 3SFVA 1XTPA 5EHZA 4J7UA 2IWRA 3C2QA 3DBRA 3ELUA 2C7BA 5EL0A 3GLSA 4TYPA 3P9CA 4W82A 3S2ZA 4JA2A 4XM0A 4IX1A 2PPVA 4W5HA 2FDXA 5E0OA 3FSRA 1FDUA 3CLCA 5D6NA 3IBSA 4LA4A 3VZRA 2V59A 1II9A 5DSZA 3A4MA 2G25A 5E3HA 2FZKA 4JMPA 2F9FA 3HFGA 1HURA 4G8DA 4AUEA 4EBBA 3A6JA 1BD4A 1R0BA 1Y48E 2EWMA 4GZ3A 4OXXA 3T7AA 1BAPA 3GAFA 4RBNA 3VOTA 2D2EA 1U8EA 3DYVA 1E5TA 4PR3A 5EZ5A 3FTDA 4C76A 1T2FA 2YTZA 1YFLA 4ZICA 2ISSD 3ISVA 1L7OA 2GNOA 3DEYX 4TWAA 4FBMA 4I0WB 3ZH2A 1QRSA 1MB0A 4LOLA 4C3ZA 1SIOA 3KSRA 3LM8A 5GJVC 3H2JA 4B43A 3CPEA 4BFYA 1RZ3A 5M2QA 1DRVA 4OP2A 4YUVA 2IUYA 3DZDA 4ZAZA 5INTA 2J9RA 4FX2A 2IYQA 1WB6A 3ASVA 2O07A 1AB5A 2XVMA 3HJAA 4X1KA 8LDHA 1ZXXA 1WHTA 2GK6A 4Q3KA 4GPBA 4C01A 1H9BA 3ESYA 1R3UA 1V3UA 1P0MA 2VCYA 3B53X 1QO0D 5HHTA 1JQKA 3EZXA 3UMYA 2DUUA 1J8MF 1D7AA 1E1QA 2GDZA 3LQXA 1L7PA 2IOYA 2WBLC 1WWKA 4CM6A 1SWVA 2W2TA 4TVKA 1I2BA 3WNDA 5AVYA 3S70A 5H9WA 5HG0A 3DL4A 2OBNA 1ZGHA 3IB3A 1ECGA 3H1AA 4QQRA 4YPFA 4C7OA 3WLAA 5EKSA 2G4LA 1Z6XA 4V1CB 5HIAA 5J3JA 1E3JA 1MIHA 2WAMA 4PE5B 4DNPA 3D6FA 5IDWA 1L4NA 1XR3A 4O3MA 2H1LA 3PUJA 1HI9A 4KVFA 4YRDA 2PLWA 3GJTA 4GUDA 3JZDA 4TMTA 4ZAGA 5BPHA 1SOVA 3OQPA 2XW6A 3T7DA 1KR2A 4RGQA 4OUDB 4K6GA 4EYQA 4C6HA 1U3DA 1PR5A 4L0DA 2Z1NA 4DJ5X 3ZK7A 3PDCA 1PYGA 3R7FA 3UT0A 1CUIA 3WTBA 1VKHA 1FRZA 4RZXA 3I0MA 1GQOA 3T38A 1QOQB 3O8QA 4ZYVA 3QE0A 4E51A 4HNUA 1YRHA 1JU9A 2O2SA 2FMXA 2YYAA 1E0SA 3MWEB 3U26A 3ACBA 4D7AA 1PDWA 3D3WA 1Z6GA 3PDIA 5ITZB 2FDCA 5DYIA 1GRQA 2QPOA 2FMUA 1D6MA 3CO5A 4RVHA 4UJ3A 5KJ6A 1YOVA 4M0MA 3V7UA 2Q7OE 3T3MB 2FSHA 3HPRA 1GLNA 3CLTC 2XKBA 1ENOA 4Q21A 5KCZA 2H4JA 1Q84A 4JT4A 4DLUA 4ACBA 3Q8WA 3AONB 3SDBA 2PWAA 2W5UA 5TVKA 2ZUFA 1FFBA 1Z4IA 3FBGA 3G0GA 2J9YB 2VJBA 4MDYA 3DHYA 3RTGA 3FNBA 1MRSA 3I0ZA 3WB2A 5JZBA 1NRWA 2VBIA 3F3SA 1SQ5A 3L49A 5JMWA 4TOIA 3A6LA 3O9ZA 1WXHA 1X80A 4EB6B 3BXOA 5JVDB 4RNDB 2WWIA 2EKBA 3HP4A 2ZBFA 4O2LA 3N74A 4XQ0A 1A8HA 1CIPA 4MAFA 1GKYA 3JZAA 3KR0A 4LSGA 2JFZA 2EHDA 1N6LA 1CS0B 1U65A 4I6JA 5KNBD 3WMXA 4CEJB 3WL6A 1W0JD 1ZPDA 2BFEB 4Z49A 1RE1A 3Q2IA 1FFHA 1PW5A 5CDUA 1UT5A 2VR1A 4KP7A 3IIIA 1ZGCA 4G4JA 2IL1A 3C8MA 1PHPA 3DZHA 3HRHA 4GI3A 4LZAA 1SC9A 5F2KA 5G1NA 5TGDA 3SQLA 4NL4H 1BFDA 5A5VA 5KPJA 3PEWA 1M5UA 1OASA 4B2PA 1AQUA 1D2HA 1G21E 3QBDA 4FGLA 5GGYA 3AEQA 1XMOB 2JGAA 2JCBA 1JAIA 2REQB 2R2AA 5CFPA 1I3OA 2B9VA 3TI7A 5L4NA 4EG8A 2O8FB 3K2EA 3PUIA 4QU8A 5GV8A 3W9YA 4TQAA 4PU0A 2OYCA 3T3NA 4YRBA 4P4LA 4PSKA 3PDHA 5ILOA 1ODFA 3B48A 4RVCA 2Q0QA 5TS3A 1NW7A 3UAOA 4C1NA 3HUTA 4POAA 4Y42A 4URWR 5HTKA 2D0DA 2QM0A 3ETDA 4OB6A 4OIMA 3MTJA 1XEAA 1E77A 5EPOA 2POQX 1UQUA 3UFXB 4MYTA 1FZTA 1JVNA 3ZCUA 1KIMA 4ND1A 4YT8A 3FAKA 3A9CA 2XT6A 1KEEA 2XMZA 1P7ZA 1D6NA 5J63A 1N8NA 1G7RA 1YK0A 3ANLA 3O90A 4AMUA 1HFKA 5FI0B 4W5RA 2Z2XA 3TOSA 2QR3A 5JPCA 3HR8A 5KWEA 3PNBA 8MHTA 1GUAA 5JVDF 4LGYA 1KNXA 2HSEA 5CU7A 1LJUA 4ZOBA 1B6TA 1EP1B 1WSBA 1KQOA 1AK1A 4KR2A 2IH5A 3S0JA 4O0LA 3RF6A 4RA6B 1HORA 3F9RA 2C99A 5C31A 4KXUA 1EZ1A 1RR6A 3EVNA 3IPCA 1GGHA 2JF0A 1UUFA 4YLYA 4LDZA 3JTEA 1MQAA 3KT3A 3HZOA 4CLXA 5C37A 4D26A 2RHBA 4M9CA 2VN8A 4BNYA 4Z9AA 1GM5A 3VPAA 1UH5A 5A4MS 3EXIA 4KRYA 5ALFA 2EG9A 2Z95A 1H2YA 4KB5A 4YCAA 2XCRB 4BFZA 3W4IA 4Y2JA 3OT1B 2HRZA 3AFOA 4COKA 2PTHA 1I01A 2QUBA 1S5PA 2Z4RA 5FI5A 3G2HA 1NR1A 2Q6LA 4HWRA 1AO0A 3RUAA 1WPXA 3I2JA 5DM4A 4F4JA 3NOOA 3RRYA 4IG4A 3B6ZA 4D6XA 4IRUB 2CVZA 4E7OA 