1QQBA

Purine repressor mutant-hypoxanthine-palindromic operator complex
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
338
structure length
338
Chain Sequence
TIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLAVNHTKSIGLLATSSEAAYFAEIIEAVEKNCFQKGYTLILGNAWNNLEKQRAYLSMMAQKRVDGLLVMCSEYPEPLLAMLEEYRHIPMVVMDWGEAKADFTDAVIDNAFEGGYMAGRYLIERGHREIGVIPGPLERNTGAGRLAGFMKAMEEAMIKVPESWIVQGDFEPESGYRAMQQILSQPHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEVHPRLIERRSVADGPFRDYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Gene regulation/dna
molecule keywords 5'-D(*TP*AP*CP*GP*CP*AP*AP*TP*CP*GP*AP*TP*TP*GP*CP*GP*T)-3'
publication title The role of lysine 55 in determining the specificity of the purine repressor for its operators through minor groove interactions.
pubmed doi rcsb
source organism Escherichia coli
total genus 121
structure length 338
sequence length 338
ec nomenclature
pdb deposition date 1999-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00356 LacI Bacterial regulatory proteins, lacI family
A PF13377 Peripla_BP_3 Periplasmic binding protein-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 1qqbA01
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1qqbA03
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1qqbA02
2JVJA 1A04A 3QQ6A 1P6UA 2PUAA 4F11A 4F8JA 1SRRA 2PL9A 3H5IA 3C3KA 4QPJC 4LRQA 4NICA 2JBAB 3JPYA 4KMRA 3HK2A 5D2CA 4EYKA 1E6LA 3RVNA 3O1JC 2OQRA 1A0OA 2JCGA 1ZVVA 2FEPA 3OQMA 3F6CA 3IP6A 4NQRA 1H9CA 3QEMA 4G0ZA 3H6GA 3H6HA 4KV7A 3K9CA 3OLWA 4YO7A 2CSFA 2ICPA 3OLVA 2PL1A 2X7XA 3ILYA 1BA2A 3A10A 1DP4A 3KYIB 4PZ0A 2R4QA 3Q7RA 5PNTA 2P9HA 3TX6A 1W9HA 4JP1A 5DCLA 4G0OA 1K66A 3SQNA 4NCAA 2B1JA 1ZZCA 2EBYA 2MEZA 3DNVB 2KZ8A 4RDCA 3HZHA 3QWGA 1BDIA 5K98B 2A9RA 3OLXA 4F06A 6ABPA 1PEYA 4JCYA 2HQBA 1M5UA 3TD9A 1JL3A 4MS4B 4X4IA 1JLKA 2DRIA 4MQFA 5KI6A 4YCSA 2PUGA 1Z2DA 1ZH2A 3H5LA 3OMTA 1FFGA 2VUIB 4RK0A 5FWXB 3KLOA 5ED4A 4YS6A 5JNWA 1EHCA 3RH0A 1U04A 2FMIA 2AUWA 1DRKA 2IPNA 3QEKA 3VNBA 1FFWA 4MRMB 1QPZA 1POUA 3KLNA 2WWVD 4MS3B 2LYLA 1S7EA 2L8NA 1NXWA 4Y42A 1KRWA 1E3OC 3L6UA 3O21A 3PXPA 2RDMA 5HSGA 2L2QA 5B3JA 3GBVA 3CG4A 2AYZA 4O1IA 3LISA 3MIZA 4OLAA 4RU1A 4N41A 1JHZA 2PPXA 2XI8A 4XARA 3OMWA 1CHNA 2FVYA 3A0UA 2B4AA 1PRVA 3JVDA 1DRJA 3RQIA 2GRLA 3MA0A 3N0RA 4I6TA 1RPJA 3LFPA 2FW0A 3JXCL 3HS3A 4X4BA 2KPJA 2AXVA 1KGSA 3UK0A 3JXBC 1NXXA 4EVQA 2I6FA 2JBAA 3FGZA 1LBHA 3SCFA 3LUDA 3VK0A 5FBHA 4MAAA 5EWJA 4D6YA 4KQ9A 3FMVA 4PU3C 3CLCA 1D4ZA 3C3MA 4OTZA 1NXSA 4P98A 2MYTA 1KRXA 2WJWA 3I5AA 2MSKA 1L5YA 1WH6A 4RWEA 1TMYA 2QV0A 4RZSA 4GQMA 1DCMA 4F12A 1VKRA 3KSMA 4MR8A 2E4XA 2NZVG 3HZIB 2JRLA 3F6PA 1ZAYA 1U2QA 3DGFC 2BJCA 1UTXA 2EF8A 3KZ3A 3SNKA 1F4VA 2E4ZA 3NBMA 3QEMB 1PRUA 2WJAA 3CRNA 4QYMA 4XXHA 1U2PA 4PU8A 3D8UA 1BDJA 1M2FA 1MAVA 3SG0A 4N76A 1CYEA 1WETA 5KQMA 1PRAA 2IVQA 3KCNA 2LUOA 4DADA 3IVPA 4Q6BA 2IDMA 2AXZA 1EWKA 1ZS4A 3LTEA 4J1WA 4MS1A 3BDNA 2FQYA 5B3JC 4O5AA 3G7DA 1D1PA 1JYFA 4GHJA 4OATA 1ZGZA 2PKXA 2BNMA 1NY5A 3BRSA 4RV5A 4D74A 2PJUA 3Q9SA 4DN6A 4MRMA 2IPLA 2FEKA 3A0RB 2HJ9A 4MS3A 3T6KA 4OLBA 4IMJB 1B0NA 3QELB 1D2AA 4RXUA 2QVCA 4MLDA 1ZPQA 3GN5B 3C97A 3RVRA 3N53A 4LE2A 2JK1A 3RVSA 4N0PA 5EWMA 4MQEA 1NERA 3D1NI 5DKFA 2IVBA 1QQAA 2NUBA 9ABPA 1XWWA 4YP9A 4RKQA 2FN9A 4G97A 5KWSA 3H5VA 2IYNA 1U8TA 3BRQA 3IP9A 4G0PA 4Z9AA 1WIZA 4HYEA 5IUKC 2WB4A 3O75A 3RVLA 2LYQA 1L1MA 2YHBA 4Z0NA 1QKKA 4X4HA 1UXCA 3HV2A 3FFXA 1Z17A 4Z4HA 2IOYA 2R48A 5TQJA 5TPZA 5JNRA 3CECA 4RK6A 1R69A 3S8QA 1DWKA 1ABEA 1QMPA 1Z26A 1P2FA 2MYUA 5FBKA 1LLIA 2PUEA 3JTEA 1TJYA 4RK1A 3FDFA 3O2SB 3NNNA 3EDCA 1E6MA 2NT3A 5BQ3A 1USKA 2IPAB 3HEBA 4ZYLA 2F8TA 2A9PA 1JDPA 5DGCA 3ROTA 1Z13A 4O1HA 4ZJPA 4FB4A 4HNSA 4PICA 2FQXA 4KVFA 5EWJB 1LCCA 3KKEA 4G86A 5C5EA 1P8AA 3MQ4A 1K68A 1FQWA 1JFVA 3O74A 4S05A 4OB4A 4GPAA 2XDYA 1R8JA 3QYXA 4MR8B 5CNIA 2NZUG 3RVMA 1M5TA 3EGCA 1VPWA 1X2LA 2FQWA 3I42A 1FFSA 4QYWA 4D6XA 1TVMA 2VK2A 1OCTC 3JPWA 4G0YA 3RVQA 4DQDA 3CU5A 2GZUA 3UFDA 4P1ZA 2FMFA 3G85A 1WH8A 3QLUA 3QF3A 4W5TA 1URPA 3Q15C 3QELA 3Q41A 2RJOA 1R63A 4YG4A 4OBBA 3T38A 4B09A 4E7OA 4RY8A 4F8DA 1NEQA 2QW1A 4MS1B 1BDHA 2OFYA 3GN5A 1ISSA 2J48A 4FE7A 3F7NA 4H3HB 3LUCA 4ZMRA 4KFCA 3SCHA 4TMYA 1QO0D 4UHKA 3LKVA 2JVIA 4XLTA 5CNJA 2H8RA 2B5AA 4MR7B 6CHYA 2V0NA 1RPEL 2LYJA 1M2EA 5TE9A 3ROFA 4RS3A 3DLBA 2IUOA 1AU7A 4OG2A 5F64A 1QP7A 2LYSA 3IP5A 5IUNC 3RZZA 4WXMA 4JA2A 1KMIY 3BS3A 4JCXA 4N03A 2E4YA 1LMB3 3LKBA 2LYPA 4RK5A 5EWMB 4Z4EA 4MQEB 3ILHA 4JASB 3LUGA 2KEJA 2ID9A 2IVGA 4KNYA 4FBIA 1BAPA 3LOPA 4RXTA 3SY8A 2A9QA 3JXDL 4KRFA 1CEYA 5CHYA 1PHRA 4X4FA 4CBVA 2LYRA 5FWYB 4RY0A 1GUBA 4W5QA 3MF4A 2KYRA 1YVUA 4L85A 5HM6A 2QU7A 3OM0A 4W5NA 3HDGA 4G0XA 3H5OA 1RXIA 2FLWA 1A2OA 3F6WA 2O20A 3EJWA 2MQKA 2XIUA 2GI4A 4W5RA 1J56A 4KK4A 4Z5HA 3EODA 4Q6WA 3SAJA 3GBFA 5GOTA 4Z4CA 2JVKA 3R0JA 4HNQA 4G0MA 2PUCA 3NHZA 4Z9BA 1BVHA 1ADRA 1SQ8A 1LJLA 3E61A 3QLUC 1ZESA 4IA8A 3CKMA 1LQCA 1XWRA 2PE5A 5KC9A 1SXHA 2CHEA 4JB0A 2IU7A 3TRBA 2IV1A 3OQNA 2JVLA 2FXIA 3FYMA 2H0AA 4EYQA 1JFTA 2EWTA 1YS6A 3F52A 1DC7A 3BILA 4H60A 4UHJA 5IX8A 1GUDA 3QK7A 3TO5A 1UXDA 2KEKA 1VLZA 3OM1A 1YMUA 