1JH9A

Purine repressor mutant-hypoxanthine-purf operator complex
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
339
structure length
339
Chain Sequence
ATIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAAYFAEIIEAVEKNCFQKGYTLILGNAWNNLEKQRAYLSMMAQKRVDGLLVMCSEYPEPLLAMLEEYRHIPMVVMDRGEAKADFTDAVIDNAFEGGYMAGRYLIERGHREIGVIPGPLERNTGAGRLAGFMKAMEEAMIKVPESWIVQGDFEPESGYRAMQQILSQPHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEVHPRLIERRSVADGPFRDYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*AP*AP*CP*GP*AP*AP*AP*AP*CP*GP*TP*TP*TP*TP*CP*GP*T)-3'
publication title Role of residue 147 in the gene regulatory function of the Escherichia coli purine repressor.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription/dna
total genus 117
structure length 339
sequence length 339
ec nomenclature
pdb deposition date 2001-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00356 LacI Bacterial regulatory proteins, lacI family
A PF13377 Peripla_BP_3 Periplasmic binding protein-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 1jh9A01
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1jh9A03
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1jh9A02
1WETA 3F6PA 4PYRA 2XDYA 2MSWA 1JBEA 2E4UA 1B00A 1AB6A 2LPMA 3EJWA 3KLOA 5TQ2B 1RZRD 3E3MA 3HM9A 1Z18A 3LUKA 4KZKA 5HQJA 3GRCA 3O1IC 3QEMB 4G0ZA 5IC5A 3OM0A 4MS3A 1JFVA 3BBLA 4HNQA 4GPAA 1EWKA 3O74A 5JNTA 2LYQA 1U04A 3M6MD 5FWXB 1YTUA 3MF4A 2GRLA 1WH8A 4RY9A 4EVRA 4HNSA 5EWMB 4DADA 3MA0A 3NNDA 5TQ0B 1GLGA 4RK0A 3L1PA 1EAYA 5EWJB 1ZS4A 3OLWA 2HQOA 3GN5B 2GKGA 1RXIA 3H1GA 4G0MA 4YO7A 4W5TA 3JPYA 3JVDA 3TO5A 5FBKA 2AXUA 1ZGGA 4NDWA 3TD9A 3ILYA 3H6HA 2XI8A 1DW9A 2KYRA 3URMA 1LCDA 2IKSA 1UXDA 2L18A 2ICTA 2IVGA 3RVJA 1E3OC 2BGGA 4F8DA 2HJ9A 2IDMA 3T95A 9ABPA 4X4FA 1BDJA 1K66A 1XHEA 2MYUA 5FWYB 4E7PA 1BDHA 4PEVA 1QP7A 1GUDA 5CNIA 5F64A 3KSMA 1LK0A 2N9UA 4Y42A 4W5RA 4X4CA 2A9RA 3SCGA 3LUAA 3A3KA 2H8RA 2AXZA 3RQIA 4PU8A 2NUBA 3KTOA 3JTEA 4RWEA 3N53A 1DRJA 2LBPA 3IP7A 3UFDA 4KMRA 4YG4A 1JWLA 5E3JA 8ABPA 4S05A 4OLBA 2LIVA 3HUTA 4IWRA 2HQBA 2M1ZA 3L49A 3SCHA 1JYFA 4OBBA 4WXMA 3CHYA 2FN9A 3KLNA 4XASA 2GRMA 1C0EA 2PAFA 3O21A 5T7BA 5BQ3A 4OB4A 2I6FA 2FVYA 2AYZA 1E6LA 2JBAB 1ZGZA 1LJLA 1KGSA 4LE1A 1OCTC 4WT7A 5TPWA 2Q5CA 1EFAA 4Z59A 1FQWA 2J48A 4G0XA 3QX8A 5KC8A 3DBIA 1RZSA 3QQ6A 1NY5A 4JASB 4MCXA 5IEBA 1RXEA 4JAVC 1ADRA 1MIHA 2ZWMA 4IA8A 1CYEA 4ETMA 2WJWA 2PUAA 2PJUA 3G1WA 4RS3A 5TQJA 3OMTA 2FQWA 3C6QA 4XAQA 2W42A 4FBIA 3C97A 4PICA 3SQNA 1YS7A 2OFYA 2HINA 3BD1A 1PRVA 4X4DA 1ZZ6A 2IUOA 2B1JA 4YBAA 4IVZA 1M2FA 3FDFA 3O1HB 2QVCA 4B09A 1PHRA 1A2OA 3GYBA 4MS4A 4RKQA 3T6KA 3QYXA 7ABPA 1KMIY 1ZZ9A 2PPXA 3K4HA 1URPA 3Q7RA 3DLBA 3VK0A 3KG2A 4RV5A 3BDNA 5K98B 3E61A 2MEZA 1LMB3 1DWKA 4X4IA 2IYNA 4QYWA 1SQ8A 3H5OA 3A0RB 4JB2A 3NHMA 1RZRA 2QSJA 2JK1A 1OXKB 3H5TA 5B3JA 5IULC 2ICPA 2O38A 2M98A 2KZ8A 4X4GA 1DC8A 3Q7SA 3H5WA 3L6UA 4NCBA 4TN5A 4D74A 1YIOA 5C5EA 3CFYA 2F8SA 3EQ2A 2LYPA 3HCWA 3LUCA 3QLUA 4MR7B 5TPZD 3SAJA 4LE2A 5PNTA 3HZHA 3H6GA 2MQKA 1XWWA 2R48A 4IF4A 4WZZA 2AWIA 1OXBB 2CD7A 4FE4A 4MQEA 3DLHA 1LCCA 4QICA 4F3TA 3T38A 1PUXA 4LE0A 2EBYA 4Z5HA 4OG2A 1PRUA 3BS3A 1R63A 3Q7TA 2JCGA 1JDPA 5GQSA 5I4CA 3QF3A 5JS1A 2HQRA 3LUFA 2MSLA 3FMYA 1A0OA 1NXOA 2FN8A 2PLNA 3Q15C 3N6VA 2R25B 4RY8A 4YG1A 2H0AA 1OSLA 3R1FA 3OLVA 1X57A 2A9QA 3OO0A 3KHTA 1Z17A 4D6YA 1ZZ8A 3H1FA 4KNYA 2GI4A 1U8TA 3N0RA 3BILA 3QLVA 3FFWA 1DJMA 5ABPA 1JFTA 2CHFA 2QU7A 3RVQA 3LUHA 2QXYA 3QELA 4MRMB 1P6UA 3U3WA 1U2PA 3GT7A 5JNUA 2LP4Y 2AXVA 2OQRA 5FWXA 3KCNA 5BRJA 3CS3A 3JXDL 4EGSA 1Z2DA 2P9HA 4PU7A 3CZCA 2WMYA 3BREA 3OLZA 4O1IA 1ZY2A 4UHJA 3GN5A 4PE5B 2R63A 2IVBA 4WXEA 5DGCA 2E4XA 4RU1A 3CECA 3VNAA 3S8QA 2FJRA 4L4UA 1JX6A 6ABPA 4HYEA 2BNNA 1JHZA 4MQFB 4LZLA 1JDNA 1DC7A 2HSGA 1K68A 1MVOA 1XHFA 1GCGA 1LJUA 2MYTA 3LKVA 1U2QA 3GBFA 2L17A 1H9CA 3QK7A 3EULA 1DP4A 2CSFA 3BRSA 4OTZA 4NV3A 4JB0A 4O5AA 1DCFA 3GBVA 4IMJB 4RK6A 2FXIA 3I09A 3F51A 4YRZA 1SXHA 2NT4A 1YMUA 2JVLA 3RVMA 1JF8A 3OM1A 2IU7A 1GCAA 4LDZA 1W25A 3HDVA 1P2FA 4X4HA 2NZVG 4ZYLA 4S04A 1BDIA 1BVHA 4EVQA 2JBAA 5KWSA 5CNJA 4Q6BA 3SNKA 1Z13A 5IX8A 3RVOA 2EWTA 1Z25A 4RXMA 4YV7A 5TPZA 2CWDA 2V0NA 3C3KA 1F51E 1D5WA 3I5AA 1RPJA 3D02A 1NATA 1YSEA 2QR3A 5EWLA 1KRXA 2F8TA 3HUUA 5JNWA 4KVFA 3SCFA 3JPWA 4EYKA 4Z4CA 4I6RA 4O8BA 1NERA 4O1HA 3QLVC 3HV2A 3Q41A 2O20A 1IIBA 2R4QA 3JVIA 1EHCA 3QEKA 3O9XA 3QX9A 3R0JA 4WWHA 2NT3A 1LBHA 3CG4A 3NBMA 3N0WA 1M5TA 1Z26A 4G97A 5KQGA 4LX8A 4YS6A 1U0SY 2B5AA 3IP9A 4RXTA 4F8JA 5IEJA 2IOYA 3A10A 3OLYA 4MS3B 4XLTA 1QPZA 1YS6A 1GT0C 4YARA 1AB5A 4DQDA 1R69A 1UTXA 4Z9AA 3JS5A 1X2LA 2FMKA 4P98A 4QPJC 4JQDA 1NXVA 2X7XA 3LUDA 4EYOA 1O4XA 3N8IA 1LQCA 4PU3C 3F6WA 2WIUB 1ABFA 5JS2A 5KQMA 4IRXA 5DLEA 1FFWA 2OENG 1SRRA 3DGFC 3O2QB 2LYSA 4MLCA 4F06A 3TRBA 4RSMA 4G0QA 3TMYA 2P4UA 3O1JC 3EGCA 2FEWB 1DRKA 4RK5A 1UDRA 3ZHMA 4Z4GA 1ZESA 2XJ3A 4ZMRA 1BAPA 1M5UA 1YMVA 5GOTA 2KEIA 2L2QA 1ZVVA 2WY2D 1D4ZA 4MS1A 4GNRA 4YCSA 3IP5A 4KQ9A 3A0UA 3O75A 2O4AA 4P1ZA 1E6KA 3IVPA 1RPEL 1M2EA 1NXWA 2JVIA 3MMNA 4JP1A 4ZPJA 4N76A 2DRIA 4RK7A 5BR1A 1PEAA 3IP6A 3QWGA 3SY8A 