5JH7B 1SVNA 5I9LA 4F3YA 3OOJA 1UZAA 3U3WA 5LZ4A 5G0TA 5HCIA 3FFWA 4AO8A 5D5PA 5CAEA 3UW1A 4GD3Q 3PFIA 1P60A 3PQDA 4GI2A 1NOIA 2FPMA 2RKBA 3HKBA 4ER0A 2IW1A 1E6UA 5I51A 4QREA 3FHCB 2WI8A 4CL3A 4F06A 4GZ6A 5J4VA 1MV5A 3UATA 3W2GA 3AUAA 3TD9A 1XRMA 1XZFA 2VF2A 2WSYB 3EF3A 2LCQA 1UP6A 1SBQA 1OWPA 3KEOA 2IZ6A 2WIDA 4EB0A 5BNZA 4CM4A 4QDOA 3KFVA 4MWDA 5AYVA 2HO4A 4O2BF 4PIPA 1RJDA 4AICA 3UV7A 4E6EA 2WB2A 2XT0A 3S29A 3H05A 2QSYA 4AG6A 1ZW1A 5L45A 4MW5A 1SQSA 1Y6QA 2XOXA 3DKKA 4XEUA 4I5FA 1FTQA 2VJMB 1F20A 2BFNA 3VR5A 4DHWA 3D02A 1P61B 3PPWA 3GDFA 4HT3B 1ODLA 1R9JA 3ESAA 1Q1BA 1G38A 1NW8A 5C8ZA 1V7PC 1KMHB 5HJEA 5F9FA 4I5EA 4C0XA 2J59A 1KJNA 5F77A 1CIVA 3S55A 1PRAA 5D7NA 4E3ZA 3DHNA 1JDBC 1I51A 1EA5A 4OHXA 1Z35A 2C0CA 3PC8C 4JC5A 4K9DA 1DULA 5JLJA 3QENA 3W2FA 2PJDA 1YQUA 3HDVA 5CM9C 3UAXA 5TF0A 4YV2A 3AESA 1FUKA 2JI7A 4WNAA 3E3MA 4QQKA 4RJTA 3MHPA 3STTA 3U4MA 3GEEA 5JRDS 1GRNA 5FF9A 1YZQA 1QG4A 3BMOB 2B8JA 4E6PA 3OJLA 4KO4S 3K71B 5LXTF 3KQUA 4G1CA 1GNVA 5AK3A 3I2HA 2AC4A 1M2HA 1ZSVA 3AEZA 1RQPA 2CHQA 1I9CA 4Z86A 3WYEA 4WBNA 4OI2A 1G1MA 4OMUA 1O2DA 3LSTA 4QU0A 1Y4ZA 1N92A 2OGZA 3DTVD 3HCDA 1MAVA 5DB4A 5K3SA 3VHLB 4V1CA 3NALA 3CN7A 1OCTC 1DE0A 2BFMA 2INGX 1H2HA 3CEPB 4PF1A 2Z56A 3KDAA 3M81A 4R31A 5TJ9A 2V0NA 4F5DA 2OVFA 1DAPA 2Y4OA 1MF7A 2O7SA 3EXEB 5CA1F 1U99A 1RYDA 1ZGGA 2D5BA 3FDIA 1GLVA 4LWPA 3IT3A 4QRHA 3A1CA 3DLPX 4RLHA 4XWKA 5LQRA 4WKPA 1SQFA 4DMFA 3BGOS 3ZCTA 4R9RA 1DSSG 3M5CA 3IOYA 3KPWA 3H84A 5B37A 4RLQA 4PAQA 2H1CA 5L8VA 4DR5B 2QL5A 1GL3A 1RFLA 3F2IA 3F5QA 1QP0A 2QR5A 3SJ7A 4FC7A 1U6KA 4ZODA 3ACCA 4B85A 2JIOA 1CVLA 3KDSE 1XPOA 5K4HA 3K4HA 1BVHA 3OMWA 2XE8A 2YOFA 1W29A 2C9CA 3S2IA 4BO9A 3FNRA 4EVRA 2MTBA 2UVQA 5KYKA 5BW6B 5IX8A 3AUTA 4MR7A 3RGGA 3WB0A 3ISJA 4B4KA 1MW8X 1SUSA 2ZWOA 3JD0A 4CV1A 3D4PA 3WWYA 4R84A 4AYTA 3ZWDA 4WA7A 3R5JA 4KMSA 1HV8A 5KAMA 5LB4A 5AJWA 3RC9A 3SOZA 4BBPA 4EF4A 1GG9A 1QDLB 4FBGA 1NAIA 1NBMA 2C2ZA 1JFFA 2O6LA 3B1WA 1HYEA 3NHRA 4NICA 1UC9A 4XUGB 2DVMA 2HHJA 2XVXA 4KNWA 3I37X 5F12A 3SC6A 4MKXA 3MNFA 2CMGA 1ZRHA 3QQPA 4PZUA 1T5IA 1DV2A 3GJXC 2BP7A 5JADA 4RS3A 3ZW9A 3CMMA 3BD9A 3UXHA 2OL4A 3BCRA 2O5VA 3A9RA 4AY2A 1EFTA 1D0IA 2PMKA 5CX1B 3REQB 3U49A 3ZDQA 3SBEA 1QHYA 1YOVB 1X8LA 4R16A 5MGBA 1RPNA 2P27A 4L0MA 1NYQA 2G82A 2L17A 1ISRA 6AT1A 1UBMS 3DE5X 3E27A 5GONA 2FPIA 1U8XX 1AKNA 4FGSA 3I9MA 1Y7HA 4JZKA 3NORA 4L02A 4L8GA 1QTRA 1Z06A 3FNIA 4J0HA 5DJ5A 3QXXA 2FUCA 1NQTA 1Q2XA 1WMBA 2OZEA 3KQTA 4L6AA 5TSDA 4DPKA 5F23A 3F49S 1VL8A 2JLAA 2C58A 2KBFA 4QRDA 4F2HA 3FPGA 3QWGA 1V9SA 4HDSB 4AWXA 2YWXA 3ZHMA 4MW0A 3SIXA 4M0LA 5SICE 2M6LA 3HRKA 3EZNA 5EZQA 1E3OC 3FLEA 1I33A 3SX4A 3TW8A 1I4EB 4X8HA 4UREA 6YASA 4RZ2A 4NCKA 2XBMA 4DR6B 1JFLA 1X1QA 3NBZC 1XJWA 1UMBB 1ZNZA 1MDFA 2YFKA 3L01A 4P3OA 4C0JA 3P32A 4AF6A 2EX0A 3MJEA 1HE5A 1WDWB 4ZTZB 2B8NA 1BRMA 2EZUA 4QNNA 1OC4A 3NEJA 3U6BA 3SC2A 1QWSA 1KZ4A 1ZICA 1NTRA 1JLLB 3B3JA 4BATA 1WP4A 2HMAA 5I4KA 3H99A 3LFUA 4B48A 1QCCA 3HUEA 2FRVA 1J0BA 2YMLA 1IBCA 3L04A 4YPOA 4HRAA 4GP6A 1XZDA 1W36B 4RTPA 2AFVA 2ZR9A 3ROGA 4XWYA 2QG6A 3WFZA 1OU0A 2CXNA 1TVCA 4ZO7A 1GUZA 2JHPA 2Y1OA 4DVGA 4ED9A 3RC8A 1GTL1 2BFCA 4WERA 4IGEA 3FUVA 4KR7A 3F5FA 1CY7A 4FFNA 2EJBA 3ITKA 4GW3A 4L75A 5E1BA 4ZV7A 1ZZ6A 1M34E 5BN3B 5L40A 1L1EA 2IRWA 2Q0XA 4GAEA 3T3GA 3ZXIA 1NW4A 5KQRA 4NBWA 2JGJA 1ULTA 2C0PA 2Y6VA 4HQ0A 4NABA 4B6EA 4CTJA 2XB2A 