1JH9A

Purine repressor mutant-hypoxanthine-purf operator complex
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
339
structure length
339
Chain Sequence
ATIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAAYFAEIIEAVEKNCFQKGYTLILGNAWNNLEKQRAYLSMMAQKRVDGLLVMCSEYPEPLLAMLEEYRHIPMVVMDRGEAKADFTDAVIDNAFEGGYMAGRYLIERGHREIGVIPGPLERNTGAGRLAGFMKAMEEAMIKVPESWIVQGDFEPESGYRAMQQILSQPHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEVHPRLIERRSVADGPFRDYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Role of residue 147 in the gene regulatory function of the Escherichia coli purine repressor.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription/dna
molecule keywords 5'-D(*AP*AP*CP*GP*AP*AP*AP*AP*CP*GP*TP*TP*TP*TP*CP*GP*T)-3'
total genus 117
structure length 339
sequence length 339
ec nomenclature
pdb deposition date 2001-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00356 LacI Bacterial regulatory proteins, lacI family
A PF13377 Peripla_BP_3 Periplasmic binding protein-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 1jh9A01
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1jh9A03
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1jh9A02
4FE7A 4TN5A 4D6YA 4YG4A 1MIHA 1APBA 4KNYA 3GN5A 1ZZ8A 3MQ4A 3HCWA 4N03A 3OP9A 4PEVA 3JVIA 4HNSA 2LYKA 4JOQA 1E3OC 1QPZA 1R8JA 1HF0A 3KLOA 1GUDA 4KK3A 2PLNA 3LFTA 3SQNA 4Z58A 3KTOA 4PU8A 2PUDA 3A10A 1E6LA 1QO0A 2LYLA 4RV5A 2W42A 3H5VA 3OMTA 1RZSA 3K9CA 3UKJA 4GQMA 2IU7A 1UTXA 2XDYA 4Z5HA 3TMYA 3GBPA 4J1XA 4X4CA 3C3KA 1C4WA 4D6XA 1MB3A 1KRWA 5KC8A 3GBFA 1QQBA 1ADRA 1OXBB 3O2SB 3HZHA 4MS3B 1FFSA 2FTKE 3I09A 3OQNA 3E3MA 2RJOA 1R63A 3UUGA 2H8RA 4Y9TA 5PNTA 1JF8A 4JB0A 4O1IA 3RVJA 3QEKA 3UFDA 2B1JA 3MF4A 1XWRA 2FJRA 1ZH2A 2L17A 2VUHB 3O74A 2QV0A 4D74A 4F3TA 1QKKA 3GYBA 1GT0C 3HEBA 5IUNC 1JYEA 5HM6A 2L2QA 4HNQA 2CWDA 1H9CA 3LUHA 1PNTA 3Q7TA 2JVLA 4B09A 2XIUA 4P1ZA 2MYPA 1PNRA 1NATA 2GRMA 2GRLA 1EWVA 1RNLA 1Y1LA 3QLVA 2AW6A 3I45A 4LE1A 4NV3A 4ZPJA 3T8YA 1Y7YA 3NNNA 1NXXA 2VUIB 3EULA 2QXYA 1ZY2A 1YK0A 1NXOA 4O5AA 4MS1B 1BA2A 3HM9A 3URMA 4WWHA 4FE4A 2FQYA 3OLYA 3S8QA 2O49A 2FMKA 3BRQA 5TPZA 4N76A 3DNVB 3CNBA 3I42A 1QQAA 3LKBA 3BREA 3Q9SA 2B4AA 5JNVA 1S8NA 4MLCA 2FQXA 4XLTA 3JS5A 5JNTA 3FMYA 1JWLA 3TO5A 2LPMA 3NBMA 4S05A 1WH6A 2JB9A 3O1IC 4KK4A 3D02A 3MLFA 2MEZA 1M5TA 4WUTA 1JH9A 1NY5A 5BR1A 1D1QA 2WB4A 2IV1A 4MR7A 2EWTA 3GN5B 1D4ZA 4ML3A 5JNUA 2LYQA 3FFTA 3FFWA 2ZAYA 3EQ2A 3E61A 4PU7A 4ZYLA 5KQLA 3G1WA 2LP4Y 2NZUG 3L6UA 1ZH4A 1D5WA 4HNRA 2N9UA 3EDCA 3H1GA 3HUUA 1CJGA 3LTEA 4KV7A 7ABPA 4W5OA 3RVRA 3QELA 1OCTC 1ISRA 2JCGA 5EWJB 3SCFA 5TQ0A 3HO1A 5A7LA 1EWKA 1NEQA 3MA0A 5KWSA 1AU7A 3DGFC 8ABPA 1MVOA 3OO0A 3O2QB 4YR7A 1JFSA 3TD9A 2OENG 2V0NA 5KQGA 3KYJB 4MS3A 4PZ0A 1ZITA 2FMHA 3H5LA 5FBKA 1DWKA 1LJLA 3N0WA 2R47A 2MQKA 2IPMA 4N47A 1P8AA 1NTRA 1LJUA 1JYFA 3NNDA 4Z4HA 3T6KA 5TQ0B 3JTEA 4LDZA 1BVHA 3HJFA 4MRMB 2FLWA 2JRLA 4MR8A 3IP5A 5DTEA 2HINA 3JY6A 1VRVA 2XCJA 3HV2A 4G0MA 3OLWA 2CSFA 3G85A 2FKAA 3QEMA 5HKOA 3A3KA 4YO7A 4RK6A 2PIJA 1QMPA 2CHFA 4PU3C 2JBAB 1KMIY 1F4VA 1Z18A 1VPWA 2IOYA 2QSJA 3NHMA 4RS3A 4Z4GA 1NXSA 2WIUB 1UDRA 3BRSA 3F51A 1EAYA 3QK7A 1NXVA 4KQ9A 2LYPA 2E4YA 1FFWA 3ZHMA 3KKEA 3A0UA 1P2FA 4ETMA 2LYSA 2O4AA 1L5YA 1DRKA 2JVIA 4MQEA 5EWLB 5B3JA 3F6PA 2ZWMA 4X4GA 4ETNA 5JNSA 5DLEA 1ABEA 3LUAA 1LBHA 3DGEC 4MCTA 1DC8A 1SXIA 4IGAA 4TMYA 2EF8A 1QP0A 3HS3A 3OLVA 3QEMB 3B2NA 4LZLA 1EHCA 1LBIA 2MYTA 4I8TA 1JFVA 1NXPA 2EBYA 1AB6A 1EWTA 1YS7A 3EUSA 2PUCA 4MRMA 3QQ6A 4KMRA 3EGCA 4P98A 2AYZA 2JK1A 4FB4A 3MIZA 3QLUA 3F73A 1A04A 5IC5A 4OLAA 1PRUA 4JASB 4Z4CA 4EYOA 4RY9A 1LMB3 3H1EA 4IA8A 2NT4A 4IMJB 3BDNA 2IYNA 3L1PA 1JDPA 4JCXA 1JHZA 1PERL 4CBVA 1ZS4A 1XHFA 5ABPA 1DCMA 4G0OA 3F6CA 1ZN2A 2LBPA 3ILYA 3OMXA 5EWMA 3QYXA 4Z5CA 4NQRA 1YMUA 1POUA 3ZHIA 2FEKA 2J48A 2TMYA 5IEBA 4W5RA 1BAPA 2PL1A 3CROL 3GRCA 3C3WA 4EUKA 4YP9A 1RXIA 2WMYA 5B3JC 1W25A 1RIOA 1B00A 1ZGZA 2OFYA 1WH8A 3CKMA 5FBHA 1EFAA 1DZ3A 3JXCL 3FDFA 1R69A 4RK5A 4YV7A 2LUOA 4NCBA 3VK0A 3SCGA 4X4BA 2XSDC 2GWRA 3FGZA 3IVPA 4DQDA 3RVQA 3JXBC 3SCHA 3GL9A 1BDIA 3B7HA 3OM1A 4MR7B 4YGXB 4YLEA 3SM9A 1CHNA 3LFPA 2MSWA 3N8IA 2LYRA 3OQMA 4XAQA 2A9QA 2NUBA 1ZZ9A 1DC7A 3GT7A 4PE5B 4O8BA 2FQWA 4IILA 4MYRA 1J56A 2JVKA 2WWVD 2AXZA 3G5GA 1ABFA 3C6QA 2OR1L 4UHJA 4RKQA 3K4HA 2NT3A 5E3JA 1WIZA 1W9HA 1RPEL 1JX6A 2QU7A 3BBLA 3ZKCA 4G86A 5CNIA 1E6MA 3QLVC 2FMFA 5DCLA 1SQ8A 2ID7A 3JPYA 2PJUA 4MCXA 4GHJA 1XHEA 2QVCA 2P9HA 2IVQA 4MQFB 3MMNA 2O20A 2A6CA 4EYKA 3FYAA 4I6UA 3IP6A 1Z13A 2IUOA 3FYMA 1VLZA 2FEWB 3H5IA 3N53A 3OLXA 4N0PA 4YWHA 4S04A 1YS6A 3TRBA 1ZZBA 2IKSA 5D2CA 2CHEA 4G0ZA 1ISSA 4Q6BA 1RXEA 2GKGA 2L8NA 3CHYA 3OM0A 4RXTA 4KRFA 2O38A 2F8TA 4RDCA 4Z99A 1B0NA 1TJYA 4Q6WA 3JXDL 3N0XA 3DZDA 3H1FA 2IPNA 1NXWA 1USIA 1QP4A 5TQJA 4IWRA 5IBQA 5JS1A 4X4HA 3HSYA 3TB6A 5KI6A 1E2BA 3N6VA 3KS9A 2ICPA 3O21A 5T3YA 1NERA 3GV0A 1OSLA 1JL3A 1K68A 3KCNA 4WXEA 5EWLA 3RVSA 3HDVA 1LCDA 4X4EA 4H3KB 4RK1A 1A0OA 2P4UA 2VK2A 1DCKA 2IVBA 3HUTA 2RDMA 1CQTA 3Q7RA 4MS1A 2FN8A 4OG2A 3SNKA 1P6UA 1C0EA 1E6KA 4JCYA 3C3MA 3O1JC 4M88A 1Z12A 3KJXA 3H5OA 1L1MA 