1JH9A

Purine repressor mutant-hypoxanthine-purf operator complex
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
339
structure length
339
Chain Sequence
b'ATIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAAYFAEIIEAVEKNCFQKGYTLILGNAWNNLEKQRAYLSMMAQKRVDGLLVMCSEYPEPLLAMLEEYRHIPMVVMDRGEAKADFTDAVIDNAFEGGYMAGRYLIERGHREIGVIPGPLERNTGAGRLAGFMKAMEEAMIKVPESWIVQGDFEPESGYRAMQQILSQPHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEVHPRLIERRSVADGPFRDYR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*AP*AP*CP*GP*AP*AP*AP*AP*CP*GP*TP*TP*TP*TP*CP*GP*T)-3'
molecule tags Transcription/dna
source organism Escherichia coli
publication title Role of residue 147 in the gene regulatory function of the Escherichia coli purine repressor.
pubmed doi rcsb
total genus 117
structure length 339
sequence length 339
ec nomenclature
pdb deposition date 2001-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00356 LacI Bacterial regulatory proteins, lacI family
A PF13377 Peripla_BP_3 Periplasmic binding protein-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 1jh9A01
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1jh9A03
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1jh9A02
4Q7EA 1KRWA 2FQXA 4YS6A 4DQDA 1E6KA 2M1ZA 4PU8A 2E4XA 2KZ8A 2R63A 1JFSA 3P9YA 3L6UA 5TPZA 2LCVA 3PXPA 1L5ZA 2ICPA 1X2LA 3HSYA 3Q7SA 2E4UA 4RU1A 1W25A 1ZY2A 1YSEA 5TQ0B 5KQMA 2FW0A 4YG7B 3QLVA 1PRVA 1ZZCA 1QP7A 2CHFA 3T95A 1DBPA 2H3HA 2E4WA 1LK0A 4XLTA 4LDAA 4RZSA 1YMUA 3C97A 2NZVG 3N0RA 3ZHMA 5ED4A 1QPZA 4WZZA 5HM6A 3SAJA 1DG9A 1ZZ8A 4JB2A 4KVFA 3KSMA 2R25B 4RY0A 1BA2A 4J1WA 3F6CA 3O1IC 2KEIA 3Q9SA 3O1HB 1ZZ9A 3CLCA 1TM2A 3KLNA 1DBQA 4XFKA 4N47A 4GPAA 1M2EA 2JB9A 4DN6A 3SG0A 1X57A 3F73A 5EWLB 1RZRA 3FMYA 1DP4A 1JL3A 4XXHA 4PEVA 1JYEA 1LCDA 3DGEC 5BRAA 1NERA 1YIOA 1B00A 1ZHHA 2FLWA 2L19A 3MYYA 4Z4GA 4N76A 3LUFA 3Q15C 1EFAA 4MQEA 4YLEA 1NXSA 4D6XA 4L4UA 4N0QA 2FMHA 3GRCA 5D2CA 1F4VA 3HV2A 3O21A 5ABPA 2QVGA 1Z18A 1P6UA 4ETIA 4PU4C 2FQYA 4Y9TA 3KHTA 3M6MD 2FVYA 3VNAA 5JS2A 2IU7A 3H6HA 