4ENUA 1PT6A 1BNCA 1JWAB 2B1QA 1NSTA 3ZVMA 2F8SA 3ZK9A 1XMJA 3GJ7A 3OPYI 3WHLA 4KTVE 3PHGA 5JPIA 1X9HA 4UM9B 3U4IA 3NHPA 3TL3A 4ZU3A 1US8A 2WJVA 4JLDA 4O0MA 4FZRA 4IQ0A 3AP2A 3G0DA 4RFSA 1OI3A 1W5BA 1M2VA 1RHJA 1Q17A 2CNWD 2QMZA 2DY1A 2FEOA 2R00A 3HGQA 5I01A 2ZJ1A 2OO5A 1NJ5A 2H1FA 3H9EO 3WGHA 3LHIA 4MS4A 3WQRA 2WPDD 4MZXA 3LISA 1RRFA 2JIZD 2TMDA 5PGMA 1H2XA 3NDJA 4IP0A 1RLTA 2IELA 1N1GA 4AMBA 2WKQA 2JZOA 1AUPA 2NUAA 3QE3A 5IC5A 2QY9A 5A71A 4CIAA 3EPJA 3VU1A 3D8HA 1TFRA 2FPUA 4XWGA 2IX9A 4W63A 2X0KA 5CURA 2X14A 2GPTA 4BAZA 4D3FA 1IN4A 2PT7A 1ZU5A 5ALEA 1N9ZA 4KPGA 1LCCA 4N7JA 2VT7A 2J67A 4M86A 1JPVA 1U9YA 2VDMB 1NRXA 4LYGA 2OPBA 2WJIA 4KQ9A 4H1TA 2FZLA 5MFZA 3U7GA 1ZH6A 2ZJ4A 2OUKA 4BNDB 4L85A 2F3QA 1J0AA 3SS7X 3DGFC 1MAWA 4RHXA 4AUKA 8AT1A 4TYWA 1B23P 2A86A 5K4AA 2AR7A 2BHRA 4GBMA 2HPZA 4RSMA 3LUCA 3COPA 3TD2A 4DCCA 2NU9A 2OXRA 2WKPA 3W79A 3CRQA 4HNHA 2QQEA 4RVDA 4XM1A 2ZR7A 1LLIA 5EJ7A 3CNNA 3EQ2A 2ZYSA 4HLQB 4KE7A 2VPYA 2PHZA 4MB6A 1E79D 4NZ9A 1J2YA 1O5OA 3WGVA 4ETNA 1SJ9A 3KLOA 5HILA 1J20A 5GAJA 2UZIR 4LTMA 2J9FB 2FW0A 1FMFA 2GPJA 2IXGA 4PYRA 2P9YA 3I2IA 3MCUA 2V9ZA 3UC9A 3BIJA 1M3SA 2QENA 5CDGA 2A8YA 1I3KA 3C6KA 3LGXA 2PSEA 4R9UC 3WSTA 3LCVB 3AJDA 2DWUA 3PHHA 4EYEA 3IP1A 1U8YA 1DXHA 2O06A 4JASB 3ZXXA 1CETA 2IS4A 5BVHA 3H5NA 3OE7A 2F1RA 1VGVA 3OZVA 3WS7A 3G0TA 2JHFA 4PZLA 1JQAA 4KFCA 4KQJA 3KL4A 3LBFA 2K2WA 1QDEA 3S2GA 3WRXA 1KA9H 1ELOA 1OYYA 2YW2A 3DAHA 3TBKA 4YY3B 4IZ6A 4KO3S 1VTKA 5U4QA 3L18A 1ZGJA 2ETVA 3KAJA 1I6MA 2RC6A 4MOWA 3BB4A 2NTNA 3HFSA 4YWHA 5H5JA 4YDQA 4E4RA 1TYBE 3QPBA 5T6BA 5K05A 1T4DA 3KK0A 4FVTA 1GDHA 2FH5B 5CBPB 5K01A 1I7DA 1Y98A 3B9QA 5DXAA 2QLTA 1PZMA 2BAGA 2PL3A 2QHXA 5G2OA 3QMVA 1P5FA 2Y1KA 3IP3A 2HCTA 1DRKA 1G6KA 2HRDA 3TNLA 4JI4B 4EL0A 4HGZA 5FTWA 3F73A 3WB1A 3LSYA 2NVUB 2MSEB 2A4MA 2FOXA 4KI0A 4QATA 3WIUA 2AX4A 2XT9A 1I5RA 2JEYA 1LCIA 2YZMA 1OXVA 3NTUA 3V4SA 4AULA 5JJCA 5IAGA 2PKWA 3AB3A 1R0KA 2FX2A 3G3EA 3GLRA 1UJMA 2FPGA 4FHCA 5I6DA 4ZCQA 2W0MA 3J81k 5EOVA 1IOZA 1HO3A 5EP3A 4CQLB 3RTEA 4A3SA 2Q8QA 4UTRA 1G1AA 2YQ5A 3CZ5A 3M7IA 4BU0A 3RS9A 5FLEX 2AEFA 3GN1A 4Z0PA 4AX8A 4P3NA 2C5SA 4JBNA 1PWXA 3KQQA 3CURA 4LHVA 3NC4A 2BFAA 4RPGA 1RM5A 2JAQA 3E9EA 1GL9B 3ELBA 4URFA 3MINB 4YBRA 4M2LA 1VGQA 2A9VA 2EBUA 2VWGA 2A94A 1MPTA 3FBWA 3NB0A 4DCMA 4PO8A 1YB4A 5KX5B 5ELLA 2QRPA 3DJYA 4QC2A 3G9TA 2HV8A 2LCIA 3OOWA 1IRIA 3K2BA 1N77A 1JTVA 4CUKA 5HOEA 4B75A 3F4LA 3IH5A 5FUYA 3H1GA 3S2SA 5JO9A 2VXYA 3N8KA 1POWA 1G2OA 1F0YA 4A5SA 5LQMA 3PQ2A 1HE2A 2OHJA 3HJFA 3TR0A 3VKGA 1A82A 3GV0A 1A9TA 5EXTA 2P9JA 2VP9A 3EDYA 4LW8A 4NZYA 1NJSA 1JRLA 3MLBA 2PY6A 2WUGA 5EERA 1ZUIA 4BU1A 4BLRA 8ADHA 3OJFA 1NW9B 4M9QA 5I5EA 2XDQA 4OXQA 4DYHA 1ZI6A 2ERCA 3KR9A 1K4MA 4PLFA 3DXXA 3HB4X 4JLMA 4E15A 2XNDA 2J5BA 1AH2A 5IBRA 1U0JA 3L6OO 4ABTA 3N0XA 4BTLA 3H8SA 4HWKA 5IBQA 1JJAA 2PBRA 3IODA 1WLSA 4XE5A 8ABPA 3A6DA 3CCCA 1KYQA 3FH0A 3KWJA 3UTDA 3LFPA 3AJEA 3O8CA 2IZ5A 1XFAA 2XGGA 2C4UA 3I8SA 5BQOA 2O19A 1QGYA 3KYIB 4OB4A 2V6MA 3PDJA 2HWWA 1FTYA 3F5MA 4H7EA 1YB1A 4KLAA 5LD2B 3IUSA 1DJPA 2CJYA 2GRAA 3SYLA 2N42A 3FZYA 3VI3B 4JOCA 7REQB 3CVYA 1H4VB 2QW8A 2HDWA 1H8ED 2R4QA 3FY4A 4D42A 4M8NE 3LHFA 1QLWA 2IOFK 1NDQA 1RBMA 4JJKA 1IJEA 3HBMA 4WCVA 3F96A 3RVMA 1NUHA 2ADMA 1JLSA 2IGTA 4J6FA 4BNDA 4YRJA 3O3NB 4FE7A 1TT7A 3ZHOA 4RZSA 3COJA 1K5HA 1R5NA 5IVDA 5T4BA 2XTJA 4XB6B 4YRIA 4D99A 