3M9WA 4TLLB 2FEPA 2FEKA 3LFTA 1Y7YA 4YGXB 3UK0A 3CLCA 4FN3A 2ZAYA 1VLZA 3GV0A 5CNMA 5JNVA 2CROA 1ZUGA 2IPLA 4KV7A 3O2SB 1QNLA 2VYCA 3CZ5A 2H3HA 2NZUG 4MR9A 4RZSA 2BNMA 3OP9A 4DN6A 5TPWB 1HF0A 3N75A 2LYRA 2E4YA 1ZZ7A 1FFSA 1AU7A 2FMIA 4H3HB 4KQCA 1LBIA 4J1WA 5BRAA 5DTEA 1SXGA 4MAAA 5TQ0A 2JVKA 2GWRA 3EQZA 3LISA 2QV0A 2RJNA 2E4WA 4TMYA 2PL1A 4L85A 3JY6A 1PEYA 4Z4EA 1DBQA 5TQ2A 3ZKCA 2RJOA 4MQFA 1Z2EA 2B4AA 3QEMA 1VRVA 4E7OA 3RVPA 2FQYA 2FTKE 3KZ3A 2AYXA 2E4VA 2FLKA 4Z9BA 5HKOA 2JRLA 3VNBA 1QMPA 3H5LA 1TJYA 4Z5DA 5EWMA 5IBQA 1NXXA 2QVGA 3F7NA 3CLKA 3HEBA 1DZ3A 5EWJA 1APBA 2XIUA 1QKKA 2XCJA 3LKBA 4LRQA 2L49A 1E6MA 1S7EA 2ID7A 2IV1A 4I6TA 3T8YA 1Z12A 4W5QA 2VUIB 4Z58A 3RVRA 4X4BA 3TX6A 1RNLA 5CNKA 4JCXA 3EDCA 3FFXA 2PIJA 2FSPA 1MAVA 3GWGA 1R8JA 4MPTA 5FWYA 5HSGA 1D1PA 4MQEB 5B3JC 3HZIB 1JH9A 4ZMSA 1T34A 2GBPA 2WJAA 1ISRA 2PL9A 3TB6A 3HSYA 4H60A 5C5CA 2VUHB 3FFTA 4XARA 3QLUC 2PUGA 4KFCA 1DBWA 4MR8B 4YP9A 2L8NA 4Z4IA 4G0YA 1QO0D 3UUGA 4ETIA 3CNBA 3CROL 1ISSA 1L1MA 3SG0A 4YG7B 4Z4FA 1DCMA 1L5YA 4RK4A 1GUBA 4N03A 5IUKC 4HNRA 1TVMA 3OLXA 1P6QA 3LUGA 4N0PA 4G0OA 3KJXA 1Y9QA 3MLFA 3F52A 4N47A 3HXMA 3LMKA 1MB0A 4Z99A 2PUBA 2E4ZA 3FYMA 2ID9A 3MM4A 3QELB 3ROTA 3M9XA 4EVSA 5JNSA 4OLAA 1WIZA 4Z0NA 4ETNA 5KC9A 4W5NA 3FMVA 1W9HA 2LYKA 3NNSA 3EUSA 4N41A 3RVSA 3HK2A 3KS9A 2LYLA 3H5IA 1ZZCA 4X4EA 1PNTA 4Q7EA 3F73A 5T3YA 5KQPA 2KEJA 1VPWA 2PUDA 1CHNA 1USIA 3CTPA 3RH0A 5KQLA 1YVUA 1EWTA 5DCLA 3OQOA 3IPCA 3LUJA 2KEKA 1YK1A 3H75A 4MYRA 3RVKA 4JA2A 4NICA 4MCTA 2PE5A 1JFSA 2LCVA 3DNVB 4J1XA 1D2AA 2GX6A 3KYIB 4RK1A 4RY0A 4I8TA 2MYNA 3HJFA 3JXBC 3CG0A 1SXIA 3ILHA 1NXSA 4PU4C 3FYAA 1LLIA 4G86A 2PMCA 4TLMB 3D1NI 2TMYA 1USGA 1ZPQA 3SM9A 3OO1A 1Z15A 3HO1A 3CU5A 1CJGA 2KPJA 3ROFA 3G5GA 1TLFA 2VK2A 1J56A 1Z16A 1DCKA 3D8UA 3F6CA 4GHJA 3NHZA 3C3MA 5FBHA 2HPHA 2WRZA 3S99A 4Z5CA 4MR7A 3UKJA 2GZUA 4RDCA 1ZZBA 4CBVA 3N0XA 2XSDC 3O2JA 3RVLA 3HVRA 1NEQA 4KPYA 1PRAA 3GA5A 3K9CA 1TMYA 6CHYA 2YHBA 3MIZA 2FMFA 4WUTA 4GQMA 4M88A 3DGEC 2R47A 4F12A 1F4VA 2QZJA 2YHAA 2MSKA 1IC8A 1QQBA 4F11A 4EY3A 5JNRA 2FW0A 3EODA 5EWLB 4G0PA 5HM6A 3IPAA 4EYGA 5A7LA 5D2CA 3JXCL 3H5VA 1E2BA 4Z4HA 2BNOA 1XWRA 1ZAYA 1QP4A 2A6CA 1P8AA 2CHEA 2FQXA 1TM2A 1JLKA 2LUOA 2RDMA 3OMWA 4RKRA 3RVNA 3LOPA 3OQNA 3OQMA 2FKAA 2R1JL 3H1EA 1NTRA 1QO0A 1ZH2A 2MYPA 4ML3A 1ZN2A 4YLEA 1UXCA 2IVQA 4MRMA 1NXPA 3QLTA 4YWHA 1RIOA 3DZDA 1USKA 1PNRA 2A9PA 2FMHA 1QQAA 3KXAA 1CQTA 4UHKA 2D5VA 1HEYA 2PKXA 2QW1A 3HS3A 2WUSR 4IMIB 4H3KB 1ABEA 3KKEA 3MYYA 3NNNA 1FSPA 1B0NA 4IGAA 3HDGA 5KI6A 3LFPA 4KK4A 1KRWA 1ZITA 4Y9TA 1CEYA 2PUCA 3I42A 4ZJPA 4FB4A 1JL3A 5TE9A 2WB4A 1C4WA 4MS4B 5IUNC 3P9YA 4MLDA 2L19A 3B2NA 3IDOA 1DBPA 3I45A 3ZHIA 4JCYA 4NQRA 5ED4A 1VKRA 4N0QA 1MB3A 2IPMA 2PUEA 4MS1B 1I3CA 1FFGA 3RZZA 2RGYA 1ZHHA 4MR8A 3MQ4A 1QP0A 3KYJB 3C3WA 3GBPA 2AW6A 1S8NA 3LTEA 4PZ0A 2IPNA 1YK0A 2PUFA 1Y1LA 5CHYA 1L5ZA 1D1QA 4FE7A 1BA2A 1NXTA 4I6UA 3CRNA 3PXPA 4EYQA 4KRFA 2AUWA 4KREA 5DKFA 3CKMA 3B7HA 3GL9A 2BJCA 1JYEA 4Q6WA 4QYMA 4RXUA 4LDAA 4MGEA 3EAFA 4MR9B 1ZH4A 2IPAB 1SD5A 2JVJA 4NCAA 1DG9A 3BRQA 3W9SA 5IUJC 1A04A 3Q9SA 2A9OA 3G85A 4EUKA 4XXHA 4D6XA 4W5OA 1PERL 4IILA 1EWVA 2JB9A 2O49A 2FLWA 3FGZA 4JOQA 1ZDMA 4YR7A 2LYJA 4XFKA 4OATA 2WWVD 2EF8A 1POUA 1WH6A 3OMXA 2OR1L 4KK3A 3G7DA
chains in the Genus database with same CATH superfamily
5DWQA 3UFXB 1V8PA 2ZBEA 1ULHA 5FRDA 4YV0A 3P9ZA 4R68A 2BIFA 4XCVA 2CEKA 4DDKA 2BM8A 1M34A 1QFSA 1XRPA 3DNFA 1KO5A 3FPLA 2GCOA 3L6CA 1OAOC 2XVMA 1K92A 4UC0A 4DSZA 3ODPA 3E2IA 4GPAA 3K0AA 2FEOA 4RIHA 1N2HA 4BP1A 4LYEA 5D51S 3DAGA 4OK3A 2FY8A 4J16A 4O5OA 1TW3A 5EFOA 2VT3A 4J4BA 2YZNA 2RGCA 4TTJA 3BX1A 1GNQA 3K5HA 3ET4A 3QUCA 4LS3A 1H8EA 3D7RA 3IP8A 3COZA 2ZIXA 5IJWA 1PNVA 3G5AA 5B4TA 1SOAA 1EG2A 4GXRA 1NVWQ 1ZGGA 4PGFA 3R0QA 3BCHA 5AWFC 2FR8C 5IAKA 1G64A 3JQ8B 4YMWA 1R1DA 1ZZGA 3LCRA 3RVJA 2YUTA 4RDIA 3ZDEA 4BO8A 1PZHA 5HS4A 4PRLA 1QK4A 4E7PA 3UICA 3MHTA 1H5QA 4RUKA 1BDHA 2OV2A 2ZWAA 2ZRHA 2BM0A 1U0HC 1P9RA 1UXJA 1COZA 2JGDA 3TKAA 3EVZA 1TUBA 5FOTA 4N3CA 3FPGA 3CLTC 4KP7A 2Y1GA 3WWEA 2H7YA 3O0TA 3AF5A 2VJDA 1H4SA 4R1OA 2NUBA 4HWTA 4LY6A 1OWOA 3CF4A 1PYOA 1QPGA 1U1EA 3DNMA 4QNRA 1L8QA 3JYQA 2HRBA 4YJFB 5DHSA 3B1FA 1CUVA 1M54A 1MX3A 2F17A 5AVJA 3U9LA 2FFAA 2FN9A 4UASA 4UW9A 4BMCA 2ONYA 1TIKA 2FA9A 1DUVG 3B3QA 3MINA 3ETDA 4DE5A 1RAAA 4DR5B 1YONA 2JBAB 2IJGX 1NYLA 1SXJD 3TIVA 3QFRA 1EUZA 2PUVA 2Q5CA 4L75A 4OQEA 2J6IA 4YDSA 4CR7A 5FO0A 5IM4F 3V6LA 5DSZA 5I4BA 3DLAA 1PD1A 2SCUA 4CL2A 2AYYA 3DQQA 4IA8A 5ALIA 4RVNA 2PUAA 3U6BA 3R74A 4RTJA 4CV3A 1P0CA 4M9SA 1U7XA 2A0FA 4UPVA 1KFJB 4R98A 5ADUS 3ZGVA 3JR3A 4B1FA 2C7OA 4C2TA 4PICA 5E7MA 3RGGA 3P2YA 3ZZNA 1XAHA 1PRVA 3AF4A 4JB8A 4O3MA 1JDVA 4IVZA 1ECCA 1VA5A 2V58A 2Y27A 3FR8A 3ZHOA 3GYBA 1FOEB 3T6KA 2CFSA 3C1OA 1KVRA 2OO5A 2XQVA 3CCCA 4ZZ1A 3JQ7B 4M7RA 5K0ZA 3LWBA 2MEZA 1OZAA 1MEEA 4RVHA 5BSHA 4C5BA 4JJKA 2OWDA 3RYHB 2Q2VA 3QOFA 1A9PA 1TD1A 3H5OA 5K3EA 3JX9A 2IOQA 2EX0A 2WD7B 1EHIA 1ENPA 1JXOA 2KZ8A 1JHOA 1WA5A 4L0DA 5TT1A 5JARA 1ZCZA 1UKEA 1MVNA 3KIPA 1VLVA 4OP2A 4CTOA 4HHEA 3HEMA 1J0AA 4Y1RA 5LDHA 3DR3A 2YS7A 1A9SA 1GTVA 3PQ5A 4Q1AA 2ZAIA 1DO8A 