1JH9A

Purine repressor mutant-hypoxanthine-purf operator complex
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
339
structure length
339
Chain Sequence
ATIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAAYFAEIIEAVEKNCFQKGYTLILGNAWNNLEKQRAYLSMMAQKRVDGLLVMCSEYPEPLLAMLEEYRHIPMVVMDRGEAKADFTDAVIDNAFEGGYMAGRYLIERGHREIGVIPGPLERNTGAGRLAGFMKAMEEAMIKVPESWIVQGDFEPESGYRAMQQILSQPHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEVHPRLIERRSVADGPFRDYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords 5'-D(*AP*AP*CP*GP*AP*AP*AP*AP*CP*GP*TP*TP*TP*TP*CP*GP*T)-3'
publication title Role of residue 147 in the gene regulatory function of the Escherichia coli purine repressor.
pubmed doi rcsb
source organism Escherichia coli
total genus 117
structure length 339
sequence length 339
ec nomenclature
pdb deposition date 2001-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00356 LacI Bacterial regulatory proteins, lacI family
A PF13377 Peripla_BP_3 Periplasmic binding protein-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 1jh9A01
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1jh9A03
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1jh9A02
1XHFA 2JBAA 1L5YA 1M2FA 3C3MA 2PPXA 1YMVA 1CJGA 3ZHMA 3TMYA 3TO5A 1JBEA 2AW6A 4MS3B 1ZY2A 1YIOA 4JCYA 4FE7A 4IRXA 4PE5B 3SY8A 4WXMA 2HSGA 1YTUA 2FLWA 4MCTA 1DCFA 2MQKA 1QMPA 1EFAA 4X4GA 2XSDC 2A9RA 2GI4A 3OQNA 1ABEA 3R0JA 5FBHA 1P8AA 3EJWA 4MR7A 3ZHIA 1RIOA 5EWJB 4KPYA 2GRLA 4GHJA 3LKVA 2CWDA 1GUBA 3N75A 1EHCA 5JNRA 1YK0A 2JVIA 4O1HA 4XASA 4IWRA 1O4XA 4LE1A 4YS6A 2WWVD 1DCKA 3CHYA 3HUUA 2E4VA 1PRVA 5B3JC 3H5IA 1ZVVA 4KMRA 3GBFA 4F8DA 1FQWA 3HUTA 3O1IC 5DCLA 1NEQA 3HJFA 4GNRA 3N6VA 5JS1A 4RWEA 1DZ3A 4Z59A 1ZZ9A 1M2EA 4NQRA 4JB0A 1NXVA 4JP1A 1LJUA 3GL9A 4RKQA 3SG0A 4D6XA 1LQCA 1ZPQA 1ISSA 4JOQA 1VLZA 2AXUA 1VRVA 1QKKA 1RZRA 3EDCA 3LMKA 2D5VA 4RY0A 3R1FA 4WWHA 2GX6A 4MCXA 2QR3A 3CNBA 4P98A 2LP4Y 1RZRD 3EULA 3N0RA 3JTEA 1S8NA 2BNOA 1SRRA 2KYRA 6CHYA 2PUFA 4YP9A 3LUKA 4KQ9A 1Z12A 4KK4A 4JQDA 2AUWA 3OMXA 2MYNA 3SM9A 4MQEA 1SQ8A 2EBYA 3LOPA 5IEBA 3TD9A 3LUHA 4Z99A 4GQMA 1DW9A 2DRIA 5FWYB 4HNRA 5IUKC 3CU5A 3T8YA 2FW0A 3Q9SA 3GN5A 1BVHA 4MS1B 4YRZA 2E4XA 4Q7EA 1H9CA 2IPLA 3EAFA 1RPEL 4OB4A 2O20A 3QLTA 4Z4EA 5IUJC 3OO0A 4KVFA 4KRFA 3C97A 3RVKA 2XI8A 3C6QA 1JWLA 4O8BA 4FE4A 3QYXA 3O2SB 4D6YA 3D02A 5BR1A 2XCJA 4YV7A 5IUNC 3S99A 2R25B 2IOYA 4O1IA 4I6RA 5IC5A 3ROTA 2LYLA 4TLMB 1TM2A 2MSKA 3N53A 4G0ZA 2VUIB 3O74A 4Z4GA 2HQBA 1B0NA 3I42A 1MB0A 4YR7A 3DLHA 2PE5A 4W5NA 4G0MA 3IP6A 2HQOA 2IYNA 4XARA 1CQTA 3HCWA 1LBIA 1ZS4A 2WIUB 2B5AA 2YHBA 4XAQA 2NZVG 1BDJA 1QP4A 5E3JA 2LYPA 3LISA 4RK4A 3QLVC 4W5OA 4MR8B 2KEKA 4PYRA 1PERL 3Q7RA 5JNSA 1IIBA 3OP9A 1QNLA 3HEBA 2IV1A 3SCFA 1D4ZA 3LUJA 2WY2D 5GQSA 1F4VA 3I09A 5KQMA 2RJNA 1URPA 1KRWA 3L49A 1JDPA 2FKAA 5TQ0A 3RVSA 1E2BA 2MYUA 1Z15A 3F73A 3BS3A 3KZ3A 5K98B 2WUSR 3MIZA 5EWLA 1U0SY 2LYRA 2A9QA 3I5AA 3KG2A 3SAJA 3F6PA 1ZUGA 2FEKA 3HVRA 1RZSA 3MLFA 1OXBB 3UKJA 1DRJA 5FWXB 4MQEB 2BJCA 3CZ5A 3QWGA 3CKMA 3G1WA 4H60A 1ZZ8A 1RPJA 4HNQA 4F3TA 4X4IA 2AYZA 3NNNA 3HZHA 2PUAA 4RY9A 4Z9BA 4NCBA 5IEJA 3A0UA 4YCSA 1NXOA 3FYAA 2KEIA 4RXUA 3F7NA 1EWKA 3ILHA 1GLGA 2IVGA 1M5UA 4RKRA 4L4UA 2R1JL 1X2LA 2L18A 8ABPA 3OMTA 2CROA 1EWVA 1ZH2A 2FMHA 4YGXB 5GOTA 5JNWA 2PL9A 4PZ0A 1P2FA 4KV7A 4H3KB 2O38A 1P6UA 5DTEA 2IPAB 2W42A 1JFTA 2RJOA 4DN6A 5CHYA 2FQXA 2MSLA 3QEKA 1D2AA 1MAVA 3QK7A 1UXDA 5JNTA 3EQZA 1JDNA 1MIHA 2Q5CA 2XDYA 4I8TA 1LK0A 1NERA 2A9PA 4MPTA 3LKBA 2ZAYA 4Z5DA 2PUBA 3CLKA 5DKFA 4IF4A 4Q6WA 1A04A 2E4ZA 1Y7YA 2H3HA 3H5TA 1OXKB 2FTKE 4GPAA 1E6LA 1TLFA 4IVZA 1TVMA 3KHTA 5TQ2A 1MVOA 1PEYA 3A10A 3MM4A 4FN3A 5IULC 4LDZA 3O1JC 4YG7B 4YBAA 1J56A 3G5GA 1VPWA 3MMNA 2VYCA 1ADRA 3H6GA 4JB2A 2FXIA 3GBPA 3OM0A 4G97A 1K68A 3RVOA 3SQNA 4Y42A 1ZAYA 3C3KA 3FMYA 4LE0A 4WXEA 1DBPA 1VKRA 4QPJC 4D74A 4YWHA 1SD5A 2IDMA 3L1PA 1XHEA 4EGSA 5TPZA 2GRMA 4E7PA 3HS3A 3RVQA 1Z17A 4Z4IA 3JXBC 1Y1LA 4EUKA 1RNLA 5A7LA 2FQWA 4N0PA 3IPAA 3FDFA 5TPZD 5D2CA 5CNJA 2MYTA 4RXTA 4DADA 1NXWA 1T34A 5IBQA 5ED4A 1LCDA 2F8SA 2NT3A 3OQMA 3OO1A 1L5ZA 4MQFA 5KQGA 1YMUA 4G0OA 1GCGA 4RS3A 4MR9A 1ZN2A 4IA8A 3LFTA 3QF3A 1ZDMA 2FMKA 3LUFA 2FJRA 1OSLA 5T3YA 2L8NA 3B2NA 3GWGA 3H5VA 3FMVA 3Q7TA 1JYFA 2HPHA 1ZGGA 4PU7A 4JA2A 4OG2A 2RDMA 2FVYA 5TE9A 4MS4B 1PRAA 2I6FA 4IGAA 3QLUA 3M9WA 4EYOA 5KC9A 3H6HA 3KJXA 1PNRA 2PJUA 4Q6BA 3OM1A 3E61A 4X4BA 3CTPA 3QX8A 2IVQA 1S7EA 1DBWA 1F51E 2JBAB 2IPMA 2V0NA 3T95A 4G0QA 4QICA 2WRZA 1R8JA 3HM9A 3OLXA 5C5EA 3CG0A 2ICPA 3GA5A 3KYIB 4ZJPA 3H5WA 4F8JA 4KREA 4NV3A 2BGGA 2AWIA 4KZKA 2BNNA 4Z0NA 4RDCA 3QEMA 2AXVA 1JX6A 1E6KA 1R69A 3BRQA 3VNBA 3KLOA 3MF4A 2OQRA 4MR7B 5HQJA 3I45A 2L49A 2VK2A 3F52A 4XFKA 3SNKA 3DGEC 3UK0A 3CFYA 1NXPA 3DZDA 4WUTA 2NT4A 3OLZA 4LRQA 1JYEA 1NXSA 3EQ2A 1EWTA 3TX6A 2MSWA 3JS5A 4OTZA 2A6CA 1WH8A 2CSFA 4OBBA 4Z9AA 1NXTA 2OENG 4ZMRA 3JY6A 4QYMA 1DC8A 2B1JA 4O5AA 3T38A 2F8TA 2XJ3A 2XIUA 4FBIA 4TMYA 4W5TA 1QO0D 2WJWA 1DCMA 3H1GA 3D1NI 1BDHA 2HQRA 3O1HB 2E4YA 3ILYA 4HNSA 1D1PA 3BILA 3G85A 4MQFB 2H8RA 2KEJA 1A0OA 3LUDA 5TPWA 3LUAA 3NHMA 3IP7A 1ZZBA 