4P92A 4UUBA 1NR7A 2P3OA 4AKHA 5DNCA 2VTDA 2GRLA 3E18A 3DHEA 3LL4A 1YBMA 3PKJA 1DMSA 1YOBA 4HRYA 1L9KA 1C1YA 5IDYA 1DKRA 3FZGA 5HFNA 2QZ4A 5CGQB 1WXIA 3F1LA 5KAPA 2GN1A 5G3ZA 3WOVA 1T4MA 5GV7A 4TMVA 3RS0A 4CLOA 1VMAA 5M34A 1RMTA 4G85A 16PKA 1RHQA 1RIFA 3PRJA 3ZZNA 3PUXA 1ZSNA 1E3DA 3KC2A 1IE3A 2WSIA 1Y1SA 3PGJA 1RI5A 4LJKA 5T6MA 2YN2A 3K31A 5HKOA 4H15A 3WZ2A 1M2OA 4QOJA 1MXFA 4FDUA 4X95A 3A0RB 1IHPA 4GYYA 5JNUA 1JFSA 3CPJB 3DM9B 2CNBA 1U0OC 1WKCA 3QVWA 1JT2A 1NQAO 1DWUA 3LBNA 5FFNA 1UFQA 2FKAA 2Q8PA 5AKYA 3F2VA 3RAGA 2V65A 1M73E 3KYJB 1QG0A 2GHIA 2EP7A 3H2BA 4P81A 4R81A 4CKWB 3SVLA 2OCDA 2R6ZA 1JR3D 4D44A 4JGGA 2ZYHA 1A8PA 4MRPA 4NZZA 2QBYA 3JYOA 1T9ZA 3LLCA 2VSQA 3B5JA 4LBWA 1GAWA 1YU9A 3H7AA 4OXYA 1W1UA 4LI3X 4I4TB 5GAHi 4PWZA 4YAEA 4A0RA 4OQ4A 4KNVA 3O8OA 3DWGA 2HWYA 3AV3A 3V7NA 3JQBA 2PS9A 1E4EB 1SZDA 2FZ4A 1ZH8A 2BDUA 1NBEA 1ECJA 2HZ7A 5K0SA 1AMNA 1W34A 4M3NA 4OAOA 5ADVA 1L5QA 2H85A 1H93A 1RWBA 3LPLA 2VPWA 3H1PA 3RQSA 5LYJF 1K7XB 2Y0EA 1GGNA 3INGA 5BWMA 1F3OA 5IZCC 2BKAA 4HFJA 4E5KA 1YQTA 1ZP6A 3HJTA 4FR2A 4IBOA 4EVSA 5JZMA 2GZ3A 1CRLA 4G23A 3U9TA 1MGPA 5C80A 1RCFA 2YIJA 3FGPA 5HKKA 3K9WA 1R6VA 4NPAA 4PYOA 4JLKA 2J3LA 3R7DA 5HS4A 3H9CA 2B61A 1L9XA 4LY9A 2AQHA 3JY6A 4WN9A 1SA0A 1V4NA 1J24A 2NN3C 5DVZA 5EA2A 3RARA 1Y8QB 1Z0AA 1Y89A 1FU7A 1GSIA 1O57A 2B2CA 3QNWA 4ZCTA 1WXXA 5C1BA 3WGMA 2J0VA 5KWIA 1C9MA 1YJXA 4KFTA 1U3TA 3BZBA 3C3AA 3I5MA 4YG4A 4UNQA 2B4AA 1GITA 4V3BA 1BE6A 5BRAA 5G1PA 3DL7A 3NWEA 5BUSA 5IZCA 3SS8A 1CQIB 1P7CA 3BRCA 5FWXB 1YE5A 2J33A 1HYGA 4QPZA 1JPUA 2GBIA 1M72A 1T4GA 1DL5A 3UXEA 5B4TA 2V8BA 2VQEB 1FZQA 4DLAA 2DPLA 1ZJZA 1GGJA 1P1KA 1QIJA 2XIQA 3MQFA 4KX3A 3RYFA 5DP2A 5JSHA 4J0DA 2VDWA 3GQBA 3FGNA 4KMRA 5A06A 5ITSA 1NG9A 5A02A 5F7ZA 2I78A 3E82A 1NOKA 4QJ5A 3U4HA 1MNQA 3D5TA 1UPUA 4OPMA 3WGJA 4HDSA 2H4WA 1HDIA 5TXGA 3WLKX 1GZ4A 4RHTA 1Z7WA 4XR9A 2OV2A 1LBQA 3DD5A 3FF4A 1E3LA 3W5AA 4FNGA 3NTQA 1W59A 4KQXA 5JAZA 5MFPA 3WLSA 1EX6A 4CIBA 3I61A 2F2TA 5HKLA 2CE7A 2AXUA 2YYSA 1KYWA 5IPFA 4EB8A 2E5WA 2B2NA 3G1UA 1JDTA 3GP5A 3CN9A 1XA0A 4HUJA 4MVJF 4PM4A 2C00A 2O23A 3N39C 1UZNA 3A36A 3AJ8A 1Z3CA 4H4DA 2OXCA 4GXQA 2OFWA 1NBHA 2SHKA 3FI9A 3PKIA 4AQDA 3BSWA 1JH8A 4TM8A 2PWYA 2Q1TA 1HFEL 3DUWA 1EP3B 3W7VA 4BYGA 1QU3A 1KF0A 3IA2A 4K0RA 1KETA 5SYNA 3VNBA 4BCCA 4CM1A 3KKLA 2FK7A 2QJRA 1LI5A 4TMWA 5L6MB 3K3PA 3IOEA 4RY0A 1LDGA 4OP1A 4UDXX 5JROA 3TQFA 1FVOA 2VF8A 2H5EA 2FZ5A 3BFVA 3UNXA 1ZVKA 2W6IA 5IJXA 5BO5A 3U62A 3W8DA 2QI9C 1O8BA 4UOZA 4PU3C 1W4AA 1J33A 2QMUA 1GEGA 4X92A 4BTEA 4PBSA 4MQBA 3EMVA 3F3YA 1BFKA 1I2CA 2F1KA 1RHRA 3AF1A 4JJ8A 4DDTA 4P6VF 4FOTA 3VX4A 1THGA 1JQLB 2I29A 4GH5A 5K8JB 2IXDA 4K9SA 4EHNA 4FMPA 4UHHA 3A32A 4KE8A 1DLIA 1CQWA 4YQYA 1G4AE 3VYTB 2I4MA 3WDKA 3DMPA 3IC5A 2KX7A 3QX3A 1E1KA 4B2IA 1UPTA 3H4IA 3WXBA 1I6WA 2IEIA 3K1ZA 4Q9KA 3CRNA 4GDMA 1SULA 2YUTA 1P44A 4CYMA 1MR3F 3BRSA 3OCJA 3O3CA 1J5EB 2XWQA 4TL9A 2YWFA 2QUHA 3VPXA 1AKQA 1HG0A 4TXLA 1KYVA 5AOBA 4G0XA 2BR5A 4CHTA 5ICSA 1RBZA 2AFHA 4HC4A 3IUJA 2JLRA 1SCBA 2N0SA 1V11B 2NSHA 2YV5A 3BGVA 4XTCS 3IILA 3OKCA 2XYQA 5JAOA 5C5IA 2PM8A 2GEJA 4I14A 3CA8A 3DVAA 2CYBA 3QNUA 3MYYA 2YS7A 2QMOA 4GR9A 2ODBA 2I6FA 2VF5X 2MSLA 1RMYA 1YIAA 5E0KB 1CX9B 4D0NA 2DBQA 2ZR0A 4JVLA 4HB0A 5FOQA 3H5IA 3A1VA 5L3RA 3EIQA 1UBRS 2C4WA 2Z2KA 3KEQA 3P94A 1X8JA 3JXDL 1L4MA 1TCUA 2G76A 2GM9A 3AVQA 1LPBB 4AXBA 1Z9BA 