4LE1A 2PUCA 1DCMA 1Z12A 4IA8A 4G0OA 4OLBA 1VKRA 1TJYA 5PNTA 2GX6A 4OG2A 4D6YA 1R63A 1LQCA 2WWVD 4YO7A 3LUCA 3RH0A 4EYOA 4Z4HA 3JPYA 2MYUA 3JPWA 2P9HA 2CSFA 4RDCA 2IPAB 4ZJPA 4OLAA 3B2NA 2PLNA 2YHBA 2L8NA 5EWJA 1ZH2A 1DJMA 1QP4A 1JYFA 2L18A 3D1NI 1A04A 1FFGA 2LPMA 3N6VA 4HNSA 4IMIB 2IVQA 2PUBA 3GN5B 1QKKA 4JA2A 1USGA 1VLZA 3VK0A 1JH9A 3KKEA 2KEKA 4G0PA 5GQSA 2KPJA 3O9XA 3UFDA 4CBVA 3G85A 1WIZA 2MSKA 4KREA 4ML3A 1YK0A 2F8SA 1USKA 1KGSA 3JVDA 3JXBC 2R47A 4EYKA 3DNVB 3M9XA 1ZH4A 4LRQA 2O4AA 4HNQA 3F6PA 4E7OA 1D1QA 2I6FA 2NZUG 3H1EA 1MAVA 4MQFB 3QK7A 2FLKA 4XASA 3O74A 4RXTA 1NXVA 3KZ3A 5DGCA 2F8TA 1XWRA 2IVBA 3FYAA 2R1JL 3I45A 4E7PA 3QEKA 3CRNA 4RKRA 3HXMA 5T7BA 1ZVVA 6CHYA 1ZZBA 4RK7A 3KTOA 3A10A 2EBYA 4X4GA 1DRKA 3CS3A 3DZDA 3I42A 3LUKA 1KRXA 5IUKC 2WY2D 2A9PA 3FMVA 1WH6A 4X4FA 3RVJA 3EUSA 4NICA 2D5VA 4OB4A 3DLBA 1QP0A 1PNTA 3LUJA 2WB4A 2OENG 1JHZA 3GBFA 1EWTA 4JCYA 3QQ6A 2HQBA 5TQ0A 1RXIA 2QSJA 1LLIA 3A0UA 4ETNA 3A3KA 1HF0A 1BDHA 2PUAA 3O2SB 4KZKA 4FE4A 1LJUA 4EUKA 1Z15A 3LFPA 5IBQA 4JOQA 3L1PA 2XI8A 1NXWA 4G0QA 2MQKA 4H60A 5DLEA 3VNBA 2EWTA 2LBPA 2BGGA 4UHJA 1MB3A 1MVOA 5DCLA 5C5CA 3ROFA 2R4QA 2TMYA 1GCGA 3QX9A 4YBAA 3MF4A 3H5LA 1OXBB 3MMNA 4W5QA 2GI4A 1J56A 2IVGA 2OFYA 2A9OA 3O75A 5HQJA 5KQLA 1ISSA 2PL9A 4O8BA 3OLYA 1E2BA 3GN5A 3JS5A 5IC5A 2GZUA 3QYXA 1NXTA 2JVIA 1ABEA 2XIUA 3OMTA 4F8JA 4X4BA 3QLVC 4NDWA 3W9SA 2GRMA 5KQGA 2H8RA 1TLFA 1U2PA 5IEJA 3N53A 3KS9A 2LYSA 4QICA 3GYBA 4YRZA 1FQWA 1RIOA 3MIZA 4NCAA 1QO0D 3MM4A 3RVQA 1U04A 2ZWMA 2JK1A 1YK1A 3CHYA 2CD7A 4MS3A 5TPWA 4EGSA 5TPWB 3KYJB 1FSPA 8ABPA 1S8NA 1JX6A 1NXXA 1BDIA 1EHCA 1BDJA 2FJRA 2LYRA 3UKJA 3CTPA 1IC8A 5EWJB 4J1XA 1XHFA 1VPWA 4YR7A 5I4CA 2WJAA 2MSWA 4Z4CA 3GA5A 2PJUA 3GWGA 4MS4B 2IPLA 2J48A 2LIVA 4Z9BA 5IX8A 3HCWA 4Z58A 2RJNA 2FMFA 3BREA 3BRSA 1S7EA 2FN8A 3QX8A 1E6MA 1Z17A 4O5AA 5TQ2A 2VUIB 3ZHIA 2PKXA 1EWKA 3LUDA 4YWHA 3ROTA 4EYQA 5JNUA 2AUWA 4LE2A 3F6WA 1P2FA 4FE7A 3JXDL 1M2FA 3IP6A 4B09A 1FFSA 4PU3C 4P98A 4RV5A 4IGAA 5KI6A 1RZSA 3R1FA 2ZAYA 3KG2A 2E4YA 1L5YA 3DLHA 1LBHA 2B5AA 4ZPJA 5IUNC 4OBBA 