3MGCA 4LX0A 2O5EA 2D0OB 4H7DA 3D8NA 3QFFA 1SO8A 2HX1A 2ZJ6A 4JI1B 2DFDA 1N6RA 1XCBA 4P7KA 3DBLA 5T6MA 3EMKA 3UNXA 3M6XA 3ZE8A 5BVGB 5F7JA 4JLSA 2ZBDA 4CRWB 4MVJA 3C6BA 5CHEA 3UV6A 3VO8A 1VJCA 3Q15C 4RORA 2GXUA 1WDKA 2WWTA 1TAGA 1X7WB 1ODLA 2IL1A 1T8UA 2RAFA 4HUQB 3CRZA 4EX7A 5JASA 3OTWA 1XYGA 2DETA 3E5RA 3ZDZB 2V7TA 2REQA 1DG3A 3N9IA 4AJEA 1J25A 3C3CA 5E7IA 3GT7A 3M3PA 1YZ3A 4LZOA 4MYCA 4BC1A 2FWJA 3FFBA 4D8VA 5JNUA 3EZLA 1GKYA 3KSUA 2X76A 4E1BA 1A95A 2FW7A 3K7EA 4RVSA 1J21A 5C32A 3SC2B 4K1LA 2PY6A 1SXJA 2V0GA 5D5QA 1W4BA 4HATA 1TM1E 3WYEA 3AONB 3MOGA 1JQLB 3R0IA 5AHWA 1L9XA 4MW1A 3PUYA 4V0LA 2PU7A 2IODA 1WVMA 3S2GA 5KKAA 3ZV6A 2ODRD 3TEFA 4A1OA 2ET6A 1U3FA 1Q44A 3WICA 4L74A 3H5RA 3G2LA 2O1WA 4MUAA 4YMIA 3FNIA 2XNJA 1QZXA 3BJIC 3QK7A 4RD2A 5CT9A 4HNAA 5FD8A 1H6DA 2HRQA 1SBZA 2UZ1B 3OPVA 3NPMA 3UA3A 3ORRA 1OASA 4B5LA 4Z9XA 4GZMA 3TZ6A 1CRQA 2FXIA 1PT8A 1FXWF 1SQSA 2DHRA 2IHJA 3A9CA 3I09A 3N2IA 1ORRA 4NZ9A 3UC9A 1GAJA 5BUZA 3T1YB 4C0SA 2LKDA 7ADHA 3AB3A 4N0DA 1RQXA 4BQPA 3OQJA 4QTYA 4D56A 5K09A 2IE8A 2B4QA 3NRJA 2B9VA 5HGXA 1BVHA 1FDOA 1T0HB 2J7PD 2OCBA 4TUYA 1A9YA 1X8JA 2PS0A 4NC9A 4BRWA 2G07A 5ENDA 4RCYA 2YN2A 3EIHA 4F56A 4B32A 1MQ8B 1ZXXA 3PUHA 4I1YA 5B3KA 1NATA 5SZJA 1Y7IA 3I9JA 3JVVA 4QRDA 1FNBA 3OOYA 4AM8A 1G5QA 1F6DA 2EXXA 1NWCA 5EZYB 2PXUA 4S1PA 2B1GA 1FUKA 1PYGA 1BJKA 2VATA 3KWJA 4EWLA 3A3NA 2BEJA 1MOSA 1NVVQ 4GWKA 4KPUB 1N78A 4AX8A 4LYAA 1E3EA 4X65B 3GGJA 4L27A 4OXKA 3AR8A 3T7IA 1ZOSA 4NPCA 2GD1O 3EUWA 3KKQA 5FBRB 2LIPA 3IXMA 4REQA 2WOOA 3NIDB 4MUJA 1M2OA 1IQUA 4MXDA 1T4MA 1YNSA 3LYHA 4DJTA 1G6OA 1N7JA 1LWNA 1ZH6A 2IVZA 2NXEA 3G9ZA 1HORA 4IEFB 4XEUA 2MOKA 1F8XA 3OT5A 4HDOB 3SS9X 4BP9A 1J6UA 4DSNA 4JXZA 1RQ2A 2FK7A 4DL9A 4EHDA 4YRDA 1NXVA 3U0BA 2CE7A 3E7FA 1LQCA 1AKVA 3F6WA 2B4YA 1M0TA 5JS2A 5F2KA 1ADBA 3QHAA 4MGYR 1SXQA 1F3LA 5FL3A 2VCEA 3VKWA 4LQDA 3OJWA 4JLDA 2AG6A 5HIKA 4MYDA 1SULA 3L8FA 1ZN7A 5ITWA 1UDRA 4GLBA 1KO7A 1EK6A 3WK6A 1BAPA 2QL6A 4PLYA 2VDRB 5EXXA 3JD4A 1ADCA 1JH8A 1TNDA 3OETA 4Y9DA 2OCLA 3NZLA 4R05A 1I13A 3C4VA 5LIRA 3TLGB 2OB2A 5KJEA 1CULC 1J09A 4N01A 3A0UA 4QU8A 4B2PA 3D9QX 3SK0A 1I2ZA 1E6KA 1O89A 4GWLA 3ZD8A 4CHTA 1C30A 2KI5A 4UTXA 2IVFA 5GONF 2UZ3A 5FNVB 4XIIA 4N76A 1Y4UA 2ZZKA 4X93A 1P77A 3HJUA 3V8VA 4CG2A 4H18A 3AETB 5K8IA 1WIWA 5DGHA 4LISA 3OJLA 3PENA 5LD2C 2P8JA 3T94A 4CMEC 2NZUG 2QVZX 4LHVA 3ZY3A 5HF8A 3ZYZA 2QE6A 2XWBF 1AN9A 4BTEA 4DN6A 5HK9A 3EZFA 4RGQA 3WISA 2AW5A 3KT6A 4D4JA 2CT8A 3NHJA 2QE7A 3CZ4A 4NU6A 1C7JA 3ABRB 2B61A 2JVKA 1I7PA 3EQZA 4NLLA 5F1YA 3V48A 3PGXA 5KTOA 5IJ0A 1BCRA 2VBGA 3F47A 3BSYA 2XPCA 4AZTA 1KNQA 1X7ZA 4TWIA 4Y2XA 5HMMA 4YCMA 3BZBA 2E18A 4P80A 2PSEA 3BFXA 3MLEA 2IGBA 3PHHA 2ERCA 4I9HA 1DRWA 4JBIA 3EXIA 2B78A 5JDIC 9LDTA 5IVKA 3QEMA 3HABA 2H8GA 2PS3A 2AR0A 3T3PB 2AOXA 3X44A 3K71B 5T41A 1HR0B 4NYIR 1TJYA 3H7AA 1WUIS 3KTFA 5IYZA 1A4XA 1CXZA 1MH1A 5BW5A 4EEKA 4AICA 5JALA 5K0NA 3J7AC 3AVQA 1E6MA 1CCWA 1AS2A 2ZRQA 4UVIA 3V80A 5JD6A 2XGJA 2XYHA 3I6IA 4RV9A 3FKJA 5AICA 1SN7A 2QTZA 4Y7DA 4AF7A 2C03A 2QN2A 3SYMA 1ZJ4A 1VMIA 4E94A 2IXAA 1GEEA 2GVNA 4RH0A 1D1PA 4UHDA 4KCGA 5IC4A 4F04A 2BGWA 3C8MA 3TR5A 3TB6A 3WA7A 1R4MA 1T8TA 2F1OA 3FYDA 5GMOA 5H16A 1CVRA 1BWPA 4A2QA 1S9HA 1ZM9A 1YUBA 1LRLA 1MF7A 2XHEA 2ZYVX 5KEIA 1DG1G 2HK9A 4Z4IA 2CJWA 3ZLVA 1EUCA 4Y1FA 1V8FA 1C1HA 3DEYX 2J9FA 2J5XA 4LXYA 4L0MA 2QV7A 2ORIA 1KR2A 4QWWA 4HNRA 1V5EA 2HR1A 1A98A 3AEXA 4H1HA 3JZIA 4HSEA 3MJTA 1VL6A 1TB4A 4K3UA 4ZQBA 4PPYA 3RIHA 3M81A 1RVV1 4YJKA 1MX5A 4L4XA 5K8UA 3P0EA 5J58A 4UBMA 2WJYA 3GCXA 3QSYA 2HXSA 2J3KA 1I4OA 2GN4A 4QXMA 2R6AA 1MJGA 2YV2A 1TL7C 5DCLA 2PCLA 5BW8A 5MFZA 1U02A 4QG7A 2HF9A 3IALA 1IY1A 3I04A 2N75A 1T5TA 4YQEA 5CBPB 4DRYA 3C3XA 3JASB 3F7OA 3EGDA 3L6EA 1CJSA 4UQPA 5C7YA 4EENA 1SA0A 3UJ8A 1RWNA 4DLKA 1N0UA 5JAUA 1YV9A 2QVXX 4G86A 4JYZA 1R0SA 4WKGA 3EE6A 3KRTA 2AQ8A 5EVCA 2EDCA 3V1KA 1GN9A 1JLHA 2ZXFA 2DY1A 2V7XA 2XUAA 1B73A 1I6KA 3NWJA 4CF7A 3WLLA 2KBEA 4PX3A 3HBAA 3FJ1A 2IV7A 4ZHQB 2IYXA 3C3MA 2IX9A 5JOQA 4H17A 3ZWCA 1IY8A 1DBIA 5LA6A 2XMGA 4TGLA 4YAUA 3VRHA 2RAPA 5EKUA 1C1DA 1WU8A 3EHEA 4HWPA 1PRAA 2H4XA 4NH4A 3X1ZA 3EW9A 1AQIA 4DTIA 1VDZA 2FETA 4Q93A 2QW0X 4UM5A 3RT7A 1F9AA 2H5LA 1Q1AA 2ODBA 2BZ0A 4QBKA 1KY3A 3JQPA 5CVCA 3GROA 1QQBA 1EDOA 4JSRA 4W6QA 3ITEA 2NU8B 3TM4A 3WWDA 1BEUB 1TA0A 4F11A 1H69A 5LD2B 1H2HA 1SHTX 2HNKA 1ML3A 5A7LA 4Q21A 4W4TA 4YT4A 4XDZA 4Y6SA 3W6NA 4M22A 5T5QA 4HWOA 1Z7EA 5G1NA 4Q9IA 4KQKA 4CMCA 2V7UA 4HCJA 4OUKX 4AZ0A 3O8RA 1DTWB 1XMIA 3A1EA 4EQ6A 4CNBA 4RLQA 3HNRA 1UZAA 1CY8A 2YL2A 4XUEA 4UARA 4BQNA 4DCUA 1E2FA 2UAGA 1E2KA 1OLOA 1RZUA 3G68A 4K9PA 4EMTA 3OFND 2VJBA 1YR3A 1IHYA 5JPCA 4XQ9A 1NXPA 5HKBA 5LZ7A 1L3CA 2FPGA 4U2GA 2LXNA 3IOEA 1W93A 3IELA 5KIAA 1HEYA 1DKPA 1R9GA 2G9NA 2XRFA 3THWB 1ABEA 1GR0A 1V2HE 2I7CA 4WOCA 3ZCRA 4PAQA 2P3OA 4FEYA 2UVPA 3GFFA 2A7XA 2QAGB 3IV6A 1YZTA 3IBSA 1P2TA 3JZAA 1RYYA 2GESA 1LVHA 4Y9TA 5ERYA 3UW3A 2FNAA 1XYYA 3VDRA 3DHVA 3GZJA 5L3RA 4EELA 1KF0A 3ENZA 1CZHA 3LC2O 5C4IA 1RP7A 1IN5A 4UNIA 5L3SB 3EWAA 1N1GA 5F3DA 4FZ3A 5BSEA 1CR1A 4OXNA 1LVUA 3AILA 1HX7A 1LQ2A 1V8ZA 3IP3A 1L4BA 5BN5B 2WP0A 1AXRA 3KKLA 1PR0A 