4Y0NA 3ZLVA 2OP0A 2RMKA 1NQUA 3PD1A 1M7GA 2NUAB 4A82A 3IMFA 4RFSB 4LOIA 4MVWA 5DW3A 5DRTA 3E1KA 1AF7A 2Q29A 3GRVA 1K8QA 1THZA 1NTOA 3FVWA 5IUKC 1PLKA 4ZO6A 4DSTA 2AG1A 1QK4A 4GNRA 3V1TC 4BVFA 4D9GA 3O4JA 3UGKA 4E5YA 4V0OA 4GKAA 2PXEA 1ZMXA 2WMDA 3BG5A 4V0KA 5F5XA 5CG2A 2Y77A 1CQJB 1RMQA 2P79A 4ENWA 1LPSA 5J1TB 1JHYA 3OD5A 3ZYZA 3U81A 1OGYA 3B1JA 3KS9A 3O8BA 4P3XA 1Z0FA 2ORED 4R2XA 4B3JA 4ZQBA 2UZ1B 3HXLA 4U2FA 3L8GA 4LY3A 1RAAA 3G8BA 4Z0NA 3SY8A 1AQIA 1F2TA 3E7PA 2HA4A 4Q1DA 4X71A 5CP8A 3ROFA 1ODSA 2BI4A 3VGJA 5E1DA 5CLJA 2Q3LA 1NF3A 3UV3A 4MB2A 2QU7A 4RE6A 1R7RA 3FTCA 1ODKA 5E4FA 4ZAWA 4F56A 4NMXB 3D8TA 2WWXA 3TRJA 5ALPA 1NVUQ 4CLEA 2AFIA 4KQ6A 5AKKA 3REOA 2YZGA 3NIDB 5KYWA 4KXXA 4AURA 4TT8A 3KE9A 1C1DA 3LX6A 1W5EA 4DIOA 4FWTA 3DMNA 2HO5A 2YR0A 4TQUS 3T3HA 3WLTA 4ETMA 3ON5A 4N49A 1N6OA 3HSSA 4I08A 4U3JB 3CROL 2R6R1 2XMGA 1LTKA 2DTXA 2W70A 2RGRA 1QIDA 3BF7A 5AIBA 3K5PA 1O6CA 1F6WA 4IGFA 3ORFA 4P0PB 4EUKA 4LXGA 1M2EA 5IULC 3MUOA 1JHUA 1L3BA 4DV6B 2HLDD 3SJUA 2IV3A 1SQGA 4FEGA 2HMYB 4HJRA 4MW2A 5DHTA 1IEVA 1L4EA 4YB8A 1TL7C 5K0TA 2B34A 4G9BA 5CXSA 3MJHA 4LWZA 4LSZA 5F78A 3QWBA 4MCJA 2GARA 4UAGA 4U1RA 4UARA 4C0AC 2Q99A 3HA2A 3IMKA 4Q4DA 4FOSA 4X3CA 1N2SA 5D7BA 1ISHA 1N7IA 1P1RA 1O97C 3HACA 2R8ZA 3NHSA 1H3FA 3SLGA 3OE5A 2XE7A 1FTSA 3WYCA 2A5YB 5DGIA 3C3JA 3O3OB 4H27A 3UIEA 1V48A 3RUDA 4EOGA 1FW8A 2FMKA 3ICWA 4AP6A 5HWSA 1ZUHA 4N6OA 3DFKA 3B9PA 3TQSA 4MGIR 2N75A 1GR1A 1G8PA 3QHQA 1Q1GA 4LRSB 4CKBB 3N7TA 5C2JB 1XTBA 3EODA 4M6WA 3GOHA 6NULA 4OGFA 3OPNA 2QD2A 3R3YA 4KO8A 2PDAA 3UJBA 4NPCA 3W6UA 2IUFA 2FLKA 4XLTA 4G1MB 3G5TA 4G9GA 3CH5A 4REQB 4YJ3A 2ZS8A 4OU4A 4C5BA 5JNTA 1JR2A 5LA6A 3WHPA 1TJYA 5AKXA 1LK7A 1XLUA 4AMYA 1KMCA 3E2IA 4FU0A 1BDIA 1JDZA 1LRKA 4ZJPA 4MR7B 1PYDA 3T3PB 5C8YF 2PXVA 3OM8A 1R6BX 4N8DA 4QPDA 4Q4HB 1GPH1 1D1TA 1U7TA 2BC9A 5FL3A 1DARA 1E1QD 3AFNA 1ULAA 3GX1A 5JWRA 1Z6TA 5KVQA 3QX8A 5JJBA 1DZIA 3TMYA 1P6XA 2B4KA 4BQOA 2NTVA 4W7SA 1MOPA 2Q3FA 3B13B 5BY2A 2WNHA 4TT3A 3NAGA 4JI6B 3IIJA 3AHEA 4UZSA 3BD6A 1N2CE 4I8IA 5BXQC 5HPYB 1K5PA 1HSOA 3MFQA 5E2IA 5D86A 5FBVB 1AZWA 1LFAA 3URKA 2DQKA 1I2MA 1DKPA 2GJSA 1VPLA 3R1FA 2H11A 3IVCA 1YSCA 1Z4PX 2ACEA 2VNAA 4IFTA 4HI0E 2I7CA 1HMYA 1HYBA 2Y1XA 3LWZA 3RROA 2OB1A 2G07A 2DH6A 5EWMA 3FM9A 1JQBA 1FUEA 3GT0A 4DSZA 3FAZA 2XF8A 3CF0A 3NCHA 4BMNA 5KWJA 2QTVB 1Z82A 2FWJA 4BJ5A 5DP1A 3WKEA 2VK8A 3FXAA 2R44A 4YUAA 2JZCA 3PS9A 1WXDA 2CL7X 1KL7A 2BMWA 1XF1A 4ZU1X 1J09A 2VT6A 3AR7A 4DAEA 2QTRA 3TDNA 1TA0A 4XI9A 1E60A 1C30A 3HP1A 3VNSA 5KKAA 5G0WA 1DC3A 2WZCA 4UXIA 1OXTA 4GT1A 1NVDA 4UXJA 1LRLA 2V5UA 3C7CB 4A92A 1DFGA 3E4DA 1SOAA 3N0RA 4V03A 2G1UA 4B76A 4A36A 1RXCA 4MW7A 1P8AA 1N8TA 2LKCA 1PJQA 1FEZA 2G08A 2Q7XA 4AN4A 4DYVA 3EFEA 3ID6C 1QUFA 2GEFA 5DYNA 3DMFA 1USKA 2QLNA 4J2OA 5JT1A 3U60B 1E98A 5B3AA 4BE4A 5JYBA 3U56A 1E2FA 1T2AA 1UL1X 4NARA 5CFZA 2UZ1A 2PXAA 1Z0UA 2WDPA 1CFZA 3OMTA 2VHYA 3C45A 5JDIA 3U3RA 2OV6A 2R97A 3CVWA 3NIFB 3KZ1E 4R69A 2F1HA 3LUJA 4RTKA 1DKNA 3DCYA 3KQNA 3EEBA 1OXMA 1PUJA 4IKOA 5IC4A 1UOEA 1BCRB 4XWAA 2FPWA 4PSAA 4ZI7B 3AETB 5C8DA 4X8OA 4FSXA 4AXXA 4DMGA 2PSFA 2BZ1A 2EVWX 3LW8A 5KYWB 1YZNA 5FD8A 4ESEA 1A3CA 1AE1A 1U0RA 5CCBA 4FR5A 2GBCA 3LECA 4G56A 1X8XA 4WKBA 4I36A 5H81A 3LLUA 1SO8A 2XITA 4P2BA 4XJVA 1T9CA 3Q5EA 5LOVB 2MYPA 3GHHA 4G41A 4G1FA 5KU7A 3EPKA 1VI5A 1T5DX 1GAXA 2G5GX 4AQYB 4AZ3B 3INNA 2VP4A 3GC6A 