2IPNA 4MS1A 4OATA 4W5OA 4MS1B 3C3MA 3TX6A 4Z5CA 4MCXA 2IYNA 3E3MA 3GV0A 3NHMA 3OLVA 5KQPA 5JS1A 3S8QA 4GQMA 1C4WA 1ADRA 1KMIY 2XDYA 5BR1A 1PRAA 4YG1A 1UXDA 2QZJA 3BD1A 2X7XA 4RK5A 1YMVA 3RVSA 2PUFA 1JWLA 5TE9A 2IDMA 3GBVA 2AYZA 3RVMA 1I3CA 2EF8A 1ABFA 3A0RB 1GCAA 2AXUA 3RZZA 4FN3A 1E6LA 2JCGA 2PMCA 3FFTA 1QQAA 4Z99A 4EVRA 3EQ2A 4JASB 2LYLA 4N03A 2PPXA 3CZ5A 4EVQA 4QYMA 3OMXA 1H9CA 2GWRA 1AB5A 2LP4Y 1HEYA 1ZITA 2PL1A 7ABPA 5JNRA 1JF8A 3HZHA 1UXCA 3RVKA 1ZS4A 2O20A 4HYEA 4QYWA 3RVLA 4YARA 1R69A 1Z25A 4JP1A 4MR9A 3Q7RA 1SXGA 1DBWA 2H0AA 3NBMA 4MR9B 3OLWA 3C3KA 2LUOA 2FEPA 4TN5A 1JLKA 5HKOA 1VRVA 1GUBA 4JAVC 3G5GA 2LYPA 1ZESA 3H1GA 1ZAYA 2AYXA 2QVCA 4Y42A 1T34A 5E3JA 1A0OA 4H3KB 5HSGA 1QO0A 3T38A 2AXZA 2B4AA 2JBAA 2QR3A 1ZPQA 3O2QB 5CNKA 4W5RA 3QF3A 2AWIA 2PUGA 3FFXA 2XCJA 2WRZA 5FBKA 3U3WA 1ZZ6A 5KC9A 3KXAA 2B1JA 3QLUA 4Z59A 2OQRA 5DTEA 2JVLA 1JDPA 1GLGA 4IILA 4RK1A 3BRQA 1AU7A 1WETA 4QPJC 5FWYB 3HO1A 1Y9QA 3M9WA 1Z13A 3EULA 1A2OA 2LYKA 2CHEA 4X4HA 2IPMA 3D02A 4YP9A 1XWWA 4Z5HA 1JDNA 3HS3A 4MLCA 3SQNA 4DADA 1SXHA 1B0NA 4RY8A 3RVNA 4MRMB 2FTKE 5EWMA 1NATA 3GBPA 1DW9A 5EWMB 4EY3A 2IV1A 4IMJB 4MS3B 5TQJA 3EQZA 4RK6A 4I8TA 2JVJA 3IVPA 3GT7A 5JNWA 2L17A 3RVPA 1D5WA 5JNVA 4MGEA 1UTXA 4KRFA 4MPTA 4RK4A 2JVKA 2HJ9A 3LUGA 4N0PA 4YCSA 2FN9A 4WXMA 3UK0A 3I5AA 4Q6BA 3K4HA 3IP7A 3IPCA 2BNMA 6ABPA 3HDVA 1LJLA 4TLLB 1R8JA 5IUJC 2A9RA 1TMYA 3I09A 3FYMA 5C5EA 4RXMA 4S04A 1Z26A 3OMWA 1CQTA 5TQ2B 3UUGA 4MYRA 2FMKA 2ID7A 2O38A 2PAFA 5BRJA 3H1FA 3KYIB 4GNRA 4ETMA 2FKAA 5IULC 4G0ZA 1RPEL 5CNMA 4PU7A 1IIBA 3SCHA 2RJOA 3T6KA 5CHYA 3LUHA 3OM0A 4GHJA 2HQRA 2FQWA 3FDFA 4MAAA 2PIJA 4F06A 5FBHA 2IUOA 1D4ZA 3G1WA 1Z2DA 3LUAA 3OQOA 5B3JA 3MQ4A 3E61A 4YV7A 4RXUA 4LX8A 3H75A 3IDOA 3N0XA 1EAYA 1NY5A 4MLDA 4P1ZA 3C3WA 3S99A 3FFWA 1DCKA 4WT7A 1M5UA 1NEQA 3LOPA 3LISA 1WH8A 3CECA 1APBA 3ILYA 3URMA 3RQIA 5KC8A 5FWYA 3Q41A 4RY9A 1PERL 1Y1LA 4MR7A 2V0NA 1DZ3A 1URPA 2VK2A 1PEYA 1D1PA 2FMIA 1K66A 2HQOA 3CU5A 3LKVA 4ZMSA 3EGCA 1Y7YA 3GL9A 4N41A 1L1MA 2MYTA 3JTEA 1JFTA 3KCNA 1NXOA 3TMYA 3OM1A 2KYRA 