4Q7EA 5IEJA 3C97A 4WXMA 1TMYA 1M5UA 4MPTA 2BNOA 2MYNA 4Y42A 5DKFA 1ZESA 3LMKA 3EJWA 4MR8B 1LCCA 1YMVA 3GWGA 2WJWA 4RZSA 5GQSA 2QW1A 4Z9BA 4W5QA 3ROTA 2XI8A 1PEAA 3BD1A 3NNSA 4PYRA 4YS6A 2QVGA 1M2EA 1F51E 4X4IA 3IP7A 3SY8A 1ZAYA 4KPYA 4NCAA 1MB0A 5TQ2B 4PICA 4KQCA 5F64A 4L4UA 1JLKA 5KQMA 1QO0D 4RU1A 3DLBA 4JP1A 4YBAA 3LUDA 2WY2D 3IP9A 2ICTA 3O9XA 3LOPA 6ABPA 1FQWA 1PHRA 5TPWA 2MSLA 3JPWA 3KLNA 1K66A 1SRRA 5IX8A 1DJMA 4YCSA 4MS4A 4QICA 4Z4EA 3CTPA 4LE2A 4N41A 3NHZA 4F12A 4YARA 4Z0NA 1S7EA 4EY3A 4RK4A 4E7PA 2KZ8A 3TX6A 4RK7A 4G97A 5K98B 4JB2A 4OTZA 2X7XA 5CNJA 3DLHA 2JVJA 3H5WA 2CROA 2A9OA 2R63A 3KZ3A 1IIBA 1SXGA 3H6HA 2GBPA 4JA2A 1PEYA 1JDNA 3H6GA 3CLCA 4H3HB 4RY0A 3M6MD 3RVKA 4EVRA 4OB4A 3G7DA 4IF4A 4QYMA 4LE0A 5DGCA 2GX6A 3KXAA 4G0PA 1LK0A 1XWWA 4TLLB 1YTUA 5I4CA 1CEYA 4G0QA 2HJ9A 3IPAA 2M98A 4I6TA 3KYIB 2E4WA 5TE9A 2FMIA 1JFTA 2VYCA 3BS3A 1ZDMA 5IULC 4IMIB 4YG1A 5FWYB 4Z4FA 1GCAA 3LUJA 4FN3A 5EWMB 3CU5A 1DBWA 3RVMA 2L18A 1ZHHA 4MAAA 3EODA 3M9XA 2A9PA 3H5TA 3F6WA 5CNMA 2RJNA 1DRJA 4F8JA 4I6RA 2PMCA 4X4FA 2IDMA 3R0JA 1I3CA 2XJ3A 1NXTA 3CFYA 3F52A 3RVLA 3KSMA 2PUAA 1Z2DA 3LUCA 2I6FA 2KYRA 2H3HA 1LQCA 3OQOA 1A2OA 1U0SY 1URPA 2HQRA 3ILHA 1YSEA 3LUFA 4Z4IA 3IDOA 1USGA 2IPLA 4OBBA 9ABPA 4F06A 2FEPA 2HQBA 3OO1A 4ZMSA 2LCVA 1DBQA 4L85A 1Z2EA 1RZRA 2E4XA 2CD7A 5C5CA 5TQ2A 4W5NA 4RXUA 5KQPA 3LISA 1AB5A 5KC9A 2LYJA 2PUEA 4ZMRA 1U2PA 5FWYA 2HSGA 1DG9A 4MQEB 3R1FA 2WUSR 3IPCA 3Q41A 3ROFA 1PUXA 3L49A 1DP4A 3CS3A 2DRIA 3SAJA 1FFGA 1YK1A 4RSMA 4YG7B 2H0AA 1WETA 4EGSA 2AXUA 2PAFA 4KFCA 4IVZA 2JBAA 1ZZCA 1BDHA 2PUGA 1YIOA 3CZ5A 4QPJC 3A0RB 3T95A 1Z26A 5BRAA 3Q7SA 5BRJA 2Q5CA 2F8SA 1Z17A 3H75A 4RWEA 4W5TA 3PXPA 4OATA 4Z9AA 4XARA 1RZRD 2HQOA 3N0RA 2RGYA 2FW0A 1BDJA 4KVFA 3RQIA 4LX8A 2R48A 4F11A 3D8UA 4EVQA 4J1WA 4MS4B 1LLIA 2WJAA 3S99A 2BNNA 1SXHA 2BGGA 1ZZ7A 3VNAA 4WZZA 5BQ3A 4FBIA 3FFXA 4NDWA 3VNBA 4EYQA 4GPAA 1DW9A 2AYXA 2FLKA 2KEKA 1RPJA 1Z15A 1YVUA 2PL9A 1ZZ6A 4RKRA 5FWXB 2AWIA 3D1NI 2PUFA 1TLFA 3GBVA 3EQZA 3O1HB 4KREA 2NZVG 5TPWB 2KEJA 5JS2A 4MLDA 4XXHA 2KEIA 5EWJA 3CECA 5GOTA 1U04A 3QELB 4DADA 1ZUGA 5CNKA 4G0YA 1ZPQA 1ZGGA 5HQJA 1L5ZA 1KRXA 4E7OA 4MGEA 3HZIB 1Z25A 1OXKB 3M9WA 1D2AA 3LUGA 3HVRA 1T34A 4RXMA 1O4XA 1KGSA 3LUKA 3O75A 1M2FA 2FN9A 4TLMB 3JVDA 5C5EA 2B5AA 3RZZA 1TM2A 2IPAB 2GI4A 4XASA 5ED4A 2L49A 2HPHA 1PRVA 4MQFA 3LKVA 1DCFA 3F7NA 2GZUA 2L19A 3GA5A 1SD5A 2PE5A 1D1PA 3RVNA 1VKRA 1U8TA 4HYEA 2BJCA 4WT7A 3CG4A 5JNWA 3Q15C 2MYUA 5HSGA 1X57A 3QLUC 4EVSA 1FSPA 1Z16A 4Z59A 1QNLA 1IC8A 2R25B 1U2QA 2PPXA 3KHTA 3N75A 3HK2A 1CYEA 2LIVA 5IUKC 3W9SA 1GCGA 3HXMA 3T38A 3RVPA 2KPJA 2WRZA 3KG2A 5TPZD 1UXCA 3QLTA 2R1JL 2E4UA 3DBIA 1X2LA 3U3WA 2A9RA 3OLZA 4Z5DA 4JAVC 3QWGA 4LDAA 1USKA 4RY8A 4KZKA 3QX8A 4RK0A 5IUJC 3CRNA 3RVOA 2ID9A 3QX9A 1PRAA 2PKXA 3UK0A 4YRZA 1GLGA 1ZVVA 1UXDA 2FVYA 4X4DA 4JQDA 3OMWA 4O1HA 3MM4A 3MYYA 2OQRA 2FXIA 1TVMA 5CHYA 3CLKA 1JBEA 2BNMA 1QP7A 4NICA 1P6QA 4PU4C 4GNRA 3SG0A 2YHAA 3P9YA 3I5AA 2IVGA 4ETIA 3RH0A 1Y9QA 1MAVA 4QYWA 4ZJPA 4XFKA 4N0QA 4EYGA 2FSPA 4F8DA 4LRQA 2R4QA 3EAFA 4MR9A 5T7BA 2QZJA 2AXVA 5FWXA 2E4ZA 2PUBA 4G0XA 4IRXA 2M1ZA 4MR9B 6CHYA 2AUWA 3O2JA 1GUBA 2QR3A 3FMVA 3CZCA 4UHKA 1HEYA 2YHBA 1DBPA 3CG0A 4H60A 5JNRA 4DN6A 2MSKA 2D5VA 4OLBA 3HDGA 2E4VA 3BILA 3QF3A
chains in the Genus database with same CATH superfamily
3ANTA 5HE8A 5K6TA 1ZZ8A 1IHOA 1JR2A 2GUWA 2HLDA 2HCTA 2I7TA 2V8BA 2XZDA 1L4HA 1XN4A 3R6LA 2IS4A 5B1SA 3JVIA 1E3OC 3HSKA 2F3UA 4IIJA 4ABYA 3RYTC 3R75A 2UAGA 1VXOA 2PZBA 1LSOA 1N2CE 3D3WB 3QW4B 4XX1A 1JS1X 4CFYA 2XE7A 3A10A 1CQJA 4G09A 1YUBA 1X94A 2RMKA 3H5VA 2GQ0A 1G9XA 1FF9A 1NBAA 3CLUC 1C9JA 1KJNA 5EZQA 1JHRA 1SKMA 2YJNA 4I19A 1JIQA 1QQBA 1BGVA 3OE4A 3RU2A 3T7TA 3HZHA 2Y68A 4MS3B 3E7FA 5D3KA 2PBZA 1UL1X 1DQRA 1W94A 2RJOA 2Y67A 4KZPA 4L0DA 5CT9A 4Q9HA 5ES3A 4TZTA 5JSZA 1E69A 4HH1A 2WHEA 1RLJA 3EG9B 4EX7A 3UFDA 2CVZA 1E7MA 2XJ4A 3K70C 1DAOA 1E18A 1AE1A 1MFPA 1SD2A 3O0TA 1KAQA 5IMBA 1YA6A 1GT0C 4H3VA 4O2RA 1S8OA 3EZYA 3LY5A 4G23A 4ZVPA 4ZQFA 4WV3A 3TKAA 5CFLA 4EABA 3AZPA 4PLWA 5EHIA 2V03A 1W5BA 2GRMA 3G2PA 3ITNA 4CV2A 1F2TA 2C3OA 5AKIA 2VT3A 4PRYA 5TMBA 3B89A 4UUQA 5SYAA 4YT2A 4LTMA 4NABA 4O5AA 2EBWA 2C0PA 3AG6A 5JTUA 3P2MA 3SSMA 3VU0A 4IXTA 5K2OA 3RO7A 1PS0A 3MFYA 1YJBA 3WKAA 3GPIA 5BR8B 2CXOA 1E77A 1EFDN 3C5WP 3HDTA 2QRUA 1WW2A 2VZEA 4YAEA 1JQJC 5DO9A 3HR8A 1KY2A 5DULA 1EE1A 4NOKA 3SDSA 4MJXA 5C8YF 1V8OA 1A3CA 1I4TD 4GZMA 4A6DA 1VM6A 2H65A 5AW1A 2V45A 3I3SR 3JQGA 3M1LA 1E2KA 1DO0A 3M6FA 4G1UC 1KEKA 4IWYA 2HBRA 4RZIA 3TQOA 4Q21A 4HWSA 3FE2A 5K9ZA 3WLQA 1UQUA 3PGXA 1Z5NA 2JPDA 1L7OA 4LXQA 5KQLA 3G1WA 1KDPA 2LP4Y 1QIFA 3PRHA 2Y27A 4Q1DA 2DHEA 1D5WA 3GAMA 3OQHA 5LA6A 5AJXA 5AKXA 1B73A 4M9QA 4W5OA 5CB6A 2VLBA 3CZ9A 1VJGA 4OQQA 4OX9Y 3C3CA 3TLKA 1FPMA 3NR2A 1EB8A 4OGLA 4OP1A 3ZS8A 3WI7A 5MFPA 1TYZA 2IYTA 2X6TA 4L4XA 1TX4B 2RAFA 4ZVRA 1AMNA 1N7IA 1X80A 1P4HA 3QWBA 4RGBA 5BR7A 3W8NA 3ZOZA 2W8BB 1DHTA 2IZ6A 4CE6A 3NC0C 5I3CA 2JLZA 3DO5A 1UR5A 4KP7A 2FUEA 2VCYA 3PNSA 4IIVA 5KPJA 4KW7A 2WK1A 5FORA 1GPNA 2QY6A 5AW6A 2GFQA 2NQTA 2QUHA 2X8JB 1KI3A 1YONA 2G88A 3JTEA 3W7BA 4AJPA 4CQNA 3VDQA 