1Z4LA 2ZRKA 3F7NA 2WAXA 4FGJA 4YTEA 4RMHA 3VV3A 4CMGA 3QU5A 3LDUA 3R74A 1PX0A 3EFBA 3W5BA 1GQQA 4TWJA 1FRVA 1QVRA 2BJHA 3L05A 3IL2A 1NURA 7YASA 3DOUA 3O94A 3QVLA 4XEHA 5AM0A 3AL2A 4AZSA 4DIBA 1EQAA 4C4SA 5A3JA 5DCLA 3LNCA 4DE9A 3L7DA 1N6IA 4Q1AA 4N5HX 3ZE8A 1DU4A 3PXAA 3E22A 1WD7A 4HN4B 2GK7A 4FS8A 3TD6A 4DV1B 5FWAA 3GJRA 4Y0VA 4JBLA 3ZLTA 4MW6A 3ZHYA 1Q21A 3SF8A 4DVJA 2QSUA 3K8OE 1YQEA 1QPBA 3CWZA 3VMFA 4YAWA 4WCFB 5KTNA 5KQMA 4G3XA 4DCGA 3DXYA 4LIPD 3TQTA 3ZW8A 4G0VA 5HZHA 1LBEA 4Q9LA 1UJ5A 1U94A 1BHJA 1Q1EA 4ZEOA 4HK4A 5JTTA 2OOSA 4D3SA 3VSAA 2BBTA 1JIVA 2PUHA 4V0MA 5E3JA 3WP0A 3P0EA 2XB8A 1W9HA 4PLYA 1LQUA 1QGOA 2ZB4A 4XYLA 1A2OA 1Z56C 3ILYA 4NAHA 1UK8A 2BBOA 1PJ8A 1HM5A 4QXPA 1TQHA 1XKLA 2XD4A 3OIYA 2EDAA 4NNPA 1Y7YA 3LY8A 4WESA 4B8ZA 3S7TA 1MEEA 1WCXA 2HV9A 4QHTA 4DIDA 4Z51A 2QTVA 5H68A 3VOAA 2J85A 2JFUA 3W5IA 3AKYA 2QR2A 3JVDA 4GMFA 4XDZA 1H5NA 4D41A 2PZJA 3FVQA 2C7GA 2R1ZA 1Z36A 1U3FA 3QFRA 4HTFA 4IXTA 4J90A 5SYAA 2LLWA 3ZXUB 3K70C 2FX5A 1V1MB 2XYVA 1D6SA 2PEZA 3GWGA 4C7JA 1T15A 4O2RA 1Y3CE 2M6KA 1A8QA 1ISMA 4MITA 4P93A 4IOJA 3UJPA 1D9ZA 1PEAA 2ODPA 3L1KA 2ZSHA 5D3QA 3HQ4O 4D0LB 4F97A 1GFWA 1ZVVA 4HG2A 5DCUA 5B1IA 5JXWA 2TS1A 4N48A 3H8VA 4F86A 4XJXA 1TMGE 5FTMA 3OZWA 3G0HA 4DMRA 3EXG2 4AJPA 1XMSA 4EG0A 3UG7A 3UFDA 4RXUA 4RL4A 5LMCA 2PA0A 2IE8A 1YA6A 1AK9A 1GZVA 1LNZA 1SHTX 3KQVA 3GN5B 4BTVA 1LPOA 1IQUA 1EB9A 3OO1A 4LYHA 4QEKA 1KY2A 3CUYA 4LKRA 2VHEA 3L4BC 2VSYA 1P2GA 1UK9A 2OP1A 3FA2A 1UEXC 4O29A 5H3CA 3TJZA 3VZBA 2OILA 3IKJA 1H5UA 1CUWA 2IHTA 5LZ2A 1CG6A 2VRCD 2QVLA 3PITA 5DI3B 1BD3A 3NFRA 5B7NA 2UUPA 1G5IA 1ZNQO 3OIGA 3EYAA 3PHCA 3PX2A 3TTVA 4EF5A 1CRZA 4RIFA 4TLLB 3RAPR 3PIRA 1HDGO 4TVBA 4MQ5A 3KEGA 5AIAA 5CA0B 2QT9A 3CLKA 5I47A 2B83A 4YONB 2DPXA 4ZP1A 2MOKA 4BS9A 3NUQA 1VIYA 4FOOA 1WBBA 2X22A 3PUKA 5D87A 4D4KA 2CUKA 2R1VB 3JR7A 3OH8A 4W6QA 4B6GA 4KHPB 3GLGB 1LS6A 1KDRA 4QLOA 2RJOA 3PPVA 4CR6A 3UVEA 3OMXA 4IJKA 4W9MC 4IHKA 2YVLA 1IHXA 5D5HA 4JSTA 4WNIA 5B1EA 4G5RA 3KVOA 1OY1A 2JH3A 2WD7B 1OZAA 5A3VA 3OU6A 4QUDA 1YR9A 1JFVA 5K20A 2C8VA 3PTLA 4WCFC 4BJ3A 2I4RA 4GWGA 2QUZA 5EIFA 1W52X 5CFNA 2WV7A 1H8HA 3E9CA 3HEMA 4RYLA 4D9EA 4R0MA 2I6UA 3I3OA 3UGJA 4DKJA 3C4JA 3C1TA 1J23A 5H70A 4WADA 1S3SA 2HF7A 1BGXT 1IUPA 1PEDA 2O2DA 3H2HA 3O92A 3PXCX 4O4LF 2ZK7A 3FCAA 4NBTA 3KKOA 3PRHA 2QRMA 4XSVA 1IK6A 5AUQA 5IT4A 10MHA 2O8BB 4KHZA 1TM7E 2W2MA 2WAYA 1ODCA 3DQQA 4YQZA 5CYGA 3AINA 3E23A 2PGXA 1A9XB 1OI2A 5K3EA 2ZWPA 4N7MA 1E7QA 1PBNA 3DQPA 4FYYA 4MV5A 1L5YA 2IZ1A 4R0VA 4EPXA 5AVJA 1WH6A 4WOJA 3U31A 3MILA 1N5MA 3I9NA 4FFLA 4RLFA 3WLRA 1I4LD 1A69A 2J5KA 1GT0C 2IHBA 4RU1A 1DLJA 3GLFA 1ZBQA 4JP2A 3U4CA 1KH3A 4IH4A 4B6OA 5F2NA 2X4IA 3OO0A 2HK7A 3EF0A 3C39A 4IZIA 2R60A 3HVIA 4JEUA 4BFTA 4HQOA 3Q7TA 4YR7A 1JL3A 3GRYA 1BWRA 4C4ZA 5FUWA 4CL8A 4H6WA 4EY7A 1WB4A 1YS4A 3PPIA 4OHOA 3SDSA 1J0CA 3FR7A 1F06A 2XEXA 2WJ4A 1Z2DA 2EZ9A 3RT7A 3L2OB 3KWLA 5JC1A 2M1XA 5AJHA 1Z68A 2GVNA 2W93A 3ACDA 4FEYA 5TX7A 3QG5A 2P8SA 3RRBA 3BMQB 4GQBA 1CF2O 5FPTA 3UJ7A 5HK8A 1JFTA 3C24A 3T95A 2HM7A 4FMBB 4F92B 1D07A 5AVUA 3PEYA 1UXCA 4QO8A 1OBFO 1XKQA 4GUAA 2QLJA 4LE0A 1V16B 3MUNA 4WGFA 1NNEA 1QC5A 4XRGA 1CY4A 2RONA 3AR8A 3DKRA 3VH1A 4HSEA 4AMGA 2EP5A 3AHJA 3H1FA 5JHHB 2O8VA 4US2R 2JGDB 1U1FA 3AILA 2HF9A 4P80A 5DNYB 1QRTA 3ZJTA 5KYNA 3L4EA 3DPSA 1EIZA 2MINA 1W1IA 5FP0A 2FQWA 3JYNA 4K9RA 4TV9B 1AUXA 