4TXLA 2VZ8A 1PUIA 2G88A 2F43A 3ANNA 3KOXA 5HA5A 1DMSA 4KTTE 5A7GA 2OAEA 2X1LA 4GYKA 5SY4A 5K0GA 1RC0A 4CL0A 5LQMA 1OMOA 1TEZA 1NXTA 1NMQA 3GDGA 2QJRA 3KT8A 1P7VA 2ZR0A 2J9XB 1TQ4A 4Y7CA 5EYPB 4IHQA 4ME6A 3OZ7A 2JVJA 3QG1A 3A9YA 2QD2A 5IUJC 1T5SA 4D9KA 4C4PA 1KPIA 1A4UA 1QHEA 4NMXB 1G7SA 2JB9A 4YCJA 1K08A 1DWUA 1K5DA 3FI9A 4XFKA 1L4NA 1HE8B 4U7TB 5B2FA 1V8DA 2EGUA 3WHIA 4QXRA 4OQDA 4Q4CA 2VHYA 4QPPA 1N7GA 2QVBA 2P6RA 2G0TA 4LAFA 4NYJQ 3ZLTA 4PYRA 4BTLA 5CRIA 1V26A 1KYQA 4YONB 3VPFA 2B82A 1ZK4A 4G4GA 3K8OE 3LHIA 1PFGA 2P79A 2PT5A 3MGKA 4I1UA 4LYGA 1BS9A 4W7IA 2JFVA 3PEVA 4YP1A 4E31A 5E6SA 4X62B 1JFVA 2IHKA 4H6PA 2Q4OA 3M0EA 3PT9A 1OJ7A 1UDXA 2WUVA 2WUGA 1CQIA 3OPNA 4AP6A 5AVTA 2LYQA 2HA0A 3PC2A 3RR2A 3IJ5A 4INJA 2VT6A 3LLSA 1HEUA 1ZSNA 2DG2A 1EXWA 2G8LA 2ZRJA 4TS1A 5CTJA 5HFAA 1I1QB 2QTTA 4NU8X 3TLZA 4B6EA 6LDHA 2HSEA 2PD4A 2DBQA 3TTSA 4XE5A 3GAMA 1CV2A 2QX6A 3TO5A 4HG2A 2A94A 3X1XA 1PWHA 5BOSA 7MDHA 5IASA 1XZJA 4JROA 4CIVA 3C14C 4JJGA 1OJLA 2ZBFA 4BO0A 1P5FA 3O4HA 2VNAA 4HQ6A 4KQ6A 3H13A 2A2ZA 4KXQA 2FFBA 3EXHA 3TPCA 1XFAA 2YIVX 4BFSA 2HWKA 4UOQA 4DR1B 2IYRA 1TC1A 4NZZA 3ILVA 1YZKA 4PU8A 4KQGA 3KTOA 4BFCA 2RHCA 3EPLA 2VQFB 3EEIA 1UODA 1WM1A 4MINA 3KVYA 4RWEA 2C88A 1SNYA 3P2KA 4MKFA 4CF6A 5JRDS 5H9VA 2J45A 3KB8A 1JW9B 3DLPX 1XEAA 3HNPA 1I30A 2I6FA 1IU9A 2AYZA 5IJAA 1M1UA 4DJAA 1X19A 2CLLB 4L9SA 1A8HA 3T7RA 5L4NA 4B3CA 1VBKA 5JYDA 4JAVC 3ZEAA 4ZOLB 4R83A 3WL4A 1UQRA 3ZWBA 3DCYA 2UZ0A 1SKYE 4I9FA 5TQJA 3RS4A 4RESA 2YWEA 3EPKA 4R41A 1F0PA 1MA0A 3N59A 1HM5A 2JASA 1G5HA 1TA9A 4UCWA 3T1OA 5EHXA 5KTKA 4P3PA 4X3CA 2OZPA 1SKQA 2EP8A 3PNYA 4HX9A 3KZVA 2DFNA 4B09A 5JXIA 5LOVF 3UJNA 1Q11A 4EI2A 4IXDA 2GZ2A 1ZINA 2XEDA 1INLA 1UJBA 2YMQA 3L1VA 4Y2UA 1N9ZA 1JN0A 4MAFA 5D84A 1ZJWA 4X24A 3ML1A 4X4IA 2F9MA 2IEZA 3KQQA 4OXXA 3FNEA 3FSEA 5AM2A 1RAEA 2C3PA 5A3SA 4JYAB 1H66A 2CZCA 2I1WA 5EPEA 4BDSA 4EGFA 1TYCA 4DDTA 2XUFA 2QROA 3PUKA 1S4MA 3DFFA 2OHGA 1Z5OA 1P2SA 3A27A 4QL3A 4WY2A 4TXNA 3VAZA 3O73A 4YWJA 5KYUA 3U4MA 1NYQA 2RGUA 2ZQYA 3IEUA 4KIFA 3E8SA 5G4KB 5LBUA 2Y93A 2BTEA 4O8CA 2FR1A 4MR7B 1G3RA 3OD1A 1KIFA 3E3OA 2JL1A 3KC2A 2Z3VA 1P31A 2IYUA 3JYLA 2Q3HA 4FOTA 1RI2A 1KRHA 4TLDA 4PY2A 3MCZA 1G21A 4Z7QB 3NV9A 4OKIA 1Q0ZA 5CXSA 3T3DA 4QICA 5GOZA 4CL3A 5AIBA 2ZSJA 2I2CA 5FBZA 3EHDA 2ZT5A 3HVUA 5JHGB 4HGZA 5F23A 4X8LA 4B3XA 1UCFA 4RA6A 5ILGA 3HA5A 3IEPA 2XKJE 3OPYI 5B3AA 2OAGA 4AX4A 3I23A 5KX5B 2JFHA 1Q6ZA 1JS1X 1OAAA 1Z6YA 2B25A 4MWGA 2I8AA 2HPAA 4ZO6A 3PL1A 3SFTA 5BVHA 3RU2A 1THTA 5JSZB 2O7NA 4W5JA 3MWEA 4BWVA 1UQUA 3QSGA 2WMOB 5ABPA 4H08A 4MRMB 4REOA 4GM1A 4GX5A 2ZE5A 1MV5A 4H77A 4ZKDA 4OMUA 1JA1A 2V59A 2BT4A 2HA7A 1VZ2A 3TEJA 2ZWIA 2Q9BA 1TLTA 3B6JA 3H42B 2CUZA 4O1IA 2Q6VA 2KWIA 3AW9A 3UWDA 3PITA 3QV2A 3DXFA 4YP0A 2DULA 4OAOA 2ZUWA 3UW1A 3R7SA 1OR8A 5JCZA 4X94A 3E7WA 5HJ2A 5KOJB 1JHZA 3VZRA 2O3RA 4DUPA 3HJRA 1Z28A 3V1YA 4KJXA 1UXOA 1F8YA 1H1TA 3GPCA 3FROA 2Z04A 4AY3A 1ZP6A 1WKVA 3OU6A 4BLSA 4BQIA 4C7OB 4CXMA 3GBFA 4DFDA 1LLDA 1E1QD 5I7HA 5ECDA 1Z0AA 1HE4A 4D99A 1OYOA 1YL5A 2CSFA 3R40A 2BKEA 2KM1A 3BERA 1VM6A 1E7MA 1ZNYA 2G6BA 2V8OA 1FVFA 1V1MB 4GX1A 5EHNA 4U63A 4D46A 4MWZA 3PPWA 3RBAA 2AKYA 3FA2A 2ISQA 1EWRA 1HV8A 3A9ZA 4LTDA 1B4DA 1M2VA 4OLHA 4BQQA 1U9IC 2XRMA 4UAUA 2Q50A 1W25A 2FEAA 2XMSA 2BHTA 3PQ3A 3TQSA 2YJ3A 2HPVA 4IMPA 1FNDA 1RMYA 1W1IA 4I36A 4U6NA 4V39A 4BO5A 3MCUA 5CLJA 1BTOA 1G6KA 1IEVA 4HLNA 4K0KB 3RC1A 1Z07A 2XTMA 1GRNA 3PC3A 3AEYA 1BWRA 4RABA 4TTVA 3W6ZA 2DQYA 4M8NE 1KAOA 4N0MA 1GZSA 3VKFA 1U4OA 2JCBA 2PANA 1E79D 1PWEA 1I0LA 1VMKA 1YFKA 1HQKA 1R66A 2UZAA 4P3NA 3ZW7A 3O8BA 4B3TB 4MUGA 5EFZA 5C81A 5DRTA 5CX1A 4HS4A 4GR5A 1SUPA 2A4KA 3ENKA 3GEEA 2ZSAA 2WUWE 3DO5A 3RO7A 3ZXYA 4GM4A 1BG6A 1U0SY 2EKPA 3MRXA 2QN6A 2BJWA 1UMBB 2AX3A 2XDQB 2WVGA 2GPTA 4WECA 5HCUA 5LSAA 4MS3B 2PUTA 4YRSA 1QPZA 2TMGA 2C2OA 3JWIA 3MWJA 3U4HA 2FYTA 1WSAA 1ZI8A 4PRYA 4HLUC 1CUEA 2PBZA 3ZHZA 1IZ8A 4PFSA 1X2LA 1EWYA 3CLSC 4Z5XA 4ZRDA 3DCNA 1FJ2A 5GY7A 4MI9A 1IAVA 3PGVA 1CRZA 1J2RA 1NP6A 2H65A 3L7BA 3Q0TA 4GBED 5ENZA 4ZDWA 1C3OB 3AY3A 3HKEA 4G1UC 1SRRA 2GFQA 3KQMA 3QI2A 4J4TA 1BFDA 3W5CA 4NOKA 4EGCB 4Y18A 2PKEA 2WZQA 1KQPA 1KJIA 1P44A 1NBIA 1XDWA 3N6XA 4M0UA 5JVDA 1C8LA 2P30A 1D6JA 2L2QA 3LT2A 3VJLA 1U7WA 4C6TA 3TDNA 2PL3A 4PPGA 1EFPB 1XZFA 4ZQIA 3ICCA 3TLXA 1L7NA 4Q4AB 4QUDA 4IKPA 1HLGA 3SXPA 1IULA 1CUWA 4B6QA 2X1MA 3JYOA 1RXSA 2OZVA 1YOBA 3HR4A 3RB8A 3WQSB 5LNK1 4QM7A 4KR7A 2Q8QA 1XPUA 1I4DD 2O5RA 3DDOA 2ZI4A 3SZMA 4HEJA 1RI4A 2FEKA 4D0RA 1E1QA 2H0RA 5DTMA 2H17A 2ONKA 3QVOA 1E92A 3GV0A 2IV3A 1GG5A 1O94A 4WTOA 4XDYA 4Z1MD 4KV7A 4NCIA 4X84A 3R7BA 1OA0A 4J3FA 5AUPB 2N1MA 3CUSA 4MDEA 2O05A 2H3HA 3FVTA 3JQGA 2PZ8A 3N2YA 3PKIA 1A7KA 4XQGA 1E5TA 2ZRLA 1D8AA 4A8JA 2PFKA 4N8SA 6Q21A 2HMWA 2PYIA 5JMWA 3IAM6 2RD2A 4O6VA 1QGOA 4AURA 2SICE 4O29A 3OH8A 3EASA 8MHTA 1YZFA 1OZGA 1REQB 2FXVA 4PLWA 4PFQA 3CURA 4W7SA 4XD7D 2I4RA 4KN9S 3H65A 2I33A 3KYCA 4GPBA 3IAEA 4TYPA 4AMVA 4I2NA 4TMYA 5DEOA 3O91A 4LBYA 5ALSA 5H02A 4EYSA 5AM0A 2WSSD 5L7WA 5C8VA 1E79A 1AA6A 2L82A 4TROA 1YDFA 2QU8A 3ZJYA 2HLPA 4GAEA 3FUCA 2FTKE 4D9JA 1CPYA 1EBFA 2WVHA 4Q3CA 2XQKA 4BFYA 1DJOA 