5MGBA 5L7WA 1GAQA 3G7UA 3V4SA 5IFLA 4RY2A 3BKWA 1P7WA 5FNVF 2FCAA 1D09A 2EGGA 5BW6B 1VRVA 1X86B 3W7VA 4YUXA 4UM8B 2AZMA 1FYVA 3AJAA 4Z9FA 1GNPA 3G49A 5FBWB 3UM9A 3WRXC 4BFZA 5LB2A 4I1IA 2OO7A 4ESHA 4BWYA 3U4QB 4B3RB 4P7BA 1E5TA 5JFTA 2DLCX 1XVAA 3E9MA 4Z4GA 4A2CA 5HX7A 1LTHR 3BRSA 1XZKA 1BXGB 1XLTA 3CLSC 4O8CA 4TYMA 1FP6A 4YT8A 5IU6A 5JE8A 2A5DA 4GZ5A 1B6SA 1AKQA 5BW4A 5LKAA 5TB5A 2KSQA 1UK9A 2F1KA 4PVCA 1XNHA 4DS3A 1W2GA 2QW8A 1LC0A 2WE8A 1V3UA 1CJTC 5H83A 5TEVA 1PNQA 4EG7A 4CIDA 1H66A 4Z6KA 2R84A 16PKA 1ONOA 1U7WA 3JZAA 1P0CA 3QZUA 5IZCC 2FKNA 3PRJA 2QAJA 2WNHA 3QEMB 4INOA 4O59O 4Z0HO 2GM9A 4CQMA 2PBLA 3P32A 1SUPA 3DOUA 4X54A 2VDRB 4QSHA 5EJFA 4BVJA 4E32A 3V33A 1EWTA 3KCQA 1V1RA 4CLOB 3IAHA 3PQFA 3VNSA 4ZMBA 5BP7A 4BATA 3EUSA 1NMSA 4ZI7B 5EJ8A 3S8YA 1V71A 3M1YA 3RSHA 4BLPA 2YIVX 2CGEA 3JWGA 4MWCA 4X3CA 4WY5A 2VYND 4AX4A 1PRUA 2V9CA 4WBNF 5A5GA 4NDNE 2BFEB 3ZW7A 1BXRA 2Q5JA 1JEDA 1QR6A 2Y1OA 1M1NA 1BNCA 5AVQA 1WSDA 5KX5F 4TLEA 2CUKA 3FVVA 1TUGA 3CVYA 4GGPA 3PHCA 1DCMA 2CMFA 1I2BA 4HDOB 1K3TA 4MQUA 5ARBA 1SBQA 5EWMA 2OV6A 2QMUA 3QYXA 4LOJA 5HYVA 4FGLA 5ERGB 1YMUA 1FOEB 1D8TA 2ISCA 3EQ7A 1S8AA 3KR9A 3PNPA 4E94A 2A86A 3K9NA 4QXAA 1ECPA 1DKPA 3JQ8B 3KU1A 1GPBA 4WKBA 3MCZA 1GZ5A 3PX2A 5F2OA 5C53B 1WH8A 1SCUA 1IUPA 3JAWB 4HDMA 3JXCL 3FDFA 1R69A 5D7BA 2ZIZA 2ZGVA 5CCDA 4C3UA 4YV7A 3L05A 4NCBA 3G3EA 5JQGF 1WKBA 2C8VA 4YGXB 3ZU6A 4JEIA 3R4VA 5E4YA 1QDUA 2ZVQX 1JB1A 2QI9C 1BH6A 2OMEA 4LWPA 2O8NA 4MMZB 3IULA 4BX9A 4UUBA 5BQXA 1P0QA 2DQYA 4BLQA 1MP0A 4B0OA 5DT2A 1FUUA 4IUBS 4KAFA 3VGPA 5B30A 1RJEA 4LC0A 1XI2A 4QXQA 1NFFA 5CJJA 3S70A 1E1YA 1X7YB 3M6IA 3TVDA 1I6KA 1PFUA 3I9KA 3K4HA 2DC1A 5DN6A 4WECA 3OT1B 3MLAA 4ARZA 1PNOA 3UCEA 1ECLA 2FK7A 1C7EA 3IP8A 1WPRA 4AYXA 3W9UA 5JH7B 4RENA 5FUVA 4HP8A 2ZRBA 5JCJA 5ICSA 3BDAA 2YW2A 3DJFA 3FX2A 1NOIA 3NBZC 4PZUA 4UHCA 3WLFA 2H57A 5L4LA 4MQFB 1T36A 2GEKA 1RAIA 4LKOA 1NAHA 3OE7D 2BEVB 2Z2YA 4HMOA 4RZXA 4WFIA 3FYMA 4YI3A 2OZPA 2XVXA 4XQ0A 3U80A 2IS1A 3H8SA 1OH8A 5I5EA 2WAMA 2GZ3A 1WB9A 3PQ5A 1UJCA 3KXKA 5LJLA 1Z28A 1D1SA 1Z22A 2WSYB 1MEOA 3AUXA 3F5FA 3L4BA 4G5RA 5KDDA 1JAIA 1P1IA 2EX4A 2JI6A 2TMDA 2AV6A 3ZE8A 3SOPA 1XQ9A 1MC1A 3DZDA 4MB6A 2WZCA 3PX3A 4MEBA 4RZUA 1CQWA 4LDRA 3TQCA 3TPCA 4B6FA 1QP4A 2R1VA 4EA6A 3V8NA 4QBKA 1UZLA 2HA5A 2VJAA 3A1SA 3M5CA 3NAMA 4XE5A 5KI6A 3WYFA 3NHLA 1Y8CA 3K96A 3TTVA 4LZAA 5KPDA 4GSKA 1OSLA 1OZFA 1SU6A 2H7VA 4WKCA 3PZBA 3ZNQA 4R1PA 3FMIA 1KSFX 1E62A 4EDHA 5ADUS 2FW7A 4GDMA 4JXKA 3AH8A 2WWTA 1DDGA 2BELA 4A8JC 2X42A 3AP2A 2WUFA 4DARA 3AI1A 3ZHBA 1R74A 2P9JA 1ZL2A 4WX2B 3ZHYA 1Q0PA 4JS0A 3U5TA 1QDEA 3CPSA 2GA8A 3EQ9A 2DY0A 1TT5A 2QLMA 4C0QC 1NVAA 1KI9A 1WF6A 1QHHA 3FRIA 3TW8B 4FYWA 3VTZA 5CDHA 1FYFA 4Y42A 2XYQA 5H16A 4MQ6A 5CJ2A 1ID1A 4BRZA 1BA3A 4K46A 2QW1A 4CLXA 2W7TA 3SQOA 3VTKA 3KPUA 5C18A 2O8DB 4ECAA 1X7WA 1LI5A 1QYRA 1Q0QA 2Q6IA 1PL8A 1T2DA 1FNNA 1KMCA 3FI0A 4MPDA 4QU9A 1GQRA 1SU7A 3CLHA 4Q00A 2AFVA 3SY8A 4BO4A 4DR6B 3NJ4A 5FD8A 4L4UA 1G4UR 3O4FA 1P9OA 4M1SA 1C3XA 1OT3A 5H9VA 3O9XA 3EASA 1O97D 1EXMA 3W2HA 5DN9A 4MHOA 3GR6A 5AW7A 1IK4A 4QRDA 4ARAA 2ORVA 4DLUA 3IGFA 4WK2B 5AW4A 5EMHA 1FTQA 5JXHA 2OE2A 2MR6A 3F4LA 3WB1A 1RM5A 4MI6A 4ZPXA 3NTRA 3NATA 1KVSA 3OX1A 1Z0KA 3SZOA 4M1QA 4B3DA 3ECSA 1VHDA 3K30A 3BFVA 3EZGA 3BIOA 1ONNA 1N9ZA 4BNZA 2FF7A 2FPIB 4IF4A 1RT9A 3KDSE 1XZIA 1NVVQ 3RQSA 4F86A 4N6NA 5AXCA 1ESNA 2ETVA 3RUCA 1P81A 2BR3A 1M2GA 3HJAA 3OCVA 1IM5A 2AWOA 4GPBA 1AQYA 3WFJA 4ENVA 4ZEVA 3OFVA 1U63A 2WD7B 1UJ5A 5E1OA 4MJLA 4DWJA 1K4YA 3DV2A 2HMWA 4H6VA 2X23A 4QGGA 5E7JA 1IUKA 1LX7A 2W6JD 3D8NA 3I64A 1QIEA 1Q0TA 4DTIA 1G98A 3WWPA 2EGUA 2ENWA 4MXDA 3THYB 2BH2A 3G2OA 3EW7A 4BJ5A 5LP6A 1N5MA 4PRLA 2EKPA 3LHSA 3FTPA 3INRA 1RAGA 5HF8A 4E5DA 4I6RA 2JKYA 4FWIB 3H83A 4FDLA 4FP9A 5IDVA 3HB9A 3F52A 2IXGA 4LZWA 3VOAA 1H4VB 4GPIB 1PJTA 1JYSA 4DREA 4RC9A 5HCUA 2HQRA 4C06A 3PUZA 3WL8A 4AMZA 3AVPA 4NPCA 2IPLA 2VPIA 1FMTA 4OBBA 5JANA 2PD6A 5J3JA 1EWRA 3ECCA 3LA6A 2HCNA 1RCUA 1UJ2A 4LDNA 3DEAA 4L85A 4QG7A 4C5CA 4DCPA 1PO7A 1RZRA 1Z2EA 3PXBA 4LSWA 2OEPA 5CVEA 5TQ2A 2KB0A 1J6UA 1V48A 4IZHA 4M0LA 1MKYA 3WG9A 1J39A 3WOHA 2YVKA 1UXHA 4QOFA 1U2PA 5FWYA 3OCYA 3GRZA 2I76A 2IPOA 1FXSA 1R00A 4JK3A 3DDZX 1U0NA 1P0PA 1VPLA 2CCGA 1M8FA 3A27A 4AN1A 1UEJA 2W4QA 3DDCA 1EUCA 2Q41A 1G4HA 3WLMA 2ZSBA 3ZWNA 4Z7NB 1XYGA 2NYUA 2J6CA 3P0FA 3GLGE 4UCWA 4JLJA 2G76A 1BDHA 1YIOA 4R1SA 5AK4A 2GRUA 1DWUA 1YFLA 1H5NA 3H75A 4ZU1X 3PXPA 4JUIA 4WVFA 2K7FA 5I7HA 421PA 4OYYA 4F8YA 5A0VA 3LXRA 2GN1A 1QHEA 3ON5A 4MV7A 3JXEA 4OCZA 5TF0A 3DHYA 1J8FA 2DSTA 3IQGX 3MGBA 3OIUA 2PA3A 3P9RA 2Z5LA 1YZGA 3SFVA 3UKDA 4MS4B 4TKVB 3S8MA 3WYNA 4AJ2A 1QRAA 2WU4A 3FGOA 5EL0A 5ITWA 4YJ2A 3SMQA 1SC9A 1PYGA 2PLAA 4H4CA 1C7QA 1YZTA 2EBHX 2H92A 1SVOA 4GRDA 5KJFA 1CY1A 3Q1LA 2ZTMA 1RPJA 1Z15A 3P4YA 3PXDA 5D3QA 1QG6A 5C1PA 1NDHA 3OKZA 3DWIA 1IEVA 4YT4A 2FFHA 5DFAA 1FVXA 4CF3A 5F51A 3E1KA 4U7FA 1ZRSA 1MG0A 1ZNXA 2OHVA 4AMYA 4B46A 3OU7A 2JFNA 1AGPA 1V6SA 2BEVA 4C04A 4CM3A 2JNWA 3CE9A 3E3AA 3E5RA 1W0KA 4RCVA 5AFSA 1RIIA 1HE3A 3E2IA 2Y66A 5LWHA 4MCIA 4O33A 2YNMC 7ADHA 1TM2A 3PQ7A 2NUAA 2R9VA 4E6EA 1ZI9A 1VZ3A 2IQ5A 3GD5A 