2W00A 3OCCA 1I6LA 2WHQA 2X15A 2XIJA 3CTMA 1QTNA 3AERB 3IR6A 4K88A 4TVOA 3SJZA 3CECA 4I2VA 4U2GA 5KJ1A 1NP6A 2UVDA 2XOKD 3I9JA 3QW2A 4B6FA 4BQIA 1D2GA 5FEMA 2OSVA 2C2YA 2NU6A 4GMHA 1U7OA 1FVHA 2KBEA 4XIGS 4UM5A 3JVUA 2QLLA 3K9LA 5IUNC 3GEHA 4MRSA 1S3IA 1DKOA 5E6UA 3DLAA 3FOAA 1R0WA 3RTBA 5L3VA 1I30A 3I73A 5SZKB 3WYAA 5DI9A 4PYJA 4BZZA 4O4HB 3EZ2A 4G63A 5EJAA 1JSRA 3QP9A 3RRJA 3R4VA 4PINA 2XI4A 2WJPA 2RHTA 3FFBA 1TLLA 2KJQA 3P4UA 2ZT6A 4OJMX 4D3YA 4ZI3A 1QG2A 3EZFA 1P7WA 4C4OA 1KMHA 3T1TA 4EIWA 3A2MA 2BF4A 3SYRA 4BN5A 1BN6A 1YKSA 4X4IA 2KEIA 1XU4A 1G0NA 1GG2A 3BD1A 1RT9A 621PA 4LXXA 4N3BA 4Z4HA 2JGMA 4QXOA 1JIUA 4QUIA 4DM7A 3GFRA 3ZD7A 1K66A 1IVNA 1VG9B 4GR5A 2QWXA 2LXNA 4HWTA 1DBRA 3PR3A 4YAOA 1TM3E 2WEKA 2D0IA 2EFDB 2RAPA 5A4FS 3RU2A 2CCJA 3JWJA 1F2DA 3KAKA 1VJ5A 2CHFA 3C70A 2JGLA 5GJBA 3L7YA 3FYTA 4HS9A 3USCS 4NXMB 5HMLA 1DWKA 4HLUC 1OAOC 1G5QA 2QX9A 4CGZA 3Q10A 1CBUA 3NAMA 3R5XA 4B9EA 4HAIA 3KPUA 5JZ9A 2CHVA 2JEOA 1XOIA 3VR3D 5M5BA 1LSSA 5TQ0B 4MKGA 4LY6A 4WJKB 5CBPA 1O6ZA 1ZK2A 3MJCA 3Q3JB 4J4BA 4YRAA 5IJ9A 3NW9A 2WSSD 4IJ6A 2W6CX 1FX0B 3EG9A 3R40A 3QRWA 2HH9A 3IX7A 3F7MA 1KDYA 1PFUA 5HRUA 5JYCA 4HVLA 3Q88A 2V9CA 2QLFA 4B6JA 3DVSX 4I4TF 1VJ0A 3R3XA 4WIAA 3VAZA 3WTCA 4BKRA 1AUVA 2XTZA 2VTEA 2O50A 4HDRB 1YZ3A 2HI0A 3FR8A 3NVDA 2RI6A 3M6WA 3H1EA 4F3KA 1MBZA 4DMHA 1WL8A 3OZGA 3TTSA 5IS2A 2A59A 4KE6A 2E5LB 2BGGA 5DPMA 1U2GA 3G5UA 3EN0A 5AP9A 4JI3B 5AESA 2WWWA 4LZJA 4H31A 5DTEA 2Z04A 5IYZA 3IAAA 2HQOA 4X8LA 5T3YA 3PGLA 2EC5A 3ZXSA 3WYDA 2V3CC 3KQWA 3GLKA 3S8QA 1E9VA 2OCPA 4PNZA 1C14A 4U00A 5LP6F 5LNK6 2IYFA 1DNPA 3EDQA 1VBFA 3HSKA 2W2OA 4B3GA 1U5AA 3HDGA 3IE2A 3L84A 3UY4A 3EIWA 1CPYA 3MGGA 3IAEA 2K4MA 4GI1A 5FQNA 3AVWA 1YWGO 2R66A 2C0QA 3HB9A 2Q6VA 3V55A 1ZHOA 2WU3A 3W9SA 4AUMA 4OOFA 1CLUA 2ZRMA 3PFCA 3N2ZB 2PUBA 4MWZA 4DSUA 1QFJA 2VWQA 2WIBA 4YUXA 5K0CA 4KSCA 5IW8A 2P69A 3HJBA 5HBGA 3W1VA 4DGQA 4BWGA 1XMIA 3B1KA 3M6LA 4RWEA 1IEXA 1CJVC 2JA2A 1ZM4A 2Q9CA 3PTZA 4JUBA 4F4CA 2QNBA 3CNOA 3UK0A 4HUQA 3IAM1 3OKFA 2NSLA 4INJA 5DLQC 3THXB 1BDMA 2PJUA 2Y1EA 1CR1A 2PX8A 4MA5A 4XSGA 3V6MA 1DTWA 1XBTA 3GCZA 2MINB 4ZCLA 3V4ZA 4KWIA 1QX4A 3S7ZA 3X2SA 3A14A 3UMBA 4X1OA 3KWMA 2ZUBA 2R7NA 4DR7B 1VBKA 2E48A 1CB7A 2GZ1A 1ZN7A 4R1TA 5ALSA 1ND6A 2ZJBA 4MJ3A 4N6NA 1AO3A 1E0DA 1SNYA 4UBLA 4PXYA 5EHQA 1II0A 3AB7A 3OJ0A 2C7OA 1MQ9A 1RLOA 1MABA 4MVXA 4TS4A 1P62B 1ZGBA 1PQYA 3OZUA 2FV8A 4MDHA 1Z63A 3FUCA 4RVSA 3O9MA 1NM5C 2WTEA 3KSUA 4YJKA 3HCNA 4KJZA 3RNOA 1EWTA 5CXQA 1NASA 5G1OA 1B73A 4GOND 3AJ9A 4G4IA 4XD2A 1KSGA 3A7DA 4RHEA 4YQFA 3C3PA 2ERXA 4CTOA 1MFPA 4LK2A 1WUTA 4DMKA 2OM2A 3JSAA 3TSZA 1E6MA 4C6TA 2BM1A 1YFZA 4QXQA 2RBEA 3R1IA 3ROEA 5JATA 1DFHA 1QS0A 2AWOA 5EUQB 4GQAA 3TGPA 3MRXA 2BWJA 2QTAA 3OA0A 2BSXA 2ZVJA 5EJ6A 1FJXA 3ZXYA 1R8XA 1FP7A 5CLFA 5KYYA 4J7AA 3V7FA 2WIKA 4PAWA 3TRIA 4KGZA 3T3IA 2DEUA 5EUBA 1W0JA 2FR0A 3BKWA 4WASA 1DKUA 4PQYA 3V7WA 2NTJA 1R8JA 1EA7A 1V8DA 2J0EA 2Q0HA 1UQRA 1N2JA 4NESA 5IH3A 4B8YA 3LQ1A 4IWYA 4XWWA 3OP1A 1TKRA 2OBBA 1M2OB 3AXTA 3QI2A 4OHYA 2W4MA 1EK0A 3VYVA 1GADO 3NT4A 1TTPB 5KKCA 2FI1A 2Q4BA 4TS1A 2WD7A 2Z2ZA 3GZDC 1W2HA 4P86A 3HKEA 2FMIA 4GPTA 4IL5A 4DARA 2PO7A 3UA4A 5JMTA 1O89A 1XQ9A 2H54A 1P77A 2ZTVA 5ANRB 4BNMA 4KWCA 1TU4A 4PAGA 1N5DA 1VXRA 4GLOA 1F8GA 1JHRA 3GRZA 3HNRA 5FA5A 2HA5A 3VV2A 2FSGA 2G28A 2OCBA 2Q3JA 2FSPA 4M37A 1K6XA 3T3OA 2UUOA 2IYYA 