1JLKA 1NY5A 4MR9B 5KC8A 2J48A 2LYJA 3SCHA 1FFGA 5C5CA 3ZKCA 4W5QA 2O49A 1Y9QA 3Q7SA 4G0YA 2M98A 5TQJA 3HK2A 1DBQA 1RXEA 4MS3A 1ABFA 5CNMA 4RK1A 3BDNA 1SXIA 3O21A 4RU1A 4YLEA 2MYPA 1Z18A 2QW1A 4IMJB 1YS6A 3JPYA 2IVBA 1USKA 3F6CA 3D8UA 3GYBA 3OLYA 1PUXA 2IPNA 4OLBA 1R63A 1DG9A 2P4UA 1IC8A 3FFTA 1UTXA 3GN5B 1GCAA 1TMYA 2GBPA 1BA2A 4X4CA 1DC7A 2PMCA 4RZSA 1JHZA 2OR1L 3GRCA 4YARA 1FFWA 2ZWMA 2O4AA 2FMIA 1DRKA 1FFSA 3IPCA 1BAPA 4MAAA 3M6MD 2FMFA 4I6UA 2PUEA 5B3JA 4QYWA 4F12A 5BRAA 1ZHHA 2GWRA 3Q41A 4Z4HA 2JRLA 2R47A 9ABPA 3O9XA 3QX9A 1GT0C 3RVMA 4LX8A 3URMA 3PXPA 3F6WA 4XLTA 4MLCA 4EYGA 1UDRA 1PHRA 2WMYA 3UFDA 1ZH4A 1AB5A 3A3KA 3QELA 2PUGA 1UXCA 2OFYA 2QZJA 2EF8A 3LUGA 1PRUA 4M88A 2R4QA 5JS2A 3P9YA 2CHFA 1FSPA 3VNAA 2JB9A 4ML3A 3DLBA 1ZESA 4IMIB 3EUSA 1P6QA 5I4CA 1EAYA 3HZIB 4YG1A 1YK1A 2IKSA 1JH9A 2PAFA 3MQ4A 1DJMA 4PU8A 3FGZA 5TPWB 1KMIY 1NATA 1XWRA 2HJ9A 3LUCA 4WT7A 1HEYA 3IP5A 3CS3A 4E7OA 4N47A 1QP0A 3DBIA 4RXMA 3TB6A 4L85A 2EWTA 1Z25A 2QU7A 4NICA 4YG4A 4CBVA 3JVIA 4MS1A 5TQ0B 1CYEA 3N0WA 3JXDL 2GKGA 2H0AA 2PIJA 4G0PA 5EWLB 1C4WA 5HKOA 4MRMA 4I6TA 2FN9A 4KQCA 4UHKA 4LDAA 2E4WA 1JF8A 5PNTA 4DQDA 2M1ZA 3NHZA 3HO1A 4RV5A 3NNSA 2NZUG 4N03A 3RQIA 2FEWB 6ABPA 2LYSA 4W5RA 4G86A 4ETMA 4LE2A 2CD7A 3GT7A 4PU4C 2L17A 4X4FA 4Z58A 2CHEA 2P9HA 2IUOA 5F64A 5KWSA 1YVUA 1KGSA 3KKEA 7ABPA 4ZYLA 1MB3A 2JCGA 1USIA 4XXHA 5EWMA 3BD1A 3BREA 1PNTA 1A2OA 3Q15C 1JL3A 1ISRA 3HDGA 5T7BA 4TLLB 5BRJA 3RVRA 4MLDA 3UUGA 5CNKA 4JAVC 2JK1A 3GBVA 3KSMA 3QLVA 4J1XA 4MR8A 3NBMA 3S8QA 4X4EA 3QELB 3E3MA 2AYXA 2FSPA 4RK0A 4N76A 4RSMA 1I3CA 2R48A 4JASB 4MGEA 5ABPA 1WH6A 1U2QA 1Z2EA 4X4HA 1JFVA 3JPWA 3LTEA 4G0XA 2ICTA 4RK5A 4NDWA 3HV2A 3KLNA 5DLEA 3B7HA 3ROFA 1RXIA 3OMWA 1Z13A 3EGCA 4LZLA 3H1FA 4KFCA 5TQ2B 1M5TA 2NUBA 3O75A 4OATA 5IX8A 2E4UA 3IP9A 4EYQA 5JNVA 2L2QA 2FEPA 1CHNA 3O2JA 5FWXA 2R63A 2LUOA 3IDOA 3A0RB 2BNMA 1QP7A 3CROL 4F11A 1USGA 1POUA 3CECA 3NNDA 3FFWA 4UHJA 2VUHB 1C0EA 2PUDA 2QVCA 3QQ6A 3C3WA 1DP4A 1DWKA 1QO0A 2TMYA 4HYEA 4IILA 1JFSA 4MRMB 4EVRA 4S04A 3JVDA 1TJYA 1LBHA 2QSJA 3FYMA 4NCAA 3GV0A 1K66A 2LBPA 3KCNA 1E6MA 3RZZA 3EODA 4OLAA 2QV0A 3F51A 4X4DA 4J1WA 1E3OC 3N8IA 2QXYA 3K4HA 1YSEA 1B00A 3HSYA 4N41A 1LJLA 4JCXA 1ZZ6A 2LYKA 4S05A 2FQYA 4B09A 3DNVB 5DGCA 4PEVA 1AU7A 1ZGZA 4EYKA 3HDVA 1NXXA 1AB6A 2GZUA 1ZITA 2A9OA 4EVQA 3KYJB 1LMB3 4RY8A 1YS7A 2PUCA 5EWMB 4Z4CA 1APBA 4KNYA 3MYYA 4Z5HA 4MYRA 1Z16A 1SXGA 4F06A 3SCGA 2PL1A 3FFXA 4EVSA 3HXMA 1D5WA 1D1QA 4WZZA 1KRXA 3QLUC 2L19A 2JVLA 4PU3C 2B4AA 2PLNA 2WB4A 2AXZA 3RVLA 3MA0A 5JNUA 3JXCL 3OQOA 3U3WA 5EWJA 2HINA 2LIVA 3K9CA 1GUDA 1U8TA 2PKXA 3RVJA 3CG4A 4RK6A 4ETIA 3KXAA 2LYQA 2N9UA 2QVGA 4PICA 5HM6A 2ID7A 2KZ8A 2X7XA 4P1ZA 1WIZA 1HF0A 4YO7A 4N0QA 5CNIA 5BQ3A 1LCCA 2LPMA 2FLKA 1QQBA 2JVKA 2JVJA 3QEMB 3H75A 5KQLA 1ZZCA 3RH0A 2MEZA 3LFPA 1U04A 1W9HA 2YHAA 3OLVA 1ZZ7A 3M9XA 2LCVA 3IVPA 1Z2DA 3H5LA 4FB4A 4ETNA 5HSGA 1CEYA 4EY3A 1QPZA 1PEAA 3O2QB 4Z4FA 3OLWA 1Z26A 3H1EA 1L1MA 1X57A 3TRBA 3RVNA 4H3HB 3VK0A 4TN5A 4Z5CA 4ZMSA 5KQPA 1QQAA 1NTRA 3KS9A 3W9SA 3L6UA 5FBKA 3BRSA 1LLIA 1WETA 4RK7A 1W25A 4KK3A 2KPJA 1SXHA 3CZCA 4MS4A 1XWWA 2FN8A 3N0XA 1U2PA 1BDIA 3RVPA 5KI6A 3T6KA 3DGFC 3BBLA 3KTOA 3G7DA 5FWYA 2IU7A 4ZPJA 2ID9A 3CLCA 2RGYA 3H5OA 4Y9TA 3CRNA 2WJAA 1OCTC
chains in the Genus database with same CATH superfamily
1I10A 4KR2A 3PFGA 2O8CA 3KTAA 1KDPA 2CXUA 2ZGVA 2YJ3A 1SU8A 2MSEB 4KBFA 3RS4A 1XELA 2BTOA 2P41A 4CMEA 3CEPB 1KP9A 2CXRA 1QZTA 1Y1PA 2VC2B 3FVWA 4IRXA 4PE5B 4JJEA 4BO9A 1CJCA 1P4JA 2PU5A 5CBPA 3OT4A 2CMHA 3DS8A 5L7TA 3DJYA 3MXOA 5IAKA 1EUQA 2XVYA 3QWBA 4LUCA 1E3IA 2AQKA 4KODA 3EW7A 4QLOA 5IBRA 2OCLA 5LB2A 3U6BA 1JFFA 1YK0A 3FX2A 2LLWA 4DNPA 1KKUA 2C2ZA 2EBHX 1VP9A 1ZG3A 4I8XA 4B7ZA 4G2TA 4DUPA 3A6DA 3B6EA 5I9TA 3FB1A 4L9SA 2I7VA 3DV2A 4KMRA 3PWZA 1R0YA 2WI8A 4ZD6A 1NBHA 3LV8A 1CQJB 4KHZA 1R9MA 4Z59A 3ECCA 1PRYA 2ZBRA 1O95C 4IG4A 1WZEA 1LFAA 4JP1A 1P3Y1 2XJ9A 4JJGA 5AP9A 2VWHA 2NO6A 3DEIA 3NM4A 4DFDA 1W73A 2RHMA 1EFCA 4DQUA 1SHJA 3BS4A 1IUPA 3FPFA 4L9RA 4B3FX 4HH1A 4O29A 4EHIA 5BUQA 5T4BA 3REFA 2CDAA 3UANA 4RY0A 4BE7B 3HLKA 4HDSA 4KCGA 1DTWA 1DFHA 3PXXA 3C0KA 1WOMA 2CLMB 5F2EA 5DTIA 1ZUHA 5K0GA 2F1JA 4C06A 3DL7A 4RTQA 1Y1KE 4AJEA 4KQJA 3VR2D 4CV0A 4ZQCB 4B82A 5FLEX 4PCVA 1C30B 1UC5B 3I2GA 4RYDA 3ZW7A 2C20A 2IUUA 1ACJA 2R62A 1VG1A 1Y6ZA 2FRDC 2DQSA 3CWZA 3G9UA 3Q0IA 1POXA 1Z6ZA 2I1QA 3NETA 4MQEA 3TD9A 4DNFA 1WY7A 5IDXA 3T8YA 4XYEA 3M6IA 4H6PA 1JSLA 3TLZA 1F3OA 2RKWA 4F04A 5DLDA 2A1IA 1G3IA 2XCOA 1W52X 3O0DA 5A4FS 4HSEA 1HR0B 4PX5A 1IOLA 4YRDA 5IUJC 2IZ1A 3IEXA 3PBKA 3MJ4A 4JOSA 3VH4A 1RIIA 2D0IA 2ODEA 2B0JA 3S29A 2ILVA 3V7WA 1XCJA 3DAOA 1TCBA 4M1TA 2RGNA 4YV7A 4C20A 4RHFA 3HL0A 4QULA 1V8BA 2D5AA 3V55A 3ROTA 4BFYA 1ZNYA 1L1QA 2NVUA 4Z4GA 1B0NA 2ZIEA 1NSFA 1KJNA 3CPJB 2NXCA 4IXTA 4OJQA 5CGZA 4X62B 1N92A 2AFRA 4NMXB 1Y9DA 3KOZA 1RXCA 3HCWA 2F1KA 4HTFB 4IJ6A 2ZUWA 2ZI4A 4RIIA 2IYPA 4QODA 4WEQA 1XZFA 3DZBA 4E13A 1LLUA 5AKYA 4B43A 3CX6A 4MUJA 4Z5XA 2KEKA 1NVAA 1WKVA 1KZ7B 2BKUA 3Q87B 3A1FA 2ZIXA 3QXHA 5DNDA 3EE6A 3RIGA 4EX7A 1G38A 2JGMA 3LOQA 1YVRA 1C9EA 2RGDA 3F78A 3E4DA 3TMAA 3VC7A 4M53A 