4IVZA 3HDGA 2WJWA 3NNNA 1RNLA 5CNIA 4KK3A 5JNSA 4KPYA 4MQEB 1PHRA 4MRMA 2R48A 2QV0A 2NT4A 1K68A 3BDNA 4F12A 3OLXA 3CFYA 4KK4A 3T8YA 3OO0A 4F8DA 4M88A 4ZMRA 1ISRA 2E4VA 4WUTA 3EODA 2FSPA 2HPHA 2JBAB 2ICTA 2FEKA 2W42A 1U8TA 4G0XA 4NQRA 3ZKCA 3LFTA 4FB4A 3H5IA 4EVSA 3MA0A 3LTEA 4PZ0A 4LZLA 3JVIA 4OTZA 3IP9A 4MR8A 1OCTC 3F51A 3L49A 4KMRA 5CNJA 4ZYLA 2A6CA 1LBIA 4JCXA 3O1JC 1SXIA 1SQ8A 2WIUB 4X4DA 5FWXB 5FWXA 5KWSA 4XARA 1OXKB 4NV3A 4WWHA 3HUTA 4S05A 1RZRD 1EWVA 1E3OC 1CJGA 1DC7A 1Z16A 1UDRA 2WMYA 3TB6A 4RWEA 2VYCA 4WXEA 3JXCL 2XSDC 2HINA 1RXEA 3OQNA 4RKQA 1PUXA 3H5WA 2MYNA 1ZGZA 3D8UA 3EDCA 2P4UA 1LMB3 3HUUA 3SNKA 3HM9A 1ZN2A 3KJXA 2A9QA 3LKBA 1FFWA 2KEJA 4G0YA 1GT0C 3QLUC 4L85A 1GUDA 2L2QA 2NUBA 2QXYA 1D2AA 1JBEA 3OP9A 1CHNA 3SY8A 4Z9AA 1CYEA 5JNTA 4JQDA 3SCGA 3G7DA 2XJ3A 5T3YA 3JY6A 4MR7B 4I6TA 4YG4A 4EYGA 2BJCA 1QQBA 4O1IA 1RPJA 4D74A 2FEWB 2MYPA 4Z0NA 4PYRA 5F64A 4W5TA 4Z4EA 1POUA 1CEYA 3H5VA 2AW6A 4XAQA 1QNLA 3N75A 3SCFA 2AXVA 4G97A 5EWLA 5GOTA 2ID9A 4KV7A 3TO5A 1C0EA 5B3JC 4G0MA 2CROA 3NNSA 4Z5DA 3OO1A 3BILA 4FBIA 1PRUA 4PE5B 4Z4FA 3H5OA 3CZCA 5DKFA 4Z4IA 1MIHA 4IWRA 3KLOA 3QLTA 4UHKA 3FGZA 1U2QA 3QELA 4RK0A 2PUEA 4RS3A 9ABPA 3EJWA 2RDMA 3CG0A 3QWGA 3CLKA 3QELB 4TMYA 2O49A 3R0JA 4TLMB 2RGYA 4RSMA 3HZIB 1USIA 1Z2EA 1M5TA 3CG4A 5K98B 1XHEA 4F11A 3TRBA 1OSLA 2MEZA 1PNRA 2JRLA 2M98A 1PEAA 1YS7A 2GBPA 3C6QA 1F51E 3OQMA 5IEBA 2HSGA 3SM9A 4W5NA 2PE5A 1NTRA 4IRXA 3DBIA 3BS3A 4Q6WA 3NHZA 1QMPA 1ZZ7A 4X4CA 1DC8A 3F52A 1BAPA 1LCCA 3RVOA 1DCFA 4HNRA 3LMKA 4KQ9A 3RVRA 5BQ3A 3MLFA 1YS6A 2FXIA 1P6QA 4IF4A 5A7LA 2IKSA 3N8IA 1W9HA 1ZGGA 3CKMA 3NNDA 3O2JA 3HEBA 2Q5CA 4G86A 4LE0A 5TPZD 3N0WA 1SRRA 3F7NA 3IP5A 3B7HA 3EAFA 3QEMA 2GRLA 3H5TA 1U0SY 1TVMA 3QEMB 4YGXB 2GKGA 1BVHA 3OLZA 1MB0A 3H6GA 3ILHA 4X4EA 2N9UA 2MSLA 4KNYA 3CROL 1DRJA 1ZUGA 3Q7TA 2OR1L 2BNOA 2BNNA 4MCTA 4KFCA 4I6RA 1ZDMA 4JB0A 1YTUA 4F3TA 2E4ZA 2YHAA 3TD9A 2WUSR 2QW1A 4MQFA 2VUHB 2LYQA 2IOYA 4MR8B 1DWKA 3BBLA 2NT3A 3CNBA 3K9CA 4O1HA 1O4XA 1SD5A 2QU7A 3IPAA 1YVUA 2CWDA 1NXPA 3HVRA 2L49A 4I6UA 4NCBA 3HK2A 2PUDA 3DGFC 2DRIA 1P8AA 4PICA 4KQCA 4LDZA 1AB6A 2LYJA 1JFVA 4H3HB 4X4IA 4MS4A 3HJFA