4TSFD 3IT2A 3ENNA 2NVWA 3AL2A 4GDFA 5EZSA 3ZQUA 1CY0A 4CKYA 4XIYA 3PTLA 4CLRB 3AFMA 4G2NA 4DYVA 4Z3KA 1MENA 3SDBA 3U56A 2VNHA 2GEDA 3C3YA 4KX3A 1JEYA 2B69A 1C7EA 2AKAB 2VUIB 4QHSA 3U4QB 1YFJA 4M49A 1YSCA 2CL0X 4DUGD 1ZXLA 5AM5A 3OCWA 4MKGA 3K6RA 4QVKA 1DAOA 1GTJ1 2ZRNA 3BDIA 3MQFA 4AQYB 2ZR7A 3IAS1 3MB5A 4K5QA 3MT8A 4NENB 4ACBA 4H15A 1KDOA 1KI8A 3CX8A 3E53A 4UUNA 1QVWA 1WCYA 3LDUA 1DT5A 1PFYA 4RULA 4FN5A 4TQAA 4C4XA 3RRFA 4RHCA 4X90A 2IF0A 2FP4B 5ANRB 2O8EB 4QBHA 1CF4A 4LOAA 2QTBA 3GLKA 1QHGA 4CN9A 1WHTA 4H2DA 2Z6VA 1VE5A 4PIPA 3UK6A 2WD9A 1E1MA 1VGVA 4K40A 3O82A 1QH8B 2BFAA 4F85A 4C9BA 2MU1A 4OQFA 1FFAA 1NSYA 2PS1A 4N0PA 5JUWA 3PDJA 3BT7A 5AJYA 1GUZA 1Y9QA 1D03A 4EUNA 1N2GA 3KQVA 4P38A 4DE9A 2RGWA 1CNEA 2C92A 2FUNB 3KQTA 1X1SA 4BO9A 3THYB 3GMIA 3AR2A 2W2NA 3S2ZA 1C3VA 2O1XA 5KC9A 3BXFA 1BFUA 1HDOA 3PC6A 4Z1MA 3RVSA 3TL3A 1JV2B 3IS3A 2RARA 2LYLA 1ODSA 4HDAA 3FYUC 4X4EA 3TXAA 2D5BA 3R3XA 4RCZA 2HLNA 1I24A 1C3EA 3GK3A 4B46A 4BKOA 1VKOA 5HZMA 3LY8A 2XGOA 3GGOA 2FFJA 5C1BA 5ALPA 1IEQA 3ND6A 2BGMA 2IU6A 4JLMA 3RS0A 1HQYE 4NS4A 4PQRA 2EZTA 2P5TB 2F3TA 3A2NA 4XD7A 1LFDB 3VSDA 2YH2A 3U3KA 1U7OA 1N1EA 5I9BA 2J3IA 5AW0A 3HJFA 3DMNA 3ZD9A 4UNRA 4K28A 2GHQA 2NZWA 4KQXA 1E3LA 4L07A 2FPSA 5ALUA 4ZT4A 2PBLA 1USGA 5AVXA 4R7GA 1OFHA 5JECA 1Z15A 3HO1A 1PN3A 4XWGA 5IJZA 2FE1A 4DMHA 4OJMX 3HM2A 4JODA 1EHYA 4GSYA 2OD7A 4Q4HB 2ONJA 5JY6A 5JWHA 4MWBA 2K87A 4RDHA 1JGTA 1R12A 5H1YA 4TSFA 1PJCA 5DP1A 1SK9A 3HBNA 1PS9A 3UENA 3U7HB 3O2JA 2W6NA 3R6DA 5AUQA 2JIBA 5GWXA 4PIVA 3R9XA 3NYIA 4EW6A 1ZQ1A 3IUPA 5BSMA 1TD9A 4GQMA 2H2FA 3DGEC 4QECA 3S3TA 1SIUA 5EHIA 4FLFA 2I2FA 4E30A 1CC1S 8LDHA 5EWLB 2PSFA 2HOQA 1L1RA 3B3AA 1Z9BA 3ZPXA 2C31A 4MTLA 1MCZA 4ZCMA 3WY9A 1OGIA 4NDAA 3FMIA 2F1RA 4JHXA 1Q0SA 1OHHD 4RHEA 1QP4A 2A6CA 5BXQC 3TW8B 2FE4A 4J2OA 4OL0A 1R50A 4WK0B 1P2GA 2BGKA 2M32A 2BEVB 3WAKA 1BQ4A 4BUCA 2XUHA 3W3AD 3NYQA 5AI5A 2LD4A 5ES4B 1Q20A 4WW0A 3GIDA 1QQAA 5K8JB 3G49A 4OHRA 4ZVTA 1KU6A 1PJ2A 3M5PA 3OA0A 3LDAA 1GKIA 1ORWA 4YRCA 3MEQA 4AJHA 2H1CA 4QDOA 3TD2A 2WLSA 3ACBA 3EZ9A 1O6GA 4FYHA 3WBFA 4BVHA 4Z2AA 4OQMA 4B7AA 3AEUB 3B7WA 3FJYA 4JVLA 4HDRA 3N2KA 1QKIA 4CFZA 3SQWA 3VXKA 1W9MA 2FF7A 1WQ3A 4UEQA 2XZOA 4FZRA 2L19A 5AVRA 4G84A 1TAHA 1OFTA 2PMDA 4MWTA 2VJCA 3EVNA 3EBOA 3UO8B 3B2EA 2QTCA 1ZHHA 2QRJA 5EMLA 3WGJA 1IBKB 4RH3A 3I4CA 2R1VA 4UEKA 5J3JA 2Z6AA 2YZGA 2A86A 3BHJA 5F1KA 3IDZA 4TV8A 1B26A 3PR1A 1B2LA 1ICEA 2GDZA 1ZYUA 5DYNA 2VFAA 5TJHA 3UWOA 5C8DA 4YHHB 5K3BA 4IGFA 1U5BA 1WB4A 1AA9A 1MB9A 3F0TA 4ALMA 4Z3OA 4KRFA 2PIDA 3INGA 4ZREA 4CKZA 3LO5A 1Z4JA 3QRWA 1CHDA 3T3NA 1BRTA 3EAFA 4PXAA 5IZ4A 3TIFA 3WJ7A 1NHGA 4ENWA 1DG9A 1UJMA 5FUXA 1Z39A 4ZT7A 3KR0A 5M5BA 2Y1LA 4D6XA 4N3NA 3WMGA 4D80A 1JSZA 4EB6A 5TF4A 3ROXA 5H59A 1POUA 2GFIA 3V4RA 2P6OA 3R24A 3OMXA 2OR1L 2WU0A 4QGFA 4IIUA 4Q9JA 5DF1A 3VH2A 1J97A 1II9A 1NL3A 2JGIA 3ZZTA 1PE0A 2BEKA 2H1IA 2LPMA 4W9RA 4XM0A 3FYUB 3FY4A 5TQ2B 2H0QA 2CY0A 1Z18A 3LUKA 4HJRA 2C4MA 3MFYA 2WD8A 3HU5A 3OCZA 1OHHA 1LC3A 1T9DA 1VCIA 4BCDA 1KOFA 1ZBDA 2E5FA 4QNNA 2HAEA 3UXHA 2Z2ZA 3VR5A 5FWXB 3CX7A 4IQGA 4M0LA 5EWMB 4EFMA 1C9DB 2Y6VA 4XPIA 4OFZA 4RK0A 4MUBA 1CB0A 1U2DC 1HTWA 2LNDA 2JLQA 3W3AA 4NZMA 2B4KA 4E6EA 4M9RA 4NOJA 1I2DA 4JX8A 1MG0A 4TVBA 4X6YA 2P68A 4DIFA 4QKQA 4W82A 3CE9A 2QBYB 2KBFA 1O96A 2PXKA 1J8QA 3GEMA 3QPUA 5K4GA 4HBGA 1IPFA 1W0JD 3G13A 4FFSA 2IYQA 3HXTA 2VR1A 2BGGA 5AESA 2NU7A 3ZV3A 2J33A 2X86A 4X4FA 4YYZA 4FS3A 3ER6A 1UK8A 1H2WA 3PXGA 2P9EA 5F64A 3KSMA 4ECAA 3IDAA 1CX9B 5CITA 1AD2A 4WKCA 5CX4A 1Z5NA 4I50B 3JWHA 1U0GA 421PA 4NBWA 2V7PA 1W36C 1F1JA 5EVJA 1II0A 1T1RA 2Z1MA 3L4SO 4MUKA 4KMRA 3WP1B 2XADA 4G36A 3SJCA 3BK1A 4IWRA 3N05A 1R0RE 1YCHA 4WCFC 4AO8A 3KLNA 3WK5A 3G79A 1ZUNB 3WGGA 3SXUA 3H3FA 1ZD5A 1T2DA 3EZ6A 1X94A 2R6HA 3H2GA 4KKVA 5EN4A 1Z56C 4OJYA 3V8RA 4G0XA 5A9SB 3TGLA 3GRKA 1HDZA 1PQ4A 2Y66A 4LI3X 5JVDB 3ZBPA 5B6PA 1CJVC 1EDBA 1NU6A 4CLXA 3FWKA 3GFOA 1J9EA 3EEQA 1CYEA 3SHVA 1SKUA 2BFEA 2XY4A 3G1WA 2EDAA 4OK6A 4ZYZA 1AC5A 3NASA 4JOCA 1E2PA 2D3TA 5B4UA 3RUEA 1KO1A 2XQJA 1HT1E 1WLYA 1H4QA 3P9RA 4WERA 1UZMA 3O4RA 5KOHA 1TEVA 2VK1A 4UPEA 2YNMA 1U3WA 1PHRA 3KLPX 3Q3EA 1KMIY 1J2TA 2VF2A 3C85A 1GG8A 1MTZA 4DLRA 3ZBUA 4XB6B 4JU8A 2Z1NA 3E61A 2PXXA 3ZHUA 1LMB3 4LWZA 5ADVA 1A5AB 1XP5A 1KAMA 2IUFA 4G8DA 3GFVA 4YPVA 1HFKA 3ZJVA 1CKEA 3DBRA 4I1IA 1BJRE 2OK7A 2QORA 4XOIA 2Y2UA 5HRCA 4OHUA 4YRAA 5HKKD 4DY4A 5B3JA 1KMCA 2NO5A 3NM5A 3QKWA 3DE2X 1N3LA 4FXPA 5P8WA 5C5EA 3HCWA 2Q3MA 1A5ZA 1JHDA 3PCXA 2I54A 2ONCA 3R0VA 2FX5A 4ZVVA 3ND8A 5EIBD 2JFOA 2V98A 2ZVJA 3GCWA 2R48A 1KKMA 4Y3UA 2JLSA 4W63A 1G17A 1EX7A 2CD7A 3FMFA 1I5OA 1D2GA 1JTVA 2RK6A 4FE4A 4BNJA 4DWWA 1NLMA 2VZ9A 3DV2A 2OFWA 2J0VA 4LE0A 4FYPA 4MHTA 3BD9A 4Z5HA 3HN2A 5B2EA 1ZU4A 5TR9A 1I80A 1U9JA 2R66A 1W0JA 2GN0A 2YHIA 4YJ3A 4BVFA 1JDPA 2BLNA 2VDWA 3TOSA 4OKNA 2X8JB 3EIUA 1IH8A 1L8XA 3F9IA 1XVIA 3A14A 4RIIA 2ZTUA 4YP6A 1CY4A 1TQ8A 3BIOA 3DONA 4YJGB 1OWNA 2ZIVB 1BD4A 3IQWA 1KFBB 2M6SA 4EKGA 2IY9A 3R7AA 4B6SA 5BSGA 3DAHA 3KELA 3T5BA 4FHCA 2DHDA 1XRRA 3U9SA 1TCVA 4PIMA 2GK7A 4QFCA 3QLVA 1JFTA 1PKXA 5J5CA 3CWCA 2A9JA 4RACA 2VTKA 1MJFA 4QDKA 5AVQA 5LMNB 