3IDSA 3L49A 5UKDA 4PG6A 3B51X 4XB2A 2L1PA 3AHJA 3WIOA 3WGTA 5CT4A 3TEJA 5GVSA 3F6PA 5GJWC 1UBFA 3P2MA 3PC6A 4HAOA 2TRSB 1GN8A 3V4SA 1EBUA 1Z8NA 3JASB 16PKA 2G5PA 3MJEA 4ZEOA 3BSSA 1WE2A 3NNNA 1CDEA 1EG7A 1BU5A 1L4MA 4PONA 1ZCFA 5COQA 3VWSA 3KRTA 4YCSA 1BHO1 1MAWA 1ZUWA 1Y3IA 2KEIA 2PXCA 4Q15A 4YAUA 2GCEA 4BN4A 4RXUA 4S1TA 3U4QA 1M33A 2QIOA 1E1NA 3QWIA 1YOVB 2C4KA 4JLBA 1UKZA 1LWNA 2B34A 2OOKA 1M10A 2HA0A 3I04A 3CE9A 2GJ8A 3O8OB 5EY5B 1JKXA 1SHZA 5KKNB 1T1RA 2SCUA 3UOWA 1TC1A 1G20A 5BN3B 4XWWA 1BOOA 3U3RA 4DLXA 3W5UA 5MN6A 3U61B 5K9ZA 4NHOA 1KI8A 2C9MA 3WO1A 1XVIA 4A6PA 3TS1A 4OY3A 4XOIA 5L7YA 5BWOA 4E09A 3ETLA 3OCVA 2CMKA 4C07A 3WWPA 3T4UA 4EG0A 1RACA 1GOTA 1Y8ZA 1Q7RA 4BRSA 2VK4A 4QQFA 3FKSD 4GICA 2KJQA 2I9PA 2GTPA 4FJ1A 3P0EA 4ASUA 1PFUA 1QVZA 3IDZA 3QYFA 1MC4A 3A10A 5F4BA 3WLKX 4DCSA 4EELA 2YBEA 4IP0A 4YG7B 1KQOA 1DSSG 3UCEA 3L0SA 2I6GA 1UKCA 4MIYA 5JSYA 3QVUA 4G97A 3ROQA 1MU0A 4IJUA 2Y92A 2JJQA 2ONJA 5HIAA 3JYLA 5DM70 1C0LA 2IP4A 2WTNA 2YJ5A 3D8SA 1KHTA 3RO7A 1RQGA 3ZQ6A 4YMHA 3KZVA 3E22A 4LEIA 1ZEJA 5A6SA 4FR5A 3IIEA 4L5JA 2HHAA 4U7PB 3VKWA 4LHZA 1A7KA 4BKRA 3EF3A 1BX1A 4JC8A 5EYPB 1JDBB 5A04A 4D8YA 4O0MA 3Q3VA 4RW0A 3Q7IA 5CXSA 2WLTA 2VHJA 4RTMA 1LCDA 4HJRA 4RF2A 1NPTO 4IZIA 5HYVA 1L5ZA 4E46A 2HGSA 1M6VB 1NX9A 2I2BA 3OZWA 4F96A 2O3TA 2GGSA 1DAFA 1ULBA 1PWEA 2F1RA 3VVCA 4LRSB 1RLUA 2BBOA 4QUDA 5EEHA 5DT2A 2XWSA 3OLQA 5DLYA 2P6RA 3LUFA 3W5IA 2SBTA 4FOTA 3PL5A 2I9KA 1N1EA 4JVMA 4TZTA 3WGNA 1C7JA 5FWDA 4OG2A 4UFOA 1DJLA 1KZ9A 4W9RA 4X41A 2WP8J 1MBZA 1PRAA 1OJ7A 3R0XA 1Q3TA 4K6CA 3A1DA 1TUIA 2XXAA 3H6HA 3MQFA 4GGPA 1JQAA 4YRIA 3R3VA 4B7CA 4F6LA 1E4YA 1NNUA 2AG0A 3QVMA 1L5WA 1IBSA 4ZVNA 1B2LA 1ZCJA 5HE9A 3CG0A 3RWOA 1XKTA 4BBZA 3G23A 3W5VA 3COVA 4F8JA 4BGUA 3TZQA 1KDYA 3E0XA 5DHPA 3HUEA 2Z2YA 3PC2A 4MQ6A 5HFNA 3SX0A 1XU9A 3L1UA 1EGQA 5AUQA 1DS6A 1C2TA 5HQJA 3TD6A 2GPWA 1N25A 4AS1A 3BE4A 5F1PA 1Y8AA 1NLUA 3LWDA 3BX1A 3PGLA 3ZHQA 3GAMA 5K03A 3KVNA 2YASA 4CF3A 4IIJB 3IIMA 4G1VA 3TOXA 4WN3A 3SXUA 1YRHA 4ZAXA 3JS5A 4OTZA 4RD1A 1B42A 1N2CE 4AF8A 4EKIA 2XMGA 3SMQA 1E1QA 1P8JA 2QTFA 1CZUA 3BAZA 4LXYA 4WNCA 1G0NA 4IF6A 1XXHE 5C9ZA 4LYYA 3WWYA 5B3AA 4ENTA 1DO8A 5DIZA 4B74A 1D0IA 1I3NA 4D44A 3GCZA 2IF0A 4X00A 2CB9A 3V42A 1ULSA 3HPRA 2A3RA 3E84A 2P9JA 2FOXA 3PHIA 4GMXA 4MV1A 1WY5A 4ND4A 2I4LA 3MRSA 2W90A 5C1DA 5LQJA 2O8EA 3TAHA 3KYDA 1Q5PA 2VT3A 3IJPA 5CURA 2GN2A 4Q4AA 1HDGO 4NCKA 2JC3A 3EVGA 1ODJA 3VUEA 4MS3A 4M87A 2BEWB 3L40A 2XUPA 4MDHA 1X38A 2H9YA 3ZHZA 3DDWA 4AKEA 3B36A 3Q6IA 4EFMA 1DO0A 1TYDE 1T5DX 2WJ3A 3BQNB 1ESDA 4JJZA 4OLBA 2ZETA 5CT5A 1KEVA 3TL3A 1MABB 3R3YA 1DC7A 2ECKA 2EJCA 4Y2VA 4M8NE 4CJXA 1U7XA 4A8JC 3P7MA 1R4MA 4J91A 2ZWMA 5FUWA 4H6WA 1RLTA 3ANNA 3PHJA 4I6UA 1PIWA 2VTDA 3K96A 4HZUA 2OHFA 2PS9A 4J4HA 1E3SA 4U6SA 3WMEA 4CMGA 4MCAA 3OU7A 5A7HA 5I9BA 3QX9A 2ZAIA 3KBOA 3LPCA 1D07A 1RMQA 4DYHA 4WNAB 4HADA 5J2UA 1AB5A 1MW9X 5DGXA 4FIZA 4TMWA 3ZXSA 1K6JA 1XN1A 3MSCA 4LFAB 2XGJA 2E55A 4RGYA 2R65A 4QM6A 1LVHA 2AD1A 3A6EA 5HR5A 3JQ8A 1N0WA 2C58A 5DTRA 2JJ1A 1SCUA 4CCAA 1SXPA 1OH8A 3UAZA 2VSNA 2ZRKA 2ZJ2A 5F5XA 5DNYB 1L8XA 1EAYA 1P1HA 1UMKA 1Z0SA 2X14A 4ZYUA 2UZ1A 2CSUA 3FDIA 4NOKA 4M46A 4WV3A 3BDAA 4HP8A 3BKXA 4PU8A 3GJ6A 1NFFA 2C4HA 2JJYA 4TXNA 3BWMA 1K8XB 4DIBA 2ONYA 3G2PA 2XCQA 2ADFA 1QZXA 1Y4AE 5LIRA 4DR7B 1UXHA 2R85A 3QRWA 2WKWA 1WHTA 4QU8A 5ILGA 2ZAMA 4NIMA 3GGOA 3UWOA 1C9DB 5KHLB 4LBVA 1Z7GA 3HYLA 3ETGA 4DLSA 4CUZA 5IT0A 4E1AA 4OK3A 4AMGA 4NCXA 4JB8A 1MGOA 4W1PA 4MI9A 1Z2PX 1MJGA 4ZEWA 1K6IA 3EWNA 4GP7A 3JWHA 4RADA 2IH5A 2FP4B 1TW3A 1TQ4A 3JQEA 3ZTYA 1W4ZA 2EZUA 5E7IA 3RW9A 1MORA 4LE2A 2NIPA 2W4QA 4BNMA 7REQB 1X8KA 4PZEA 1R0CA 4BN5A 5KWSA 4X1IB 3CVVA 4LWQA 2V1UA 3MTJA 2ZE8A 2H9AA 2OBMA 2JLWA 4NTZA 3HC7A 3ROGA 2WTBA 2VDKB 3ESZA 4XD7A 3DZFA 5DK4A 3WYAA 2EZ4A 2ZJ7A 4M55A 4DW8A 1QKIA 2EQ5A 1I2MA 5CDGA 3RVRA 3F5SA 2I1LA 1FYWA 5HG0A 5A2QA 4IV8A 2CCKA 5F52A 1LF5A 3R1IA 3UHFA 2VYVA 3SC2A 4TN1A 1T36B 2OHJA 3CB2A 5ALVA 4L8VA 1E99A 3KJFA 2I34A 3CZRA 1ABBA 1M34B 2Z8YM 4Y1RA 3KLNA 3BFVA 3EC7A 2WF6A 3OMWA 4EG1A 5BSWA 2JAXA 3IESA 1L2TA 3GJ3A 1OXUA 3MCWA 3ORFA 4NMMA 1EFLA 5CT8A 5DDIP 1D6SA 3H9QA 3AZQA 3TEMA 1W59A 3DEJA 1VHLA 3C2QA 3KZCA 1AUOA 1R88A 1SWVA 1PJTA 4PZCA 2W2QA 4OH7A 1IG0A 4PTZA 1N0VC 1VB5A 3JQFC 4MA4A 4TYQA 4C4PA 5DN6A 5I7WA 2V7BA 3ICVA 3A1TA 4OQXA 4IZHA 4RSHA 3RK4A 3SHOA 1QIEA 2P1DA 3OESA 1D3AA 2ZUDA 3RHTA 3L8FA 3DHYA 2PUDA 3D3EA 1DZIA 1ZM4A 1ZL2A 4M7OA 4B6OA 4OB7A 4EVRA 2H7CA 5IDQA 1OXSC 2X8BA 4H18A 4K5QA 2FK7A 4BQQA 3OCZA 3PWKA 2QNRA 3AGPA 4TMTA 1OHHA 5FT9A 1KSHA 4P6VF 4C4YA 3PE3A 4II2A 5B55A 5C51B 1B8NA 1FTSA 3ON5A 2Q62A 4QPDA 5J5AA 4L9WA 2QTAA 1ZGZA 2ZR7A 1QH1A 2QZZA 3SZGA 1EWRA 1NMEA 4MVYA 1VHQA 1BXGB 4PZZA 1V2GA 3RJZA 1APBA 5I7OA 4WXYB 4Z5HA 1H2WA 2I3ZA 1LQ2A 4Z1OA 3A3PA 1A5TA 4UU0A 1WCV1 3EQ9A 4YV2A 5TRTA 4IL5A 3QEBZ 3VRHA 2C2OA 3QUBA 5K2OA 5I7UA 5HNKA 5E4JA 3AESB 2G1KA 2PKQP 4MB0A 4DWWA 1OYYA 2CWWA 1IN1A 2FF5A 5B12A 4Z7JA 4R9UC 5KOJB 2YRWA 1JB1A 2A5DA 4EW3A 3HY3A 2AOXA 2X9GA 3B8HA 5A5DA 4HX2A 4DUGA 1N8TA 1E1KA 4PTLA 4QYTA 1KBQA 1W1WA 3BTUA 3HACA 4AWAA 4B44A 2JVKA 3FCOA 1H1LB 5P21A 5CU7A 5EPEA 