chains in the Genus database with same CATH superfamily
4ID3A 1T3GA 3P45A 4LPKA 4EZEA 1K92A 1GG2A 1E6KA 2FSGA 3TPCA 1KARA 4P4SB 4JKYA 2XCOA 2Q9AA 2Y1LA 4I9FA 3Q7SA 4V1CA 3SBXA 1AKVA 4MO2A 2B25A 3THYA 3QJ5A 1ULZA 3HHEA 3DBOB 3GEDA 4HB3A 4QPNA 3EK2A 4DDVA 2W2LD 1CKEA 2FRXA 2QX6A 4KSCA 1JIQA 1UF9A 4ZZ1A 5L4SA 3W0LB 1IZ8A 1YMUA 2OESA 1BMTA 4XEHA 1MRSA 3AR3A 3Q2IA 4IVNA 3RS4A 3P1JA 3QKWA 4YCLA 1FPQA 3DHNA 1C0IA 1DBIA 2A0FA 2D1FA 2JG3A 1U8EA 2VPPA 2XF8A 5IN4A 5CT8A 4N48A 3WLQA 3AUUA 4UREA 1U0RA 3WWZA 3GCWA 4L57A 2CHGA 1JL3A 4R1MA 2HNKA 1DKRA 1EE2A 2J3KA 2RHTA 3E3OA 2IV3A 3V8EA 2C7OA 1B00A 2CBGA 3GRPA 3U7JA 4FHEA 1JFFA 2G6TA 2PKWA 4QATA 5JQWA 2AJLI 3IPRA 1IB6A 4CEJB 3AF2A 1YQQA 3V32A 3L7DA 2WWIA 2H1VA 1DI0A 5I7AA 4F4HA 3DE6X 3LQ4A 4B6EA 4YQZA 1ZJ5A 2IU7A 2B4TO 2H4WA 2PA3A 1T5IA 4K0KB 1Z12A 1DWUA 1Y1TA 3MHPA 1AKTA 1TJYA 1ZOSA 1PF7E 1W30A 1OC2A 2ZSFA 3MCZA 3QXHA 4IOJA 1LQCA 3EG5A 3Q7EA 4KDEA 3PJEA 4B3FX 2SECE 3JD2A 4B3GA 4DMRA 1TO6A 3MUEA 1U0NA 2P9HA 3RAFC 4ICIA 3E4DA 4LYDA 3VBEA 3B2NA 3C7AA 4PZYA 4URUR 3HRKA 3RC9A 4X6LA 1DJMA 4X91A 5KTMA 1AZWA 1IQUA 3WC4A 4KAJA 1A4UA 2YHIA 1UXKA 4HH0A 4A8TA 4DKXA 3WMWA 4E5SA 3P2MA 1RP7A 2EWMA 4XDHA 3WFZA 5DK6A 2UVPA 2XXBA 1JJVA 2CJYA 3GARA 4HSEA 5AW8A 1LPMA 1U0FA 4J2OA 1Q3TA 3EXHC 1ES9A 3ZH2A 4Z3KA 1YK0A 4DG9A 3GLGE 4MUXA 4YRTA 4OHPA 3JXBC 4B5KA 1XXHB 1X7DA 5C8XA 3DNVB 4OQZA 4ENPA 5TC4A 1ZOPA 1A5ZA 1D1QA 5G1OA 1Q0ZA 1ACLA 1KZ6A 1SURA 2PWPA 2R60A 4IJVA 3O74A 2ZIFA 2BPOA 5ADHA 3BGIA 4BV3A 3TN7A 1CETA 1IUKA 2B8TA 1GKUB 2BEJA 2DPYA 2GYYA 2WG0A 3PNKA 4LTDA 4V38A 2H1LA 2P75A 1NI5A 3C5EA 3L1HA 1U6IA 2IF2A 2Q7DA 3A1SA 3FYCA 3LNTA 2IY8A 4IBOA 4EHFA 1X1TA 5C7OO 1P5JA 1UXHA 2UUAB 1HT2E 2VP3A 1ND6A 1EWRA 5A0TA 3MTAA 4GLLA 1NI3A 2HF7A 3LECA 1JSZA 5CTJA 4ZDJA 2ETVA 3F49S 2WAYA 2YC2C 5DNYB 3FPCA 2WQZA 1VDMA 2ESRA 3TVTA 4ROSA 5LNK6 2HQBA 5J23A 3CM0A 1DGQA 1ARZA 2FOLA 3HC7A 4RCYA 4PZCA 4AWAA 3BJRA 3F67A 4KIGA 5CM8B 4NSNA 4EUKA 2H18A 1Z15A 1E6UA 2GKOA 4EMSA 4QUEA 5K2OA 1NXWA 