4QA9A 4QWWA 1AQUA 4ON9A 1NJSA 1DINA 1EA5A 2C9ZA 2D1QA 4FHEA 4M9CA 3RVNA 4H0CA 4HYEA 3NBUA 4AS1A 4IEFB 4EKIA 4EELA 3QLUC 5IK2A 2A3NA 2OPBA 3VH3A 4LYDA 5DMHA 1FFEA 1H0HA 4EJSA 3PPWA 1TDJA 2FP4A 1TZ2A 3N75A 5K05A 5BMOA 2R3SA 8AT1A 2BKVA 4ALNA 1PL7A 3E6AA 4RABA 2KPJA 1KBZA 2XTNA 2ZUUA 5LYJF 1JE1A 3CR8A 4URUR 4KC0A 3U40A 3ZCSA 3GEMA 4HT3B 3RANA 4IYJA 4BKPA 5IH7A 4US2R 1GJRA 1OI7A 2B4RO 2HA2A 2BTQA 2IJGX 3BB1A 4PG5A 4E22A 3AB3A 1NQ5A 1GA6A 3GYGA 1CD5A 1E2NA 2C3MA 4LXUA 2ZXEA 4MWTA 2OQRA 3SCZA 3B6IA 3CLKA 2A0XA 4XWYA 1RWXA 1U0OC 1IK6A 1CIJA 2WWHA 1NI5A 3ORQA 1P2DA 4L74A 1NMQA 3NP7A 1LS1A 4OBWA 4ZJPA 3IILA 4PLHA 4I9HA 4PFJA 4WD3A 2FSPA 2PVCA 2UZ3A 3TVTA 1HDEA 1QV6A 3CF4G 3VR2D 4F46A 2J0UA 3K1TA 1DGQA 1A82A 1XROA 1M0TA 3D1VA 2VHZA 5KYYA 1LDNA 2BWJA 1C3LA 1ULSA 1XWFA 2XCIA 4RPHA 2BGRA 2A6PA 4HB3A 4O5OA 3HI6A 2AUWA 1QG4A 4Q3DA 1XF1A 2IYFA 3S4YA 3MRTA 3GDWA 4HAVA 2HLDD 3VRHA 1DAGA 4QBHA 3E8SA 1I3MA 2PRSA 1M0SA 1QYDA 1UBSB 4M37A 2VG8A 5D85A 4K9LA 1ZP6A 1QR2A 2E4VA 3BILA 1X3SA 2CCJA 2KJQA 3CEJA 4Y2RA 2VNJA 4TN5A 4HAIA 3ZE2B 4TYYA 1ZSNA 1MO4A 1NE7A 4INAA 1Q1ZA 2Q5FA 4JLMA 1PNVA 1JV2B 2CD9A 1HT3A 1YVPA 1EFPA 2Y05A 5GP1A 3OZTA 3HJTA 3I8SA 4KDFA 5BUQA 2FP3A 1W0KD 4LY6A 1BN6A 1RHUA 1B8PA 1DQSA 2GKOA 4OREX 5LLSA 1OWLA 3DKVA 3ETLA 4DCOA 3U7HB 3NAZA 4OGGA 4TWIA 2GK3A 3KKZA 3RC2A 2F4NA 1QJCA 3OMTA 1KI8A 5ELMA 4XDYA 1UKCA 1G66A 1U28C 3TNYA 1E2HA 5JDIA 3AFHA 2BE7A 3KHUA 5IM5A 2OZKA 3IVMA 1II0A 4A91A 3CLVA 4MV4A 4YRNA 4JBNA 1I94B 3G2LA 1M2WA 2LNMA 1VL1A 3AHHA 4RDIA 3VSAA 3QF7A 1A95A 5ALLA 2QD3A 2QG4A 3BSSA 1XZQA 1KFEB 3S2IA 1HDIA 3HEBA 4E5PA 4V24A 4M0FA 3MB8A 3CIFA 2CDBA 1VL0A 4ND2A 1E79A 3QYPA 3WKCA 1AMUA 1C9YA 1RYMA 3G7NA 3W8FA 2ZB2A 3EXEA 5JEDA 4KXUA 3SHOA 3IX7A 4NIMA 3CZRA 3X1DA 5CTAA 1E3LA 1SQSA 3MOGA 5JS6A 1RE0A 5K8JB 3GAAA 3TB4A 5DT9A 3A6GA 1IXKA 1Q15A 4CLHA 3SR0A 3PQ6A 2GPSA 4MUMA 3PDIA 3OE1A 4FR5A 1U94A 4HSGA 2HC9A 4PCLA 3DOCA 2RCYA 3K2IA 1Q57A 3QFTA 4KE8A 1O6FA 1R15A 3FFAA 4OLHA 4TT8A 3PJEA 3LPLA 2PMWB 4IX9A 1XNQB 2GF9A 2JFOA 4MLCA 2ONZA 4DIEA 2XUHA 1ATZA 2XYGA 4F7WA 1JA9A 2JA1A 5EA2A 4ZU3A 3A36A 1XA4A 1GEEA 1EBUA 2NTNA 3B9QA 3THOA 1YB5A 4EUSA 3PGLA 4RHCA 3ENZA 1K5DA 2ZTLA 1F3LA 1FRFS 1V4BA 2O2IA 2WB4A 3OICA 1US8A 3TG2A 1VIMA 5HFAA 1Q1AA 4QARA 3DCYA 1TTQB 1T9ZA 2ADMA 3FCYA 3LPMA 2AGVA 4PLFA 5DHUA 1L7NA 5DGDA 4HX5A 4D80A 4BP3A 1YQEA 4EG1A 3GNQA 3E5HA 2Q3FA 1Q3KA 3CXUA 5A5VA 1BE0A 2Q5QA 4LX0A 3LLUA 4IICA 4DCJA 5EPOA 5EWJB 2A1UA 1LPMA 1UMBA 1UT5A 1UDWA 3FWPA 1GKLA 5I7EA 1DEXA 4M87A 4B35A 3KJNA 1Y7PA 4UVGA 2ZUVA 3IVXA 2AJDA 1NKSA 2D59A 3WHIA 3QE0A 3BSWA 2VYVD 2HGSA 1JSRA 5EJAA 3A9VA 1YBFA 4G1EB 5EC8A 2H54A 4FEAA 5C3UA 1MBZA 3K5PA 3N70A 5DPMA 3W78A 4QEKA 1MF7A 3OPYI 4RA9B 1T4CA 4FDUA 5ENVA 5T57A 1GSHA 2CEAA 3S5JA 1LJUA 5HUJA 4KHPB 4ARVA 4FX5A 5KU7A 5HGJA 5BQ5A 1BVHA 2Y6UA 5THXA 3HJFA 1U8ZA 3NFRA 4H31A 3L92A 2DH5A 3LDHA 4FLEA 4HLDA 3EVFA 2W6QA 4MRMB 4NZMA 5HF6A 2JIOA 5LMCA 3ZZTA 1MX9A 2GZHA 4ZC8A 2D5LA 2GN2A 4HWPA 2C82A 2PZFA 5JO9A 2F4VB 1PR6A 1J5PA 3DE5X 3DMYA 2OBMA 3WBFA 4YO7A 1N6KA 4ZT7A 5I9BA 1MFZA 3ZDCA 2F8LA 3U7GA 4P3KA 1P74A 3ZV7A 4AKSA 4B2PA 3DE1X 5FBRB 3SF0A 1KK1A 4N3NA 2JCVA 1SC3A 1KOFA 3AP3A 3FHJA 2IFTA 3EF3A 3IVRA 2CZQA 1J8VA 5B3JA 3L7OA 5ALMA 4ISCA 1UPTA 2OHOA 4MVJD 4PTLA 2HDOA 2UZ1B 4U0JA 4BNWA 1G60A 4JLUA 5K3CA 821PA 2NZXA 4DIKA 1Y42X 3M82A 3LP6A 1VXRA 4FC6A 4LZLA 3MMSA 1TQHA 2QS9A 3TMAA 4G37A 3KVVA 1CE8B 4LK3A 5A3SA 4RO0A 5K0GA 4DIFA 4IGEA 2PXCA 3OT4A 1YS7A 1YGPA 3BMQB 4RM2A 4WJLA 1X8LA 4RW0A 1KO8A 2YCBA 2FWPA 1UWLA 3M6LA 1F2UB 1NYTA 1JNYA 1YQ9A 2EIXA 3I5XA 1TRKA 3N8GA 1W73A 1VBKA 3FLEA 4TX1A 4WW0A 5DYTA 4BRSA 4JXZA 1M9NA 1YFKA 2OGTA 5ALHA 4W8OA 3WLKX 4D3XA 4ZEXA 1SQGA 1TO6A 5A02A 5ABPA 1P5RA 2HRCA 4I8IA 4C30A 3ZLBA 3JAMA 2C3PA 2H5LA 3ZJVA 3DMRA 1J49A 3FWZA 4YCAA 5AH0A 5C8DA 2W6IA 3P2IA 3E1GA 3VR5D 1IBCA 1KJZA 4NF2A 3MB5A 3RC9A 1W76A 4XUGB 4NP6A 1UPAA 4MX8A 2MJLA 1LVGA 2LUOA 4OXQA 3X2SA 2MT9A 3IVPA 3UJ6A 1BMQA 4PIVA 4YJFA 4DQDA 3JXBC 3TBKA 4JBHA 4Q1EA 4JL6A 2CFIA 1KEVA 1GUYA 2ICAA 2MSWA 1NN1A 2AJTA 4NBSA 3T7JA 3ZU3A 1G38A 3V6LA 2HF7A 4NMXB 1CJSA 1S2IA 5FTKA 4X66B 3QEJA 4QYIA 4Z54A 2P6OA 4PE5B 3CUYA 4ZV4A 5C35A 3LBHA 4C22A 3OJOA 1Z0JA 4PX2A 1CUXA 1NMEA 2H7CA 1XALA 3EZXA 3K0AB 4YAWA 1I4LD 4KU4A 3LQ2A 1M7BA 4UU0A 4CKZA 3A7DA 2C1EA 2QA5A 3DQPA 4DSUA 1H2XA 2PQMA 3U9SA 4C03A 3U0BA 1E98A 5E3JA 3KFXA 5LBTA 4DIUA 2C9BA 3L7YA 4JHXA 4DUZB 1I1NA 4YMIA 1H3EA 1C50A 2JLRA 1IJFA 5HZMA 1LDYA 1QAOA 2EFCB 1PD1A 3OE5A 1Y5LA 2VTDA 3GOHA 1ECGA 2ZRJA 1ISIA 2CJYA 2ORIA 2WHXA 4GBJA 2WAAA 2NZJA 5CB4F 3DVLA 2HIGA 3D4OA 4K8RB 4EYKA 1NFQA 4ARIA 2RH8A 1PR2A 4YP6A 2BHLA 5G3ZA 1D04A 1VMIA 4BCCA 1WSBA 1M7HA 2I2XB 4E5NA 2VK8A 1RWKA 2VDNB 2C2XA 3LBAA 3IAXA 1M1YA 3L18A 3LI2A 3GY0A 2L8NA 1W46A 3NHAA 3ZIAA 3AM4A 5ARCA 3JSXA 2Y1CA 2ZRFA 4Z99A 4LF8B 3BRWD 4DNOA 1Y9EA 2XDAA 3LYAA 2YYAA 5A6SA 5ICEA 3WGVA 1GGHA 3IO3A 3HY3A 4MYHA 4BFLA 1ZGCA 3OJLA 4PX3A 2OP0A 3N6VA 1H2HA 2JJ1D 2NU8A 1JIXA 1H2ZA 3WICA 1HG1A 3QYFA 1R27A 5EKUA 3I6MA 1CT9A 1I5RA 1OHHD 1OOEA 1T9DA 4G8JA 4TTSA 4BVLA 2PIAA 2VNIA 1YQUA 3IIKA 1Q3TA 1ZN7A 1MX5A 3FTCA 1KVTA 4LYEA 4RH0A 5EMJA 4UOZA 