4GNRA 4WWHA 2PIJA 3RVPA 2O4AA 1O4XA 2PUFA 2HQRA 1ZZBA 2QSJA 3E3MA 4MR9B 3EQZA 4QICA 5JNTA 3H1FA 1E2BA 3QX8A 1PERL 3BREA 1LBIA 1E6KA 3CNBA 1JDNA 4IGAA 1MIHA 1Y7YA 3G1WA 5TPWB 3T8YA 5CNMA 2AWIA 4LE1A 2BNNA 4EUKA 2LCVA 3OMXA 1SD5A 4N0QA 1L5ZA 2GX6A 4MR7A 5DTEA 4Z4GA 2ICTA 2P4UA 4X4EA 2L19A 2OR1L 4MLCA 3NNSA 3DBIA 3I45A 2LIVA 3HJFA 1XHEA 4KQCA 1C4WA 2FSPA 4MGEA 1JH9A 3P9YA 1LJUA 2LBPA 4TLMB 5TQ2B 2XCJA 2LYKA 1ISRA 2MYPA 3LFTA 3OP9A 4EYGA 3GV0A 1RZRA 1YK0A 5BRJA 5HKOA 3OQOA 1U0SY 1Z18A 2BNOA 3RVOA 1OXBB 2D5VA 1NTRA 4ETNA 1DW9A 2FJRA 1JBEA 1B00A 4O8BA 3OLYA 5ABPA 4X4GA 1LCDA 2ZWMA 3N75A 4XAQA 2H3HA 4FN3A 1AB5A 1PNRA 4TLLB 4KK3A 4Q7EA 1FSPA 1ZZ9A 2QVGA 1W25A 3H1GA 3RVKA 3LUAA 1IIBA 3KJXA 4MYRA 2L17A 4RKRA 5FWYA 3JS5A 3HVRA 4LX8A 3Q7TA 4EY3A 3CFYA 5T7BA 2RGYA 4JQDA 3O2QB 4Z4IA 4LDZA 1DJMA 5TQ0A 1GCAA 4G0QA 2L49A 3BBLA 2WY2D 3TMYA 1P6QA 2CD7A 2OENG 1S8NA 1CJGA 1EWTA 2VYCA 3K4HA 4YRZA 3EUSA 2QR3A 3UKJA 5C5CA 1DBPA 3G5GA 1CQTA 2LP4Y 3DGEC 4XFKA 3S99A 3FFTA 1NXVA 1YK1A 1DCFA 3KG2A 4MCXA 3IPCA 3QLVA 4I6RA 1PUXA 4YG7B 1YSEA 4Z58A 4E7PA 4Z5DA 4HNRA 2LPMA 2FLKA 2F8SA 4MR9A 5JNUA 1HEYA 4WXEA 1PNTA 1JYEA 4EYOA 3O2JA 1JX6A 2ZAYA 2IPMA 5TPWA 2HSGA 3H5WA 2WIUB 3LUKA 1GLGA 4YR7A 1QQBA 1APBA 1I3CA 3T95A 1ZZ8A 2Q5CA 1HF0A 2PUBA 3EULA 3A3KA 5DLEA 1RZRD 5JS2A 4PU7A 2E4UA 4WT7A 1YMVA 1ZZ7A 2FMHA 5TQ2A 3D02A 4S04A 2JB9A 4PYRA 4H3KB 2R63A 1DC8A 3CZ5A 2M98A 1RIOA 2AYXA 5IULC 1YIOA 4IWRA 3GA5A 1F51E 3N8IA 4PEVA 4Z99A 3MLFA 2GWRA 3KXAA 4M88A 1ZY2A 4LDAA 4YG1A 1DZ3A 2WUSR 3NHMA 4WZZA 7ABPA 2XSDC 2CHFA 3JVIA 2RJNA 3VNAA 5HQJA 1PEAA 2XJ3A 1ABFA 1JWLA 1GT0C 3OLZA 1ZUGA 1T34A 1XHFA 3LUHA 4IF4A 5TPZD 4XASA 3O1IC 4X4CA 2QXYA 2CWDA 3KTOA 3B2NA 3LMKA 5T3YA 1NXOA 3URMA 4MCTA 3IDOA 3QLVC 3SCGA 2NT4A 1LK0A 5JNSA 5KQGA 2W42A 5GQSA 3GT7A 1Z25A 2WMYA 4NDWA 1OXKB 1ZHHA 1NXTA 3MMNA 4YV7A 4YLEA 1ZZ6A 3QLTA 1QP4A 4PU4C 1AB6A 2PAFA 1ZITA 3OO0A 4ML3A 2PLNA 4EVSA 1Y9QA 1EWVA 3JY6A 1YS7A 3SM9A 3IPAA 3O1HB 2FTKE 2CROA 1TM2A 3H1EA 5EWLA 5TQ0B 1QP0A 4RK7A 4ETMA 2O38A 2PUDA 4Z5CA 2FEWB 5I4CA 1JFSA 4I8TA 2GKGA 1D1QA 1MB0A 1C0EA 2HINA 1MB3A 1ZH4A 3HUTA 1UDRA 1X57A 1VRVA 3GYBA 3O9XA 3LUFA 3H75A 5JNVA 4Z4FA 2E4VA 1DG9A 1IC8A 3L1PA 1USIA 3BD1A 2MYNA 4JOQA 3W9SA 4ETIA 1EAYA 3DZDA 3N0XA 2BGGA 4RSMA 5IEJA 3F51A 3RVJA 3HSYA 2PMCA 5IUJC 3HO1A 1NXPA 1EFAA 1Y1LA 1Z16A 4MPTA 3MM4A 1JF8A 2WRZA 5KC8A 2FKAA 1OSLA 5IBQA 4Y9TA 3CLKA 3GBPA 2A6CA 2VUHB 1Z15A 3CG0A 3KS9A 3KHTA 3MYYA 4L4UA 1ZN2A 3GRCA 2MSWA 2GRMA 3Q7SA 4N47A 4YBAA 1YTUA 1QNLA 4ZPJA 4KZKA 3QX9A 3HXMA 2AW6A 3B7HA 3C6QA 3OO1A 4IRXA 3UUGA 5BRAA 5E3JA 1TLFA 4KREA 4IILA 8ABPA 4RK4A 4EVRA 4RY9A 3HM9A 4PE5B 4MS4A 1RZSA 3FYAA 3ZHIA 2R47A 3HUUA 4LZLA 4J1XA 3IP7A 3C3WA 3L49A 4YGXB 3M9XA 3GWGA 3ZHMA 1DCKA 5FWXA 2A9OA 3CHYA 1GCGA 3N0WA 1DBWA 3NNDA 2IKSA 2AXUA 3H5TA 4WUTA 4EGSA 4F3TA 1USGA 2ID7A 2FMKA 4YARA 4KPYA 5BR1A 4NCBA 4LE0A 4NV3A 4MQFB 4IMIB 1MVOA 1D5WA 4ZMSA 3LUJA 5IC5A 2N9UA 4JAVC 2R25B 3U3WA 2O49A 3I09A 3N6VA 3FMYA 3F73A 1DBQA 4I6UA 2GBPA 2E4WA 5KQPA 2KEIA 2FN8A 3CROL 4W5OA 2M1ZA 1QO0A 3GL9A 1RNLA 4JB2A 3R1FA 5EWLB 4IVZA 1ZGGA 5CNKA 1Z2EA 1NATA 3M9WA 4TN5A 3TB6A 4RXMA 4Z59A 3CTPA 3CZCA 3EAFA 3HCWA 5KQLA 2L18A 2HQOA 5A7LA 3CS3A 3HDVA 3EQ2A 1SXGA 4X4DA 1SXIA 2HPHA 1ZDMA 2TMYA 3ZKCA 2MSLA 2QZJA 3M6MD 4YWHA 1Z12A 3DLHA 1RXEA 5IEBA 2YHAA 5JS1A 3KYJB 3FFWA 2R1JL 4FE4A
chains in the Genus database with same CATH superfamily
5F2NA 1UFOA 4MUMA 1IWBB 4IRMA 4C4YA 3R3SA 4UJ5A 2IWHA 2FDCA 1YVPA 2QTNA 5DP1A 2Z43A 3KXDA 4R68A 2O0LA 2PL5A 1J0CA 3CJTA 1JJ7A 3NR2A 3QU7A 4R1TA 1NI3A 1XQ6A 1EK5A 2P90A 4NMMA 1XKQA 5DGHA 5KKAA 3TAXA 4BNKA 5GIOE 1NR7A 2LNDA 3HPRA 4TL8A 1JQ5A 1KJWA 2PXUA 4YO7A 2I29A 3IERA 3R4VA 4LUCA 2MCFA 3DHVA 2QENA 3GJ0A 2PL1A 3LVFO 4FNMA 4YP7A 5L3SB 1JHAA 4PZ0A 2JJ1A 3SDSA 2QQ5A 3DWEX 3SJ7A 1X7ZA 4DIDA 1W9HA 3ND7A 4HD8A 5EZYA 4Q34A 5F3DA 4LXYA 1GSHA 2YXDA 3ZWQA 4MYDA 4DM3A 1PO7A 5HYVA 5HM8A 5LM3A 1NF9A 1W0KD 3ORHA 1NBMD 2HQBA 5CGZA 3T7DA 4HAVA 4IMRA 3R8FA 4N65A 2EZ4A 1Z2DA 1N2ZA 3LHIA 4ZDWA 3Q8MA 2Q41A 3IVAA 1PEKE 2JNWA 4AJNA 2COKA 2KE5A 4R51A 2VPTA 5BSWA 2MTBA 5FUQA 2ZYAA 2QRQA 5CITA 2PYDA 1DRKA 4F6RB 4N9WA 1GL6A 1FFWA 2VOEA 2X2EA 1NJSA 3L8YA 4MS3B 1X80A 3NMUF 1YA8A 5I7AA 1J42A 3Q8LA 1F8FA 3PFGA 4L3VA 3I6MA 5B53A 3LLCA 5BT8A 5HSGA 3DE1X 3JTMA 1GYRA 1DIBA 2Z4TA 2LE0A 2FWRA 2VK4A 3QFIA 1BE0A 3DEZA 2VQSA 1E58A 4KP7A 3AETB 4TV8B 2R5FA 4I55F 4AC9A 4B48A 2FVYA 2XHEA 1F7UA 3HFJA 2XSZD 3HCBA 1JMKC 2VTVA 2I3AA 4OU5A 3RWOA 4DB2A 2F67A 1QTIA 3WGGA 1Y3AA 3PEEA 3HXTA 2P6OA 3GQBA 4HLCA 4BXOB 4B34A 1CV2A 1NXXA 3I30X 1W5BA 4YASA 3E5HA 4MRSA 2XNDD 3SDZA 3GRKA 4JEHA 3TLMA 1IN4A 5FBHA 1IJKA 4OFBA 2G88A 1GPYA 1WIWA 1Z2PX 2EL7A 4PZZA 3N3AC 2X22A 3O7WA 2V7WA 1ZO8A 4YXWD 1GZ4A 2JFVA 3EIOA 1P81A 4Q1AA 3Q3JB 1TCBA 5KQRA 2C20A 3PQ7A 4KNVA 2QRPA 3I64A 1GV0A 3FUCA 3QKSB 3QJ5A 2AHRA 4HNTA 4E5PA 1NUPA 4Q93A 2FSVC 2WNSA 2R65A 2OGUA 4IO0A 4QUBA 2XVZA 1J1IA 1EK2A 1YR6A 1NRWA 2DFLA 1UTXA 1AIPA 1MCZA 2ECQA 2YRWA 3B6IA 3KPVA 4H3VA 3NBMA 4ALNA 1PRUA 1RXCA 2HZBA 1OGIA 3K0AA 1CZKA 4HWOA 1P2TA 1V11A 1XJQA 1ZIYA 1LV8A 2C2ZA 2O23A 1WB9A 3SIRA 1MAVA 2PD4A 2R6AA 1BDMA 