3QFRA 1AV6A 3ETGA 5LIPA 1RTKA 2VYVD 1ZW1A 3P2IA 1UC9A 2IDZA 4FGUA 1E0SA 2JHFA 3DQPA 1CJBA 3SIWA 3DL0A 3WNQA 3ETJA 2AN9A 5HKKA 3CSUA 2R4QA 3A4LA 4QG7A 3GLFA 8ATCA 4B3SB 2W6ID 3TCNA 2R96A 4B3CA 1M0TA 1UR5A 3LUBA 3T3HA 2CL7X 3F6YA 3WNVA 2NVOA 1XJ0A 3OLYA 3RSLA 2VWQA 5DNCA 1MB9A 2HA2A 3L18A 1WF3A 3A05A 3LPNA 4X85A 4ZEXA 4JYZA 2TRSB 4WBSA 2EWWA 2D2EA 4P92A 3V8NA 2XIUA 2QRMA 1CG6A 2XTMA 3C8UA 4I4IA 3VMFA 2DP4E 3WS7A 4M8IA 5FUWA 2O6LA 1QIDA 1Q14A 3LLMA 5DTMA 2HUNA 4HAXA 2BC9A 1ZGBA 4KMOA 1N7HA 3BORA 3IA7A 2DYKA 1NMYA 3HKEA 1XQXA 1OLOA 3JWGA 3AVTA 1ZO8A 5ILOA 1KIMA 2RBKA 4K3UA 4PLPA 2JK1A 3L79A 2IYSA 3I9V6 4JLNA 1DFHA 2PXPA 1QFJA 5E7IA 1G3IA 4GOKA 1WAMA 2D4AA 3RIEA 2W90A 3EEYA 4UU1A 1T9GS 2WFZA 2XQGA 1WUJS 3K72B 1EFTA 1YQWA 3S2SA 2NAPA 3X2SA 1KY5A 1R0SA 1VHTA 1H2AS 1T36A 1OI4A 3KALA 4DHEA 2XVXA 5ENDA 5JE8A 3OCCA 4OOEA 1PGJA 4ZXPA 3T4EA 3MYRA 1LNSA 3R6DA 5IX8A 5HFNA 1K98A 4CM7A 3BRSA 1XBTA 1WCIB 1RWQA 4DXHA 2ECFA 4OFXA 3TAUA 4BDSA 1W48A 5K45A 2XB9A 5FOSA 3TLCA 1KKUA 1VG1A 4PSUA 3IP6A 4ZYXA 3O3OB 1CR0A 3DO5A 3QUTA 4M1EA 5IVPA 2CMDA 5EJ6A 3WBKA 3IVRA 5JI3E 3X1XA 4A0HA 2JFHA 2QR5A 4RTJA 1E18A 3DLHA 1TZMA 3AIIA 3HMQA 1CIJA 5HKBA 3ZXIA 4YMUA 1Z28A 3LGXA 4DJEC 5GONA 4ZU1X 2C2WA 2GEJA 5DLPA 4P4GA 3ICWA 3U4AA 2ERYA 4DR5B 4RE5A 2C5EA 1C4WA 1E5VA 4TSFD 5BR1A 2XBUA 2WYUA 3LH5A 2WFLA 2ATIA 3KR2A 2YY5A 4ECAA 4HDSA 2JZCA 2P2CA 3JQFA 2AYZA 1M83A 4UNQA 4DA6A 4DABA 3RSHA 2AFIB 1I3CA 1XVUA 1P3DA 3H3FA 4N12A 4DLAA 2HYDA 4NULA 2PMCA 3DBVO 3P2JA 2ZCUA 1UMCB 1IZZA 2QG6A 4HN9A 1QX3A 4Q9DA 1WNFA 1E1DA 1P75A 2CFCA 2PWYA 2Y0CA 3OEYA 4FMCB 2WU3A 2DPXA 2DPHA 4NBUA 4Q5IA 1UODA 3JAWB 5KDLA 3INNA 4IDHA 1T2VA 1P7CA 3NXKA 2GXQA 4RZHA 3O91A 1X9HA 1BRMA 2XSZD 4TYPA 3K70C 2QDXA 2BHLA 1N1MA 3RB8A 1TAUA 4Y98A 3WVNA 2X8JA 3L46A 5BVGA 5ICEA 4BGUA 4HQ0A 2AYXA 3G2KA 3SJCA 1LLCA 4UJ3A 1WX1A 2X7HA 2FZVA 3EZXA 1NDQA 1RYZA 3AVUA 2IA5A 1T0BA 2XCJA 1OC4A 1PK9A 2WRZA 5FBKA 3OCYA 3OF3A 4HDOB 4KPUB 4CIYA 4M37A 2EFDB 2OQRA 3C1UA 4Y6GB 4BQNA 3ECCA 4PLYA 2B9EA 5DF1A 1CZNA 2R7MA 2G1UA 3RIHA 2ZS8A 1R6XA 3IKLA 4J1SA 1VE9A 