1VMAA 4OYYA 3L4EA 4INOA 1I32A 2Y1GA 4AROA 4IIYA 1OH7A 3RTEA 3T52A 3K9NA 2AR9A 1VSQA 3IMKA 4DMCA 5CDUA 4IUCS 1PX2A 3I2FA 1PZMA 2Z5GA 4WESB 3GT4A 3PFHA 3TGLA 4Z5CA 4FYPA 2J9ZB 2XUDA 1YQWA 2QTVB 3KS9A 4D43A 3PEYA 3L6UA 5BO5A 1JGTA 3EXFA 1V5GA 2XZTA 1T2NA 4XWGA 2DF8A 2P11A 1RXVA 2PQ6A 2VQFB 2AXNA 1DFGA 2C98A 3NAQA 4M98A 1IVSA 3O4GA 1RJ9A 4I9GA 1GZ4A 5LSAA 3AB7A 4BHTA 3ER6A 3BBLA 5LP6F 3G7DA 2PMFA 1L4KA 4JL8A 1D04A 2ZVPX 4BU1A 1R9NA 4TSRA 2J7UA 1P9OA 3NBQA 4M3NA 2O8DB 3PXBA 1M8PA 2HIGA 2J6BA 4CIVA 2WT4A 2YHSA 1K3FA 2ENWA 3E3OA 1WHSA 3EQ6A 2ZE7A 1HMYA 3I8XA 2FR8A 3MRTA 4JJIA 3ZYZA 4AURA 1SY7A 3BMOB 1YIOA 4PR0A 5L4SA 2HCFA 4HPXB 1W35A 3PT9A 4YGYA 3OY2A 3UV6A 1IPHA 3PNMA 4X3OA 4DMMA 1O0BA 3D0OA 4X4GA 1S2OA 4FFBA 1QYXA 2BT4A 4LW8A 1OILA 3OH8A 1DULA 3ZHIA 2NPFA 2Z04A 2RHOA 1GUBA 3QQ5A 4QARA 4CMAA 4H0NA 1W1UA 3D6NB 1E9FA 1MQSA 3DEYX 4ND8A 2JFPA 5ALNA 1O8BA 2HMVA 3PA8A 1FTNA 1PT8A 2AFHE 5JS1A 1RTTA 4G1MB 1NJGA 5EKUA 4RWEA 1B6SA 4AZ3A 3U16A 3KQNA 1L5MA 1CX9B 1JJ7A 1B1CA 1E3TA 5AVJA 2WUVA 2B78A 3R7BA 3K1JA 3P8ZA 3TGWA 4EY8A 3VU9B 1HRKA 1SCJA 3WMWA 4EG7A 1U7UA 2CHGA 2N75A 1HV8A 3S28A 2VSYA 4L08A 2OHXA 3W1WA 2WKQA 2R1TA 2ZTUA 2GEJA 4L07A 4AQ7A 1RZRD 2LR0A 3A70A 2BNOA 3G59A 1LD3A 4KTVE 2DOKA 4POAA 4H7KA 2GNPA 4YP9A 3V8RA 2I6UA 1OXMA 4DEXA 2VK1A 1RP1A 1EIWA 4E0BA 4YMUA 5AVSA 5EXXA 1R6XA 4YRCA 1D1SA 3CRQA 4OOEA 3RU7A 4DSUA 5IKEA 4MICA 1SZDA 2G9ZA 4JJ4A 3BYZA 4B35A 2EATA 4D97A 3DBHB 3UXEA 5JS6A 3JYNA 4U8GA 3TM5A 4H3VA 4CDGA 4X1YB 3OC0A 5FBVB 4D8WA 2IPLA 1A5SB 2ZRFA 4GX5A 4QQ8A 3USES 4CQJA 2P2CA 3SF8B 4DPKA 3RYCB 2ZUEA 3OPQA 3UJNA 1M2HA 2HA4A 3AFMA 5E2BA 8MHTA 1NUAA 4UTVA 2HTEA 2PKQO 1D8AA 5A62A 1OBCA 2HF8A 4ARCA 1VZ2A 2E21A 4UTZA 2VAXA 5EE0A 4NLLA 4F5WA 4GMKA 4F91B 3TG8A 1KFJB 5CXXA 3X1JA 3N53A 1CIJA 3GVIA 4IDPA 4XX0B 3T7SA 1G2PA 2EP7A 3BFJA 2N46A 3M2TA 4TKVB 1OF1A 5CCEA 5AVYA 3PFFA 2H92A 1FYXA 3DLHA 4RMNA 3F5DA 2PN1A 1E1LA 2Q46A 2GR9A 3CY6A 4CKCB 1Y82A 1ORTA 2O2YA 2WT8A 3HR4A 3LQKA 4CDMA 1BX0A 1IOWA 3SHFA 3GJ0A 4QNRA 3D4LA 1WB9A 2NZVG 4FUQA 3S2GA 1QP4A 2R6AA 5E3JA 1ZU5A 3RHFA 3A04A 3C3EA 4MGIR 4JJKA 3U3OA 1IZ7A 5GOZA 5IBPA 4W5OA 4OREX 4YV1A 1M0TA 3V4OA 3MMPA 2UZ4A 4IIEA 2CBXA 2IEGA 4YMVA 3DR3A 5LQAA 4MJ7A 3W3ZB 1J09A 4LF9B 2QQEA 2W2MA 1VMEA 3WYFA 3IGFA 3PDIB 1O6CA 1Y4ZA 3ZJYA 2WTXA 2OECA 4B4DA 5JBNA 3O3CA 2PGDA 4P7BA 1ZZEA 3DOCA 1FJ2A 4JOBA 4NK4A 3MLFA 4OVKA 2ZJ0A 3UBTA 2C1EA 1X7ZA 2IE0A 4IOJA 5AVVA 3AF3A 4FGLA 3QQPA 2I6SA 4C3UA 2DCUA 1E9DA 1NVMB 1NUPA 2DWOA 4LZNA 4JSYA 1OA0A 1G55A 2O48X 3LUBA 5T6BA 3DMNA 4YR9A 2W7TA 4K9OA 4G89A 1S2LA 4OJYA 4CQMD 2ZTHA 1G0OA 2QLJA 4IKPA 4MYSA 4UVEA 2A5GA 3S7TA 4YGXB 2FMHA 4GFDA 2HV9A 3Q3IA 3GLIE 2OXRA 3NBZC 1Y1QA 1Z5WA 1G3MA 2PGOA 3HO6A 4CIXA 2P2LA 1IUOA 1T6BY 1EH5A 3VAYA 3C8DA 1P3JA 3O8DA 1J2JA 4JGBA 4DPMA 2O2EA 3IO5A 3KOXA 4G5GA 1T5SA 5DKFA 5ES3A 1CNEA 3WS7A 3H9CA 3ENVA 4MW9A 3WGGA 2ID8A 1GYQA 1XMVA 2VYNA 3DFKA 2OO3A 4LHXA 5FBRB 1MKYA 1YR9A 2F90A 2VDOB 3KHTA 4HGZA 4HNAA 2I8CA 4X5OA 4DCVA 3AVOA 3U62A 3I05A 2QM0A 4RMHA 3QI7A 1A8PA 4N7MA 4OBWA 2CY0A 3LYHA 4LNHA 4LZJA 2I0FA 4Q7KA 5TS3A 1OYWA 3KEOA 3G6KA 1TNDA 5EXSA 1T5LA 4MVJI 4GG1A 3RLIA 2P6MA 1SCDA 4LZZA 3DTVB 1PR6A 4PU0A 4U6NA 4JYAB 1XHEA 4AY6A 3KEMA 4FK8A 1K97A 2VDRB 3IAUA 4XVHA 2HW8A 4F93B 2GEUA 3HP1A 1UBSB 4OI1A 3GZNA 1EGVB 4QDKA 4ZP1A 5JYDA 2ZZNA 2IV7A 3U37A 1AHPA 5GZ6A 2Q6OA 1KYVA 3C4VA 3FYUB 2CVOA 1K4KA 2DR3A 3QBDA 3QIVA 1E3QA 1S2MA 4JR0A 3C5VA 5THKA 3PFWO 5BV0A 1Z0ZA 2P90A 3ADPA 1NG1A 2DFNA 2O52A 1RW4A 2I8LA 3AY7A 1SXJA 1ND5A 2R66A 3IRUA 3JX9A 1ZN7A 2EDAA 3PNVA 4U39A 3SNHA 4Z7NB 3F6EX 4BFWA 1YZKA 4QOFA 3D8NA 4LJSA 3ESCA 3PX7A 1Q7GA 3C98A 2JCSA 1KEPA 3Q3JB 3GD7A 1G8MA 3NX4A 2GO1A 3BMCB 4Y1GA 3U7QB 3G68A 3K92A 4NS4A 1T0BA 2VJOA 2EF1A 3R9XA 2J4CA 5C8YA 2NQ8A 4ZVTA 1JAYA 4XR4A 3M6AA 4AMUA 2ESRA 4Q47A 2YY6A 5T5QA 1Q0QA 2RB4A 4IIFA 5FL3A 3ZWPA 4CCYA 4JI0B 4ZO7A 5A3QA 4IDAA 4MUIA 3GJ4A 3HB4X 4I4TA 3T95A 5CT6A 1UZLA 4QICA 5TJ9A 1YQEA 3OLXA 3V8PA 4LIPD 1UCFA 3N59A 3HCOA 2VF8A 1H3FA 3LBYA 1PFKA 1UH5A 3PQ8A 3FCCA 2NUAA 1E63A 2JDIA 2QD2A 2A9JA 2W2LD 3D3JA 4FD2A 4NF2A 3TCKA 2JLYA 3OX1A 1ZRSA 3ITEA 3ZS9A 1EJBA 1E77A 5U9CA 1MCZA 1NQVA 2O54A 3OU2A 3AL2A 1T1IA 1E7SA 3KZMA 4LQLA 4OSPA 4IHJB 4TXLA 3QUQA 2WHQA 4OB8A 1NXQA 4X3CA 4L8WB 3PEFA 2FZCA 2OENG 1M1UA 3Q7QA 2R7KA 1B93A 3CVXA 2GB4A 3WE7A 2YW9A 1PSDA 3FPLA 3R0QA 2B8TA 2BHSA 2CNWA 2VNHA 4HL6A 4I4LA 4KTTE 4XD2A 5HF6A 1YZUA 3TVTA 2QR2A 5KAPA 3Q8KA 5JJLA 2ZCVA 4LTDA 1X2EA 1FYFA 3MJRA 4RM3A 3OKCA 1A0OA 4AJLA 2FSIA 1IQRA 1CQWA 1CY8A 5F4ZA 3PITA 4JKOA 1E2IA 4TUYA 2XYRA 2ZYHA 5CAEB 1R6DA 1Q16A 3S40A 4YRQA 2BFCA 4W8GA 3TEFA 4FOLA 1FC0A 1OBFO 4P3KA 3ED5A 1SOVA 4Q4JB 4YLEA 2CXOA 2VCEA 2MYPA 1E64A 4IMJB 1PKEA 2JHGA 1A8HA 5FHRA 3IE0A 2Q6KA 3T1NA 2VUTA 3AR3A 5IT5A 1CUWA 3OZAA 1DG9A 4TZ0A 4X9XA 4JLSA 5D1HA 2I78A 2OKCA 1JU3A 2UZ3A 4UDXX 4INAA 5DW3A 2Z1NA 3EGXA 3GUZA 3GQBA 1FZTA 4RZSA 1H9AA 2HK7A 4JGIA 4GMFA 4ZRNA 3RRMA 1PD1A 2FMIA 3LA6A 3BEOA 3HYSA 2LKDA 1N2IA 1IWOA 4L5BA 1FL9A 2ATIA 4N5HX 5ULLA 4UBOA 3RAFC 1KO1A 4QYWA 5ALOA 1OLOA 4BWYA 4JNCA 4Z4QA 1QTQA 2Z2IA 2DVMA 2H65A 3QEAZ 5EIHA 5KWEA 3O9XA 2VAMA 3WLEA 2F8TA 