2RBGA 3TLCA 1PL6A 3NC4A 2ZIWB 3ORQA 4ZI3A 2WMNB 2BJWA 3L07A 2PMWB 3OSZA 4MW5A 5LBIA 3COVA 3RSZA 3G1TA 3OQ6A 1REQB 1V4BA 3K32A 1HNXB 4RF2A 3IH5A 3OZSA 1DC6A 4G9EA 1F8XA 2R8YA 4JJEA 3C24A 5LB4A 3WMFA 4RH3A 3UWDA 4MRMA 3ETLA 2V98A 1ESEA 5HE9A 3V1YA 2NXJA 4X1KA 1TFRA 1XZ8A 1P39A 1RAAA 1A27A 2VJQA 3LVQE 4F38A 3GMSA 2UYCA 3FGOA 1P4HA 3C1TA 4ZQHA 3MJRA 1E5LA 4J07A 3NJRA 2DUJA 3LZDA 3N2KA 5IBRA 2QTVA 5EHGA 4YI3A 1YL5A 4HRXA 2V7VA 1G2QA 2O2EA 4ZP1A 4OJNA 3WLKX 5K0FA 3H65A 4D8WA 3FOWA 2BFFB 2F4NA 4ALKA 2ECFA 3G9XA 2A3RA 4JLOA 4QQRA 1WABA 4MCIA 4O0LA 2V6IA 1G19A 2R00C 4RO0A 2OO5A 4BU0A 5IT9A 3BRQA 5HBGA 2PXHA 4IV0A 1JR3D 4FDLA 3NKVA 3T7IA 1ZAKA 3CUEF 3SHVA 3BWVA 4R2IA 1PFVA 4X4HA 2BBSA 3QLEA 1FU4A 4V0OA 1RPZA 4LZOA 4EPRA 1EDDA 4U7TB 3OEYA 1CG6A 1QMPA 1Z26A 3FDZA 5CXQA 1C8VB 1P2FA 1Y6QA 3CLHA 2RHWA 2ZK7A 5DRTA 4E31A 3S1AA 4LY0A 4BZZA 3RC8A 5BQ3A 5H4GA 3SSOA 4X44A 4TTQA 2MINB 4XR4A 1PJCA 3FNQA 4E30A 4EG4A 3GGJA 3QRWA 1B3RA 1LC0A 2ZVQX 3E35A 4KCGA 3ECSA 4N3NA 4PYIA 2BFMA 2WT4A 3QBTA 5AVRA 4ABTA 3DYIA 4TRJA 4BKQA 3QP9A 1HTTA 1PFWA 2J7PD 2HOQA 4EHBA 1SC4A 3LVRE 4S05A 3WVNA 2G8LA 5F2OA 1W59A 4R1LA 1ZNYA 5F21A 3OT5A 5FNVF 4MR8B 1WQ4A 3CGGA 2JJ2A 2VRNA 2Y9PB 1FFSA 4D6XA 3LXMA 1CUEA 2R1UA 1XN4A 1U0TA 2V9ZA 4PV7A 3A6DA 4K9RA 1D6SA 4MYUA 1OI4A 4PFQA 3VGJA 1OROA 4HL6A 4UHDA 1AA6A 2IY8A 3Q15C 2DPGA 2VT2A 4HMOA 4KPGA 1KFJB 2ISSD 2ODQA 3A9ZA 2ERXA 3JQAD 4E7OA 3NHJA 2LKCA 1J49A 2FHPA 3D4LA 5B7PA 3SVTA 1BDHA 1ZMRA 4UUOA 4EJFA 2CNWD 3B51X 2Q45A 1KNXA 2GN8A 3N8NA 1TJPB 2I7DA 2ZETA 4J49A 5EGNA 5FFMA 4HGZA 6CHYA 4NDZA 4UJ3A 3TOXA 1VJRA 3DLBA 4G6ZA 2VBCA 2QEQA 1AU7A 1O3YA 2JFQA 5DLYA 1A5TA 5EZ5A 2V65A 3HA2A 3EF1A 5AJWA 3RZZA 3OIVA 3R3YA 2I4RA 4AWXA 2H5EA 5FEUA 1Q77A 1Y1QA 2FPSA 1HDXA 1SK9A 4OIMA 5AW1A 3CPHA 2EFHB 4WGFA 5M2QA 3IRVA 2ODAA 2HN9A 2Q4OA 1DJLA 2QLTA 3JQRA 4PHTA 3V42A 3GK3A 3VBEA 3ZWKA 3FMOB 2XQGA 3M1IA 4NULA 3LCUA 4TMXA 1AX9A 4D9BA 4DUPA 3FVWA 3DE0X 1MC1A 4ZZ1A 1PJ2A 4ARZB 1L6IA 1GUBA 1Z56C 2C3OA 4KXWA 1FNBA 4BB9A 5JPIA 1OX6A 3RLIA 2QU7A 1Q44A 2WQ6A 4TN1A 3F97A 2HMWA 5ECWA 1SMKA 2BEUA 2GBGA 2EU8A 3G0CA 5JCJD 5KTMA 4WZAB 1I36A 1JAHA 4C7OA 2UZAA 2Y3IA 4YTEA 4BTEA 3ORFA 2NO7A 4X63A 1M6YA 3WJ2A 4KR2A 2PZAA 3P52A 2AQHA 1DIAA 1VIVA 5G1OA 3MLEA 4BGDA 1JFLA 4M0CA 1CQJA 1EFVB 1KA9H 1P3JA 3AKCA 4RAOA 3A6HA 4AY3A 1IY9A 4MYTA 4HWRA 4HAIA 1DUVG 4QVKA 3TSZA 3ZU5A 3MB5A 4D9KA 3VM6A 3M6IA 2ZI9A 5ILGA 1OV4A 1NHGA 1ZXXA 3NXKA 3ZOKA 5DBEX 4A26A 4ILEA 1QH1A 2ZJ2A 5P8WA 4TRRA 5HG0A 1FMFA 5EAIA 2Q6TA 2Y6UA 5A0TA 2PIJA 3GNQA 3RVPA 2PUFA 2B6NA 2HCSA 1XPRA 1RYMA 1E2BA 4Q3KA 2ATXA 2PCJA 4IVQA 3UCEA 1W47A 1NQTA 2P67A 2IITA 3NJ4A 3KDPA 4QELA 5GP1A 4PGFA 5FULA 4BHTA 3PQ6A 4RELA 2BCGY 2E9SA 2P75A 3DD5A 1R4MB 2P4UA 5C8DA 4DVGA 1UP4A 4N3CA 5DISB 5JAUA 1W7AA 1GQSA 3TR0A 1WXDA 4FEGA 4WKGA 1MO4A 1NIJA 4TM8A 1WCIB 1Y8QA 4QOSA 2OV8A 3VZPA 2PLWA 1W48A 5AXDA 5KIAA 1DEXA 1BXRB 1MXHA 4CMIA 3CW8X 3NXHA 5JC1A 1GYQA 3WBJA 3EQ9A 4E15A 4EKDA 2O4UX 1LCDA 4OO3A 4BASA 3T7JA 3CX6A 4KO4S 4I5FA 3OG9A 4EUNA 1QH9A 4RKYA 2WVAA 1UINA 1PZFA 1YZFA 4FS3A 4NR0A 4LX8A 3HVRA 1CZUA 3CFYA 3HYNA 3OMLA 3BMCB 2PSJA 3C4VA 5JANA 3NHYA 2XF2A 2FPMA 3ADKA 3UA3A 3BMOA 4ZCMA 4LI0A 2MHCA 3DCNA 4PG6A 2YJTD 3JWGA 1OFUX 4HY3A 1Q3KA 1W85B 3EZYA 3TLGA 5JRJA 3UW1A 1EWTA 5LMCA 4C3ZA 1BN6A 3MJVA 3PKZA 4OQEA 2VPPA 4ZAGA 1G6OA 1IUOA 1U7OA 4JCOA 4EHKA 4G65A 5TLSA 3FFTA 4EA7A 4RLSA 4J0FA 2ZU0C 4WGGA 1GV1A 1R66A 2XT6A 3I8SA 1N7JA 3MBIA 5DM1A 3NDPA 1E3DA 1GPLA 4OM8A 3HA7A 3Q5GA 4BB0A 4ENVA 4Z5DA 4PZUA 1TU0A 2P9GA 3SXUB 2L42A 2I4LA 3VPXA 2LPMA 2C07A 2F8SA 3GVXA 1EQ2A 1KZ7B 2W2QA 3GROA 5I7EA 4P33A 1YXMA 4E14A 3HKCB 3MGCA 4RTRA 2HSJA 3O93A 3OFJA 3QEBZ 4BRWA 3AY7A 2ROQA 3RR2A 1GG8A 2DCUA 1QQ5A 1Z37A 2VPZA 3CLSD 4OHFA 4QYSA 5CCEA 3G8DA 2HJHA 4RDXA 2WYVA 1SVMA 1VI6A 2PBFA 5DLDA 2XDQA 4ZVVA 1I3CA 1ZN8A 4H16A 4AS2A 1E1RD 1ZZ8A 3AIIA 4GECA 5JZVA 3OWOA 3WYEA 3EEQA 3A3KA 3U7RA 3L6DA 4D9GA 1HL7A 3KWFA 2AV6A 4CKZA 3OFKA 2J31A 2OHJA 2PGIA 2ASVA 2YXBA 2ZYWX 3D02A 1M8FA 3AYXB 3JSAA 4CE6A 4DPKA 2YN4A 1RIOA 1VE6A 2J5QA 4C89A 4JYAB 4HGPA 4U9UA 5F1PA 2O5RA 3U17A 1OAOC 2V3CC 1RC0A 3NX4A 4LGCA 5LUBA 3TVTA 1VBKA 5B58C 5IABA 4YG1A 1JDZA 2XXAB 3RUDA 1FNMA 1K6EA 1UT8A 4FWTA 2O3JA 1ABFA 1KJJA 5CDSA 4QAJA 4EK9A 5KOYA 3ZDCA 2FWNA 3I2GA 3IUMA 2K87A 1YCFA 3FH0A 4ESHA 2DFTA 1M7HA 2WABA 4D92A 4LWQA 1SPXA 2DFPA 3I6IA 4U7GA 3FIUA 4H1TA 3K5WA 5LQDA 1PJZA 1ENYA 1QFXA 1IC6A 3D3KA 2ZS9A 3BGWA 4Q3CA 4P7BA 1JIIA 5CH5A 4DJAA 4E5SA 4GKBA 2JHFA 2B5WA 2IUFA 3RANA 1R88A 1ZHHA 4ZVOA 2AIRA 3W2FA 1I7PA 1V37A 2C54A 2WUVA 4OHKA 4PU4C 4QJ4A 2XMBA 4FCWA 4ADSG 5JMOA 1O1YA 1E5QA 5HF5A 1PZHA 2ZR9A 5JSUA 1YS7A 4ZI7F 1OU0A 1J8FA 1TM2A 1UDXA 3F5MA 3W8FA 2NZJA 1YQQA 1DCTA 1Z9BA 1V8FA 3T35A 1SK8A 3DR5A 1F1BA 4LCJA 1TKBA 1EJ2A 4RFSA 3UJ7A 4WBNF 3U3MA 2PLFA 3QVWA 3QOWA 2FGJA 2UZ3A 3K1AA 4G1BA 3SPXA 2XB6A 5KUTA 1BO6A 4MWEA 10MHA 2ZRNA 3C6YA 1IVYA 4K9MA 4IUDS 3K7EA 3NRJA 3HGMA 3K5PA 4K03A 1PR5A 1E4EA 2MYNA 5KTYA 2XTNA 4BP9A 2X4GA 1HQ1A 1C1DA 1TEZA 1BJKA 4NOLA 3F8TA 4IOKA 2HSZA 4PLPA 2OGWA 1GJRA 1EGVB 3HGTA 3C15C 4X85A 3LXUX 2WRZA 4OHOA 4BGVA 4XWWA 1LDBA 3V7WA 2P9ZA 1EM8A 3FZYA 2JIPA 2AXEA 