4ZD6A 4M6WA 2XOXA 4U6NA 3LPDA 1UJNA 4BAZA 3PKJA 1KJ8A 1JW9B 4IJ5A 4R1TA 1ZJWA 3TIXB 4DA9A 3NDJA 2Y9PB 2ZYRA 1SVKA 3WK7A 4MEJA 4XGNA 4YRCA 3F6BX 3L0OA 4MPRA 3VO2A 2XWBF 4KMMA 3VJMA 4GECA 3AF2A 2HSZA 3DKIA 1VLHA 2WJYA 4YROA 3ZQJA 1MA3A 3S2FA 1SXJB 4D9KA 5GJCA 2XMSA 5EJ5A 3WNDA 3PGVA 4PICA 3KBOA 4QBTA 1YHYA 2O6HA 5FA8A 4NMHA 2R4TA 1JSCA 1DAIA 1G8FA 3RGWS 3PHJA 4GX2A 4QVKA 1XQVA 3QKWA 1L1RA 4OP3A 2B4YA 4UU1A 1LPSA 4TXLA 4UTNA 2R6AA 2B35A 4NYIQ 2FQQA 5DM1A 4BO8A 1CULC 1UDXA 3EXG1 1OZHA 4GH5A 4FBMA 2VA9A 5AKHA 3U49A 4LE2A 4BKUA 1T25A 3NHZA 3OSUA 2WVGA 4OHOA 4Y2PA 1S7EA 3IBTA 4RVUA 4DR1B 1NXQA 4M8KA 2GEDA 4GGOA 2K2WA 3GZNA 2X7XA 3PR3A 2YJ6A 3E9CA 2JFQA 4OIFA 1KE1A 4ESOA 3WB0A 5B57C 3C6MA 1XAGA 2BUCA 1LI7A 2R63A 2CNNA 3ZWQA 1VYVA 4GWLA 5M34A 4RY0A 4JA2A 5LQSA 1JDNA 3D43A 3PTAA 1G0OA 1YU9A 4BLWA 4MYTA 3IKMB 3DG9A 3ANXA 4ISBA 2VHEA 5BN3B 4CKBB 2NU6B 1JZQA 1V1MA 2OLKA 5K0FA 4LTNA 1JE0A 1ZDMA 3DZFA 1PJRA 3PDWA 4G41A 5FWYB 4I4LA 4Q34A 1BH2A 5ALKA 3ADCA 1CRZA 1T2FA 2NU8B 2VHCA 5SICE 2SICE 2YJTD 2I9KA 4JSYA 3G8BA 1R8QA 1O4VA 3DFIA 3UJHA 2A9PA 2QMEA 3K0HA 4ARSA 4AUEA 5FO0A 1L5QA 3DB1A 3UY4A 1WOYA 2FWRA 2P3SA 4WCDA 3N76A 3TSCA 5FQNA 3NXHA 4JJIA 2IDMA 3HA7A 1SAYA 1NIJA 4UHHA 5LMZA 2D7DA 1FA9A 2R8OA 4FCWA 2Z30A 5KSPA 2N0SA 1P9RA 1U7PA 4BQPA 1LQCA 1A2OA 3QFFA 2YASA 4RHEA 3CPEA 2WTUA 2II6A 4KL8S 4P7FA 5J2UB 1OX5A 3ZXYA 2WG2A 1E2FA 5JJLA 5K6AA 2Z2JA 4R2MA 1TMKA 7REQB 3LQRA 3IO5A 2REXB 2QAGC 5EI5A 1E9VA 3NANA 4JWKA 3EPPA 5ICMA 4ENPA 3P2KA 4HTAA 4O4HB 4BO5A 5G0VA 3VKWA 4BIMA 4Y9UA 4K6OA 5IXSA 4EMUA 4TVOA 1U3DA 1VSQA 2NSHA 4QJ4A 2EZ9A 4YVFA 5TRTA 1ZVQA 1WETA 1P2TA 5JAZA 2F7SA 5CEJA 1VGQA 4B33A 4BMYA 5GMOA 3UH0A 4EHDA 4U3JA 4IQ4A 5FTLA 1NUAA 1W4CA 3B6EA 1I2MA 1U9JA 4FR2A 1EUDB 2YIJA 2GYWA 2ZJ6A 3LECA 1QOZA 2NPFA 2Q1SA 1QC5A 3HADA 4ZYZA 2CYAA 5CVUA 3HJUA 4NZ9A 3OJFA 6GPBA 4KVFA 1AIPA 2XVAA 3H13A 3VDXA 3QQ5A 2JJQA 3A26A 1B8UA 4OQMA 4P4TA 3RUFA 1M74A 4A2PA 1EHIA 4BNHA 3VC3A 3ZE0B 1L8XA 3TSYA 2VTBB 2FB9A 1S3GA 1TGVA 5CA0F 3IOYA 1QZZA 3PQCA 2DFDA 3GEIA 5BQ3A 5TC4A 3AIKA 4NDWA 2W58A 4I9UA 2XADA 5M3BA 1X8XA 2FLKA 2VVTA 2FY8A 1T5BA 3GJZA 4RPLA 5SV2A 3HHPA 1TU0A 2PUFA 2GHIA 3ADBA 5EOVA 1N5IA 1X7WB 1CDZA 1O96B 1GT6A 1JXMA 2PT6A 3OFKA 2QM7A 3A3YA 3O8LA 5KX5A 1SZJG 4ZDIA 1EH5A 4L4YA 2BEUA 4K2AA 4IY1A 1V5GA 1EAMA 2F59A 1T0UA 3UYKA 4UHBA 2ZT8A 3O9VA 4FJ0A 3N2KA 1CZOA 2PNJA 1SMKA 4ENQA 3TRJA 4Y6QA 2FVXA 3JYOA 5C7YA 3LKDA 4ZI7A 1KGSA 1VA5A 3R24A 3FG9A 4PHFA 3JVDA 4XFDA 5A3JA 4L27A 2ARKA 2IZ7A 3CW9A 3PUJA 1P0IA 2FSVA 2MINB 3DXYA 2HPHA 4FS8A 4AU1A 2FSIA 2B20A 2Y1WA 3ITEA 1KO4A 2AFIE 3NTUA 3AESB 2ES4A 4B6PA 2ZR9A 5CG1A 2ODTX 4CL2A 3EISA 3NT2A 4KIFA 2ZIVB 4XYGA 3X1XA 1K88A 5AW8A 1V3VA 3C4QA 1NPYA 3KV3O 2RG7A 2PQ0A 1BSVA 1NVVR 4KJZA 5ALYA 1FFCA 4TQUS 1L7BA 3MRSA 3ZI7A 5JCJD 2FWAA 2J5QA 2P7HA 3SE0A 4EI7A 2QRJA 3FVRA 1H42A 9LDBA 4GU5A 1XKXA 1WDMA 5TF4A 2DWQA 3AVTA 3EMVA 2HW8A 1G21B 3G8DA 5B1YA 2PLRA 1USKA 2C88A 2VJMA 3LRTA 4HYQA 3JWEA 3H16A 1U7HA 2CFRA 3PNOA 1NE2A 1Y5IA 3DEZA 5JHHB 2PKXA 1HFKA 4YRZA 5EJ4A 3FY4A 4UD6A 3V1MA 3R6DA 5EMNA 1T3ZA 5DYGA 1C1YA 1RU3A 4DMRA 5DNVA 5DTRA 2P4EA 3WNZA 1QP7A 3V2HA 3WMXA 3HCEA 3LQYA 1V8DA 2OILA 3D1LA 2O6LA 4GO1A 5KYUA 5BMVB 1QE5A 3I5AA 2JARA 4YCJA 4GUAA 5IYZB 4P5DA 4EYGA 2ZSHA 1E32A 1ISJA 2O3TA 3P20A 5DHRA 1GYQA 2QZJA 4I4NA 4EECA 4EL0A 3K8ZA 4OI1A 5JBIA 4L02A 3KZ1E 4H7DA 4F1JA 5KSOA 1XCLA 2D00A 1PWXA 4B2LA 1P9NA 1GFIA 2HLHA 3MD9A 4DXDA 4KUHA 1M72A 1DBPA 3RS7A 2PFGA 3S68A 2AB0A 2CYBA 1EHYA 3C8ZA 3HJNA 3KWFA 4WXMA 2RK6A 2WLSA 1ZFNA 3F1KA 3OQVA 4YG4A 1PGOA 2OMKA 1A1SA 3QUSA 4FTWA 1J2JA 2B61A 2PWAA 1TB4A 2BHRA 4AS3A 5CXSA 4AUNA 1NBOA 2BBOA 4DQVA 5I3ZA 1QPZA 5KNCD 4MGKR 4MROA 5G0SA 2P0EA 3CVUA 3QPVA 2FWBA 1S2LA 3H0EA 5B53A 2XY4A 4FVTA 4E3ZA 1CUCA 1BFDA 1C9EA 2XDYA 2ZDGA 3EYWA 5AM1A 5ULLA 2SBTA 1NVEA 4HATA 5BSTA 3H9JA 5GWXA 3JQ8A 4B8WA 3DUFB 4HWGA 4OSOA 3UJ3X 5I7OA 1JLMA 2B30A 3ER9A 4F6CA 2NUAB 1D6SA 1R63A 3W77A 4MUKA 1W1WA 2QUKA 3EXEB 1ENYA 5EN4A 3F97A 5ELXA 4L78A 4TWAA 2PT9A 4OF4A 2AR7A 2QV0A 4Y1RA 1T8UA 1ATIA 2GK6A 2G9QA 2IHUA 2HO4A 3P27A 4BX0A 2AOTB 5B6IA 4LTDA 2CWDA 4JR1A 3VHXA 4AZVA 1DT5A 5D1HA 2B1QA 3OEYA 2VDUE 2VSFA 5I9LA 2YVLA 3Q3IA 1TA0A 1BX1A 1SR8A 3S7ZA 4JGGA 5F7OA 5EJEA 1V25A 2XNCA 2QZSA 1T5LA 1YI1A 3FWKA 1WOMA 3TTYA 4OQPA 1E6WA 1LX6A 2V9PA 4L16A 3VHLB 3MHTA 2N46A 1YR2A 2O2DA 2UZAA 2WYIA 3N87A 5LDDC 1N2JA 2B2CA 3LKBA 4NZZA 2QTLA 3H2YA 3LBIA 1E1RD 4LOLA 4DJTA 1A2BA 2PU5A 4YRDA 1QM5A 3ICEA 4PR3A 1NN3A 3F5SA 4PZLA 4RAOA 1S89A 3HVKA 5F77A 3VVBA 2XMZA 5AVWA 1O9BA 1SUEA 2PMDA 3L5KA 5KSWB 4S05A 1X7DA 5EVCA 2UYQA 4GWGA 3GWZA 1L5VA 4N8SA 2DLNA 2ID8A 5CG2A 2VJBA 5JNUA 1WP9A 4JBXA 3RTAA 1NI4B 4ML3A 3I0MA 1LDMA 3MWDB 2GZDA 3UB2A 4EHFA 1MOPA 4I66A 5BSEA 1CZUA 3GFBA 3VPXA 1N6RA 1OQAA 3E4DA 3E9NA 1GDDA 3EIQA 3IT3A 3MTEA 4LWQA 4ZXPA 4IKEA 3T5CA 3EDOA 1UK8A 4GEKA 2PKQP 2OM2A 3RJTA 1N75A 2WVJA 3DTNA 4CKWB 4EMBA 1OXSC 2H9YA 4HXEB 3B1WA 1BXZA 1Q7TA 1TMGE 1V16B 1Y9ZA 2ZVJA 5KWSA 2AEFA 4WZ6A 3K6JA 3BQMB 4GW3A 1D9ZA 5EE0A 1AKNA 4FFMA 3ZX5A 1ZXXA 2IYOA 4IH4A 1MW9X 1QFMA 3TS1A 1IFXA 1USWA 2W6CX 3AEUA 3D4PA 3HZRA 3KOWA 4QDTA 5EIBC 