4RH1A 5D7BA 4B73A 5IHPA 4FCTA 4XLTA 1VLLA 5JSKA 4LECA 4HLDA 2WMYA 1NP6A 4UAGA 5IAAA 5IDWA 4JQCA 4CG2A 1VIMA 1EWQA 4M88A 4OSEA 3CLTD 4C2AA 4WY2A 1KKMA 3P9YA 1XRNA 3DULA 1G7RA 3AH8A 4JVNA 3TOCA 4GLOA 4XFJA 2HY7A 2LW7A 1X70A 4AYXA 1GV0A 2PO7A 3L4KA 5JTUA 2IHKA 1JEQA 4WCFC 3VU3A 4ECAA 4L8GA 3QWHA 3FSJX 2P9GA 4K6HA 4WINA 1EINA 3EPJA 4G85A 2YH2A 3VNUA 2PAFA 2NZWA 2GN1A 4I9HA 2QRUA 2ERYA 1S3IA 5AKJA 2P2YA 2FPXA 2FFAA 3RASA 4K9MA 3W8FA 3QYAA 2Q6TA 4C5AA 4ON9A 3RYIA 5A1TA 5BR4A 3I4LA 2YNMA 1RI2A 2QVLA 4KUEA 2PRIA 4Q1DA 3BEDA 5EWLB 2CEAA 2ZJBA 1V9SA 4JC5A 5LXTF 3WLHA 5KTNA 5ADUS 1T3HA 3VZSA 4I9UA 3QMWA 3PXDA 3DE1X 5HW0A 3IEPA 3L77A 1ZNZA 4ILKA 4RA9A 5E0OA 1TB4A 1FJHA 1TKBA 1U7PA 2HNBA 2HSDA 1E2NA 4QFBA 1DJQA 4G86A 4KUGA 1W6UA 3GT7A 1RQNA 4RKFA 5I7VA 1I7DA 3LCVB 1DWUA 4ACBA 2OXEA 5AFSA 3CLSC 4UNRA 2ZWAA 2J33A 1RAGA 5LDGA 1C9MA 3B12A 1YFLA 2Z1MA 4LHSA 1H4QA 3BD1A 1T8WA 1PG0A 2YV4A 2BEJA 5CK4A 5JU6A 4S12A 4X24A 1F12A 2HHLA 4S35A 2VFAA 4ARZB 3VZDA 3EGDA 4F6CA 5LQDA 2GBFA 1N3IA 1N9GB 2C61A 3I64A 2FZ5A 4IIXA 4MLDA 1RHJA 2YWFA 3UUGA 4C03A 1YE8A 2ZJZA 3BRWA 1K5GA 1DX9A 2SHKA 3VR5H 3Q12A 4ABTA 4G5SA 4EYEA 2PSFA 4D82A 3T0GA 4B3GA 1CW2B 1ATIA 2FMUA 3UC9A 4ASUD 4DV3B 4FC6A 4EJ6A 3I1FA 4HB3A 1BCSA 2P9BA 4C7BA 1V7QA 2WYUA 4TX1A 1JEYA 3T7EA 3I2YX 3S70A 3OJWA 1KEWA 4WVLA 4BMSA 5EJ5A 3IL2A 2F55A 1W96A 1UXIA 5B1YA 4BEWA 3V2UA 4BGDA 3CNLA 3IIJA 3MWEA 3AUKA 1QYRA 2KBEA 3ES9A 4GI2A 4LCEA 3TIGA 1A9QA 2YW2A 4CEHB 1DV1A 3NP9A 3THXA 4G84A 5JJCA 1ESEA 2H1CA 3NJ4A 3RB8A 2B6HA 4C0HA 4XQEA 1FDWA 3WYCA 3D2CA 1IHOA 3IQZA 2VQ6A 2E5WA 3VU8A 1I13A 1X0VA 1KYXA 3AUSA 1JHQA 3CEHA 3QQ6A 2WD9A 1CULC 1JA9A 1T35A 5DVZA 3FAZA 2O8FB 3SXJA 1E3JA 3ITKA 3MLAA 1E2UA 1GFSA 2RKBA 2C9BA 2D1SA 3MWDB 3KCNA 1WEKA 3QNMA 3H5AA 4XKJA 5TMBA 5LN1A 4ZTBA 3PSAA 3UA4A 5DTMA 3CX4A 1ZZ6A 3THWB 2E6UX 1B74A 2YIVX 1CKEA 5CCBA 3NOVA 1JG3A 4DWOA 2OGSA 1K92A 2YDYA 4CIWA 5BT9A 3JQ7B 1OX6A 4UE2A 4BNTA 1KZGB 2YV5A 1B0PA 2HRQA 1P77A 3LT5A 3HZRA 2X9QA 3V6LA 3OKFA 3Q10A 1HZJA 1NRXA 4L73A 4V0NA 4PU3C 2B4AA 4ZCLA 3SS7X 3S2FA 4MO9A 3RRNA 4FDUA 4XR9A 1CJSA 3W5BA 3VPGA 4CUJA 2K2WA 1R64A 3ML1A 3PKZA 5LZ5A 3F49S 4OQMA 4RZ3A 4YXFA 1U8TA 1N5OX 4WK0B 1TUBA 3GX1A 3NJRA 3RROA 3TLEA 5JHGB 1XSEA 4K9LA 3B3AA 3DC7A 4EF5A 2IHNA 3W6OA 5C37A 3PGJA 2V8BA 3EYAA 1R12A 1CVIA 1OLSA 1RWMA 3FKQA 5LL6P 2LPMA 2K7ZA 4M36A 3RFVA 1O94D 4OUDA 4XE5A 4Y1FA 3A1NA 2NYAA 4TRRA 3D4OA 3RH0A 1K27A 1U04A 4L4XA 3SC4A 1LSUA 4RLFA 2O0JA 1E3WB 5CJPA 2WQZA 3GWZA 1RRKA 2X0FA 2BLLA 3SKVA 4I08A 1UPCA 1KI9A 1I36A 1L3BA 2E7ZA 3JSAA 2OGTA 1RBQA 4RE6A 1PYDA 2NGRA 4V0QA 3VK0A 1VCMA 3ND6A 3L7MA 4J0KA 2A0YA 3B7WA 3ZD9A 1DTEA 4LF6B 1KH1A 1Z4NA 1FLAA 2IQIA 3KQPA 1XI2A 2CLEB 3DDSA 1OI4A 4ILEA 1BVUA 2R97A 1U2DA 3Q2OA 3IOBA 1TVCA 3DSRA 4GPZA 1LLIA 1ESNA 5BPFA 3CIFA 5AM5A 5FEUA 3T4XA 2I03A 2QVBA 3WGKA 1LDNA 5AI8A 5AUPB 4IH1A 1YS2X 1NW7A 1ZM7A 2J3QA 3V4LA 3WDKA 5EP4A 4KVGA 1R0LA 4WOKA 1JSXA 4UREA 1QV9A 3GUVA 4EPVA 4US0R 3HJGA 2YHIA 3IB3A 5I6DA 5MHTA 2VBGA 2XKAA 3WVNA 1VHDA 1DIRA 1YVDA 2O50A 3C3MA 1TKAA 4UNQA 3TO5A 3VO2A 2NV2B 4NI5A 5ITWA 1W4CA 5HXAA 4MTLA 3OUUA 4LYGA 4XWYA 3OIUA 1W88A 1XJCA 4FFWA 1K98A 1O9GA 1XFAA 3LDFA 3A1SA 3NRCA 3RS7A 3GZDA 1LW7A 4K9QA 4TT3D 5JSZB 1OB5A 4R8VA 2AEJA 1XDZA 2L42A 3NHJA 4BECA 3BXOA 2XGOA 4CKZA 2IYQA 1JNXX 2V3VA 2FN3A 1N2XA 2FOIA 1IH8A 3E7DA 3CF6R 4RPIA 2QRJA 3FUWA 3TE6A 3HEAA 3EXHA 2ZU6A 2IX3A 2BVNA 4D81A 1QTRA 1YZ3A 1AIPA 1BMDA 1Q84A 1TYBE 4M89A 4FFDA 2Y1FA 3VKFA 4B2LA 2XITA 2F6RA 2QB5A 1CRLA 4NQRA 2FPPB 3NM6B 1EHIA 3RFUA 4POOA 3L6DA 1C7QA 1LJUA 4CMHA 3GFPA 3G5TA 1VL8A 3ONEA 3TRDA 2DC1A 3UHAA 3W8RA 4Z3DA 2V6JA 5ALIA 3GMDA 4UM5A 3STUA 2HXYA 4ZU6X 4KPUB 5REQA 3OEWA 4ZI3A 1N2ZA 2FUG1 1YR2A 5DGIA 2I1VB 4JI3B 3EULA 1GDHA 4BE9A 2H9IA 1NVGA 5SY4A 1MEOA 4YAWA 6CHYA 1GNRA 1YFJA 3K0CA 3L6CA 4MV8A 2X3UA 4FBGA 1OBHA 4P3OA 5AHRA 3VR6D 5A5FA 1YKFA 2RHCA 1J6UA 1ZFNA 1TLLA 4MP8A 3E7PA 4MLPA 4QQKA 5K0TA 2R00C 1P1CA 1U8AA 1HWYA 1YL7A 4GQMA 2GBLC 3AOGA 3X2EA 2DMRA 2FUEA 1RI1A 1O6ZA 2F1HA 3LBFA 5BOSA 3M5CA 3AG5A 3C7AA 1EGHA 1JXMA 2D8AA 1QE0A 3IQDB 4NE9A 4RACA 4RCZA 3ZWVA 3ZX4A 5L51A 5ERGB 4EFDA 1RPEL 5LMNB 4PPQA 5F3RA 1EP9A 1HC7A 4R3UC 3V8MA 2VOJA 3KDAA 3ZDEA 5AW9A 1YZQA 1KETA 1NUSA 1QU2A 5BVHA 1WB5A 1UQTA 2OFWA 3D02A 5DRTA 1CFJA 2GRAA 3NI2A 2F43B 2CVZA 1NW6A 1RRMA 1R5BA 2W37A 4C0SA 4ZHQB 1W5AA 3P71T 1M6YA 4JHLA 4IV5A 1DRUA 4G0ZA 2UXDB 1UKYA 1X77A 2G5TA 3I42A 4M0PA 5AJHA 5H59A 1G4UR 3F6BX 3SJBA 4E4TA 5KIAA 1AS2A 1AQJA 1EVIA 1SIBE 3NVMB 1E92A 2HQOA 1E6CA 3E7XA 5THQA 1PBNA 4BNWA 2AZ4A 2HRBA 2X8JA 3UF0A 4AJNA 4BQRA 3ZWQA 4MVXA 1NMSA 1J8YF 4I3HA 5DISB 2E18A 3CJRA 1DKNA 2A30A 3R7AA 3WZLA 1SJ9A 4Q16A 4EB8A 2JZCA 1I4OA 4BKPA 3DR5A 3A37A 3H5NA 4OGGA 3UAOA 3DV0A 4WNYA 3HEBA 1VKNA 2VJQA 3K32A 4L2IB 5FR1A 1M1ZA 4XJTA 3AI7A 4XGKA 4FNAA 3P9CA 4YP0A 1A88A 2C2XA 3HVKA 3NDJA 3F4KA 4V0RA 2FKAA 1SVOA 3KLPX 5KYUA 3SX4A 3I3SR 1Z15A 3MIZA 3ZIDA 3L02A 3DKVA 5TMPA 3I5AA 3ADKA 4OBMA 3AP2A 1R8XA 3N8DA 4RVUA 2XXPA 1JU9A 1OXBB 2GTHA 3ADOA 4ZV4A 4JLNA 5JATA 2I4IA 1P4SA 1E2FA 5HKBA 1GAQA 2C59A 2DJIA 4PXAA 2V6FA 5LD2B 1NRJB 1Q74A 2AOWA 2OVBA 4EK9A 2XX3A 3L0OA 