2OR3A 1DEKA 3OEWA 2AUMA 1Q0RA 3L0DA 2A6CA 2GPYA 4RTQA 4PGHA 4R8VA 1E32A 3E1KA 3LT1A 1JQDA 3ZS9A 3EEBA 3SEZA 3RTDA 4Q02A 1H6DA 3PUYA 1YV9A 4YHBA 4C0AC 1PNOA 4QM6A 5HOQA 3FTFA 5BNTA 5LQAA 1QNLA 3H3FA 4AIIA 1ATZA 5EQTA 3NEJA 3SBEA 4JENA 4KLAA 1T5OA 3JYOA 4KBFA 2J0UA 1TLFA 1P17A 2X86A 3Q9UA 5FOTA 4ZV4A 3R24A 8ABPA 2EIHA 2NV0A 4BVGA 2VYQA 1XDZA 3HJHA 2IX9A 3OZDA 5AVKA 3TTWA 2OWDA 4EHHA 3H9CA 4BNVA 3S8EA 3QV1A 2W9XA 3MYRA 2RAFA 3K53A 1UEIA 2XR1A 3C1UA 4MMYB 4BFCA 2OHXA 1ID1A 4CYMA 2A5YB 4CKWB 4KOAA 4YJGB 3RIXA 1EBBA 1UJ5A 4ABYA 3VR0A 2PUJA 2L1PA 3UOWA 2ID7A 1D6JA 3GIWA 3TDNA 3ANYB 4G9GA 1HL3A 4MKIA 4PQFA 4E1VA 4Q3BA 4BFXA 2P4EA 1W0KA 1EFKA 2GZDA 4RZXA 2P27A 2Q0QA 1B4DA 2UVQA 2VDVE 3P45A 4CTKA 5JADA 1N33B 2XUQA 4I1VA 4HZIA 1TLTA 2BONA 2YY5A 4N4AA 3EWIA 2O2CA 3ITEA 4PHCA 3T12A 2E5LB 4L08A 1MC4A 3WGNA 4ZN6A 1K63A 2Y1LA 4GP7A 3AR8A 2ZT7A 1TO1E 4EJSA 4QTYA 3NVAA 3TYXA 5AD1A 3JD3A 3AERB 4XIJA 4DG5A 5IHPA 2I54A 1CE8B 3QKIA 4TKUA 1Y5LA 2IP2A 3M9WA 1I0ZA 3VR2A 2C2OA 2C9CA 4OJQA 4R2KA 3R8CA 4CI9A 4E12A 2EIXA 4ZHQA 2BGLA 5SZKB 3WLOA 1C3JA 3IESA 3MHTA 2Q3LA 2TMYA 3DLHA 2IFTA 4D4KA 3C45A 3RU3A 1DQSA 1B7GO 3T52A 1GGMA 4B4WA 1NJ5A 4I9FA 1P6UA 2GPJA 2V5VA 3UT6A 3WSVA 1YS2X 4C7BA 3OUTA 4F8JA 5C8YB 2XADA 3RSLA 4NPCA 4G4IA 2JBAB 5CDFE 4WVLA 3LQFA 3HK2A 5K6AC 3TTTA 1S2DA 4CR8A 3C5CA 1E6LA 1Z73A 1SCBA 2Y0PA 5JYCA 1A0OA 1CUCA 1WM1A 4YK7A 4ON9A 3ZGOA 3UMRA 4BMCA 4JP5A 1ZHFA 3WO0A 4PLGA 4HNVA 5IJ9B 3IMFA 3H99A 4L15A 5KNDH 1NU8A 4YXWA 4Z9XA 2P9HA 2PEYA 4TTTS 4O4LB 4M0FA 1XYYA 2DKNA 2ZYUX 2H07A 4MGKR 2GJ8A 3ZJTA 2PX8A 2MEZA 3BHIA 3FTPA 1WW8A 4AX4A 3LD9A 1N1MA 3L1JA 3G7NA 4MEJA 3CVXA 3BXGA 5K98B 3LRPA 2FPGA 2NZ8A 3GCZA 4LVUA 3IEMA 1JL3A 2AOUB 4CGZA 3IUYA 3HXKA 3H2JA 2QTLA 1NVFA 2H2HA 2PUGA 2WJ4A 3DXFA 3KQOA 4DMUB 3GEDA 1ODTC 2AVDA 1H6BA 4M1WA 1Y1TA 2F1KA 1L7QA 3WDLA 4IDNA 4DLSA 3T94A 1R6TA 3UJ8A 3WNVA 1DRWA 4DWOA 4BQSA 4BIMA 1K7XB 1WCXA 2IYLD 1G66A 1EUDB 4PXYA 3C14C 5D6OA 5ARBA 5H9WA 1C9MA 4LTNA 5AHKA 5EEGA 1WTAA 3ROQA 4F4DA 4UBNA 1DB3A 3KB6A 3WBBA 2AKAB 3AUSA 2Q6OA 4B40A 1IB0A 3EDRA 1VJGA 2KI5A 5CBPB 2ETVA 3FPHA 1K9VF 3TNJA 3GLFB 2PNJA 2E89A 2R97A 2HLNA 2Q4TA 2YASA 2Z8YA 3C85A 3MSCA 3TLKA 1RRCA 2LCFA 1TUBA 1WOMA 2YZGA 2QF7A 4J29A 1DEHA 3HBMA 2GRLA 1EVYA 2R1ZA 3QPWA 4LBZA 1E62A 4KYTA 5TARA 4RNCA 5A7HA 2BN4A 4YAEA 2FJUA 4IIXA 3F67A 3G2QA 1XV5A 2JAXA 3C7KA 2YIDA 3W2HA 4BQRA 4YRGA 1OB2A 1A95A 1NHWA 4ZFNA 1NZFA 4UNIA 1I6WA 2RHJA 4MAAA 1L5OA 3AF1A 1SVOA 3CSSA 1PQWA 4KODA 3E05A 4HI0E 4P98A 4B3HA 2BGMA 1BFUA 1T5SA 2WG1A 2WINI 3QVJA 4RTLA 2WJJA 5DP2A 5G0WA 3IE0A 2B5OA 3R23A 2BGKA 2A5FA 3KE8A 3RSSA 2GHRA 1FXWA 4N7BA 3PL5A 2IU0A 1W4BA 4QLOA 5A5VA 1TYEB 1FUIA 4ARBA 2FUKA 3AF0A 4REQB 1XXHE 1LH0A 1F4VA 3ANXA 3JD2A 4MP8A 5DEOA 4QEKA 4WOPA 4C5BA 1V6AA 5CB4B 1HV8A 1NT2A 1UXJA 2BUCA 3DEAA 4GXRA 4OJYA 1L5NA 1IAQA 1KWKA 4JELA 4RYLA 4XWYA 3ANMA 2WHYA 4JI2B 4IYJA 1G4HA 3L7YA 4DNOA 1NT4A 1JQEA 1L5HA 2G76A 4CM3A 4BNFA 3NM5A 1ZVQA 2C98A 2JBHA 4NCXA 4YQFA 4ZCQA 2ZJ5A 2QRUA 3QUBA 4D74A 2P5SA 5BV7A 2C9DA 3LQYA 5F12A 2AW3A 2PJUA 1L5RA 3E15A 3T6KA 3RS0A 4DCNA 1A2BA 1JFRA 4C08A 1KIAA 4J43A 2PFSA 3EIHA 1W2WB 2BHTA 2VXBA 4U2CA 2EJBA 1L1FA 3AVUA 4GM0A 2P68A 1Q7CA 1SVUA 1H1DA 4KEAA 5A71A 3C6BA 3V8MA 2WWYA 4YV0A 3TJMA 1CNFA 3GFOA 5J9FA 3E8SA 3K5HA 4KH0A 4JLWA 2O06A 2ONCA 3QEOA 1RWXA 2ZYHA 3ROPA 1LV7A 5AWFC 2B1QA 3V4FA 4C1NA 4QREA 1ESCA 1Y4AE 1OKKA 1QFSA 1Q83A 1WD7A 3FAZA 3U4HA 3A9SA 4DIKA 2VJLA 4X9XA 1CUYA 2HA4A 3DOJA 1ZOLA 4FP9A 2WSYB 3SXPA 5A9SA 1QHFA 5ALTA 1ZH8A 2B1RA 5K03A 2FJ0A 1UXIA 4GX1A 4RK6A 4ZPXA 3UK6A 3ZNQA 2AMVA 3VNQA 3WBKA 1L4HA 5BR8B 3IDFA 5KBYA 1CUHA 1R0BA 2F17A 3E3AA 4RK1A 3BA1A 3I73A 4ZVTA 1W5TA 4YJ3A 3DB2A 3DUFA 1ZG3A 3FD8A 3I0NA 3OT1A 2F43A 1HRDA 1Q7EA 3IKJA 3UMYA 2FCAA 2JIMA 1N2GA 3DT9A 2B3DA 4IHJF 4MRVA 4PICA 4CM5A 4YRQA 4DMHA 1SOMA 1Z5OA 1UKYA 3UJNA 5CVEA 4IQFA 3P9NA 1Q7GA 4QHTA 1L7BA 2G0TA 4RZ2A 3K0SA 4ME6A 2ZE7A 4RM3A 2LDBA 3H7AA 3IEXA 2PBZA 4MVWA 2OFFA 3QZUA 4NYJR 4OKNA 2IC5A 4NNJA 1XQXA 5LC1A 3WB1A 2XCSB 1O0BA 3DFFA 4G25A 2O8DB 1EXMA 2X41A 2RHBA 4Y2XA 2EJTA 1JHYA 1OH6A 5LXTF 3OY2A 1CUIA 4W9NA 3DG9A 2B94A 1A9YA 3LG2A 1BXZA 3JQBC 2C1EA 2W2PA 2YOFA 3L6RA 3Q41A 2C82A 1ZK1A 1SU8A 2GWHA 3TGWA 1AUOA 4RKEA 3TKYA 4EFNA 5ICFA 3SNHA 5HQ3B 4K6OA 3EQ7A 2A0XA 2QW1A 2EOAA 4AZ3A 2OFYA 1GQQA 1AXRA 1SXJC 1XU4A 2EZTA 1B15A 1P1BA 2JLQA 2RI1A 1Q11A 4M8SA 5AW5A 3JQCA 4UHKA 5JALA 2RH4A 1RYEA 2A59A 1Y5IA 2V96A 1LSSA 4FBLA 3ZE8A 4CNQA 1DTEA 1X86B 1RPEL 3B12A 1XUOA 3KYCB 2AH5A 4DLZA 1QV7A 1GPDG 5DHTA 4B79A 4PZYA 4MWGA 4HOYA 1UEXC 3QWAA 4UMEA 4D3SA 4DBLC 2QROA 3A1UA 4JCXA 2VO1A 5KDOA 3TSYA 4NI5A 1MRZA 4OLJA 4RK5A 4OI1A 3HDHA 3ZV7A 3LV8A 1PT9A 3D3JA 3R7NA 4OP2A 1W6RA 2CJFA 2G1KA 1PFKA 2EJVA 3RHSA 3L01A 5L3QB 4YUWA 1NVTA 4P4NA 4JLJA 5FWYB 3FPAA 4F91B 3B1FA 1DHTA 2VHQA 1US8A 1E7SA 2BFEA 2KYRA 1YVUA 1B0UA 3OUZA 1U8AA 2BHRA 1IN1A 1WX1A 4PQYA 1WSDA 3VYUB 4GE3A 6REQA 1PGNA 2PJZA 1GFWA 1P7WA 3O6VA 1Z6AA 4Z5HA 4Q6WA 1Z0AA 2FPIB 1TM7E 4IJKA 4PLWA 3OBIA 1F0KA 5K0TA 4LDJA 4EABA 2V97A 5DTRA 1SKAA 3KXLA 4HNQA 3RJZA 2Z9CA 1XZIA 1OFTA 1N6PA 2NU6B 4OHYA 1OH8A 1MVNA 2MIIA 5TV2A 4CL0A 4L6AA 1SO8A 