4O2AA 2PT5A 3A9RA 5LSAA 1I4OA 1B76A 4MQMA 1DXYA 3H2IA 3V6LA 1FS5A 3VR6D 1FU8A 1OBVA 1KH1A 3QITA 2QPAA 4C4XA 2D59A 3G0HA 1X38A 3U7IA 3KELA 3R3VA 5EWMB 3WICA 2I7XA 3R41A 3BL8A 1FP2A 3I73A 3RJ5A 1BYIA 5JW6A 3RFUA 3EQZA 2ZVQX 3GT7A 3KJEA 4R0MA 5JNWA 2GLUA 1VMEA 2ZJZA 4UZFA 3SE0A 3RTBA 3SJ7A 5M5BA 3A9ZA 1SB8A 2CL0X 2VJOA 2FPUA 4KFUA 4AUNA 2JVKA 2HJ9A 3EC2A 2I99A 3DNFA 1UZMA 3NPAA 5ALIA 2HCNA 2FZCA 3IPCA 5CGQB 1YB4A 2MSNA 5EQFA 1QG6A 5L3SA 1Z8NA 2A9FA 4FHCA 5L3VA 3OMWA 4PS0A 4Z7NB 1FBTA 1PKEA 2PKYX 3QPBA 1E3WA 3ER9A 3A9XA 2G08A 1HYBA 2Z8YA 3NHJA 4M1ZA 3FDZA 2ZDHA 1J2YA 4TRMA 2J41A 2FYTA 1DRWA 2WHYA 3BIOA 1ZH0A 3U7EB 3B3FA 4IGEA 4ERXA 3KB2A 3BXPA 5KMGA 4Q39A 4RHYA 2PL5A 4X1KB 5CHYA 5JMOA 4AS1A 1J0BA 1VBMA 3ZVLA 4Z3OA 1NLUA 3T4XA 3WK6A 5AJTA 6LDHA 3JU3A 1MT0A 1ZXXA 5A7FA 3DYIA 1I7QB 3E61A 4XJSA 3LTNC 2QTWB 2IV2X 1UZLA 1V5IA 2HNBA 3IDOA 4TXHA 2Q3JA 5BP7A 3T9DA 1NY5A 3S99A 4P1ZA 1EP2B 1SHJA 2R2AA 3C3WA 4JKOA 2PNJA 3TBHA 5BOSA 3PLAE 4YALA 4D0SA 4ZP1A 5EPEA 1FU7A 1KAOA 1FSZA 3PDIA 3ILYA 1D4FA 3GAMA 2C9DA 4NIMA 1VCOA 4MRVA 4B43A 4C6TA 1Q7CA 2HQOA 2FMIA 2ZYHA 2Y4NA 2O52A 2GCEA 3KYCA 4RNDB 4BNFA 4B80A 3QUSA 4EYEA 4ZMSA 3SHVA 3H2YA 1AUPA 3SMVA 1DJOA 5MDHA 3QOFA 4X8HA 2O19A 3PT9A 2VJMB 1X1AA 2YXDA 5GJCA 4EX7A 2HFZA 3NNNA 1LQ2A 3LA8A 1PJZA 1QKIA 4NYMR 3TSAA 1G7TA 4GRDA 4E4TA 1R0RE 3KOUA 2BGMA 1RLOA 2PBRA 4DUGD 4EMUA 3W8RA 4Y2XA 1VCIA 3JQAA 2W43A 5FQNA 1A9YA 2FEKA 3CR8A 3PWZA 2V6FA 4O2AF 5FPQA 2HRDA 3TTXA 5HCUA 4REQB 4FINA 1LRJA 3WYNA 2V6GA 2YXBA 2CDRA 2GESA 3VHRA 4UKDA 1E32A 4QXAA 3ZU6A 4OTZA 1PZFA 4V0OA 4UXIA 3Q5EA 4B17A 3L4SO 3EPRA 4RX1A 3DW3X 3A1NA 2A6CA 3HYRA 2PLRA 3OZEA 2J4CA 5JVDA 3QGMA 3A25A 4EQZA 2J45A 4HUTA 3DBHB 3R6TA 5MFZA 1MVNA 4HQLA 4KKVA 2IC5A 3CNHA 4H4EA 4KVGA 4R1TA 3TQIA 3TB6A 4BMPB 4DA7A 1GL6A 3VZBA 4PG7A 2XSDC 1OX6A 4B35A 2JLRA 2E4AA 1I9GA 4RZ3A 1XE3A 4JYPA 4K26A 4WKGA 3ZR4B 1Z0AA 5KSOA 2IL1A 2ZJ3A 2H1SA 4HZUA 4OFZA 1XO1A 2O7VA 1CR2A 1B0PA 1P33A 1U9YA 2RH4A 3EOZA 3EDQA 3LKBA 5DK4A 3VV3A 5G2OA 4LCBA 3GP8A 4EFKA 4TTRA 5EVJA 2JLZA 2HIHA 4OP1A 5I01A 5C18A 