4Q24A 1XC7A 1VMKA 1ITZA 3VZSA 4CDGA 2YXLA 2CLMB 1CHNA 1JAXA 3TVDA 2YIMA 4IVZA 4FLEA 3G2LA 5EJ2A 4BE7B 2AMJA 1Y1LA 1BQ4A 5HIMA 3ZEAA 4DC0A 5KKNB 2CDNA 5AW0A 3HM9A 3PGXA 1DDGA 2XOKA 4LPKA 4AJJA 4MWEA 3P0FA 3ZWQA 4RMJA 3EG9B 2EX4A 3PNQA 2DBVO 2XQKA 2B9EA 4F1JA 1IAQA 3GF4A 1YDMA 2WUVA 4M0PA 4UMDA 4D9CA 1RBYA 1L7XA 1Z16A 4IJVA 4L9SA 3MT0A 4Q7KA 4YMUA 2VJKA 4MQEA 1IN8A 3MAGA 1NRIA 3D6HA 3I64A 4MRAA 3F4BA 2Z98A 3KVVA 3D4BA 3GO4A 3MGBA 3ZIAD 2V7BA 4BFXA 3C8UA 4MDFA 3OA2A 1Z0JA 1IG0A 2EL9A 1ZAKA 5EUCA 4YUWA 4BZXA 2JGRA 4LZNA 3OG9A 2YWBA 3OPYB 1T1RA 4RDHA 3L93A 4X65B 5AQEA 1J6UA 5K3FA 4RQAA 5K3AA 5LYJA 4JENA 5KINB 5A6VA 2LR0A 3H19A 3RT9A 4AFNA 4CQMA 3RWMB 4G5QA 1V39A 2PRYA 1ZOPA 4WLUA 4IWXA 2IU3A 3ZGYA 3DS8A 1NXXA 5CCXA 1WRBA 1Q15A 4PRZA 3GEPA 3CM0A 3PI7A 1QOPB 3B7GA 2F55A 3OZXA 5EAIA 2BGWA 1Z4MA 4MICA 2QEQA 3HN6A 1E3SA 4Z4GA 2H08A 4ARBA 2MR5A 1U7PA 2QT0A 3CU5A 3OZCA 3P45A 4TS3A 3ZJYA 3FTFA 1B6SA 1DW9A 4HGRA 1PBTA 5CDFE 4O63O 1JILA 3G1WA 5EE5B 4PHGA 1AKUA 3EZ7A 3RHSA 1D6JA 4D9IA 3IV7A 4ZC1A 4LJ6A 3L1PA 4IDHA 3T5GA 1CF9A 1F14A 3SSOA 3NDBB 2X41A 2VATA 2BF7A 3R23A 1CF4A 2R65A 3DLIA 2JW5A 2X4LA 1OYOA 3FNEA 3IV6A 3QJYA 4YCMA 2WQ7A 2MIIA 4H18A 4GPIB 4QQ8A 4FYJA 5IDQA 1T4BA 3GGDA 1QSGA 2QPLA 5JQGB 1ZPQA 5DT9A 3WWZA 3CKLA 1RXSA 1IMOA 2PUGA 1CUUA 3EZYA 1I3NA 4PZDA 1I2ZA 2AQKA 4PCUA 1UCFA 1F60A 1ID1A 2J32A 3K1AB 4G84A 4M1QA 4NENA 5EE3A 1WETA 4UE2A 3ETCA 3NRJA 3H9GA 2YKGA 3V4OA 2FN8A 2P9ZA 2XRYA 1XE3A 3LC0A 3O8RA 2P6RA 1EDOA 2WHPA 3OPXA 4K40A 3GFPA 3L9WA 4N40A 4WRRA 3RI3A 2EARA 2CD9A 3QVVA 4OHFA 4BX9A 3F9CA 1NXPA 1T9AA 4B3SB 3PD0A 4K86A 3NH9A 1ODJA 1NQOA 4GSKA 4XCVA 3LRPA 1JF8A 2W0SA 3AEYA 5EXSA 4DBLC 4JKYA 3BL5A 1N4AA 4WVLA 4IV0A 4X1YB 5IM4F 3LXUX 2HHLA 1DIBA 4V39A 1ZC3A 3EPRA 2WINI 1K6JA 5K2MA 1ODIA 3LDHA 4JNKA 4D98A 2XYGA 1JG7A 4BV3A 2BW0A 2ZWVA 5EE0A 1KI7A 4HAVA 2DUWA 4AZWA 3TNDA 2XXJA 4EG1A 3EVAA 3G2PA 1C9YA 1JBKA 1USGA 1NFFA 2PL9A 4Y9DA 4AZVA 2J0QA 2CLFB 4J0CA 3WL5A 3KJNA 2WA1A 1RADA 4KE9A 2PXFA 1KVRA 3N70A 4ILKA 1YE8A 1OWMA 4MWSA 3TNFA 4KRFA 1LB1B 3RIGA 3PT5A 1ZK3A 5MF6A 2GF9A 3MWLA 1AGYA 1MJNA 1PVDA 3UMSA 4AP9A 1SXJA 3L8YA 4UMEA 2H7YA 1VOTA 5KWVA 5J1SB 4ZDIA 1B2RA 1X77A 1BG6A 2ZIGA 4W5QA 2G7MC 1P2VA 2WWHA 5HKKD 2FKNA 3F90A 3UUFA 4LXHA 3OFVA 4L6IA 2ZJYA 2FVYA 2A30A 4AIIA 4YRNA 3ETHA 2G0AA 1GDDA 1WVMA 2GZRA 1UKEA 2NW6A 4WACA 1FNNA 1XHFA 3IVAA 3WLLA 1NVEA 1YXMA 2C59A 4A6EA 4AZ0B 4RUKA 1IOWA 2PGNA 5BWCA 1QQTA 4WHMA 1SUPA 3H3FA 4TZ0A 1EFDN 2I5PO 1MC8A 4UTZA 1DS6A 1O95A 2O7VA 1UWLA 2R5FA 4W5OA 3HWWA 2B7BA 1XTZA 2ICPA 2Y0BA 2B21A 3HLKA 3STHA 3RYFB 5FUVA 3ORQA 4HEA1 4TUYF 1JJVA 3LHKA 3URMA 3E70C 2FB9A 3LKZA 3OIUA 4KQ2A 5HA5A 3VHXA 4CN8A 4EHHA 2YNMC 4L8LA 2PD3A 4H35A 1YTUA 1AQJA 3KETA 2DH5A 2KPOA 1ZY2A 2V97A 5HR5A 2NP6A 3II6X 1FFEA 4FFOA 4MP6A 5JS2A 1KJZA 2DPMA 2WP8J 4P8RA 3S1LA 4E03A 4HPJB 3CRVA 1CULC 2RGAA 3DV9A 2JGDA 4N5DA 2GXAA 4ZCSA 4YR9A 2BEWA 3MOSA 2PZKA 2YV1A 3AWDA 2QRZA 4V0ME 2F4VB 4C22A 1K0UA 2CLKB 2O7NA 3CNEA 3K9HA 2NACA 3OOHA 4MS3A 4YLGA 3VNRA 3OBBA 4QDXA 1SCJA 5ERYA 2BGLA 4EG7A 4G4GA 2B3DA 4CM3A 1ZVQA 4ZVUA 3P0JA 2FWIA 2XCUA 3GPDG 2Q5QA 3HR7A 4L4ZA 3YASA 1FS5A 1S2GA 4CL0A 5DMXA 2P0EA 4HAWA 2BOVA 5A7GA 2V96A 4A16A 2FN9A 2PO5A 3KT6A 1M74A 2EEZA 1L4KA 5JXIA 1U0FA 3ZDRA 3PE3A 4WTOA 1Y7IA 4BO1A 5B6PA 2A7XA 2RCYA 1MA0A 3Q6MA 4JIGA 5BWBA 1DAFA 1O94C 3K8YA 3HI6A 2P3LA 3D4IA</