4GGOA 4ZIRA 4O0MA 4EGSA 1QCYA 1Z7YA 3DMTC 1EDEA 3H4VA 3AZQA 3BREA 1RYNA 1V9SA 3PFKA 4UTNA 2DSNA 4HQKA 3PR3A 4HYYA 1R88A 4V03A 2ZSKA 1ESNA 1KNXA 3R0ZA 4I14A 1VSBA 4LCJA 4UFOA 4ZRNA 2WHEA 4M1ZA 3O4VA 4ND8B 3FZQA 1LDMA 3M6IA 1AHPA 5IYZF 2JJYA 3HJTA 4B8WA 2M9MA 1DVRA 2CUTA 2C4TA 2V97A 1R3UA 1AK1A 2BM1A 2EJUA 3SDSA 3TRFA 3K2IA 3LRTA 5LLSA 4R1TA 5LQNA 2QPLA 3P71T 2XAAA 4GNKA 3KFLA 2YY5A 1U80A 3EIOA 2CZGA 4ALLA 1EUQA 1DEXA 2NXJA 4IL5A 5BT8A 5G0TA 3NHAA 5E0KB 1E1CB 1LPBB 2Q2NA 3ZE0B 4S24A 3HSKA 4DLVA 2OOKA 2IXGA 4FPXA 4HFJA 3T5MA 3O4JA 3TQHA 3G5MA 1JF8A 2ZSIA 3GCDA 3KBOA 4AKEA 5ITVA 1GCAA 1HMPA 4H1UA 1Z6TA 3TLMA 1NMXA 1FRFS 2B5WA 1YU9A 3IE1A 1W36B 2C7BA 2JBAA 4EHLA 1NMSA 4Q6BA 1TQ2A 4X54A 3BWBA 1N5MA 5DLQC 4RHXA 4YV7A 1M8KA 2EG9A 3FCYA 1F51E 1ZVQA 1H2EA 3GUUA 1KYTA 3UJAA 3L0BA 4JWTA 1N92A 1NR7A 1P7CA 2DKOA 3D4IA 5ED0A 5HE8A 1W4ZA 1BOFA 3MBOA 4TQUS 1IIBA 4XJXA 5HW0A 2VJOA 1R9NA 4TTQA 3AJ9A 1NXQA 1W75A 2D0IA 5B7QA 5L3ZA 4LF5B 3TFLA 1SKBA 2B8TA 3BH6A 3EG5A 3PD1A 1NR1A 3LDFA 3EXAA 1YBFA 4O33A 4PNHA 4FR0A 3W5BA 4C2BA 1SQFA 3OLCX 3ZVMA 1G1MA 4BS9A 3ND7A 5JJ5A 3QOWA 5KHOC 3D2AA 4N6GA 4K86A 3LQFA 1YIAA 4J94A 4EO7A 5LQKA 2WF6A 3P4UA 3ZKAA 2J1LA 1E18A 3JS5A 1V3UA 4PPNA 2D0PB 3N8NA 5LCXA 4D6PA 4P7FA 4F60A 4JQDA 4A7PA 3LUDA 2O4CA 4QJ5A 3TGWA 2YV3A 1K8QA 3F67A 5YASA 2Q21A 3MD0A 4DV4B 3ZWWA 5DLEA 3CLHA 1YHYA 2BFBB 1G38A 2F59A 1WABA 4LXTA 2JJ8A 3QPAA 3TMYA 1L7AA 1X7DA 3ZCPA 1LEHA 3W0LB 3NOXA 1JU9A 1AS3A 5GOTA 1FJGB 1RJEA 2ZYWX 1AV6A 1IOWA 4UDXX 5LA6F 1H1DA 3UJ6A 3E1SA 4YCSA 4KQ9A 3NFRA 4OO3A 1KK0A 1GD1O 2ZAMA 5AOVA 2B1IA 4R8VA 3M3DA 1M7HA 5LZ9A 2JVIA 2GWHA 1RXYA 3K70C 1OXSC 2XH8A 1MC8A 4URHA 5EJAA 2NACA 2GZRA 1E8DA 5B4VA 4D9GA 1X7WA 3EXG1 1Y7YA 1Y5LA 4P0TA 2HZBA 3W9UA 1VLZA 4BECA 4AB1A 1HZJA 4GW3A 1G8MA 1Y4SA 3ME5A 1KZ7B 4UMVA 5G1PA 1Z37A 5E3HA 4J43A 2ZW9A 5LMUB 4OOEA 2QZ4A 4R7TA 3VA7A 5AK0A 4PONA 4Q1FA 5LIPA 4EK9A 1FUIA 1GYRA 1A8QA 1FU4A 3K8YA 2R62A 4KQCA 2W83A 1W48A 1LPNA 4BYMA 4JN6B 5C35A 5KVSA 2V6JA 4DPMA 4E5YA 3I5MA 5K8TA 2O8BB 1RVDA 1G2IA 5IKOA 1CQPA 1XO1A 1NE2A 1YQDA 4RW0A 3QE3A 1RKQA 3ID6C 4HEA6 4G1FA 3UMSA 4JI4B 3WMXA 3IVRA 2BGNA 3PB3A 1TF2A 1YRWA 1I0IA 2VRCA 1C7IA 1Z2EA 4BEVA 5JI2E 3W8EA 1ZIOA 2HF8A 4IYJA 4AY5A 3I52A 5JDCC 1J0BA 3PX2A 3FBWA 4O4IB 1EXNA 5E6RB 5FHQA 3ZHCA 4Q7QA 3G9UA 3ZNPA 4YPOA 3AM4A 1M7GA 4BDTA 1NXXA 3F7NA 1APBA 3PA6A 4MRSA 1QTNA 3M4JA 4D9CA 4CUZA 4OBMA 4IJWA 3GLHA 2ZB8A 3CUWA 4LC0A 2WAXA 1AZTA 2Y1FA 2YOGA 1JKIA 2VSXA 2X9QA 4N5MA 5AKIA 5BR8B 4C7KA 4UDYX 1GQFA 2BONA 4Z58A 3ADKA 3C8UA 3REGA 2F3PA 2N46A 1OF1A 2VOEA 3ZN2A 3T1HB 1BRMA 3DZIA 2IP1A 3DZKA 1SCDA 3AC0A 5CH3A 4IIVA 4V24A 5HSGA 4Q9KA 3WYFA 1GITA 4NYMR 3RVDA 3ZHSA 3GLIA 2PXTA 1QRUA 1BH6A 3HCBA 2CXOA 1N5DA 3HRKA 1PS8A 3HA7A 1NVFA 2F1HA 4RSHA 5DWDA 5C5CA 5HXAA 4PXYA 4E4YA 3T1VA 4L5CA 2E48A 2G1UA 3EPPA 3HY4A 4G8CA 4UMDA 5H3HA 3KJQA 3WIDA 1PWXA 2HSZA 1BD3A 3BIWA 5JAHA 1QUEA 3DMFA 2COKA 4X44A 2D06A 4QGHA 3MNFA 1BE6A 2F9FA 1OB2A 4B3MB 1TVMA 3NANA 3VYSB 2C57A 1USVA 2ZI7A 4F4JA 3KJXA 1UFQA 3D4PA 2GCPA 4YUVA 4IFTA 5CIYA 1ICIA 3H17A 4Z99A 1SCQA 4H7EA 4J90A 5A3QA 3JSXA 5BN1A 4CLOA 4JR1A 4P0PB 3ZV4A 1WKCA 2C0QA 3B1XA 5KREA 3MXTA 3BG5A 3WFZA 4HN2A 3O8OA 3D4OA 4BGVA 4P36A 4E5MA 3I6MA 5ALMA 3ZYCA 3HU1A 2FZ4A 2CBGA 2IUSA 5DM70 2YS6A 4BQOA 2I3ZA 4LJYA 4JA2A 1ZC4A 1E58A 1VJ5A 1I10A 3LGSA 4GBJA 2DUWA 3GEHA 1F8UA 9LDBA 4E6PA 4BMPB 1UF9A 2ZKLA 4HPXB 5SYMA 1KI1A 3WGTA 5EEHA 4OVKA 1HYBA 3RTEA 1ES9A 4AY6A 3I9V6 4I8TA 2A88A 3A4TA 4ILEA 1IZ0A 1O6CA 1SXIA 2BE9A 2BOVA 2NNLD 2ZPAA 3HLYA 3TLGA 3AINA 2CV1A 3KYDB 5HF6A 4JQCA 4ZVQA 1A9XB 5L3QB 4JLAA 4LDJA 4OREX 3DPUA 1I0ZA 1TLFA 2UUCB 5FNVA 1YKSA 2RI6A 1YZHA 3NHZA 2HT1A 4GHJA 3ZLBA 1L5LA 3MWYW 5DYIA 3S99A 2WSBA 3R3JA 5H80A 3UKJA 2ZI5A 2Q0SA 1OGYA 3PJDA 3QHPA 2HU7A 3SLRA 1JLSA 3EAQA 3UQYS 2JGLA 1NEQA 4BB5A 4EW3A 1M2KA 3KU1A 4B4WA 3K70B 1EB9A 5FB3A 1CZLA 3CR7A 3PHJA 4ZYXA 1P17A 4QLOA 3MTJA 3NZEA 5CT4A 2RGRA 4G4IA 2C5BA 2WJ3A 2CN1A 4H7KA 1RABA 4OSPA 4FGSA 2AW3A 3DDZX 1FFHA 2DKFA 3VR5H 2XYGA 1NF9A 4REMA 4ZCQA 3NWEA 3VVLA 3H5VA 3A1UA 1JTEA 4Z4HA 3I73A 4BFZA 1GNPA 2HWUA 3GVHA 3W3AH 5C7IO 1PJRA 1QG0A 1VJDA 3KVRA 2FQXA 3NC0C 3LP6A 4QJIA 5JBIA 3TECE 3HVIA 4Q7LA 3OU2A 3MAJA 3FHCB 4D9MA 4Q16A 2VHCA 1NN5A 2C9BA 2K2WA 1BMTA 2WUDA 2X4LA 3H18A 3I58A 3R3SA 4DJ5X 3A58B 2F67A 4F4CA 1ZOIA 1Z06A 3C87A 2YZKA 3T7DA 4L7VA 2A9PA 3W1VA 4WCVA 5CEEA 1EFLA 2XVAA 5FI0B 2OFXA 3E8XA 4WH0A 1UOQA 2J41A 3U49A 1IPEA 2GD6A 1KK3A 1SOWA 5DNVA 4C4ZA 4ZOBA 5T3UA 1ZW6A 4PZEA 3LLVA 2H2GA 2KSQA 1QZUA 3I42A 3CW9A 3EIXA 4HLDA 4MJLA 3T7JA 4FI3C 1O5OA 1C9EA 3U3XA 5JCPA 3V1UA 1SMKA 2XNCA 1R6TA 2ZUCA 3WBKA 3P5BA 3GC6A 4CFYA 1OILA 1NP7A 1UXKA 4WNIA 1KE1A 1ST2A 4EKNB 3LA6A 3OPYA 2BUAA 2YJNA 3SC4A 3C74A 4B6OA 3LTEA 1E3IA 2PUFA 1JZQA 3IVGA 1Y9ZA 4M89A 1KJ8A 3B3FA 5CLQA 1NMEA 5ALDA 4ZQHA 4PAMA 3TSYA 2ZR8A 3O8DA 2J0QA 4XGRA 4M0EA 4KR0A 5FFFA 4B6JA 2W8BA 3CGWA 1HL7A 2TS1A 1RHRA 4ARVA 1SHLA 1OB5A 3SQDA 4DLSA 4JUAA 1XTIA 4F2DA 4RD3A 1NVAA 4JKOA 5LKRA 3LLMA 3BYZA 5CA1B 4YA6A 1ZLXA 2X2EA 5K8VA 4JOQA 3KWLA 3OQPA 1WSWA 2YOFA 1S3SA 2G5TA 3GG2A 3BJMA 5DYWA 4P6VF 1P0QA 3ASUA 5C4GB 3UHJA 