1Y5RA 2JS7A 4FJ1A 1E2LA 2YHUA 5BV2P 4DGQA 5K05A 2GK7A 3F52A 4UHJA 3SX0A 1M3SA 1PYGA 2XQJA 2BEJA 2QYHA 3PC2A 3TO5A 1T5IA 1RKVA 1A1SA 1J70A 1K4YA 1PT7A 2I67A 2QRNA 1AN9A 2WIDA 4X84A 4ZQIA 3UOGA 2PDAA 3HUDA 3VO1A 5A4JA 2XWJI 5LJIA 3BREA 1GU0A 1P5FA 1EB9A 1J21A 2Q28A 5GAGi 3OFNA 1QHHA 2VQFB 4EFKA 1OV6A 1EFLA 4RMGA 2OSVA 4IX9A 3ZW8A 1JXMA 3HLYA 4X7BA 4ZODA 1HT2E 2R6FA 4OXRA 4F84A 4PR3A 4MLCA 3BQ9A 1SOUA 2HUNA 1C4WA 1BU8A 4A1FA 1VLLA 1BMFA 1KJIA 2PSHA 1UM8A 4DR2B 1JEQB 2KHZA 4ZYYA 2PIDA 4HNAB 1SKUA 2VF2A 3F4KA 4HUQA 5CX1A 3WSTA 1EYZA 2QZ9A 3RROA 1DW9A 4D0SA 4B84A 5AH0A 2WPDA 3UXMA 1JB9A 4X4GA 4UUMA 3N75A 1I7SB 3ORYA 3AG5A 1M2GA 2HK8A 5KX5B 4CEJB 1E9DA 3T7TA 2RHMA 2ZIGA 5HR5A 4JI8B 2BTEA 3DEYX 5LUAA 5FYDA 2H31A 4YV1A 5AK4A 3E4CA 1HTWA 2Z5LA 4EY3A 4CQMD 5IFLA 1CY6A 4NYMR 1BN7A 4TYWA 4Y2GA 1H3FA 1PFYA 4ITRC 1TI7A 2OENG 2Q3JA 4OFWA 4XKJA 4I9UA 4D9NA 2NYRA 5KKCA 1JEEA 1FYFA 3VYVA 1C2TA 3T4EA 1EP1B 4IF6A 4P82A 2ZYIA 3ROGA 1QR2A 4TUYF 5CFZA 5ITWA 1IPFA 4CIBA 2OT3B 1QDLB 3RRJA 3FPFA 4IFBA 3SM3A 1C8BA 1VMDA 1GPUA 1JDUA 1W5EA 1UJCA 2OAQ1 4BJ6A 5CFRA 5I48A 1T8TA 1GQRA 3RJ9A 3CINA 4MPRA 4U7FA 5F78A 1M2NA 4LFBB 1UFKA 2FP4A 1JE1A 4DL9A 4JFAA 3FMIA 3W2GA 1CK4A 1JYEA 2HF7A 4O5OA 4EZIA 4QDJA 1UBEA 3O2JA 2I7VA 5EHNA 3WLFA 1GNPA 1PQ4A 3G2IA 3KJNA 4ND6A 3LUKA 1KI8A 4F60A 1NSFA 2AQKA 1E79A 1Z7YA 1U2GA 2FETA 1YC5A 3EXIB 4Y6GB 2E4UA 2IYWA 2H48A 2QMHA 1N1GA 3QBJA 1K89A 3FNEA 2R63A 3L0ZA 2GM9A 2H9YA 3CZ5A 3PRYA 4CHTA 2X15A 4EHIA 2P7IA 2VWHA 3M3HA 4N6OA 1LW7A 2KLBA 2QGFA 2WKPA 4XCQA 5U4QA 1G7SA 2CHGA 2B7CA 2C4TA 2WD8A 4YY3B 4BNUA 2GRJA 2FFHA 1EINA 3WP1B 4KHPB 1XL1A 1C9DB 2DBVO 5BN3A 2GRAA 1WQ1R 1T34A 4RX1A 1XHFA 2BKUA 2OHOA 2P79A 4E08A 5JJKA 3WMEA 1BWQA 1OLUA 2ACWA 4J90A 1H93A 2V74B 3VI4B 1OR8A 3DMYA 3BKXA 3AT1A 3RHFA 2Y27A 3VAYA 1NR5A 3AM3A 5SY4A 3MCAA 2G0NA 2P2CA 3T5GA 1TA9A 1RHUA 3AJDA 4LKOA 4LIPD 3GLVA 1WVMA 1T1EA 2QAGB 1N0IA 1FRZA 2IODA 3QLTA 4TMVA 2J4FA 2P1RA 3QFSA 1WXIA 3LIPA 3I8XA 1E3LA 2CC2A 1DJOA 1OJLA 1SU6A 1VA4A 2C0CA 2D5AA 2Q46A 2WIGA 3G0BA 3MJHA 4UU1A 2XECA 1NM5A 2FWBA 1LPAB 1BVUA 5GONA 4DTCA 1D04A 3FIJA 2JIZD 2PA0A 3EVBA 4RWZA 2WTUA 1X9GA 1UUFA 4A0SA 5F7OA 3OE5A 1U1CA 1EFCA 1RYNA 1UDRA 4BP3A 1BD4A 4HSEA 2HH9A 3H2YA 3KWMA 1VQ1A 5CIQA 4EG8A 3MLBA 1O97C 4LDQA 1RBQA 3RVJA 1LW6E 2PMCA 4QE3A 3MCWA 1FW8A 1NVXQ 2PWZA 3CR3C 4A2PA 4XVCA 3QMMA 4KMMA 1RJEA 1CYDA 5EE0A 5DJ5A 4DCPA 4C87A 5AK3A 4YB8A 1FFXB 2VSNA 4F3NA 3RS5A 3LK6A 2FE4A 5F52A 3MYYA 3TB4A 1Q1QA 4RHUA 2IZ7A 2YWDA 1T5DX 4L4UA 5K99A 4B46A 1EESA 2MSWA 5IZ4A 3Q4GA 1G6HA 3CCFA 3EASA 4DRZA 4QECA 1W1WA 3HC7A 2OYSA 1G21A 4YRPA 3VU8A 1E2PA 1RM5A 4DMFA 3B7HA 3ZGYA 4PAQA 5C32A 4ND3A 1JU4A 3ACBA 1QOPB 1WV1A 4PWYA 5T8KA 4B80A 3C8HA 5KNDA 4B3IA 4A10A 2PSSA 2ZUDA 3CLTD 1OXSC 3L49A 2VF8A 4WADA 3N74A 1BCRA 1MA3A 3KYBA 4UAGA 5EXEA 1NBME 4WZAE 3SLKA 2W6CX 3I9FA 1R6AA 4IIJA 4TKVA 5J2UB 4UCQA 4A8TA 1KVRA 3ANNA 1XQVA 3K0FB 2RC5A 4BO7A 3UWKA 4IGKA 3I23A 1XZAA 3JAKB 3KB8A 1T1IA 1F3OA 1G8HA 1GSIA 1JSRA 3O9ZA 3WDKA 2Q3HA 1U28C 2H5IA 2ORYA 4ZMSA 4CIAA 2N9UA 2C7GA 4MYCA 3ZEIA 3QITA 4EITA 3U3WA 2C8LA 2G9ZA 3ROKA 4CGYA 2QRKA 1M2JA 4L57A 5I45A 4YUAA 3F3YA 4FYWA 3F6YA 1CUBA 4CTJA 1KPIA 3CROL 4EYSA 1MX9A 1U9IC 2G06A 3DQQA 5LYJA 1TM5E 4BNNA 4ZCIA 4BNGA 2Z6QA 2ZZMA 3LGSA 2XZTA 2UUOA 2WJGA 2W6QA 4MARA 5F9HA 4UTPA 1IBCA 1UPFA 2WOOA 3GPLA 2HLHA 5K6TA 3I1JA 4JGGA 3W1EA 1LNQA 1VPVA 1ZRHA 3UC5A 2WUFA 1C30B 4XIGS 1SXGA 3F8WA 3MS4A 3ACCA 4HN9A 1UXKA 2MSLA 4UULA 4EG3A 3L3BA 3NDJA 3WLQA 4DR4B 3L1IA 4EQZA 4X1YB 5FBQB 1E2HA 3CIFA 4HGYA 1QRUA 1JHUA 1G8YA 2FZGA 2NO6A 4TXJA 2IL1A 2RGBA 2UYOA 1SRRA 1T2EA 4ARAA 1CPYA 3FROA 4LVCA 3EFOB 4QRHA 4PRZA 3AX6A 5GAJA 5D2CA 2JLVA 1LDYA 2ZAMA 1V96A 3HXLA 1Y9JA 3LK7A 4CQMB 2P0EA 4FYHA 1PW7A 4X6UA 3ZY6A 4HN4B 3Q3VA 2XKJE 3SZGA 1POWA 4E5KA 1QHNA 2P9JA 2ICPA 4F72A 2X7XA 1I2MA 2VSXA 1BA2A 5FR1A 1BHSA 5MFPA 3BZUA 4M0KA 4NATA 3ZD7A 1AF7A 1GFZA 5F9MA 3ZVKA 4TWZA 1CQIB 1G8SA 1QLWA 3SC6A 2IEZA 4P3KA 2I4OA 2Z56A 5AUOB 5J58A 1D2NA 4NCAA 4M83A 4URXR 1T8PA 5F7ZA 3DE6X 2VG8A 3VSBA 2A9RA 4D1YA 1KJYA 3ZHRA 1JGTA 3TD9A 2F1IA 1UC8A 2WM2A 4K9LA 3IDQA 4WY2A 3ZE7A 3E22A 4B8WA 1HYEA 3M6VA 5ALSA 2VA8A 5KTRA 2TECE 4FHZA 4U2GA 4HQ0A 1YGYA 1Y34E 4YS6A 4KXQA 5JNWA 1XPOA 4KWEA 1EHCA 2LDXA 3KCQA 3CJRA 3K2EA 1CD5A 3B6ZA 4QTZA 5EESA 4MW1A 4F92B 2WWVD 3GJ4A 1ZW1A 2RI0A 1NXWA 3E23A 2H5LA 4JU8A 3OLCX 4X1IB 1J2TA 2IY7A 1X1BA 3PEUA 3O21A 2O7VA 1DWPA 4GI2A 4J75A 3EK2A 4N3GA 4R54A 1NBIA 1ODFA 1UK9A 4TMFA 4F0JA 2QMEA 2ZIEA 3HJRA 3L8CA 4P08A 3S4YA 2Q1UA 1KAEA 5KNBH 3KBBA 4Q9DA 3V6LA 2GQ0A 3QOYA 1JIVA 3ENQA 5AICA 1XR3A 4CLEA 1M73E 4YCMA 1PRVA 2P9CA 1JR3E 2ATVA 2EZUA 4NMWA 3TUIC 2QD3A 1NJ8A 1NYLA 2WF9A 2J6HA 4I6TA 4Y3UA 1QLHA 2ILVA 4B44A 3HS3A 1X70A 1NOJA 4ER6A 3GR6A 3LE8A 3PIRA 1DT3A 1XJCA 4M8KA 4X7PA 2G3YA 1WZ2A 4A4DA 3ZNNA 1OHHA 1U2DA 1J9GA 3JCZA 3PK0A 3C7CB 4B82A 1X7XA 1FYXA 2ZIUB 1DAHA 3Q9NA 3R6TA 4GX2A 4AY4A 4MVJA 3EXHA 2BFNA 3GAMA 3TBKA 1II8B 2VH1A 4U5XA 3OKFA 1B6GA 1V2GA 1IPHA 1GT6A 1ESDA 2B34A 1U98A 1QYXA 5DI9A 5DK4A 5LMZA 2HRBA 2J09A 2IDKA 2DWCA 4R41A 2WPNA 1FA9A 1UBLS 4XCXA 5EP2A 4BY9E 3VKHA 1A8SA 3VPGA 2PZLA 2EF8A 2CBGA 