5E2IA 4EHLA 4Z2AA 5IEJA 3K2BA 3OZTA 1KJJA 1J8DA 1PV2A 4MWCA 3QOWA 4RQAA 4EL0A 1FIUA 3U3DA 1M5UA 1WSBA 3GIWA 4WKNA 2L18A 4H3SA 3GJZA 2GK6A 2IHBA 2QQ0A 2VP6A 1P39A 1RC8A 4KLAA 1DXHA 5FLKA 1R0RE 2QRMA 5FOSA 3TZLA 2ZEJA 4JCOA 3HU2A 2VQEB 5IYZF 1TAGA 1K89A 2D2FA 3LVRE 2FQXA 3DLCA 4KAAA 1D6NA 1H6AA 2VDMB 4F5ZA 3N2LA 4LOJA 5AW1A 4C14A 4BY9E 1OI7A 2YWEA 3S5JA 4CTOA 4L9AA 1L6IA 5JCOA 3A26A 5F7XA 2AG5A 5M2QA 3TEPA 3T5CA 2HFZA 1WJGA 3UKOA 4NPAA 2BFFB 4M4SA 4N0EA 3DFIA 4G5XA 1GZUA 4Q4LA 3A2MA 2AFIE 2XQVA 3BSYA 4WFKA 3RNLA 5ALKA 1IAQA 4DKXA 3W6UA 2ZRPA 3DWGA 4D0SA 1NWHA 1WW2A 3CLHA 1I2ZA 2OPBA 1QORA 1VPDA 4TKMA 3IDQA 4XPIA 5K3AA 5KJFA 2ZU0C 2BHLA 4NRDA 3O47A 1A9XB 3WGOA 4FM9A 3PPIA 4GGOA 4HLUA 4MUGA 3C3KA 1N33B 1M3SA 1GTJ1 4MKZA 1A8IA 5J58A 1QBKC 3B48A 3AEKB 4E7PA 2RHHA 2XVXA 2Q28A 1Y1LA 2QUBA 4HUQB 4R1QA 1RAFA 1V41E 4Y9UA 1QCCA 5EHGA 5BMVB 1GILA 4AMBA 4RXTA 1HM5A 3OIGA 4DADA 2IITA 4WZBE 3UEOA 4YPVA 4JYZA 3T1YB 2BYTA 3X3HA 2XYPA 1O8CA 4GLLA 3ZI7A 3OQMA 3CLTC 4JI7B 1G6Q1 4V1CB 2BEUB 2EWVA 1Y98A 2B82A 4LRWA 5ITZB 4CFZA 5JSFA 1QZ3A 1PR9A 2FOLA 4CG3A 3EEQA 2K6GA 2ZBDA 3RCBA 2A8YA 4BZWA 4RGBA 1U4SA 3SQDA 3QPVA 2VJMB 4MGZR 5FF9A 4NAVA 2VNKA 3Q7TA 1ZI9A 3WGYA 4E4RA 4D25A 4RPCA 4JA2A 4UQOA 1QYIA 3UJ8A 3SYKA 5F7ZA 1JG7A 3QE2A 3RE1A 1U11A 4A23A 3HBAA 1B0ZA 1KA9H 3DMGA 5KTMA 3QLUA 4JMPA 1YNSA 3CRMA 3DB1A 4DQ0A 4XIFA 2JS7A 1UDWA 2OD9A 4ZOLF 4KH1A 4L51A 2IVQA 2P9TA 1I33A 2ZSEA 3QXCA 1B16A 4M6WA 4DT1A 5LVAA 3DUFA 3PIDA 2WRZA 4PF1A 1VL1A 1RIFA 1A95A 2BIFA 2Y4NA 3HVIA 3GF4A 2BFEB 2C9CA 5LBUA 3WK9A 2XF8A 5JCPA 4RDCA 4MB2A 1MXHA 3NH9A 3OX4A 1V1MA 3V00A 3ZD8A 4LSMA 4J9VA 4UBKA 3TAXA 2L49A 3JARA 2GERA 4XFKA 3UK0A 3WTBA 2AZMA 1JA0A 1CUGA 1NXPA 1WTAA 3FHCB 3LNCA 4I55B 4IXNA 4MMZB 3LHIA 3OLZA 1SHLA 3IEIA 4OJMX 5AIAA 1ID8A 3KNZA 4XQ0A 5ECYA 1P60A 1UPFA 2F3RA 2DHCA 3UTCA 2QRVA 4GOOD 3LX5A 2G25A 1RE0A 2GN4A 3EWSA 3VYRB 1TIPA 1X74A 4O5AA 2EX1A 3EDYA 1J2YA 1KMHA 1YFKA 2AI1A 1IBLB 2WJWA 2C97A 1GSAA 4NJEA 1JVSA 3DBLA 4R2JA 4QRIA 4JMLA 1NBWB 4V2IA 5A03A 2X13A 3WK6A 4DJEC 1Y89A 2C4UA 3HCBA 2QP4A 1V37A 1YCGA 4UHHA 3VPCA 5C5CA 1JR2A 3HB0A 3R77A 1Y8QB 2P35A 1U5CA 2XCSB 3Q7SA 5KEIA 2CV1A 4DREA 1T26A 2EC5A 3OZSA 3V7UA 4QEZA 4MWBA 2H2WA 1BEUB 3E23A 3JW8A 4QGGA 3ZK9A 5IJ0A 5JD4A 4PGAA 2IZOA 5DK6A 2YFYA 1XYVA 1YA8A 4URFA 5AM2A 5LJIA 4DV2B 2FJ0A 4LJLA 1Z0IA 3RFTA 1YQXA 4AM8A 4E03A 1UTXA 2O2GA 3L0YA 3J81k 3U44B 1OI3A 4OHBA 3KL2A 4LQ4A 2PMCA 1UIMA 2R8YA 1Z29A 2BRUC 2YXBA 4PLCA 3RDPA 2X42A 4O8ZA 4GI3A 1QQ5A 3SFVA 4BLPA 5BXQC 1XXHB 3TOSA 1WUIS 1Z4IA 3O31A 2Z8XA 5K0JA 2PUEA 1LZLA 5F9FA 1P7PA 4U9IS 3D6TB 3GY0A 4N5IX 1XTBA 2B5OA 3COSA 3ZGYA 3Q41A 1ND6A 1CY6A 1FVFA 1GQQA 3ORYA 1XPUA 2R47A 2PD4A 4MLZA 4Q4HA 4QT0A 3VOTA 2WJ4A 4GX2A 2B1IA 5EIOA 1YQ9A 3ZNPA 3R7SA 4OYLA 1UDRA 2WG2A 3MTEA 2WD7B 5FL7A 1X13A 2BHNA 3O82A 2R4QA 1PJQA 5TF4A 2P7HA 4NY1A 1XNGA 3EZNA 3TBHA 2DLDA 2HU2A 2DWPA 4MW7A 5KYTA 2C7PA 3V4RA 3D2AA 1H22A 2JEYA 1EVQA 3EB9A 3EEBA 4E2ZA 3IA2A 3ZJ5A 4F38A 3FPJA 1S7CA 2GMWA 1L7QA 1DBVO 3LUCA 1XZCA 4WADA 1JQ3A 1PEKE 1C4KA 3G7NA 1GG5A 3DBIA 3V7FA 3SWWA 1NNEA 2KHZA 1O94C 2EWTA 1N1MA 1Z25A 4BZPA 4QKQA 5KMGA 3FBGA 4MS1A 1G8KA 3RV4A 2CVPA 2H0AA 1RYEA 5HKOA 4WACA 4MRMA 3RYHB 4IZ6A 2RC6A 3ADCA 1XNJA 3GN1A 1RXYA 3RYFA 2C5EA 4QDXA 1EE1A 1ZX1A 3CW2A 4OQLA 4ZKDA 4PZ9A 1EVYA 2XNDA 1DIBA 5M3BA 3DT9A 1D0SA 1DBRA 2Z58A 2ZYUX 4D9IA 1HDEA 4EECA 1WXQA 4P38A 3EH1A 1PJAA 2CD7A 1Z36A 3EVNA 1EFDN 2GDZA 3ZGOA 5M7EA 4CEJB 3IUSA 3K9QO 2IUOA 4P3NA 3AILA 3JYQA 4JUAA 3WQBA 3PDHA 4Z53A 1QHXA 1O4VA 2XTAA 3ECAA 5JW6A 3BREA 5CG1A 4FYXA 4KMOA 3DKRA 4YMIA 1WS6A 1A2OA 4LHVA 3OSZA 4NDAA 3C1TA 4CM5A 1KR5A 1WPXA 4MZDA 1PJZA 1NLFA 5F7OA 1LV8A 5HUJA 4YNBA 3AM4A 1L0BA 1Z6PA 3JCZA 4R5MA 3ZU6A 1AA9A 2I71A 2REQB 4C6TA 5BQXA 5ALLA 3WGIA 2COKA 3E3MA 5KYWA 1GPMA 2C29D 3D8HA 1CY0A 3BGOS 3NIBA 2GCNA 4KC0A 3WLNA 3TQQA 1C7IA 3SKXA 4L5YA 2XIQA 3K0EA 3ZOKA 1NOKA 1MG0A 2CL5A 1XA4A 1I6MA 2LTAA 4J03A 3EG5A 1GU1A 2JZOA 3EGCA 3H1FA 2O1WA 4F4DA 2J5KA 1T4MA 4HEA6 1YF3A 3U3JA 4MKIA 5LYJA 2YWXA 2E4UA 2PX4A 1N34B 2VIIA 2Y1WA 1N2OA 3OKAA 2HLDA 5BYAA 1NJ5A 5G53C 4DCTA 3KB1A 2LUOA 4MVCA 1TCUA 3LP8A 2YWGA 1T9GR 3VFDA 2NN3C 1TU4A 3BBPA 1WR8A 4F3YA 5CB4B 3KYCA 2D7JA 1NP3A 2XY4A 3F74A 2XADA 3PQ3A 1CFZA 1YE5A 5BN4A 2ODPA 1PLJA 1YA4A 5JH7A 1LDGA 2B3DA 1AZTA 2WHPA 4RD2A 4V03A 4MYTA 3K0FA 3QX7A 4YJ3A 2WAYA 5AHKA 4MUEA 1FVOA 3BICA 1NJ8A 1S8FA 1THTA 1V1RA 2A5FA 4PZ0A 2B30A 4PRZA 3QVTA 1YJBA 4UXJA 5EUCA 4EEKA 2DQYA 1W5FA 3C16C 2FQ1A 4P83A 1N5JA 4AJHA 1XQVA 4QXAA 5FTMA 4RPHA 1KHHA 1AB6A 1T4CA 1EAMA 4WX2B 4ZI7F 3ENZA 4UZEA 1XZAA 1YZYA 3Q8XB 2WU4A 1XZDA 4R2IA 1VBKA 1HTTA 3EMDA 2WSLA 3K31A 3TNLA 3TRJA 4BASA 1TMKA 3G8DA 4D42A 2O2DA 3MAAC 1V96A 3T9FA 4ITUA 2JVLA 2O9JA 5L45A 1UK9A 3VPBA 4C22A 5AVQA 3P94A 1FW6A 1HDYA 4BB6A 1F5NA 5EMLA 3LA8A 1FW8A 2B4TO 4EIWA 1SQ6A 1XEAA 5K8UA 3E1KA 4QPNA 5GMOA 1GUDA 1D8TA 3RVJA 2IVFA 4CM4B 4UOEA 2F3PA 3B1FA 1PZXA 2WIKA 4ZRDA 4H27A 4TYWA 2IYVA 4J4BA 1HF0A 2X3FA 5G3YA 1CWUA 3TLJA 1A4XA 5ESRA 4ZEVA 2G6TA 1GZSA 3R7LA 4HMPA 2ZYDA 4L8YA 4ZGGA 4IQ0A 5JO9A 3QEMB 5GINE 3L8EA 1XTQA 3MFQA 4KDFA 3BA1A 4NG4A 1UL1X 4RZIA 