1DC4A 4GKVA 5L7TA 4HAIA 2QMQA 1IAQA 4J0GA 5IF9A 3EUEA 1MJHA 5K05A 3UV7A 1GT91 2ECPA 3EJWA 4ALJA 2HBRA 2CZQA 5KSZA 3E3MA 3H2HA 1KEUA 1RM0A 1KORA 1LW6E 3JASA 3S1AB 4S2UA 3LPCA 5F7XA 2VRWA 4X92A 1TAUA 3GUVA 3SIXA 3C4JA 2BF4A 5CP8A 1LA2A 2VAVA 2XCTB 1YA6A 5AJZA 2XNKA 3PIDA 4M0PA 1TZBA 3MF4A 2GRLA 4X1OA 4M87A 3TEPA 1JJAA 2H2IA 3HBLA 3K0BA 3PHCA 4WY5A 3SQOA 5ALVA 5AW7A 4LWPA 1VG0B 1XMPA 1Y98A 1VFNA 2I29A 1Q1NA 2W6JD 4DKJA 5ADHA 3QPBA 3NC1C 5HQTA 4B4OA 1GU7A 4R84A 2NPOA 4N6OA 3MB8A 3MWDB 3VO2A 5AP9A 3OE1A 1DSSG 3KOWA 3TKLA 5H3LA 2WQ7A 2PU5A 3UPDA 3QXJA 1W5SA 4L4RA 2DSTA 5G2OA 5IAJA 3J7TA 4KWHA 4HMOA 4PRKA 4DCVA 2FPPB 2IDMA 5LP1A 9ABPA 4IWXA 2Q5OA 3WGHA 5A4KA 2HMVA 1DOAA 4OAPA 4CQJA 4OHFA 1K9SA 3UHPA 4MI6A 4QEZA 5ALEA 2JZNA 5F1OA 5C7LO 5HTKA 3L4JA 4BO4A 1R0LA 3IERA 5DBEX 5LZ5A 1TUEA 3CBQA 2YJ5A 4CCSA 2H5EA 4W1QA 4L0QA 4CMEA 2CUNA 3RQIA 2X5JO 5P21A 2FJ0A 3C4QA 1YDHA 3DE4X 3MILA 4CIBA 4LSGA 1ZGHA 5HDBB 4E5VA 3Q4GA 3DHEA 2DUJA 4PQYA 4WXMA 3TZCA 5KSWB 2ANBA 4KLRA 1W5AA 4BTVA 5I3ZA 1N34B 2HI0A 4M1TA 4RQAA 1DARA 3QBEA 2GH1A 3NVMB 3BXGA 4BLRA 4QTUB 3MUOA 3W5DA 4BKRA 1XEWX 2FN7A 1FQWA 5BPHA 3GLGB 2OFFA 5KC8A 4YJ2A 3D4BA 3PI7A 3WK7A 2O8FA 2BC9A 4RJJA 4D26A 3WNZA 2FPLA 1PRYA 5EG5A 1QYIA 2I34A 4RV4A 3LLUA 5CDFA 3M4NA 3BM5A 4RS3A 4D9NA 3OMTA 3ZJ5A 2Z1DA 3WLMA 1FTQA 4H27A 3UXYA 4RIEA 4XAQA 1W59A 4URWR 1OYWA 5JCJA 3P0FA 4GKJB 4KPFC 3WP0A 4FB4A 2EFHB 1QU3A 4G5SA 4BE4A 1LX6A 1DKRA 3W4KA 4HEHA 1GTG1 3AKCA 1F2TB 3PE3A 4G5QA 1PR3A 7ABPA 1CR2A 2B20A 4BZPA 5L3SA 4J9UE 3I2GA 2PXHA 3VK0A 1Q7TA 2PKQP 3A1NA 3GJYA 2YXNA 2IYOA 1FMTA 3EGIA 1GTL1 1O95C 2BGUA 3EQ6A 4AROA 4G41A 1PP4A 1DAHA 1E2DA 1I9CA 3A4NA 3D1VA 3VNUA 3VH1A 1JDSA 1CLEA 1Q3TA 2J9GA 3MUFA 2ICPA 2BN4A 4GVLA 4NAHA 4WKOA 5CW1A 4DHWA 3SGLA 4D0NA 4D74A 2AI3A 4I4TF 2C54A 5DM60 1J99A 2WF5A 3C15C 4DIMA 1R6AA 3QP9A 1DC5A 2JPDA 2GBIA 1WCIA 3F4BA 3OEHD 5DU2A 4BLWA 3UBTA 3ASZA 4R3WA 1Y1SA 5EYPA 4DW8A 1COWD 1L8AA 4ICIA 2DUMA 2I67A 3HGTA 4TL9A 3C3PA 4NX2A 5DT9A 4WK4B 1W44A 3OHPA 3PZRA 5GONB 5CEFA 5EJEA 4WHMA 5KPJA 1EXMA 1I1OA 4Q01A 1E69A 1BXGB 2NUTB 3BS3A 4B7XA 1Z38A 3OZXA 3GO4A 2Z2IA 3UJCA 5JS1A 5AW9A 3I2HA 3LXXA 1Q15A 3GLFA 3WIEA 4KOAA 3BHMA 3BSWA 4LRTB 1V1JA 1NJ6A 2W2VA 4XSVA 1JYSA 1S89A 1P6XA 3TEMA 3P0HA 3T12A 1EA7A 2GI4A 2I3BA 2QK4A 3D7SA 2C9OA 3NIWA 1T9KA 1Q22A 2X0KA 5AH0A 1TU3A 1FNCA 2DCMA 3CIOA 2QXYA 3KOYA 3TZBA 4AJNA 2B83A 4IF6A 4TWJA 5IDQA 1JG6A 1U3VA 5BRJA 5A0VA 3RABA 2LLVA 3IVMA 3DOEA 3B9BA 2P9HA 3HB0A 4R0NA 4BYGA 4HQLA 4IHJF 1PFWA 2OSBA 2Z9DA 3GDWA 4RKFA 2XVXA 4IJQA 3CLUD 2EEPA 2HUNA 3KZNA 1G3UA 4JGIA 4WQMA 5DX0A 4EPTA 4YMGA 3H9GA 2IVBA 2FG7C 3VDMA 1DFGA 4X85A 4G4SP 5A5DA 5HIJA 1QUFA 1XF1A 4TVKA 3SCZA 4NJEB 4H9GA 4A26A 2WTUA 1ZL0A 3TQCA 3HADA 2IH4A 1YJ8A 2H92A 1FVXA 6ABPA 2YV5A 2CMGA 1IEWA 3NKFA 2ZWPA 3CSSA 1XHFA 3BL8A 3P9NA 2L0XA 2QSYA 4HGNA 2HIGA 2VAXA 3T7AA 3ZJTA 2XGSA 4O25A 4D9EA 3HCEA 3EULA 2QMZA 4Z0TA 5BY2A 2HFJA 2WA1A 1VB5A 4IDFA 2Y67A 1B6RA 2ZRFA 2ZU6A 3OX3A 1CJBA 4MUFA 1KQNA 2D7CA 3KOZA 2I0FA 3I83A 1YS1X 5BSTA 3QU7A 4JX9A 3QYJA 3A8TA 4ZT2A 4KPGA 1N25A 1VI2A 1QF6A 5FTKA 4RHYA 3M6FA 1IFXA 3EWIA 3MMPA 3IVAA 1JQDA 5BWNA 1ODCA 1U1FA 2CMDA 3H4TA 4HQRA 3ZU6A 2CFRA 2Q3FA 5JNLA 1KVQA 3ZGXA 3P97A 1N2IA 1UBSB 2FPIB 3C3KA 1JQBA 3L18A 3OEHA 5DP2A 3VH4A 4ZCRA 2QR3A 5GV7A 1XD9A 1V3QE 4R0MA 1KHTA 2FLVA 1TOAA 1AUVA 3GG9A 4AWBA 1L2TA 5DT2A 2H4YA 4I6RA 3LHKA 3LECA 4HN9A 1T2CA 3JVIA 4JC4A 2PKWA 3Q40A 2FGKA 4XJSA 4LYFA 4XQCA 3UYKA 2UKDA 1UP7A 2NTEA 2OBFA 3C5VA 3K0FB 4X91A 3L8DA 4MQ5A 2JG3A 4BHTA 4QC2A 4YBRA 2ZJ2A 5HE9A 4ALKA 3Q8WA 1ECPA 4KITB 3L8YA 1UTXA 3PFIA 1XT6A 1MFQC 2GHIA 3OKPA 2IFTA 1E59A 3PR2B 5CAEB 4EYOA 5K3OA 2JZOA 4J0EA 2WIUB 5EIFA 2QAJA 3T06B 3VV2A 4OQZA 4MLCA 1G3MA 1ZU5A 3P96A 2HJVA 3VZCA 3SHTA 2O8CA 1PX0A 3G8YA 1KK1A 1YB2A 3FMGA 4HXGA 2WFLB 2IIVA 3NIFB 4ED9A 1TT5B 2RHWA 2BCJQ 2PT7A 4G07A 4PWYA 4Y0NA 2PSDA 3VU9B 2F8LA 5H5JA 1U0JA 3VYTB 5F21A 2B5VA 1CF2O 2O4AA 3WWZA 4XVUA 1XTQA 2GVZC 4W8OA 4YREA 1J70A 1KK2A 3QA9A 3HBFA 1G2QA 2AE2A 5KX5A 4DIDA 1P1CA 2O48X 4PR0A 4RD6A 1J8YF 3AI7A 4CF4A 4PG8A 1PJZA 3U6KA 1THGA 3FNGA 1MQSA 1N6LA 5JSZA 3ER9A 1KVSA 1N2XA 3W4JA 2WMDA 2H5IA 2BHSA 4A2PA 2YOHA 5I9NA 2D4HA 1E62A 1XALA 3WGZA 5HHTA 1GRVA 4RZSA 2X6QA 5DYYA 1OV6A 1QGYA 3R1IA 4KO3S 3ZU3A 4FW9A 4G0NA 2QT0A 3FF4A 3FZEA 4N18A 1GZ4A 1K89A 4H3HB 1E6UA 1OY1A 4J1WA 3ITNA 2Y92A 2C0CA 3RRYA 5FPYA 4UUMA 1SXGA 1DZIA 1EFCA 1ADJA 2FUG6 3W3ZB 1C7FA 3BB3A 3AESB 3OZVA 4W6ZA 2AN1A 4OM8A 3IUEA 4XKJA 1G4AE 5LYYA 1K98A 3KUUA 3P5SA 4HOYA 2YQ4A 4RIFA 1SG6A 2BJHA 1SVOA 1V0JA 2C7RA 1CJMA 2W6ZA 3G2KA 5KOJA 3UCXA 1Z4NA 1HG1A 2W6PA 2P2DA 3K1AB 3UPUA 5DV9A 2QF7A 4C7OA 5EPUA 2DOKA 3PYLA 3D7LA 3FRHA 4LDRA 2KMLA 1YBVA 4DDHA 2XQGA 1U65A 4NE7A 1XTUA 4YEDA 5IPFA 1QAMA 3QJ5A 4HVAA 5I7AA 3F5SA 5G3YA 1LPPA 4D98A 2QVGA 2Y9MB 1TYZA 1DZ3A 4HNGA 2OQVA 3RQSA 2OUIA 2VBFA 3DP9A 3IP1A 1V1MA 3MLBA 2MTBA 3LF1A 4I6TA 2QLFA 2Y1KA 3STVA 3PUVA 4ADSG 4Q1CA 2JD2A 4WVFA 1FXUA 1FU8A 3MOIA 3PFCA 2WM2A 2OXTA 5D7NA 1P0FA 5AJXA 1CS0A 5AQ1A 1JB9A 1WZIA 4TV8F 4BNLA 1OI3A 4EY5A 1DV2A 3P20A 1OWMA 3DO8A 3HSYA 1XRQA 1N0HA 4JJ7A 3ZNQA 4AUMA 1T8RA 3UY4A 2EBUA 