1PE0A 1SHKA 1CCWA 2HBRA 3HJBA 1P4GA 4CT5A 1T9CA 3GNSA 2YXLA 1W4CA 1NUUA 2WZQA 4FW8A 4GGPA 5JSFA 3SQWA 1RHRA 2DG2A 3CUVA 3AW8A 1NULA 1P0CA 1T5HX 1X7ZB 3O90A 5B36A 1FU8A 3KCNA 2OL4A 4M21A 3R7LA 1ZGBA 2QP4A 1Q0SA 3K09C 4LYJA 3RSOA 2W2XA 2FU5C 5F4BA 2GHQA 1N2EA 3C6KA 2JJ8A 2ZSAA 5BN1A 2IP1A 1E3SA 1N2CA 1YNOA 3SICE 4X64B 3ZUGA 1ENOA 4DABA 2CDNA 3FSEA 3WK7A 2ZBFA 5K0GA 3CVVA 1QG2A 1PJ8A 3ZGNA 1SUIA 2B1GA 3MOSA 1QAOA 3EPPA 4MQEA 1C3EA 4MQMA 4YRNA 2I2DA 4MV0A 1R37A 2X5XA 5FTLA 5LP6A 4HNHA 1VC2A 2C0QA 2DPXA 4JD5A 4CKEA 1SCAA 1FNNA 1BFKA 1NG1A 3RE1A 3AJRA 3LLUA 2OAEA 2XD4A 4U7WA 5EUQB 1YQUA 3QF4A 3A7EA 3EXEB 5MDHA 2RHRA 1NRIA 2ZJFA 2ZEJA 2A58A 1H0KA 3N2GA 1ILEA 5IARA 3ZQ4A 1NPDA 1TJYA 4GM1A 3KELA 3EVTA 3AWIA 3OQIA 3DH0A 4B74A 2G77B 3X2SA 2AE2A 5KHOC 1YQGA 2ODEA 4M1OA 1UOQA 2GCEA 2GZHA 3CZ9A 5DM60 2J3EA 1NX6A 2YZ7A 3ZU2A 1P73A 4RTJA 3TQQA 1OVGA 4K6GA 1E69A 4OSEA 2VYND 2REQA 2V55B 2D0PB 1QTQA 4EKGA 3MQ4A 1RAEA 1O4VA 3VJMA 1X1EA 1GD1O 1JFVA 2CHVA 1VHLA 4L5JA 4QL3A 3U7QA 5C35A 1ORTA 3AHHA 1LBTA 4DE8A 3IR5A 4JB8A 2OK7A 2JDIA 2BD0A 1X2LA 3ZWYA 4FSDA 4DA7A 4C7JA 2XYHA 2FZVA 4YJ2B 4PAOA 3HCNA 1G4UR 1K7FB 3JPWA 2VBGA 3R7WA 4B4VA 2GAAA 3HNPA 4TXNA 1P4RA 3G2NA 3K0AB 3RC3A 4QVIA 1EIZA 4XGNA 1E2QA 1J00A 1W52X 4O6VA 3VZCA 3QELA 5LNK6 1N36B 3IT2A 1RW4A 3SKXA 2RGWA 1J0AA 4DNXA 4F4UA 1G3UA 4FGUA 4HXGA 1NEQA 4PC2A 1ESMA 5AI4A 4OMUA 3RNLA 4H3HB 4RENA 2ZBUA 3FJOA 2W43A 3GOHA 4TMYA 3QV2A 2I99A 4I3FA 3HXOA 3B60A 3HFRA 5CNJA 2H8RA 2B5AA 2ZRCA 3OZWA 4BTLA 2R2AA 1PNVA 2HADA 1ZM7A 5EEHA 2QU8A 3P32A 3JD0A 1QORA 3KJFA 1E1CA 1EGHA 1ELOA 1I7DA 2P6UA 2VPWA 1O4WA 3KO8A 4HZGA 4WXMA 1NQOA 2CL6X 3N2KB 1MRSA 5A4KA 3OHMA 2NU8A 2V1UA 1HOXA 3DQPA 3FKSD 3DB1A 1BAPA 4B83A 3BE8A 2GF2A 2ZSFA 4JHXA 4M1KA 2YWEA 1X39A 3LPCA 4AY6A 1KO7A 4CBVA 1TXGA 3IO3A 1PJLA 2RKWA 4CHGA 2HGZA 4MV9A 4A7PA 4AKTA 3ZK9A 5HJ2A 4CG2A 1CJKC 5CFLA 3PNLA 2WA2A 2VK8A 4B7ZA 4W5NA 4JI1B 2HCRA 3GLIA 4OP3A 3B36A 3VMFA 3GN2A 1P1CA 3GLGA 1ORDA 1QYVA 3N8HA 1RYFA 3PC7A 2YMLA 4IO1A 4RDIA 3FDZB 3T1OA 3V1NA 4MJ7A 2OZPA 3ED5A 2IHJA 1Z0UA 5EIOA 3R7BA 3TBFA 2B92A 4AVYA 5GTDA 2PXXA 3CRQA 3N5CA 1H1LB 4AKHA 3KKQA 5K3EA 3STWA 1IXRC 1D09A 1C81A 2FW6A 3A05A 3S1SA 2XKBA 4MEBA 4PLVA 2ZT6A 2WB2A 1GL3A 3DXZA 3ZHBA 2IPOA 3IFSA 1P7PA 1ULZA 4CQJA 4X45A 2H17A 4MHTA 1SG6A 2B37A 3KKOA 3O38A 4II7A 5AK6A 2DBRA 2QGZA 1N5OX 5SYMA 4I4TB 3ZPXA 1HFEL 4YMHA 1FYVA 4NOJA 1AKWA 2QSJA 3FPKA 3PHLA 5MN5A 2FP3A 5JNTA 3H1FA 2QSUA 2DTEA 3B7PA 2CNNA 3CUSA 3PR2B 1XX6A 4LCEA 4IGAA 4AQYB 3F4LA 1CUDA 4M9QA 3WKBA 1EXDA 2CNLA 3E4DA 1LPSA 1OX4B 2ARKA 2CW5A 4L8YA 1ST2A 3UK2A 4LF9B 4GLFA 2EVWX 4BN4A 5IF9A 3U3JA 4U00A 3TINA 1VL1A 2GEVA 1ISPA 3EIEA 3U4MA 4KR9A 4LYAA 2FSPA 5IBCA 4K5QA 1DMSA 5AIAA 3M5CA 4PN3A 2W90A 1FU7A 1VI5A 1NFFA 2PK3A 2M4HA 1PV4A 3PGA1 7MHTA 4BO5A 3KKKA 5FP0A 1TM4E 5KDDA 3OLYA 3MRVA 4URFA 4JLVA 3MT8A 1EUZA 4BEBA 4AECA 3THSA 2FWPA 3OESA 5T4BA 1JIJA 4MYRA 4CTOA 1G2PA 5KINB 3QM1A 1GRVA 1I51A 5FJIA 2F3RA 4Y2RA 2QTHA 5AXAA 2A0WA 5BVGA 5LVAA 4CCSA 4S2UA 1NFQA 1NVUQ 3VU3A 5KOHB 1H23A 4ZT6A 1E5DA 3QXHA 4M2LA 1TM3E 4HDQB 3W6NA 1HZJA 1LWOA 1SOVA 1LTHR 2G4LA 1A8IA 4TXLA 1ISFA 1X1RA 3KUCA 4YRZA 4NBKA 1WXEA 2X9NA 5A2GA 3G5GA 1E7WA 3EC2A 5JCXA 3PV0A 1YB5A 4GUDA 2LLWA 4TL6A 2RMKA 1MQSA 1ZIOA 4RKFA 1NVEA 2BEUB 3KG2A 3CLUC 4YUYA 3LBYA 3AUTA 1WWKA 4F2HA 4YPVA 1A97A 2NQ8A 5IW8A 1PUXA 2OBBA 1AF4A 1O03A 1OUMA 4HDMB 5DULA 3ZQ6A 4JI5B 3DP7A 5L6LB 2R8EA 3HWSA 3W3AA 1DDIA 4UBMA 3ONWA 3DPSA 1IBSA 1CQJB 4UCFA 2WUDA 3IQZA 4TMTA 2JIZA 5ALXA 5KSYA 5JO9A 2WKSA 1QVAA 2CHUA 5FADA 3EEOA 1HEYA 2X1HA 4PNEA 3WTCA 2ZTSA 4ND7A 1N6RA 1L4GA 1RS0A 3PA8A 2D2XA 3EDYA 4RVUA 3I05A 1DELA 3R9XB 4HQKA 3IQWA 4L07A 2PS1A 2C57A 4IKPA 3WLRA 5CAEA 5KNCD 2WICA 1AU9A 1Z4IA 2GB4A 3MAGA 3WY9A 4YJ3F 1I4TD 2Q8PA 1HF0A 2RONA 3EULA 2HO4A 4H0NA 5KNCH 1RZRD 1YMVA 4BQOA 2FMHA 4DF3A 3C6ZA 3P9IA 2RK3A 1TA0A 3AB3A 1JHMA 1X7DA 1DC8A 2GN4A 4JSYA 4HC4A 4FYJA 4TL9A 4Q2JA 4IWRA 4HB4A 2NTJA 1X15A 2VKQA 1LTKA 1QJCA 1VE7A 1ZU5A 2CYCA 2HA3A 4JLMA 3FOFC 1ADJA 3ZDEA 3WNCA 5AVJA 3VNAA 2AC2A 3UK1A 4RBNA 3MTAA 4OQLA 4RS4A 2A35A 4FOOA 3IP1A 4NFLA 4TV9F 4PINA 3MJTA 5D5PA 2VPYA 1MJ5A 3ODPA 1EHIA 1XCLA 3O1IC 5KYWB 3V80A 1NV8A 4CMIB 3S6JA 3ECCA 4J0JA 5FTMA 2F2TA 1BH2A 4IIVA 1S5PA 3SCGA 3DC7A 4C4ZA 3EDMA 1U3DA 1LK0A 5BO5A 3E48A 3GA0A 5CD1A 1Y3HA 5TEVA 4TRMA 3NS7A 1CUFA 2J9GA 4DFDA 1OXUA 3N6RA 3PC8C 4FGZA 4O2BA 3O9VA 4OSOA 1ZJWA 4OHVA 3SOPA 4HQRA 1RXUA 2Q5FA 2JHGA 3BMOB 4ZGGA 1KP9A 3F5SA 3IE2A 4P3NA 4XIYA 1VB5A 3PG5A 1KDVA 3V8EA 1QPBA 2F90A 3H5NA 1OI3A 3QSYA 5GV7A 1QIKA 3OETA 3K8OE 1FP4A 3ML1A 5DOZA 3GEEA 4RDHA 3V6MA 2XRZA 2YICA 3GZDC 1XP8A 2HK7A 3DW3X 1HDEA 1Z7BA 2OXCA 2W37A 4RPCA 4C88A 4EJ2A 3HI6A 4IZHA 3KZMA 2EWWA 4H0FA 4C1BA 3R0XA 1V39A 4ND1A 5E6RB 3L5OA 4JOQA 4M0EA 1MJGM 2DQ4A 4J7CA 3U7JA 1SCNE 3EEYA 5IASA 2QM3A 5LJLA 1TC1A 4RIGA 2YWHA 3N1UA 1U2RA 2ZRLA 5CA1F 1YR9A 2DSTA 4MZDA 3KFVA 4O4IB 5JXGA 3W8RA 5C3MA 1JF8A 3K4QA 4HDNA 5F5XA 4B3SB 4A0FA 4J2OA 2FMTA 2YBDA 4BN5A 1UCFA 5K8LA 1OXXK 3E0QA 4EQ6A 2P2YA 3L04A 5JFOA 2XDQB 1CZHA 2W6IA 1PL0A 2XNSA 5FTNA 4CETA 5CDHA 5F2KA 5TS3A 3IB3A 3V8RA 1YTUA 4LJRA 2D4AA 2G9RA 3A1EA 