3PE5A 1T0HB 4JROA 2ZLBA 3QFRA 3L07A 4FYIA 2OQ2A 4K9KA 5FUMA 4WN9A 4Z4HA 2YWHA 3SX0A 1PR5A 2Q07A 4M0EA 3TEFA 2QN8A 5GM2A 2IZ1A 3IYLW 1O94C 3U3XA 2W22A 1E6EA 4J94A 2PMEA 4GXQA 3E7PA 2A33A 1JMKC 1GT91 2FF5A 3BWCA 3CRVA 4MLZA 5AJWA 3CRQA 4D4JA 1CJUC 3P0IA 1GUFA 2FOLA 3BTSA 3OEHD 5HOEA 1C5KA 2DE0X 2FWIA 2I1VB 3CY6A 1NBMD 3O82A 3R7BA 1VKJA 1MB2A 2R1ZA 1KMIY 3EIOA 3KYDA 3LLCA 4J1TC 4RHFA 1RC8A 4RE6A 2LKCA 1MA0A 3WRVA 2ZYGA 1JG1A 3X43A 4JLNA 2AUTA 1ULAA 4KQXA 4L4ZA 2O4AA 2FPGB 4ETMA 2I2CA 2WWYA 5CCBA 1T4DA 1Z4KA 3VUEA 1BMFA 1HPLA 3EOZA 2NO5A 1U9IC 1Y8QA 4IIEA 4AWBA 5JRZA 4KPUB 5K0EA 1F2TB 4TMYA 3T1OA 3Q8KA 5J59A 4MITA 4ZOQI 3CISA 2VZ8A 1CIVA 3NEPX 4MZDA 4TSFA 1LTQA 2H29A 2JJ2D 4EG4A 3AINA 4M49A 4PVDA 1F48A 4DYVA 4RTQA 2VQEB 1RM3A 4B32A 1VG1A 3NPMA 3D6FA 4KMRA 4C0AC 4EW1A 2AFHE 1TRHA 4KPFC 3DMNA 3NP9A 4LW8A 4QJ3A 3AEZA 1IEQA 1E7SA 2NSYA 3EGWA 4HQ0A 4UHFA 3AWDA 4HZUB 1EX1A 2HBQA 3PICA 5DNDA 2YZ7A 4AYWA 4ZCLA 1P2GA 5DWVA 2BFOA 2PGIA 3WWZA 4RTOA 4WOBA 1UBRS 3L1PA 2G5GX 1QZUA 3L6OO 4WOJA 4DYHA 2ZDQA 4RHUA 4G0OA 5AHWA 3ZG6A 4E13A 2HCSA 3TL6A 1YB4A 5LOVA 3IEVA 5U9CA 2C98A 4QEZA 2FJUA 2R97A 3D3WA 3IDQA 4AQDA 1B00A 4X0EA 1YTLA 4EQ6A 2XA1A 2C9YA 2V96A 3PRYA 3C7DB 1MMFB 3OZRA 3VK0A 4LWZA 1IY1A 2G67A 1F2VA 4EY7A 2WQ6A 1MD9A 4K87A 2GCPA 3B7HA 2RC6A 5KTSA 1ILWA 1VBMA 5AP9A 2QGZA 3ZD6A 3MIIA 1JDZA 2AA3A 1UBUS 3HB4X 1SK9A 2W2LA 1C7FA 2DFNA 2NUBA 4UEJA 4OGKA 3H2BA 2VDPB 1HG0A 2A0YA 4HVAA 4L76A 3HR4A 4OFZA 4ZVTA 3HYNA 4NNPA 1GG9A 1TZCA 2B92A 4EQ6B 3BWEA 1YOVA 4A36A 1IPFA 1CRLA 4BWFB 1NLYA 3PDUA 3AVYA 3HZZA 1Z83A 1KQGA 1CB7A 1RPEL 3CCFA 2AD1A 1ZUNB 3VYWA 1KOGA 2DWUA 3AF1A 3HYTA 3HCRA 3RTDA 2TMGA 2XB4A 4UBIA 3VR3D 4CKXA 1Z4JA 5EHXA 5DGIA 3NGLA 3QRWA 4TZKA 5DCLA 2AN9A 2C7GA 1SQ8A 1GQOA 1T1GA 5KTPA 3K8OE 1U9YA 2PY6A 4OJKA 1ZD9A 1NSFA 1T15A 4WA8A 5IM4F 1BJTA 3L06A 1T2CA 2FX2A 1EFKA 5IDXA 3K31A 5HZGA 1P91A 4BJ6A 1N2IA 5KNLA 1LK7A 4C4SA 1WXWA 2IKSA 5D2CA 3TAUA 5JV5A 1T4GA 2AOWA 3NOVA 1NLUA 2GKGA 5JBNA 3CHYA 3Q10A 4EI9A 3ONWA 2IDZA 2JJ1A 4RDCA 5IAKA 3E35A 1EJ0A 1ZK0A 2ECQA 3FNFA 3JXDL 2F17A 3A28A 5BOVA 4GD3Q 1TCAA 5A7GA 2DWPA 3WWCA 1EGMB 2WTEA 1HE8B 2FE4A 1U8XX 3ANLA 3MBKA 2F64A 4J2TA 4CW7A 2QTCA 4TTJA 3WNCA 3G17A 4D8VA 4PQRA 4G2NA 4RELA 4J6EA 3KPYA 5LBIA 5K6AC 3AILA 4RJJA 3RVSA 1CY4A 3KSZO 1PTJC 1LCDA 1XVIA 2D2EA 5EUMA 4Q9LA 4CM5A 3AI7A 1G5HA 3SQDA 1IVSA 1JSXA 4J3NA 3MWJA 4GBMA 4I99A 4REQA 4TV8A 5AXAA 3DFZA 3Q7RA 5ECYA 4FS3A 4V3BA 4FKBA 5CHEA 4P80A 5U1PA 1V7PC 4PYKA 1U4NA 3EXIB 4FMDF 1YGYA 2QR5A 1YJQA 5KDLA 1V9SA 2YJ3A 1KDYA 2IYXA 1SBTA 3HN7A 4RZSA 3W2GA 4LFAB 1J1UA 3EWSA 4R71A 5AOVA 3VI4B 1PEAA 3L7MA 1A9OA 3I23A 4R8KA 4EY8A 4WZAB 1AV6A 1YQGA 4X4IA 1EU1A 1BHO1 4HDMB 3C4VA 3IB6A 1DXQA 4J7XA 5DI3B 1BMTA 4TWBA 3NKFA 3MEJA 1E99A 4FOOA 4E14A 1LLDA 4LJ4A 3VOBA 3HXOA 3EX7C 3LUDA 1OI2A 1T3GA 3ODGA 5JAIA 2ICTA 4DM4A 2NVBA 4RZ2A 4ZEWA 5TJHA 1SH7A 1JHXA 4KXXA 1AZWA 2FPMA 1XAJA 1AGXA 3OLQA 4TOIA 4QLAA 2PKQO 4QPNA 1JQAA 1Q7EA 4Y2XA 3EC7A 1FJXA 4X6UA 5JSZB 1SXJA 3KO8A 3X1KA 4XRGA 2OBBA 4HS4A 1K89A 3S81A 4L5IA 4GP7A 1X0XA 4F4IA 2QN2A 2FRVA 2HK6A 1KETA 1NF2A 4ALIA 1DJNA 1L6IA 4PRZA 2O1SA 1E7QA 3ONDA 5EPEA 1T5OA 4BMSA 4F1WA 1QS0A 1QDLB 3CLCA 4AG5A 4X9XA 5JPIA 5DLQC 4X1KA 3TUJC 2GCOB 8LDHA 3QX3A 1XV5A 1KO1A 5H02A 3WRWA 2QX4A 1MOZA 2EG5A 3UJBA 3FNGA 4CQMB 2NG1A 3ZTYA 1R6DA 4HRAA 1JFTA 4CRWB 5ALVA 2XNHA 1Y98A 4YJFB 2BCEA 4J75A 3RBZA 5A9SB 4I9GA 1SUWA 3D81A 1E4VA 3KQPA 3UAGA 4DIOA 3LUJA 3PQDA 5ECGC 3GRVA 2A5LA 3QXGA 3DXFA 1C0KA 1BTOA 1BE1A 5DBIA 4D0SA 2XB6A 2FPXA 4MAAA 2RJ3A 4AXXA 2BKXA 3EY9A 1ZD5A 5DSTA 4YUAA 1V5EA 1CEEA 4AKHA 1G8PA 3KALA 4EEZA 1F8FA 3DE4X 5CT5A 4RPGA 1E1DA 3RABA 3KQSA 3PKZA 2AFIB 3IIIA 4G5SA 4UUNA 1GU7A 2V74B 1YS4A 2NACA 2QMQA 4IW3B 4F5ZA 4NAUA 3C5EA 2WILA 1MZPA 4XWWA 1TT7A 1Z0SA 5JWRA 4IJ6A 3EA0A 3ORYA 2BMAA 4QJIA 3VZSA 1UKEA 4F8EA 1X8JA 1SC1A 1HTTA 2C94A 1N1GA 2IVFA 2HDNB 2X8JA 3BMOB 3D6UA 3L1VA 4JSTA 1I8TA 4HPXB 4QWMA 2DXIA 1EB9A 4CHGA 1QHSA 1XRMA 3GJXC 2R68A 3MJHA 4JVLA 5I9TA 1XEWX 1GZSA 2PX0A 2HSGA 2ESRA 1NIPA 4MA4A 3ZDDA 3I6BA 1HTBA 5FFFA 3I1YA 5ALSA 4ZT5A 1U9IA 5EP2A 3ESAA 4RMGA 4FBGA 3QXSA 3AKZA 4YG7B 2H0AA 3L0BA 5ITVA 2KPOA 3L82B 1FTGA 3VJRA 3C85A 4KWEA 1W85A 3JWPA 1C4XA 4QLBA 2K87A 3T95A 4HEQA 2F8SA 2VAXA 3AF5A 3NRJA 1XAHA 3GLRA 2LE0A 3K1YA 5JJIA 1BDBA 1XZEA 1VHJA 1NF8A 2QVXX 2RGYA 1JVBA 1BDJA 2PXHA 1UPBA 3ACCA 1EK1A 5K6RA 3K0KA 4QVIA 3K1JA 2XMCA 3EMBA 4G01B 2XHZA 2ZJZA 2PS1A 4HN2A 5L51A 3SBOA 2Z2KA 3FA2A 2AOVA 1LLIA 5THKA 5KJCA 4EW6A 4CKEA 2X8LA 1OBFO 4F96A 3C5VA 3LUPA 3OPYB 3FUXA 4O2AF 1HTWA 3GOQA 3SN6A 4EGQA 2PL9A 4GVXA 4WZAE 3PDHA 5FWXB 2VL7A 2ZTHA 3AKDA 2JBHA 2DHRA 1I7LA 1S4QA 3KZCA 4E1BA 4UQLA 2OK8A 5HKBA 4D4KA 4GAEA 5JSKA 4A26A 4U7TB 3UV6A 1QQ6A 1UXIA 2FU5C 2HGZA 1TUBB 2DJIA 2PXLA 5KJEA 4I4IA 3CR3C 4IZIA 1KOLA 2V9ZA 4CI0B 4D9JA 3HH8A 2JK0A 3PHLA 2H4FA 3COPA 2JCXA 4MRRA 1G3UA 1BIFA 2G04A 2J4DA 1B6TA 1UP4A 4QL3A 3AOEC 1T34A 3HVRA 2XCLA 3I5MA 4JR0A 2OGUA 5CFMA 2QTAA 5LZ5A 2B5AA 4MK4A 1OYYA 4XASA 4QYXA 3NWBA 2YV1A 1RAHA 1RYNA 3BGOS 1VGVA 3GA5A 4IGFA 1ACJA 3NC4A 4N5LA 4HDSB 3SD7A 2LD4A 4ALLA 1ITZA 3EFEA 5KNDH 5ISMA 3E81A 4UVEA 