3D81A 3JWJA 5FV4A 3ZGOA 1UK7A 4UBIA 1GEGA 1XDGA 2X77A 1YZYA 3LDGA 4FINA 4IDHA 4BFLA 2QTGA 3E6AA 1G59A 1U1GA 2BKVA 2X3UA 1LB1B 4YG7B 2OV8A 3EA0A 1WVIA 2PZMA 2PWAA 1UOEA 3KSZO 3NT5A 1BMDA 1VYUA 1MNQA 2NV6A 2QJTA 5C8YB 3OMLA 6NULA 4HDCA 3K16A 4X7MA 1NONA 2RMKA 2XDQA 3UAXA 3VZQA 3F52A 4AMGA 2J5KA 1VE6A 1KJ9A 2P91A 3OIYA 1B6TA 4W5NA 3G2JA 1WIZA 4WBXC 4DEXA 5I7WA 2PHZA 2POQX 4KN6A 4DCPA 1U0NA 3U1TA 3GFSA 2PWYA 4JQOA 1GPKA 3FIJA 3UJ7A 3F73A 5TEVA 2V3WA 3T3IA 1M33A 4XSHA 1QYDA 1X1EA 1USIA 2CF6A 1NI3A 3B6MA 1BZYA 2C4NA 2FFRA 3G9TA 1C3OA 4INZA 4KFRA 4PS1A 4C7JA 3ICQB 1V7PC 1TKCA 2IYAA 2R97A 3IPCA 1O4WA 2CK3A 2P3SA 4KYIB 1DMRA 3A9RA 2WG2A 4QXPA 5FJJA 3UANA 1N77A 2VQSA 3SF0A 4L8YA 3DNVB 5MGNA 2BLLA 2QP3A 5F73A 4ZU3A 1U7HA 1YB7A 1Y8QB 3HN7A 1Y8CA 2V03A 4RM3A 4QBTA 5FWDA 4X7BA 1G8PA 1W94A 3ILHA 1UOOA 5U4QA 3HC7A 4QRIA 1Q83A 2O50A 3N5CA 1XD2A 4KXNA 3GLGE 1ZPQA 1EJ2A 1LFAA 1YB6A 3HU3A 4X3PA 1PS0A 1U8ZA 4AS3A 1FJXA 1T2EA 4EJ6A 2QN1A 3QEAZ 4DMRA 5JTTA 5TNXA 1S3GA 2OA0A 4EHFA 1UC8A 2IYSA 2BPOA 2QG9A 3G0TA 5FBHA 1W5BA 3WMRA 2YX1A 2I4LA 4TOIA 2XSDC 1GAXA 3K35A 2DTDA 3KQYA 4NBRA 1PJ8A 4P33A 3VOAA 1SOVA 3V4PB 3Q6IA 4MV8A 4CT0A 4A0QA 5ALOA 5CYGA 2XHZA 4O2AB 3R44A 2GPNA 4URXR 4TRRA 1C8BA 3CLSD 4PQEA 4DLXA 2OVFA 2V9PA 3IDQA 4R2KA 4QEDA 3HJCA 4I8DA 4CCYB 1E98A 2O2SA 4DV0B 2BNOA 3NTOA 3D2BA 2PEZA 3B36A 3HDYA 3SBDA 1P8AA 1VMEA 5H0IA 1AUQA 4CF3A 2PLAA 3V8PA 1MMFB 5KNCA 4IDQA 1KO4A 3HPRA 3H1EA 2EP7A 4IINA 1H65A 3WGMA 2GYUA 2HRRA 3QW4B 1FTGA 4QHTA 5JO9A 2DB3A 4DR6B 2G5PA 3JAKB 3JARB 3ZHRA 3AKYA 3GN1A 3MJVA 3LXRA 1RIOA 1FP7A 5CD1A 1U8CB 3LZDA 3M33A 2ZJ8A 3FPCA 1C3XA 3KXAA 4HZUB 1YB4A 3ZXXA 2YFHA 2I2BA 4FOOA 1IY9A 1OV4A 1QG6A 4I08A 5J5AA 3JQBC 5F5NA 4IMIB 4BV3A 5JI3E 2Z4SA 2GILA 5DNEA 3NM4A 1QYWA 3TXXA 3WLRA 4A73A 1DQRA 1TVKA 3G3EA 3HDGA 5JTUA 4DV2B 4LCBA 1GPJA 2GXAA 2ACWA 1BGWA 3KKPA 2BTQB 4ZJPA 1AG9A 3PVZA 4O4HB 2P9GA 3GLQA 3L7DA 5JS8A 1J06A 1XTZA 3FHJA 1JXAA 4PX2A 1FBNA 2ES4A 1ONPA 2ZIAA 3I45A 4PU0A 4RZQA 1ZSVA 3UHFA 4BMSA 4Q15A 3VAYA 4FR2A 1VSUA 4UMEA 4Y1GA 4WBSA 4DKXA 3IIMA 4E2FA 4N0EA 1LZKA 2WC1A 3RUFA 4FIZA 1SFRA 1IUOA 1C41A 3S1SA 2NNWB 1Q1QA 3HUDA 3N2GB 2BKAA 3JW8A 3SZGA 1DCTA 1E7RA 1F9EA 1GZ5A 3GGDA 3N5KA 1YK0A 1Q0LA 2ONZA 2VNKA 1B2RA 1OPXA 4LY0A 4MJXA 4ZEVA 3DC7A 1QH8A 4UEJA 1XMJA 4YJ3F 2XT9A 4J0CA 3S28A 3W6PA 3ZQ6A 2X6TA 5AXCA 3B13B 4XJTA 5JC1A 5I8PA 2PWPA 3M4XA 4MR9B 2IPAB 1J5EB 3VUEA 2AR7A 4HN4B 2F62A 4URVR 1DDGA 3UJPA 1PNQA 1KC3A 1GPMA 3A6ZA 5PGMA 1ZONA 1IWPB 2V0CA 4QUKA 2Z5LA 5A05A 2ZIEA 2AN5A 5CH5A 4FHEA 1TW2A 3U4IA 2ACKA 5T8KC 5DE3A 2AMLA 5JCOA 3F6PA 3S2EA 2W2KA 3KPVA 3GRRA 1UBUS 1JR3E 2X19A 2JI4A 4WNCA 2AEJA 2DTEA 1YAJA 1RJ9B 4Y9UA 1R0XA 3G5TA 5B1YA 1QV9A 3K0KA 1JKXA 1QYRA 1Y3DE 2JKVA 3EVDA 4PYLA 4ZQGA 3H0KA 3VC1A 1RYZA 2CYBA 2FRXA 4HNQA 5JNTA 4OFXA 3WZ2A 4QNMA 1X7XB 3D6AA 3I2JA 1Z0DA 3TCNA 1BYIA 1F5NA 1OIWA 3QFSA 5TQ0B 4B0OA 4E5KA 3QF7A 1HNWB 2DPGA 5B7NA 2ETXA 2VC2B 2A8YA 4PGAA 1PFVA 2Z2YA 2PH3A 2YFQA 1TQDA 1IUKA 3I39X 3L43A 3OE7D 3QUSA 4MJ7A 4Q4HA 4TWBA 5HJ7A 5LXTB 5CFZA 1I5RA 1TZKA 1W2HA 3EGVA 3IUYA 3LBAA 4RNCA 5CLLA 1D2RA 1RP1A 2E85A 1UKVY 3GMSA 3OCVA 1LCDA 2X8LA 5CFRA 1NVEA 4CIAA 2IW1A 3FOAA 1XZGA 3KAKA 4N3AA 1Y7HA 2AFIB 2EVWX 1JHAA 5D7BA 4EMUA 2OCDA 1Q2XA 1K1EA 2DCUA 1EGMB 4C3OB 2GZDA 2JRCA 1AGYA 2XBUA 2YINC 2IUUA 2JF0A 2NTVA 1B14A 2W58A 4JVSB 5CDSA 3LUAA 4X20B 1Z0JA 1Z7BA 3GCGA 3GFTA 1AJEA 1T26A 2XUKA 2QM7A 1M1YB 3ZU4A 1EZ1A 2YXDA 2V7BA 4PBTA 5KAPA 2TECE 2Z2KA 5DGIA 3UCFA 5K9ZA 3Q3VA 4FM9A 2ATCA 6PFKA 1H94A 4W8GA 3KKKA 3LBYA 1GV0A 2IEIA 3AUUA 2VUSA 2O1SA 4L3VA 5DLPA 3A6JA 5J2UA 5T7BA 4CV0A 3L0IB 1KFCB 2WIKA 1US8B 1BS1A 5IFLA 2O7VA 1UBJS 1GL9B 4NV0A 5TPWA 2H4ZA 3M1IA 3V7YA 1Z82A 4C76A 3M82A 1JHVA 1CR0A 3N3BC 3S29A 3QQ6A 4BLTA 1KI7A 4U3JB 1JIUA 4B74A 2OILA 1G1AA 3KE9A 4XR4A 3RADC 1E0JA 3T9AA 4I3GA 2I2AA 3C6QA 5DIZA 3AEUA 1JI0A 5GADl 1BMFD 3IP9A 1W2GA 4LHYA 5I3CA 2OTCA 1UWLA 3GJRA 1AGXA 4HWRA 4NP6A 3PIRA 2P9CA 4M8IA 1GTZA 3OFSA 3T7EA 3EIQA 4YTEA 5BXYA 3TZLA 1IWBB 2WU8A 1QZZA 3AVOA 1WOMA 2E1PA 2VF8A 1JKMA 1XJ0A 4IIHA 1SQ8A 2RHRA 4F5ZA 4JB2A 1Y34E 3VBCA 3NHMA 5JMTA 4R40A 3FTNA 1ZNXA 3MXOA 1L4UA 4KAJA 4DT1B 2JK1A 4KPEC 5BR4A 5FIUA 2R44A 4OQLA 5DNWA 4B3HA 3H86A 2VJQA 2XCQA 1JVSA 2ZJ3A 3U5ZB 5AKKA 3ANLA 3DZCA 1EVJA 1P9OA 2JI7A 2Z9CA 4HK4A 3CZRA 1PDOA 3V7WA 2WAOA 3BHNA 4NBUA 3Q1LA 3AP1A 4BNUA 1UM9A 5JFOA 4MV9A 4LSMA 3OE7A 5EZQA 3WFIA 2I7VA 3ZE9A 3NDJA 3FCXA 2XE8A 2ZEJA 4OG2A 5AYVA 2ZB4A 2MSDB 1FRQA 2XE6A 4B2YA 5LKAA 1SM4A 2BMDA 2XRZA 3WLNA 4OA5A 3WV5A 1SBYA 4J2HA 3PP8A 4L1KA 4L5AA 5LQDA 1NXOA 4MV6A 3PRHA 4JQZA 2A1UA 2EX1A 3EDOA 1ZOLA 3DM9B 4D3SA 4ZC8A 3ZIAD 3PXAA 2H2AA 1YACA 4KBYA 2O19A 3IR5A 1U4NA 3FYUA 3KFXA 4R9UC 5EKTA 3CPEA 1U8TA 3D0QA 1D2CA 4C08A 3RYCA 1Q1ZA 3COSA 4M21A 4TXJA 2DPHA 4YALA 5KAMA 3FNFA 1ONBA 3LX6A 2JLUA 3SF8B 3DV9A 4FYJA 3U16A 2EHDA 2ZIZA 4DDMA 6REQB 5FWXA 1HPLA 3TQQA 4HTFA 4B34A 3AEKB 1MXHA 1U3CA 8ADHA 3F46A 1NNUA 2OKCA 4NI5A 4RGYA 4IQFA 2YQZA 4IJUA 4U7PB 3U3RA 1ZY2A 2LKCA 1E2QA 1YS9A 2EF1A 1G6HA 3E5NA 4HL6A 1KOLA 1P5JA 4WBNB 5D1NA 1QJCA 3AFIA 2P0EA 4GRIA 5JJKA 2QD4A 1JG7A 5L53A 1S8FA 6GPBA 4UDOA <