4MWBA 2ZYVX 2X77A 3QX9A 4L0MA 4O4LF 5AXCA 2XW6A 5T6BA 3OO1A 3HXMA 1XVUA 1M1YE 2X2FA 3JRWA 1E20A 3Q7PA 5DHAA 5IBPA 4XPIA 4MXDA 2HLPA 2F1HA 2XVXA 1ECCA 1K7EB 2X0KA 5EXPA 3I62A 1GITA 1NMXA 2Q9UA 1RZSA 1HXHA 5D5HA 2JANA 3BE6A 3LU1A 1U1FA 2VDNB 3GLUA 4LOLA 1JP7A 3M4ZA 5I4KA 5K0BA 1XCOA 1YZNA 2ESRA 2DC1A 1A9SA 13PKA 1C4OA 1NLMA 4D79A 3ZH2A 3U7EB 3SF0A 4I3HA 2IEGA 3LX6A 4IOMA 5JUWA 1A71A 4HH3C 4DJFC 3HRKA 3MINB 1MAHA 3PTLA 1YS1X 1FEZA 3PXBA 4NU6A 2RGAA 3B9RA 1AQ6A 3CZPA 3OJ0A 3PJEA 4BNHA 1CY4A 5IC5A 3HO8A 3LGAA 1W4RA 2DP4E 1P4SA 2GJ9A 3BF7A 2Q5IA 3C3BA 3I09A 4IUYA 4TYQA 4WNYA 5C7YA 2YCLA 1JZQA 2CK3A 3U49A 4ZYUA 6PFKA 5EJ9A 3ZHZA 3D6JA 2YW9A 4CLXA 1F4LA 2J3JA 2XIQA 4ZGWA 1U8EA 5L7WA 3ZDFA 4ZYWA 1VIMA 2ACEA 3ECAA 2R62A 1QQ6A 4RFSB 5H3LA 3GVIA 3K1AB 4LZPA 3IC5A 2RGUA 3KTFA 4WFJA 4C0JA 3ZKCA 1WZNA 5KNBA 1FXSA 3VZQA 3D7KA 2YHAA 1KBQA 4B8ZA 5U4XA 3FFWA 3ICQB 2QHXA 4E2ZA 5DT9A 2R8PA 2QLLA 1E4EB 4AJ4A 1C1DB 3JATA 4UM8B 3DMDA 1GPJA 1CJSA 1Q20A 2Q0SA 3BXXA 4HEA1 4QFDA 3CPJB 4RYDA 4UMFA 3UCFA 1JS1X 2R11A 1K3FA 5REQA 3JR3A 2H65A 1V1RB 1QMGA 1GYPA 5ALLA 4TWAA 4KZPA 1LLUA 4BMOB 1SXQA 4ENTA 3V7UA 4F4IA 1G7CA 5I4BA 2IX3A 4QIHA 1NUQA 3ILYA 5CH3A 4CQLB 2UYQA 2A5LA 4Z86A 4DR3B 3PXEA 3WLAA 2XCRB 3KX2A 4UTRA 1RCFA 1K66A 3BKWA 2C9YA 5K3SA 1JTFA 4NBUA 3NXSA 1ZUWA 5JR3A 1EBUA 3DNVB 3OOWA 4UTXA 2EV9A 3HZRA 1R16A 3UF0A 3UBMA 4QNNA 1SA0A 2HRRA 3U81A 3OLXA 1OC4A 3BZWA 3D4NA 5EUBA 3WGTA 5ADHA 3CNQS 4TLBA 3TRIA 2EKDA 1BW9A 4R1SA 4BVAA 1NMEA 1XD8A 5I4IA 3A4IA 4LRTB 1IY1A 4FNOA 4MCAA 3G89A 3DTVA 3D6TB 3NKLA 4XB2A 3RH0A 3SDBA 3X1KA 3L06A 2AUWA 2IPNA 4YLYA 1RD4A 4ARIA 2Y93A 1DQPA 1TA4A 1ZCAA 3KQSA 4KU4A 4QOIA 2IE0A 3WOVA 4DYVA 3R3HA 2F4VB 1WHSA 4GKJB 1WRBA 3B6MA 1RP7A 3AVOA 4D46A 4KIUA 1W2GA 1NMZA 2RDMA 4HWPA 2YZ2A 1N6NA 3ZDXB 1CDZA 1L5QA 4I50F 1GDHA 2F3SA 3OPQA 4ZALA 4V1CA 1G38A 3UT5B 4Q9JA 2B3TA 1R18A 4LV6A 1H94A 2HV8A 4RF3A 4RL6A 2HDWA 2NM0A 2VLIA 3ADPA 4RLFA 3AY6A 3E2PA 3JZIA 3VH1A 5G3ZA 3KOUA 2I78A 4PYLA 3WIBA 1BNCA 4X4BA 1GNSA 3KR0A 4KAFA 5AVQA 4ZHQB 2PXDA 3CH4B 3PICA 3EGDA 3R0VA 4QXAA 3UB4A 4HAOA 4LA4A 4UBLA 1JG7A 3UWSA 3WJ7A 1PFQA 1NW4A 3ESQA 5C80A 1CDDA 1JEJA 2XJ9A 2ZWIA 5L6MB 2CFTA 2QMZA 1VJ1A 1M8KA 3H7IA 4L0DA 5EWJA 1YVRA 4M1QA 2CDBA 2VN8A 4IJ6A 2MYTA 3A25A 1KSGA 3VC1A 1WBJB 1X0VA 3QE2A 3KYDA 5C52B 4OHPA 2BFOA 4JIMA 5H02A 3JWHA 4GQMA 1WS6A 3UH0A 3VPBA 3BICA 4B4OA 3A8TA 3TLEA 1SOWA 3M5DA 5EIBC 2Z98A 2GS9A 1O58A 2I80A 2OB1A 1QRRA 1YCHA 2D59A 4EA9A 2W2OA 3F1KA 4ZDJA 3CRNA 3K9WA 1YMQA 4DDWA 3GB9A 1U2PA 2IJGX 1AGXA 4XXHA 5E8RA 2MR6A 3HR7A 5E4YA 3BGDA 2W4QA 4KVAA 4PSUA 1UFQA 1CUGA 1WVGA 5LA6B 4E13A 1W5AA 3QWIA 4H4CA 5CDUA 1W36B 1U1EA 2DZDA 3DVAA 2GNAA 4GYJA 1Z38A 2CE2X 4PNHA 3PFFA 5I9LA 1ZGZA 1AZLA 2HD4A 1N7HA 1SULA 3GRRA 4UXHA 5EKTA 2FPGB 3JQFC 4CN9A 3O4VA 1V26A 2FEKA 5A4DA 2PXLA 3BFKA 1B0NA 3PQ8A 3ICCA 1RJWA 3DF9A 4G37A 4RIFA 1JH8A 4Y1RA 1SB9A 4OFXA 3L84A 5DMHA 3MT9A 1S01A 4M76B 1P0QA 1GDDA 1NURA 1WKVA 3AI1A 3F90A 4AXBA 4N0PA 5JH7F 3PP8A 3TXAA 5CDGA 1E1LA 1E1QA 2WOJA 1JEOA 2BLNA 1A9ZA 1NE2A 5IT0A 5I9SA 3RCBA 3B6JA 1GNQA 4D5EA 4GFDA 1W0CA 3AR7A 4GMDA 1M6WA 4C07A 4D3DA 1AVTA 2Z1DA 3ZXYA 1DAEA 3H5VA 4IIJF 4FOSA 4MI3A 2JAOA 2GARA 3T1TA 4FZRA 1U5AA 1VJ5A 1EAMA 1L8XA 4ROSA 2BFBB 3FMGA 4JMLA 5TQJA 4YRMA 5TPZA 3I04M 3BHNA 3T3HA 2J32A 4EG7A 5KJ1A 3U3OA 1R3DA 1EB8A 1EUCA 5C31A 5BPHA 3FKSA 1SIWA 4KLRA 3QFFA 3NROA 3F7MA 5A03A 3LH5A 4YCAA 3EDCA 4TGLA 4XH9B 3JD4A 2H1HA 2F8TA 1BH6A 1IBMB 4YMUA 2P8JA 4ASUA 1DT5A 1GGFA 4HRAA 4L3OA 4F7DA 2OXTA 3KKEA 3U4DA 4DM7A 1IJBA 1OXVA 4KGDA 4B45A 4DR7B 4K40A 3TIFA 1IQPA 3ZD9A 5C5EA 1NI5A 5KCMA 1V1JA 4KSCA 4TYPA 3VKGA 3G5TA 3D3EA 4EB0A 2FZKA 3WNBA 2J0VA 3QW2A 4Z2AA 5CEEA 3SHTA 1LD3A 2G5TA 3I1FA 4QYWA 3KT6A 2OM6A 2ZIXA 1NMQA 4TPKA 1RIIA 1CF4A 1EZ1A 1U0FA 4F93B 2G6BA 5JXIA 3PHGA 1OGJA 1F60A 3CMMA 1Z63A 3OZBA 1BKSB 1Z39A 1G9TA 3GJTA 1JSXA 5EPEA 3RYHA 4R8SA 1H8ED 2ZPUA 1C1YA 4KAXA 4B09A 3B78A 2BSQA 1L5HB 3BXPA 2IV2X 5HRCA 3JZFA 1Y4DE 1CC1S 3EG9B 1BOOA 2IDJA 4ZKEA 3ERCA 2J48A 4RE5A 5B1HA 2ZM5A 1GAJA 4D3YA 2J3MA 2WDZA 3PDJA 2B4KA 2MSCB 4YQZA 5I01A 2DFNA 3K70D 5D7NA 1A9RA 1GTL1 4DZRA 3C7DB 3T7EA 3ET4A 1G3QA 2ADMA 2EP8A 3C8UA 1XDGA 3CH5A 5EE3A 3LP5A 5AJHA 3WMRA 5I9IA 2JLRA 1KP2A 1T0JB 1R9MA 4KLNA 1U9YA 4BNTA 1LMB3 5KX5F 2HWWA 1QVZA 5AM4A 2XMQA 4YJHA 1IM2A 3QU9A 2G1JA 1CUXA 4J0DA 3G8AA 1PS0A 1KY3A 1T2NA 4HG2A 2EBHX 4R01A 4ZVNA 5BYAA 2JGMA 4MW9A 2RGCA 3KM0A 4D96A 4KRXA 2SBTA 1ULUA 1ECLA 4JYPA 3LC7O 4H31A 4Z8XA 1G64A 1L7RA 3EZ7A 5E1BA 5J47A 3AR3A 3A9YA 4W5QA 2OECA 2RGEA 4XD7D 3I2FA 3P4XA 4K9DA 2RGGA 1C3OA 2YWGA 3PX7A 4KWHA 3FN4A 2JI7A 1YRBA 1A2OA 3C8MA 4J7XA 4XOIA 3V1LA 2D6FA 2H08A 1KI6A 4FBMA 1U2TA 3KL4A 1UBUS 5FA5A 2HNAA 3F6BX 2V5UA 2PUCA 5E2AA 2VDUE 4RTNA 4NU0A 4DY4A 1NF8A 1PKEA 1DE0A 2F43B 2PWBA 3DM9B 3FHCB 4KIGA 5F76A 1MPTA 1W8IA 3GLQA 3DLPX 2H0AA 4R71A 3T34A 4AD8A 3L4KA 1JFTA 1E0KA 1KI2A 3WGZA 2OBMA 5E1MA 3SF8A 4XYEA 2NQTA 3CNNA 3EWSA 4TSFA 4W8GA 3R44A 3UAWA 1X7HA 3SX4A 4B3CA 2FFJA 4CT4B 1ZCZA 3M2TA 4Q1FA 1ZZBA 1D3AA 1X7WA 3OKCA 2XE6A 1HMYA 4K9NA 4PGMA 4CF5A 1Q14A 1FMCA 1LS1A 2F64A 3HJUA 1PERL 4FBGA 3BGVA 4G5RA 4L28A 2D5IA 3CF6R 