1RDFA 2A9KA 4CM6A 2HSJA 2HBQA 4KQGA 4YCCA 3VMFA 3AUJB 1TW2A 4ND2A 3TRBA 4RDHA 1NRWA 1W6RA 1XL0A 2ERXA 2YV2A 4GVXA 1DLIA 2CFCA 4Q03A 4TN5A 2ZRCA 3SJZA 4AUNA 3UGKA 2QE6A 1XMPA 1YJQA 2JGNA 3U40A 5BNZA 3W9SA 3I9V6 1ELOA 1JLSA 3AG6A 1IBMB 1QIMA 1MEJA 1YZTA 4GKVA 3IMEA 4W99A 1QC5B 1NFRA 1VSTA 1V48A 5BW5A 2RGWA 1C30A 4MVJF 3T54A 3HN7A 2J5XA 4I1UA 4BKOA 5JFOA 1H2EA 1BDIA 1PFWA 2Y9MB 2IK8A 3PNQA 3UUWA 3WYGA 3C8MA 4J43A 5JAIA 5HCIA 4QWWA 2PIAA 3FI9A 4H1VA 1HBJA 1SBCA 4GOMD 3WL6A 4EFNA 1AV7A 3GFSA 3ETHA 3QPUA 5JDIA 3DP9A 5EINA 1GPYA 1W93A 3VYUB 3A4MA 1SCKA 5KYYB 3VJRA 2VRCA 4QBKA 5J23A 1OJLA 4O4IF 1Q1AA 4CZ2A 2XSDC 4JNKA 2WQ6A 3CEAA 1HNNA 3I9NA 2QAGA 4MO2A 5EWJB 4NQZA 1YVPA 3GH3A 1EHCA 4O3FA 5DLPA 4KAXA 2FK8A 4AN1A 5JUWA 1V3VA 3G8YA 4IINA 3N9IA 4RX1A 9GPBA 3WLAA 1O4XA 1IY0A 3GLUA 1H42A 3VR5A 2OV1A 1PDOA 4HAYA 4OHPA 1QLWA 3DAPA 2JGEA 2WMDA 2P5YA 4D26A 2FPWA 3NLLA 4NZOA 1NQWA 4LV5B 3FNRA 4IVQA 1NF3A 4QU0A 3G2JA 4QEDA 1RWXA 2GEBA 2B37A 2ZVJA 2A5YB 3FW1A 3NPMA 4PQRA 5CM2Z 3WDSA 2NQ2C 1PS0A 5INTA 5KOYA 5IVDA 3G5UA 1GAEO 1XZHA 2DX7A 3FJYA 1RI5A 4JOQA 5CYOA 1OA1A 5AK0A 4BQIA 2BFMA 3RUAA 4KYUA 3R7WA 1NW5A 4C78A 5E9AA 4L57A 4YRLA 3QXGA 4MCXA 2KLHA 1EUCA 1II8B 2R86A 5H83A 4II7A 5B36A 4UU8A 1ODFA 1NYRA 3K16A 3SVTA 3MCAA 1XPOA 3OCJA 3MJTA 4JIGA 2IEYA 3GLRA 4Q18A 1TZKA 5DXAA 3AMVA 3O8QB 1B8OA 3PNSA 4UEKA 4ZVVA 5T41A 3PCXA 2BH2A 3N07A 4YT8A 3PVZA 3EW9A 2J09A 5EIWA 4N18A 1Y7PA 2R5FA 5FWYB 3WLMA 3OECA 2DJ5A 4D80A 4TROA 4NV1A 1ZMOA 3CU5A 2BOVA 3QVGB 4PG5A 3RSOA 4O4HF 3V2IA 1DPFA 4PVCA 3F0TA 1IM5A 1TYEB 2DQZA 2W4MA 3AIMA 1C3LA 2P4EA 4RS4A 3JQAD 3UIEA 5JC8A 1SU6A 5AVUA 1I9GA 4BP1A 3ZHYA 3WLIA 1YOVA 2QLNA 1V8ZA 1C0PA 1VA5A 3BJIC 3D0RA 4FYWA 1E0AA 4O08A 2ZIVB 3FWHA 3O2SB 4Q19A 1FUUA 3B3FA 5CX1A 1FUYB 4PC7A 1E2PA 2IYTA 4EBFA 3DAFA 1TGVA 2V55B 2W6CX 3G9QA 4EHKA 4RTOA 3EDMA 5BQ5A 3DCNA 1WXEA 2BCJQ 4UDYX 1IEQA 3FPHA 3MQ2A 1ODKA 1PJRA 5ICEA 3KQHA 5KYXA 2GH1A 1DC5A 1CF4A 4EA9A 2XUIA 5FRDA 2QE7A 1WXFA 1Z8HA 1LBIA 1MOPA 3VAZA 1ZS4A 3WK7A 3E5RA 3JQRA 1VLMA 4TPKA 3RIMA 5LU9A 3G89A 1ZEMA 4Q48A 1PERL 3OIYA 4G07A 4DLVA 1C5KA 3DONA 3PKIA 4LN1A 4AL4A 2P8JA 3ZIUA 1P0IA 2AZXA 1D4ZA 1AGXA 3L06A 5BW8A 1OGJA 2VCHA 1M6EX 1OFHA 4BNGA 1AZSC 2R5NA 4M7RA 4G5OA 1U94A 1NQXA 1IMJA 3GLQA 3BGDA 1OWPA 1E9SA 3TW0A 2HOQA 3Q72A 2RCYA 4X92A 3SLRA 1KI6B 3M6LA 3KG2A 2PXPA 3EUAA 3R5SA 5F7JA 1NUHA 4ZV9A 3TMKA 4WA7A 3FROA 3LRTA 4BVLA 1IEWA 5HS6A 5G40A 1J8QA 4HQ6A 3CKMA 2FG7C 3RUDA 4F3TA 5JD6A 3MTBA 3QJ5A 5ALZA 2BDUA 1GFIA 2GEVA 2JHPA 1KY4A 1DKOA 421PA 2Q8NA 3NS7A 2A57A 5DU2A 3WLPA 1Q7CA 4E08A 4XSGA 5LB4A 3BSWA 3QMMA 4BCBA 4F3RA 4K9NA 1R8SA 3QX3A 2KI5A 2P5SA 3LC0A 1TF2A 1QH0A 1RMTA 1GL6A 2DBQA 4DQKA 1NM5C 3FKJA 4DYDA 4YPOA 4ABYA 1TPYA 4OFBA 4DKJA 4F84A 3EGEA 1ZN9A 1FF9A 1XMSA 1Z2CA 4AZWA 4ZC8A 5CA1F 3DMPA 5I9SA 5EKTA 4MYHA 3EQZA 3LD9A 4OQ4A 2DPGA 3ZY5A 3X2FA 4E31A 2OBLA 3JZAA 1GKKA 5BV7A 4M1KA 4RE5A 1J5XA 1GSHA 2B7LA 1A4RA 1A9SA 2ACEA 2HMSA 3QOXA 4P4NA 3HPQA 4I99A 3SBXA 4DR4B 1OXKB 3EC1A 5EC8A 3TTYA 2HF9A 2ZKIA 1TQHA 5FFMA 1B76A 1ULUA 5F78A 1JKJB 2PAAA 1YI0A 2XMDA 1GAWA 4LDZA 4BQSA 3ZE0B 3FVVA 2G5CA 4G0NA 4BFZA 2QRPA 4J1QA 4K7JA 1ADRA 3DT8A 1S1MA 4JB2A 2E6KA 1LLQA 1BG6A 4TTRA 1UINA 1MLDA 1ISPA 1ZINA 4M49A 1KKLA 2ZYWX 4HDMA 4OXKA 4UC0A 4R6WA 1IG3A 4B4WA 1BROA 1PJBA 2VWGA 2ACKA 1IVYA 3DPSA 5JS8A 1OLXB 1UANA 1HL3A 1H65A 2CDBA 3EZ6A 3GNTA 2WKPA 4FMDF 4CLDA 3GLIB 3V2GA 3HB9A 1YASA 2EFYA 2F3SA 4FI3C 3FDFA 3UNXA 3A7DA 3VVMA 4ISBA 1CY7A 1T34A 5IBQA 3V48A 4BEBA 1OFUA 1YIAA 2P67A 4JY7A 1C3EA 3JTMA 2NU9B 4FINA 4LY9A 3HFSA 1SVKA 1SPBS 3GGPA 3PRYA 2FV8A 1I7PA 1LLCA 2ZBGA 3C43A 4HEHA 4YRNA 5L4LA 2G17A 3AGQA 4KXMA 4TWRA 3B1VA 2GHTA 5B53A 3Q5EA 3U3XA 4OHZA 2C4VA 3UICA 1I2BA 3ER8A 4EY7A 1W2GA 4L1KA 5FPPA 3EG9B 3RTAA 1QRRA 4AYTA 4FILA 5C3UA 5I45A 1XPJA 3OOYA 4Z6KA 3D6HA 1ORIA 4XD7D 4KXFB 2ZJAA 4XUEA 3EA4A 3ST7A 1NC1A 1L5GB 4C7OA 3LF2A 4KLZA 2PFKA 4ZO9A 3H87A 1SD1A 5F9HA 5AOVA 4A8PA 1XZ8A 1CF9A 3VI3B 1KEEA 1XTZA 2VYVD 521PA 4DRZA 3GLFA 2CUZA 2J0UB 2ZS8A 3EZLA 4NVRA 3HM9A 2BFDA 3TWOA 1EX1A 2GESA 2QJWA 4CMEC 4URUR 2PBZA 3H5WA 3K70D 5GP1A 3OJEA 1KGDA 4C4RA 4XH9B 3EZ9A 4YUZA 5AVTA 4HLQB 2D1QA 1YZLA 3OFSA 3KLOA 2OQRA 4IMPA 4MR7B 3I45A 5CVDA 1YS4A 1AS3A 1OT5A 2QMHA 2D6FA 1UBGA 3F6RA 4UU1A 3LU1A 4YRKA 5KTRA 4WPGA 2DAPA 3DTTA 3NM5A 1AKVA 1I3KA 2IUFA 4NCIA 1WD7A 4QOGA 5DHFA 3BIXA 3NTOA 1MIOB 1OBOA 5CDTA 4R7GA 1O6GA 3PDUA 2C00A 2PD3A 2OZKA 4QYMA 2C7QA 1DC8A 3T38A 4AZ0A 3C70A 2DY0A 1BA3A 2YBDA 4ZI5A 3ERCA 4PTYA 4B7XA 4LTMA 3DD1A 1N2SA 3NYWA 1SBTA 2F59A 4RJLA 3FZNA 3UKJA 4F5EA 1D1PA 3OKZA 2I54A 3A6ZA 1OHHD 1WMAA 3OZFA 3PYXA 4FGWA 5JXWA 3RF6A 3SCHA 2P68A 2O05A 3FHLA 1G66A 5CA0B 2D62A 2P4SA 4DQXA 4FNGA 1YGYA 3JZMA 1K8ZB 1N6IA 2FGJA 1AQUA 1UBKS 3KJZA 3UJ3X 3WJAA 4DR3B 1RKQA 4DA7A 4BUJA 5K1ZA 3NHLA 4PC2A 1EU1A 4B3RB 3JQCA 1JQEA 4YAOA 3HLYA 1GRCA 2VTBB 3OZXA 5FUXA 1P7VA 3KE9A 3KUXA 4D3ZA 1ZJWA 5I7FA 2XQIA 1SBIA 2JI4A 4LF5B 3DF9A 3G9TA 2TSYB 5DULA 3WYBA 4GPIB 1O0SA 1LDEA 4EAQA 4A8JB 2H1FA 4A0FA 2HB6A 5JVDF 4AX8A 1YAJA 1HI9A 3M6MD 3JQ9A 3IPLA 5F5LA 1L3IA 3RKRA 3W6PA 5K8IA 5B3JA 4O3MA 3P9ZA 4I5EA 2IXEA 4DUGD 1O9BA 