2AX3A 3FN4A 2R6FA 4V0QA 3SFZA 4BU0A 1LKZA 1C1HA 2PPXA 4RIIA 1NMYA 3FPLA 4OB6A 3I58A 4UAVA 4MV1A 3JQ9C 3LHDA 4NENA 1JTFA 1OFTA 1VLVA 1CQXA 3RVPA 5BNWA 3A14A 4E5VA 4L95C 4RFSA 1PWEA 3W5VA 1X2LA 1Q0HA 2O1WA 1JLLA 3PSHA 4KRYA 4UXIA 4V03A 3T1VA 4JXJA 4KOEC 3DZIA 1H93A 1OC2A 1EQAA 4HGQA 3WLAA 4BBPA 2QVZX 4AB1A 5HQ3A 3BSYA 3HVUA 1NU6A 3DNMA 1OUMA 2ZFUA 3ICVA 1OI3A 4NONA 5ICCA 3KPWA 3EBLA 3ZBTA 1TKCA 4OXNA 1EGHA 3JVEA 1XVUA 2DUJA 2GDZA 4X7RA 5HILA 3WYAA 1E2IA 3RUHA 5CLFA 5KX5B 3PNVA 4NBWA 1LD3A 1ZW6A 1RACA 3FI9A 3QVKA 4ETIA 2ZKLA 3KL2A 1K92A 3ND9A 3TIIA 3LUBA 2BM8A 3VHRA 4BVKA 2Q50A 4GM4A 4TRRA 2X19A 4EA8A 2SCUA 1Y7HA 5G0UA 3LVFO 3T3MB 1OLXB 1SUDA 2VPZA 3EBOA 1O8CA 4KIJA 2W43A 3ZLVA 2XXPA 5AKLA 3PA8A 4NWIA 4GXNA 1SOWA 5E4FA 2HUPA 2EG9A 1VL8A 4XD2A 2JAQA 4F2PA 2GXUA 4LCJA 1UC4B 2C83A 2RIRA 1VGRA 1XZJA 3BHMA 4UC0A 1Q0LA 3N1UA 1APBA 2VJCA 2JGIA 1KTIA 1MB9A 1EUQA 4U8GA 3HBNA 3W2IA 4FX2A 3S1AB 4JQZA 4EAQA 2AMFA 3OP9A 1YD7A 3TMKA 2BGWA 2X0NA 1RQNA 5SZKB 4B84A 5MN5A 4LC1A 4BO2A 4F04A 4JLWA 2F1JA 1KDRA 2QX6A 3OCZA 4YLGA 5LP6F 1EM8B 4I4TA 2QJFA 3E58A 3JR3A 2Q0HA 1NVDA 1IVYA 1U0RA 1VLQA 1E7WA 1W1IA 3B5EA 2BC9A 1UTXA 3K1AB 2Y2UA 1HETA 1QH0A 4KQFA 3AUAA 1NQTA 4MRVA 4IYRA 5J9FA 2F67A 1KQFA 1UQTA 4L08A 4UTOA 3I2IA 1ADRA 2X5JO 3KEFA 5EPUA 3QHAA 2MINA 3SZLA 5EZ6B 3GJ7A 5C1DA 4US1R 2X9NA 3COZA 4M76B 3P52A 3KETA 5PNTA 3LHFA 3OQIA 4KQJA 2AUNA 5JZOA 3AZQA 2VUHB 3G88A 4MICA 4ED9A 3X2EA 2VRCD 2X4IA 2VJLA 1DAHA 2GBLC 4JJAA 4Z1MA 2HI0A 1H2FA 1KI6A 4Q7LA 5JZBA 1ULUA 3Q7TA 5KTRA 4CZ2A 2C2HA 2D5BA 2GDJA 3RVJA 1E2DA 1U6IA 1U6KA 4UZFA 1BEUB 5KOIA 4RFSB 5DNCA 1NXXA 2HNAA 2O8BA 3A05A 4F71A 3EULA 5I7RA 3V8QA 1YNOA 5FP0A 1J0XO 3UA3A 3HM9A 3LXXA 1BO6A 4E21A 4W63A 1O89A 1E6CA 3AR2A 1RZUA 1DELA 2A9VA 3M0EA 2ZTVA 4K05A 4LAFA 4C07A 2CXQA 3QU5A 4JGBA 1C7IA 4DMUB 2A8YA 4MKFA 3JS5A 3GJRA 3O8OB 3PUKA 2J7UA 5A4AA 1PIWA 5H4GA 1N9GA 1VE6A 3NTQA 5A05A 1HNWB 2OWDA 4P08A 2MEZA 2VQ6A 4DWOA 2IV1A 4HOYA 1UWKA 3UUFA 1IZ7A 4RF5A 1GSOA 1WMBA 2JH3A 3SIXA 3T15A 4L8VA 1UBJS 3BWXA 4NTZA 4B6OA 1XD8A 2G0AA 2WBLC 2WNIA 4O0LA 4QDKA 1ZM4A 1HL3A 2W6NA 5I9MA 4TUYA 3RVRA 4DV3B 4H7HA 2XRMA 4QTTB 5B2ZA 3SCFA 1TVEA 3LQ1A 3MWGA 1JJBA 2G63A 2I1LA 5IKEA 2V3CC 4JJKA 3ZQKA 1ULBA 2WMOB 3EF0A 3GI1A 4U9UA 3TN7A 1B0PA 3AY7A 4L73A 4HCJA 3PD1A 3QPUA 4DBLE 3DVRX 3N2ZB 5HJ2A 1OBCA 2UVDA 2WR8A 2R47A 5H3LA 3IE0A 4J0IA 4TTPA 2JAPA 4RFVA 4PCUA 2WHYA 1YHNA 2AKAB 5E9QA 5I7WA 1XEAA 3EGVA 1J7JA 4ZDJA 4PYOA 4IWXA 2YXBA 2H1HA 4ROSA 1MU0A 4NBTA 5AJYA 4C4AA 4C4RA 1QX3A 2QUIA 4QRHA 1TFUA 3BL5A 4DKXA 5LU9A 3E2MA 4LMAA 2XCJA 1WEKA 2BM9A 2ZAMA 3N2NA 5EJIA 5C4IA 3FB1A 1MOQA 1IUOA 1M1YE 5DHTA 5BN5B 4ZQCB 3OI7A 4BO0A 4DRXA 3BMCA 2PZ8A 2AN3A 2YWEA 3R5KA 2PIJA 1AF7A 4GXRA 1H2EA 2CHFA 3LQ4A 1F4VA 2OP1A 4MUJA 4JP8A 2BR4A 4ARZB 3UMCA 2NO0A 2P4QA 1EK6A 2VXCA 1OFGA 3QVVA 4FQ8A 4UTXA 2XWJI 3TI9A 1DRKA 4NC9A 3FCUB 5B3KA 4NESA 3CF2A 3F6PA 3I04M 2COKA 3P0JA 1FSFA 4KLCA 2R7KA 4NU0A 1N2ZA 3PHGA 3GB9A 4L5CA 4L75A 4DLKA 1GRNA 4Q37A 3MT7A 2WIAA 3BMCB 1VIYA 2DAPA 3OKPA 3F90A 4TKZA 1WCWA 4L6CA 1M7GA 4FD2A 3IOMA 5DB4A 3DW1X 3OBIA 2ZWIA 4GOXA 4RADA 1HSOA 1MG5A 1SO8A 2IUSA 4L2IA 2DPMA 3S6JA 5CVTA 5EXSA 2R86A 2B8EA 2BVNA 4OLAA 3LX4A 4EJSC 5GPBA 4UREA 1Z3CA 1MZVA 1N5JA 2YXDA 2CT8A 4IMJB 4JEUA 1ZISA 3IKVA 4PZ9A 4C0SA 1B6RA 3SS8A 1V35A 5CURA 1R9GA 2GN6A 4CM4B 4Y6GB 2OCDA 3IAM6 4PW0A 1H8HD 2ZETA 3DBHA 4R2WA 1BQ3A 2F3TA 3BXZA 1N7GA 3E48A 5AJTA 4JJFA 4BNMA 4Y6LA 1HDYA 1R2QA 5AVOA 4AN4A 2QM0A 3I6YA 2G06A 1VSBA 2D2VA 2NXNA 4RBNA 4DDUA 2O3QA 5LQKA 4UTPA 1UDBA 4TUYB 5HBGA 4JVOA 3SC2B 3ZIDA 1ZGZA 5AXBA 2ZYTX 2B7BA 1ZM7A 2UU9B 4NK5A 4L0CA 2C7OA 4ZJYA 5D5HA 3M6WA 2OSBA 3H1BA 5ALNA 2XSZD 4RVHA 3D8RA 3TTTA 3V1YA 3PSAA 3WDKA 2QSYA 3OIDA 3BJEA 4NFSA 1Y6JA 2C9CA 1E60A 3EQ6A 3RYIA 5LXTA 1TM4E 1AUOA 1JSLA 1WR8A 2IBMA 1XXHA 4FZVA 1QFZA 4LRUA 4C6TA 3KXPA 4XAQA 2DKOA 4OHWA 4BP9A 1IN1A 3T0GA 1PHPA 3K92A 4EMSA 3GEBA 4GMHA 1CZKA 1J56A 4EKGA 2R5WA 1J2RA 1DC3A 1QVAA 4ZAXA 4U00A 5FHQA 2QRGA 5TGTA 5JJBA 5JVDB 3PLAE 3IXMA 3V9AA 3U39A 4CTKA 2NP6A 3U3JA 3Q9NA 2ZK7A 3HB5X 2NSDA 1EBFA 3EXHA 3Q3GE 4UU8A 4E4RA 3L0PA 4B47A 4IH9A 3ST7A 2XV1A 2EEZA 1OJ7A 3JWIA 1TLTA 1E7YA 3G2NA 5IKMA 1G291 4TTAA 3UEOA 1H6DA 3MMNA 2O20A 1QB8A 4P54A 3BD8A 3G0CA 5F1PA 1MV5A 3DHEA 3VKVA 3MAJA 4BBZA 4E51A 4QTXA 2OBNA 2I1WA 3B2QA 5KEIA 3JU3A 1F6WA 1RRPA 1RXEA 2BMEA 3QFHA 2O2SA 5AVTA 1PEDA 4RXTA 4ZIRA 3KPVA 4CMEA 2D0PB 2O38A 4K9OA 5LUBA 1Q6YA 2VT7A 2QTTA 3N0XA 1HEUA 3RG8A 3ZY4A 4A2WA 2IPNA 2RAUA 1UZAA 2H5JA 3IHKA 5HBRA 5LLDA 4IAOA 2BYTA 2JFVA 4QODA 1BJKA 1TT5B 2VP3A 2Q5IA 5FTNA 4B3TB 3KKPA 5JS1A 2ICPA 2OTCA 4MPPA 5CH3A 1SKBA 5EXTA 4OO3A 1L6RA 3HNRA 3M83A 4O4IA 4KXFB 1PG5A 4UAJA 4RORA 5CTJA 4A0GA 2FG6C 3ZPXA 4ND5A 1TPZA 5K1ZA 3D5EA 3SLGA 3Q5GA 5CFPA 1G55A 1NX6A 5JD5A 4Q82A 4A23A 4XSHA 1CUDA 1JZTA 3C3MA 3LK7A 2FV8A 4CIVA 4WNIA 1R8SA 4O4HA 3D7RA 1E3JA 4IIBA 4PAMA 5BQOA 1T9KA 2WJPA 3PC3A 1M5UA 4LOHA 4XM0A 1F20A 2MYNA 4FGWA 1CY6A 5CVCA 13PKA 1EFTA 1Q3HA 1V5FA 4C01A 5KDOA 3R8FA 4NCXA 2H4JA 3M4NA 2F90A 1T5DX 4KUEA 4B75A 3DAFA 2EX0A 2JL1A 3NQ41 1II9A 5LQUA 1F51E 1ZLYA 3FHOA 1CUVA 1GKIA 2FWMX 2PTGA 