3CZAA 4UEOA 3T3NA 3CNBA 2XGOA 1ADFA 1PYDA 4OKSA 1OT5A 2QI9F 3GFRA 2IIBA 4IJQA 4YMSA 1AJEA 4N0QA 2CZGA 1N25A 1Y7IA 1FL9A 2HA0A 4CMEC 2RB5A 4DLRA 4QYIB 3SHQA 3H1TA 4OQZA 4OGKA 3WRXC 4NMXB 5KNCA 3QVLA 3B5IA 1XDDA 1RZRA 1YK0A 3PSAA 5TX7A 4UM9B 5C1BA 4NFYA 2AZXA 3C70A 2HPZA 2H7CA 2ODNA 2R1VB 2FPUA 4QXQA 4O8BA 4R8RA 5HTKA 2QXUA 5E4JA 4E88A 1IYZA 2CGEA 2Q4BA 1UAGA 1T2FA 3ABZA 5JAPA 5EMNA 2GBLC 1YWGO 4P6VF 4R31A 1IMOA 2IIVA 3R3JA 3HKBB 1XWIA 1TUGA 3ST7A 2DQZA 3A3OA 1HEUA 1OFIA 1NDQA 4C30A 1J2RA 1E7QA 3GH1A 1H5QA 3G2LA 2W2TA 3R74A 1XRJA 1KY5A 1YVDA 4KQFA 1S8NA 3WLNA 2PS3A 2Q7OE 4BQNA 3OZTA 3GFSA 4LV8B 4OQNA 4AKEA 5EZQA 4MTLA 4Y2VA 1NIPA 1UK7A 2GCIA 1US8B 4LZAA 3MILA 3RSGA 4D3ZA 4XFKA 5IVKA 2PXVA 1ACJA 3QIAA 5CEJA 1JJVA 1MOZA 2Y8EA 3PDCA 4G24A 1RE0A 2VP6A 1SVSA 2IYUA 3LT2A 1YB7A 4KIJA 5FJJA 4IOLA 1SCUA 4ZICA 1E9FA 4TYYA 4ZK2A 4YG7B 2J3IA 3ICOA 4PHFA 3TDKA 1M2VA 5BOVA 1R6BX 5AT1A 2O0KA 4ECAA 4DR6B 3DV0B 1C7RA 3GOQA 2OTCA 5C2JB 3PXXA 4BVFA 4FR5A 2VNKA 1SURA 2YOHA 3N5KA 3BAFA 4ZD6A 2AJ8A 3OCWA 5B58T 5K51A 4KN8A 1DWUA 4IXTA 4AQDA 2QPLA 2AL7A 1ODKA 4H0CA 1RMTA 5CX4A 1GP2A 1N6IA 1YZHA 1HQYE 1IU9A 2ZB3A 3I32A 5AJZA 4BGIA 1WMSA 3G2JA 1E2KA 3AHIA 2GZ2A 3L1VA 4JEIA 3OBBA 2NUAB 5AVSA 1KYTA 4Y6RA 3VAAA 3N2IA 3PEVA 4LRSB 5C0OE 5K1ZA 4MVXA 3V00A 3RG2A 4FHEA 3FTNA 1WBDA 1GZ3A 1ZXLA 2RGNC 1R9NA 4UUQA 2HRCA 2HY7A 1QHHB 1BYIA 3JYHA 4GW3A 3GT4A 4QWWA 4CV3A 1NJGA 3IMGA 5C1IA 4PBTA 1J5XA 4RCVA 4A8HA 3N05A 4JUIA 3L8FA 1O9BA 3C87A 3SD7A 5JS7A 1DZ3A 4JR0A 4S1PA 3KZVA 5HQJA 1GT0C 1FE8A 2O2ZA 3IVRA 4K3VA 3VKVA 2Q1SA 3R40A 5BMVA 3HCDA 5IYZB 2HV9A 3NHBA 4JN6B 5TT0A 5J2UF 5HCIA 1R6XA 2RIRA 2GA9A 2QXYA 5EKXA 2XB2A 2OUKA 3LPDA 1E9VA 3DMNA 4CU5A 2DQSA 3ORSA 2UXBB 3CRZA 1DO8A 3ONDA 4I1RA 4JGIA 2NT4A 1Q7BA 4J8PA 5KQGA 3T5AA 4TQ9A 1Z25A 2OZKA 5JDCA 1YQ9A 1POXA 4IRUB 3QPBA 3EW9A 3GF4A 3IIIA 2YWFA 3SM9A 3V46A 4AZVA 5A5FA 4JWKA 5BN5A 1VKJA 3HBAA 4OSPA 4C3VA 4W8OA 4HH4A 3A3PA 3L18A 5CVDA 1C9NA 5B7NA 3TZLA 2FEWB 4N6NA 5CTAA 1JFSA 4BVJA 2CFSA 5K09A 2VH2A 2I7CA 1YE8A 3LNCA 4U2BA 2E3JA 3EIWA 1IQUA 2XUZA 3LUFA 2NSYA 3AOEC 3PXUA 5BSEA 2DT5A 3K70B 1Z33A 3A31A 4J3FA 5ADWA 1P1KA 2CLDX 3A6KA 1MUUA 2O0HA 3N0XA 4I4CA 1LPBB 2P9TA 1YJ8A 4ZK6A 1XU7A 4Z8YA 4B7UA 1R5JA 2BDEA 1Y1LA 4XRGA 2P3LA 4YMVA 1B6SA 3INYA 1VE3A 2B7BA 5IBQA 4IDDA 4QOFA 2FP4B 5J59A 4PRKA 3PXAA 4QLBA 1E7MA 2XYQA 3T3IA 2C61A 2HFKA 4GGOA 5DYWA 1F17A 3NWOA 3INRA 1R74A 1TPYA 3ZEAA 1TAQA 1VE9A 3KSBC 2DBYA 4Q9AA 2A78A 2DBQA 5T57A 1EHYA 2X3YA 2C7PA 2CF5A 5KMGB 3H8WA 1NI4A 4OK3A 4HADA 1YRAA 4PS0A 4EVRA 2CV1A 2AMLA 3HSSA 4PE5B 4MS4A 3W1VA 1J4AA 4MYHA 4EW1A 4LZLA 3RS3A 3O8NA 1Q2XA 3CX4A 1JFFB 1T26A 4MX8A 1F0PA 1ZUD1 3KD2A 2DKOA 3PPVA 1GKIA 3E5RA 1U2EA 3D7MA 4JZKA 5JROA 3TMKA 3OZIA 3W06A 5BN3B 2GN0A 2P6PA 4WUTA 2BR4A 4BWFB 4WZBE 3FCOA 1M7BA 2SCUB 1COWA 2EDAA 4IXDA 3RJ5A 3SE0A 4DV3B 1OLUB 5CG1A 5AI5A 2O1WA 4UVDA 1GCIA 1XD2A 4FI3F 5EXDA 4G5XA 4KUGA 4D4JA 1D5WA 3MWKA 2V0CA 3ILSA 3CE6A 2Z2YA 4GS5A 5HNKA 5EN4A 4D4LA 3FTDA 3KXIA 4LJYA 1B2RA 2BF4A 5IG2A 3ICWA 3AHFA 4MB2A 4KBGA 4B3MB 4BLSA 2IHZA 4DJEC 3LBNA 2OP1A 2VDPB 3EJ6A 4BJ5A 4GPIB 5CNKA 4INAA 2NZWA 1UODA 5EXSA 5H9VA 4WK2B 5HEKA 3RADC 2IIQA 5GONB 4O29A 3GDGA 5HUJA 2WSLA 4RMJA 1GA1A 1NSYA 4HZUA 4AURA 2E0IA 5SYNA 2V5AA 4TMZA 4YP5A 3NIGB 3WGQA 1OFGA 2UZ4A 4KUEA 2QZJA 5T4FA 3UFXB 4JMPA 3M0EA 3SBDA 2OV4A 2AUNA 1L7XA 3L82B 4Q4HA 4US2R 4BC0A 4J1NA 3MMPA 3ZNOA 1TYDE 3TKLA 3ISTA 3ZCQA 4CUJA 5F73A 1TYCA 3RVNA 3VR4H 4ZT5A 3EH1A 2YINC 4YMWA 2VDKB 4KN5A 3AVXA 1UMCA 2GCOA 3HJNA 5DT2A 1BX1A 1QIEA 3OLWA 1AK1A 4GPEA 4KV7A 2GO7A 5DCUA 5BWMA 2FB9A 4IDAA 5JWHA 5FEMA 3CEMA 3DAYA 3E2IA 2D5BA 4LZWA 3X44A 5AW0A 4DILA 4JQOA 3TL2A 1Q1NA 4HX5A 1IE3A 1G21B 4BO9A 1GZ6A 1L8AA 2HMAA 3KR2A 1KEUA 3PGKA 3X1XA 2HL6A 5BSFA 4XM0A 3HU3A 4P53A 4B6JA 3HA3A 3VO8A 3UV7A 2AQIA 1JJFA 1B8PA 1M5UA 1UPXA 1HURA 3SQLA 1EWYA 4YIKA 3WGMA 5LMNB 1YBVA 2FSVA 3NWJA 4XSGA 1BCRB 1JMVA 3OOEA 3X1JA 1X8XA 5I6DA 4TKVB 2C4KA 4TT3D 5MF6A 1DOAA 3PI6A 1MIOA 2FWMX 3VV3A 2VJPA 5K9ZA 2WJVA 2D0DA 1KSJA 5JBIA 4UZSA 5FH9A 4GPBA 1G6KA 3VYSB 1S0UA 3GQVA 3DAOA 5HIAA 2SKEA 4MQUA 4Z9FA 3PPXA 3NB0A 1VHJA 2TSYB 2Y68A 3PF8A 4BFVA 1JALA 1U9CA 4EP1A 2LKDA 3D3WA 3GBVA 4Z6KA 4DUGA 1JHZA 1N8NA 4BCBA 1XLWA 3DOIA 2LVBA 4KR0A 2XH8A 4UAUA 2WF7A 3JVDA 4KW7A 1J0XO 3SBOA 1WDMA 3V48A 2GNPA 1D2RA 2RGXA 1K8RA 3A9UA 1GT91 4K9KA 1M7GA 3ODGA 4XIIA 1RPJA 2WWWA 5FL7A 4B17A 3JXCL 2FWJA 2XX3A 3LUBA 4YCCA 1QGYA 2KPJA 1DC4A 4RE6A 1QYIA 5IKXA 1GQOA 2OHHA 5AHXA 2VP4A 4D9CA 1W4LA 4YDQA 4YROA 3J7AC 4AN1A 1UEJA 4Q1EA 4R5HA 3FR7A 4UTZA 2NNLD 4RHXA 5DVZA 3C3MA 3RT7A 5BWOA 4UHFA 1KQ3A 2AKEA 2R00A 2X7JA 5J43A 3GJSA 5J5AA 2Y1XA 4WJLA 3UEOA 1A7AA 3RLFA 2WV7A 1WH6A 2A1UA 2AI3A 2YVLA 3I4CA 3KV1A 4ZYVA 4H15A 4MGIR 4IQ0A 5JT1A 1MW8X 5FYQA 4FQ5A 2CLLB 3ZY3A 1K6MA 2X0FA 2JRLA 4BBZA 3JWEA 3D6FA 2JAHA 4PG5A 5SY9A 4XCVA 4R1NA 4E2XA 4XA8A 1DIHA 1UBSB 3C3DA 4JBNA 3DEIA 2GYWA 1XZQA 5EL0A 3H87A 3LYHA 4CLRA 5ALMA 1QXSA 2BE7A 3P0IA 3ETHA 1PNQA 3AVPA 3IODA 5CUQA 3UMBA 4UTNA 3K20A 5LIRA 1TCVA 4DS3A 4MCJA 3U61B 1CZRA 2QVYX 1J20A 3G7DA 3JYLA 4HDSA 4RV5A 1VDMA 3VPCA 2FH5B 3BRSA 1J8MF 3V1UA 3WWDA 2IPLA