2WUWE 4KQFA 1AKYA 2R4UA 3G0CA 1JIXA 4O2LA 4RHXA 2RGNC 2VUUA 5K3OA 5GIPE 4OEHA 5FH9A 2FWNA 4P4SA 5LDHA 5EP3A 3REQB 2EYQA 4P7FA 4EYGA 1JECA 3GLVA 2MCFA 1TAQA 3E9CA 4Y7CA 3OTOB 1IRIA 2J9XB 1PWHA 4MHOA 1CG6A 4G2NA 5E4TA 4C0BA 3JALB 3DCYA 2P0EA 1FSPA 3FR7A 5LA6B 3UA3A 2JB9A 2V65A 3ZBTA 5ISMA 4AUMA 3GA7A 4Z8XA 4HKTA 2IIBA 1WQ3A 2QN2A 2IKSA 1T1SA 1XCPA 2CZCA 3AHCA 5KVQA 1EFRA 3WWEA 5BWMA 1ZSNA 2QYSA 4JKYA 3SSOA 3T9EA 4DV7B 3GLGA 5C8VA 5KX5B 3L9WA 4WY8A 4D4HA 2QA5A 3GUHA 3KZOA 2CBGA 2H54A 2C5SA 5HBRA 4ZC1A 2W11A 3AUAA 3C6YA 1G16A 4PLHA 1HLDA 1SKYE 1ZGCA 3WSWA 1K6EA 4WY5A 4IPTA 5JPCA 1WDWB 5GJVC 4E1VA 4CLRA 3NBXX 2AN1A 4D4LA 2HSEA 3NHZA 4BLSA 3K8QA 3H8JA 4YX9A 1LKZA 2FE1A 1FDSA 2PGAA 4K8RB 2CKDA 4EITA 3GELA 4G6ZA 5A0FA 4UM8B 3R8XA 5D51S 3WADA 5HZHA 1LSJA 5B57C 2PO5A 2C2WA 1G42A 3DVLA 3PGA1 4MQLA 4PX9A 3WWZA 2ZG6A 4GPD1 4B6SA 3J7AC 1JTEA 1B0UA 2D2XA 5HHTA 4BX9A 1DUSA 1CU1A 2Z56A 5DB4A 3NEYA 4B6RA 4CHTA 2BSQA 1NP7A 3TLGA 2QG6A 1W0KA 2E5FA 2R11A 2BZGA 2BWJA 3IAEA 1QFZA 1XLVA 4EGFA 1JL3A 1ISRA 1S2GA 1XKQA 3QFSA 1MC8A 1BMFA 1XRMA 3UHOA 5BNTA 4Q37A 1XRPA 2GVNA 1CDDA 1ZOIA 2XUFA 3AYZB 3VBEA 5K5EA 1TECE 2WMNB 1FFAA 1UMBB 1PBTA 3W4IA 2VHZA 5FFNA 1KWGA 1M0EA 3HI6A 1JLLB 2VOEA 1T5OA 4KN5A 4ESOA 3NEPX 2GILA 4OFWA 2G7ZA 2B5WA 1KIAA 3C6KA 4Z0PA 4IKEA 4OXIA 3I6IA 2VVTA 1TMGE 4B8ZA 1C1XB 3OQ6A 1UEJA 2WIAA 4FHZA 5DHQA 4X8HA 3U3ZA 3OURA 1MO4A 2ORVA 1SVMA 3HB1A 3IAM6 3M6UA 4GM1A 1HY3A 1UJ4A 5IX8A 1T15A 1KTIA 4CNBA 4RVSA 4CL8A 2ZSAA 5HMMA 2AF3C 3HXKA 2FSFA 1ZCAA 2I6QA 5JAPA 4RBNA 3K8YA 3U4GA 3LVQE 5DSTA 4PLGA 1T1EA 5IJ9B 3A9YA 5M34A 2AJTA 2J4FA 2BR4A 3NNDA 4ZQBA 2FWPA 5EFZA 3W3AH 1KWKA 2DERA 3QPDA 3ELDA 2A4MA 2F17A 2ZUBA 4LI3X 4RJJA 1DP4A 4HI0E 4UMEA 4MSUA 5EZQA 1R4NB 3BXHA 2UU9B 2VNAA 3DAHA 1K0FA 1VYVA 1E3OC 3FPCA 3KSUA 3PEVA 5J2TB 1I0ZA 1HFJA 3DT6A 1EFVA 3I9JA 3WLRA 2OB2A 1P5JA 3SQWA 1SEVA 3CF4G 3NBKA 3O9ZA 1J0AA 4Q9HA 3G2OA 1Z4LA 3G79A 1FTGA 1NN5A 5E6UA 1LI5A 3C1OA 4ZODA 5CFMA 5FD8A 4YECA 1ML3A 2X19A 4PPNA 4EI2A 1NULA 3I2HA 3RFXA 4KI7A 3MYYA 4KSYA 4G36A 3X2SA 5DP1A 4WBNB 3AJEA 1K4MA 1LF0A 5DGDA 5C1BA 1LCIA 3ET4A 5C8ZA 1IJBA 3VZBA 5FPKA 4CM9A 4RMIA 3KE8A 4FFMA 1M2OB 3EFOB 3ZK8A 3G82C 1KP2A 5E1MA 1UXJA 3CCBA 5D6OA 2C57A 2C3OA 2F3QA 2PPVA 4QOHA 4X1OA 3TK1A 3UOGA 1UT8A 2ETVA 2ZRLA 4Q3AA 2XDQB 4QNMA 3TQFA 4YP7A 3WTCA 5AVWA 2KZ8A 3OPYA 3ORSA 5K3FB 1JV2B 2VAWA 3OEHA 4O4JF 4BMXA 2O59A 2QT0A 3AOEC 3RADC 3NV7A 1E98A 3D6UA 4UASA 3H5LA 2JGRA 2I2XB 3FPGA 4ZFNA 1IJKA 4PAMA 3FOBA 4KXQA 3OLWA 1LI4A 2HZBA 5EXTA 2G9UA 4HQLA 4HQRA 5DF1A 3FYTA 4WSOA 3KR9A 3V8EA 1BD3A 1WX1A 2XVMA 4G37A 3DMFA 4GI5A 4US1R 3WC4A 2XUJA 8LDHA 5JHHB 4DJJA 1MZPA 3THRA 5HK8A 5JQGF 4G3XA 2QZ4A 2SKCA 5ESXA 4GWGA 3UK7A 4BP8A 1UBLS 1XTKA 3OX3A 2A3NA 1XWWA 4JUBA 1XCLA 1JEOA 3A25A 1MB9A 2DGDA 5TX7A 4CEIB 1ILWA 4DMRA 4ZI2A 2JCBA 1BFDA 3PF8A 3WYNA 2J6CA 1MO3A 1X9HA 4BYGA 1JTFA 3PVCA 4PY2A 4PO9A 1PTJA 1I6LA 3L7NA 4QXQA 1QIDA 4KWTA 3SF8A 1OMOA 1A2BA 1RHUA 5DNUA 4H35A 1HA3A 3RYCA 2HSGA 4QSMA 2WM8A 1Z5OA 1DQRA 1JB9A 1LDBA 5K45A 3KEFA 2RCNA 2P9EA 1GCUA 1F0PA 2VYND 3H0KA 4PPYA 4DC0A 2YJTD 4ZCIA 1KC3A 5DNVA 5TB5A 3USCS 2CWDA 2R6DA 5JNRA 4RESA 1W36B 4PG7A 4XX0A 2WSSA 3GXOA 4TKVA 2AMJA 4JI4B 2WJZB 4MHSA 5EOVA 4QU9A 4GD3Q 3URKA 2WJGA 4HS4A 5F2KA 1RBZA 1T25A 2QMUA 1R6VA 3PSHA 4CKEA 4QYIB 1GTRA 1Y3CE 1G8YA 3HJRA 4IRMA 1UAAA 5MN5A 1I7NA 2ZOSA 1Y8CA 1M2EA 2FSGA 2X58A 4KPEC 1P4RA 3P9QA 2QTRA 2XWBF 3ZCQA 3AV3A 1VRVA 3GQVA 1Y4UA 3F4BA 4IR7A 3IKVA 3RS8A 3TW8B 3ZLBA 1BWQA 3HNRA 3CNEA 3ZLUA 2OVFA 1P81A 3N8KA 2B25A 4IHQA 3N3BC 1UPXA 2J59A 4PNZA 1SXJD 2PMDA 1CQPA 5JROA 4IIUA 2IF2A 2H63A 3WAJA 2AUWA 2SICE 3LQ4A 2J07A 2Y8EA 2MYNA 1D4FA 2JGDB 3OA0A 1GQYA 3IAXA 1PFGA 2IHUA 4QPCA 2AJCA 4S0XA 3M6WA 3EAQA 4BN0A 2VP5A 4CPDA 3WYEA 3CF2A 3OZDA 2E4XA 5JAMA 5LU8A 1B73A 2D00A 3IVXA 3ZDRA 1BTOA 3DM9B 2C95A 3Q85A 4EVIA 3TDMA 2BMJA 3EVTA 3GA0A 4UXHA 1PNQA 2AUNA 3BFPA 4CI0B 1M1YE 1GWNA 2H0QA 3EPKA 2GHIA 1KDZA 4AYWA 2QY6A 1QIKA 1X87A 3PWSA 2JDID 3QU7A 3DBVO 3PNBA 4PSKA 1Q50A 1FPMA 1KU6A 5HIKA 2W6IA 1P19A 4CMIB 1PW7A 2WIGA 1XTJA 2YCBA 3MJDA 2VS1A 2WIBA 2BGKA 5DNWA 1GTZA 1DKQA 1V43A 3IBCA 5JOQA 3EX7C 3KR0A 3GFVA 1V6SA 4XARA 4QJIA 2C0CA 3EARA 3CUUA 3S4YA 4CR8A 3DL0A 5JLJA 2YMPA 4P5EA 1RADA 4URYR 3PJDA 4L76A 1R5NA 2NUPB 3MHPA 1Q1BA 1Y6QA 2O23A 4FN5A 1XF1A 4HYTA 4BC1A 5LOVB 2V1XA 2ZTVA 2WWIA 2AOTB 1ZHOA 5E4FA 3LUJA 3G8CA 3K70C 2YZGA 3W34A 5GQSA 1FCJA 1U7OA 3AF6A 3H4IA 4WMLA 2GQ0A 2FW6A 2D0PB 4QUGA 4KQMA 5TQ0A 1EDDA 1TK2A 2MYUA 3KZ3A 5K98B 2M1XA 4PFQA 4TYPA 2IYRA 3OM9A 4AN0A 2FSUA 1GZ5A 3A6HA 2IXGA 4H1UA 1A2KC 3FCEA 2OYRA 3MJHA 4J07A 3OWOA 1XTIA 2QUAA 1Y4SA 2X2OA 3SYTA 4TTIA 4G9BA 1G18A 1I8TA 3QWGA 3BE6A 3VHXB 2MSCB 3G02A 4X4IA 1A98A 1LPAB 2AYZA 3KQVA 2EYUA 2LVBA 1QVWA 2YX1A 4AU1A 4EA6A 4KWIA 1G4HA 1V3TA 3A1CA 4XFDA 5B4VA 3FYAA 1HL7A 1UXGA 1WZCA 3I1YA 3A27A 4UUPA 4PW0A 5EP2A 4I14A 2WZBA 2DQKA 3F7NA 3INRA 1W5BA 3H2YA 5HRUA 2OP1A 4XTRA 2RFLA 2H17A 2EBUA 2GN0A 1C80A 4MXDA 5D8DA 5B37A 2WF7A 5PGMA 1P1RA 4LXUA 4P7GA 2IODA 3WBKA 5H4GA 2PL9A 2WIJA 1K86A 4KV7A 1KAQA 4WOJA 4OKSA 4RNCA 3H4MA 2CNLA 3CYFA 1NV9A 3UFXB 2H2GA 4TLDA 1TUEA