3BFPA 4ZA2A 5IVIA 1R6AA 2FGKA 2XGOA 4A0QA 5LD2C 2PMBA 1MQ8B 1OWMA 3GVIA 1QANA 1PE0A 1GNQA 1AZSC 1JFFA 3IP9A 5EQFA 1IBLB 4M7OA 4BDSA 5F7ZA 1NKVA 6ABPA 5CW1A 2PS9A 2Q0SA 3ITKA 1K66A 4NZPA 1CJCA 3PFGA 4MYUA 4MI9A 1XMOB 1KVQA 3GPLA 5BRNA 4RK4A 4Z0TA 3TX6A 4Z4FA 2GTIA 3RRJA 3T3HA 2WIDA 5L3QB 1D03A 4YJ3B 1WMSA 2A9OA 4KNVA 1IZZA 3RSGA 5TMPA 1A27A 5BVGA 4QUJA 3OD1A 2D5CA 3BXHA 4YQYA 5AOCA 1DL5A 1T5SA 4ENRA 1E92A 3BMNB 4MH0R 4G0PA 1KEEA 2WQ7A 4M1YA 3MGGA 2VEDA 4LF7B 1S1MA 1QORA 5J2UF 2AK2A 4AG3A 1VZ2A 2QF7A 1T6YA 3PHHA 2XQGA 2A2ZA 3FTQA 1HQ1A 2HJVA 4NLLA 4QTUB 4TQAA 2ODEA 3C39A 1K0FA 3OF2A 4XD7A 1LLQA 1QZTA 1USVA 1YRWA 3C14C 2YYZA 4RKWA 2RHCA 4MVJE 1K6MA 3TZHA 4D3DA 4HFNA 2QOEA 4TLBA 3Q3CA 1KF0A 4B71A 2J3QA 2RJNA 1AZLA 3OP1A 2IF2A 2NXWA 4F2HA 5K8CA 4N3GA 3SP1A 2CLFB 4X4FA 1YDGA 1Z2AA 1Z75A 1C0IA 4HVCA 3QBTA 4F4FA 3E8MA 2GPWA 2VKQA 4OAPA 2VHWA 1WQ3A 5G2OA 3REQB 2FZ4A 1U0SY 2QXTA 2O8CA 5IFKA 2G8LA 1H1TA 2IDJA 4JI2B 3THYA 1Z0AA 2REBA 3E27A 1Y48E 1Z4LA 3F4BA 2HA7A 4XWKA 4ZOBA 2GHRA 4GF5A 1Z4QA 1PFWA 1R88A 5EESA 3MMPA 5IN4A 1IXYA 2W2NA 2O8FB 4W5NA 4LJ7A 4TSRA 5A3VA 2FSVC 3T3DA 3GRFA 4IOLA 2R6CA 2XIQA 3L0CA 3C1OA 1T8SA 2W6PA 4PLCA 3RPEA 3W9YA 4DDMA 1QIIA 4BFUA 5CLIA 3SAJA 1AS0A 1FFGA 1YK1A 1K7SN 4KPUA 2QVBA 3IALA 2AN1A 2EBFX 3VSDA 1N2HA 3VA7A 4ZCQA 2BEJA 1CUYA 3IBCA 3A0RB 4WGFA 1AM4D 1XJCA 1KIFA 3AR8A 2UUAB 2QYHA 1J7KA 2O8VA 4LRXA 3W6OA 1W35A 4Z9AA 4B7AA 1QB2A 1MJ5A 1Z6QA 3EDYA 4BNXA 2FW0A 1T6ZA 4M46A 3AERB 1CVIA 2JGFA 2ZUSA 3RQIA 3IBFA 1VDMA 2FW1A 2RBGA 5LU8A 4BB6A 3VZRA 4TVSA 4MIYA 5FLYA 2ATVA 4L57A 1UFRA 1UMCA 3L8DA 4XDGA 4AY3A 3FETA 1U65A 2B0JA 1ZZ7A 2JBWA 1E64A 2RHMA 2Y3IA 4WZZA 5AI0A 3LAWA 4HUJA 2PXTA 2R1UA 4DC0A 1A2KC 1DXHA 1G8JA 2D1RA 3KTAA 1YVUA 2CDRA 2HY7A 4PBRA 4UFPA 3D1NI 1B1AA 1KTVA 3GBVA 1XOIA 1KJYA 3H99A 3OT5A 4YUWA 4CIBA 2TS1A 4MLDA 1YE5A 1KC3A 2EZ8A 5A6SB 4X8OA 4MJ3A 2A0KA 2IW3A 3GEHA 5FA5A 2W70A 1KY3A 5IVKA 4IDAA 2JIQA 1H1LA 2DETA 4EEXA 1NJ8A 3PGKA 5LYYA 3EHDA 4HJXA 1O4XA 2PGOA 2CY0A 2FZVA 4H6PA 3MJFA 3P7MA 5TX7A 4H1UA 2GO1A 3ITDA 4HWRA 1WXHA 4INJA 4TL7A 1I6LA 5L40A 1PRVA 4O2AB 2V65A 1ZMXA 4DB4A 1DPFA 3WY9A 1N2OA 1HGXA 2FPWA 3GAFA 1VKRA 4CR6A 4NH4A 2BJCA 1VJ1A 3CZPA 1CX9B 3Q15C 3LC7O 5M5BA 3K32A 1CR1A 1WPQA 4UNSA 1GQ2A 1Y8RA 1U99A 3B70A 4FLFA 4HNAB 4LBYA 2CNBA 3L7DA 1B15A 2IYRA 1WXXA 2PXAA 5BY2A 1GZ7A 3DPUA 1GCGA 2BFPA 3PYXA 5DHQA 4BEWA 2Q3EA 4XB6B 5KJ1A 4NJOA 2JLAA 2XUZA 4CM6A 1JR3A 3RUDA 1A9SA 4J2OA 3QWGA 3DO8A 1PUJA 1UK6A 1PJQA 1QKIA 3Q6NA 4P3OA 4N01A 1BW9B 4QGBA 1ISFA 1K3FA 1G2IA 3RYIB 3WNQA 4KO2S 3D7NA 4FNGA 1E66A 4C5AA 4CUKA 1E7RA 2H1VA 4WA7A 1F2UA 2I80A 3G0IA 4HF7A 4W7IA 3WLLA 5JLAA 3MYYA 4Z51A 2BSXA 2XUGA 3EUFA 4NYMR 2Y99A 2IU0A 3U7FB 3FOCA 4TKMA 5JJ5A 1QO9A 4EQZA 3GLHA 2IVGA 3RLIA 3MTJA 4RVDA 3N8KA 3EAFA 1BE8A 3GCGA 4GXTA 1E5LA 1CRWG 3D3QA 4NJEA 3VYSB 1XNJA 3I73A 1PZXA 3RS0A 2PUBA 3TLGA 4G4GA 4BRWA 4MR9B 1ZX1A 3OOYA 2XQIA 3F49S 4OJNA 6CHYA 2VNSA 1DKMA 5FPYA 3D3NA 1ARZA 4F92B 3W4KA 3CZCA 4UHKA 5HF9A 1UOEA 1DKQA 1JXQA 5CH8A 2WWRA 5HKOA 1GZHB 1AU9A 1FNBA 3KELA 5DP2A 3O9MA 3DBRA 3EFOA 4CF4A 2V59A 4D9EA 1XDWA 1MIOA 3GN5A 2ECOA 3AJRA 2X3FA 3IJEB 3BUSA 3HKBB 2YHUA 5KOJB 3WAKA 1K86A 2E21A 2F1OA 2JFWA 2EKZA 5CXQA 3FOBA 4JUFA 4JI5B 3D7KA 2BZGA 3NIGB 4RF4A 4BYMA 1PWYE 1NC1A 2V6JA 1A5ZA 4PU8A 5G1NA 5FV7A 4EWLA 2FUG6 2FFQA 3RDPA 4G5HA 1M8GA 3VYRB 5J4VA 1YU6A 4BV8A 1M6VB 4I08A 3TMYA 4AF6A 3GBPA 4J1XA 1EXNA 3IA2A 1LRJA 4O2LA 2BH9A 2CNWA 4CEJB 3FD8A 3BGSA 1H9BA 2IH4A 3VMFA 1HKHA 5KHOC 3W79A 3A9CA 3LT2A 4R84A 1LPBB 2Y4OA 2HHAA 3E3MA 3LVBA 3UUGA 1Z2OX 2G1UA 4YXFA 5JMTA 1NJ6A 4TTQA 5AKZA 1QBKC 1T3SA 1EE2A 2B1JA 5CD9A 2C7PA 1VG8A 1ZH2A 2HIAA 3OKAA 4D3FA 4O3MA 4F3TA 3LTNC 3RIHA 1CSEE 3SF8A 1XWIA 3ZIUA 3D6VA 1U1FA 1ONSA 4E0BA 4B6GA 4DV7B 3GLQA 1DQPA 4UBNA 2XIUA 1KIMA 1NATA 1V0JA 1E89A 3FWHA 1Y1LA 4EENA 4F12A 3BZBA 3HPQA 5JYBA 3SWWA 3HKEB 3NNNA 3GP5A 5LC1A 2YS6A 1EXDA 2E1PA 5KHLB 3WGNA 5IYZA 1G63A 1FU8A 5ENZA 1BS2A 4QRIA 3ZHOA 2FOIA 4R6WA 3ADOA 4H15A 4BV3A 4FE4A 3IAEA 4AMBA 3MAAC 4URZR 2FMKA 4E2ZA 1Y6ZA 3MQ2A 4B3BA 3F2VA 5LZ8A 3TX2A 1SZCA 4BEVA 5L3SA 5CVDA 1DADA 4I36A 1UFOA 2HA0A 4H4DA 2VUSA 1UIRA 4PIMA 4XCVA 4Q7MB 4WI1A 1U0JA 1YR9A 2BBSA 4UFNA 1ADJA 1ZPDA 5IT5A 3D3KA 3CMMA 3O1IC 1E2JA 3MMXA 1OI4A 5AW2A 4MMXB 1M5TA 3SC4A 3HXMA 1C7ZA 1L4BA 2F1HA 1QF6A 3Q9LA 2Z0MA 1NRXA 2RKWA 3FFWA 5HQTA 3AJ9A 2BGKA 3EQ2A 3N2GB 4G1CA 2VDVE 5DH9A 1GCOA 1MVLA 4QQNA 1I4OA 3EDCA 2IU6A 4V2UA 3P71T 1MNQA 8GPBA 1OCTC 4AI6A 4ZEOA 5DEIA 2JGKA 4OHRA 1ESCA 5AHXA 3FPJA 4HAYA 4DLNA 1X80B 3HO1A 5A7LA 2Y71A 3ETCA 3MA0A 4JOBA 4IXWA 1ZK3A 2X4DA 3AFIA 4RGQA 4EB6B 5KUTA 2RH4A 1XK7A 3AEKB 1V41E 1X8KA 5KQGA 1P3DA 4ZJZA 1KIAA 3OH8A 1QJ4A 2GN4A 1U4SA 1CJKC 1RQ2A 3N0WA 1AN0A 1DEKA 1ORDA 4N47A 1P8AA 4QUIA 1LFDB 2C2GA 5L3ZA 1KJWA 2PBRA 5HOQA 3PD0A 4D2IA 3O8NA 4F3KA 1WSWA 3KJIA 3KXLA 2OD7A 2D8MA 4MNTA 2AKYA 2XOKD 3H4MA 5EE3A 3K15A 1V4VA 3U7EB 3U6BA 1NVUQ 1R0CA 5E6RB 3AGQA 4I6GA 3AV3A 5FOTA 1CLUA 5KS2A 1ZR2A 3DLIA 3OLWA 1VTKA 2TRSB 3KP1A 1EFPB 1K75A 4HGPA 5L3RA 4MO2A 2Y4NA 3BS4A 3WBKA 1TTPB 4Y0AA 2OAP1 1FRVA 4LJ8A 1KS9A 1Z18A 3HPRA 5G1OA 3UOWA 3ZHSA 3L4JA 1KP2A