1QRSA 5JYCA 2VDOB 2KB0A 5TJHA 5KHLB 4DB4A 1QYDA 3P9KA 3FPFA 5A3RA 3BFVA 1WDKA 3FETA 3AF1A 5BSGA 3GFVA 5FTMA 3HJAA 4W4TA 1Q6ZA 3CNQS 4J7AA 3AETB 4HDRB 1KMMA 1DOHA 1U9IC 3GT0A 4HYTA 3ZY4A 3A9TA 2FRVA 1RHQA 2Y1XA 3GMIA 4AYXA 4XA8A 4CLEA 2YBDA 1T3LA 1T35A 3F8TA 3BG5A 3ONWA 3IHKA 1ST2A 3TO5A 1JEYB 4KV7A 1C0EA 5BSVA 1I3MA 2CROA 1T5LA 1VMKA 4ZDIA 4JLUA 1TX4B 4BWGA 3AXTA 1GKYA 3C3DA 1IY2A 1MVLA 4X1OA 3RYTC 1NIJA 13PKA 2W11A 4EL0A 1J97A 2ZWVA 1IJEA 1W0JD 1NLZA 2ECQA 4CQMA 3OFNA 4DLLA 4PO1A 1C7EA 3D1JA 2CDCA 2E49A 2ZS9A 3VR3A 1PNOA 2KJQA 2O0HA 2ZB2A 1E5LA 2LKCA 2QY9A 4H1UA 2PIDA 5LP6C 4I50A 3SQDA 3OOSA 2YWCA 5AI5A 5JRJA 5GIPE 4D3XA 2ORIA 2EU8A 4W1SA 3KYBA 5K8CA 4EA6A 4RZUA 4IIFA 4D96A 4CEHA 3DR3A 2C31A 1RQPA 3TZKA 2EL7A 3G5LA 4WH0A 1LPBB 3O4VA 4P7GA 1BU5A 3NJ4A 3ZCSA 3O8BA 1U7WA 3RSFA 3WX0A 4KACA 4UBIA 4XX1A 5EQTA 1Z6XA 5REQA 5A7LA 1EM8A 3PZBA 3EYWA 1DKLA 4IKEA 4Q3CA 2OR3A 2YFYA 5AVWA 2HOQA 1QE5A 2Q5CA 5D51S 4O4LB 3AJ8A 5FO1A 5TPZD 1NBEA 1D0IA 5BURA 5IF9A 3L8YA 4BFVA 3HKBB 2DFTA 3UPDA 4IDNA 3A2MA 2FSSA 3I39X 4AJ2A 1YO6A 5MN4A 1PG0A 3PUHA 3S5JA 1DBVO 2GK7A 1A2QA 2R65A 1ZRSA 1ZUGA 3RABA 3OKPA 1SUBA 3K5WA 3E5RA 1UBKS 3N8NA 1DIOB 4PNZA 4LRYA 3IOCA 2HBRA 3KB1A 3SEFA 2XGSA 3WYCA 2WWYA 4V2UA 3IAS1 2Q1SA 3BRWD 4WOKA 4XR9A 2KX7A 5P8WA 3SBDA 3ZS8A 5HKKD 2GN6A 2ZJ7A 4MA5A 3RNLA 3K31A 2CWDA 3KOXA 4UTRA 5BN3B 3IRVA 1SU4A 1HRDA 5IM5A 1KIFA 1HV8A 1TLLA 4Y6PA 4H3HB 1XA3A 3B1VA 4OQYA 1EGAA 1B3BA 3KRTA 1I7PA 4PYKA 1RDFA 2O8NA 2X6TA 4GPBA 4YS6A 5EZQA 1C3JA 1RRFA 3A2NA 1Q2XA 4HFRA 4MMYB 1ECJA 2PYIA 4CIAA 1RE1A 3F1LA 4AMZA 1P0IA 1O7JA 1TCVA 3ABSB 3LA6A 4LVOA 3GNTA 4NNJA 5JZBA 3FYUC 3PCRB 1DQSA 1G41A 4FCWA 4L3OA 5CLLA 1IG3A 1N2CA 3COWA 3WMEA 2NWQA 3ABOB 2QMZA 4JP5A 4Q9KA 5I5GA 4OHMA 3N8DA 3TD6A 5IJ0B 1XNQB 3WHPA 3WKDA 3BCHA 4AS3A 5BYAA 3UXEA 4J1WA 2AFRA 4UE2A 4KR6A 3MJEA 2WJGA 3JARB 1H4TA 1A27A 2AJTA 2O2GA 2JAOA 4YCBA 2QA5A 4F2HA 3GJTA 3EVGA 1XMPA 4WKBA 2HA4A 1Q1EA 2QP4A 5BQ5A 3U1VA 2BUAA 3WGOA 3DGEC 2P9QA 3JQ9C 5BRAA 1UPAA 2OCLA 1OAOA 4ANFA 4WNIA 4JBHA 1ZK3A 1GNLA 3C5WP 3VZQA 3DPSA 1PJ8A 1C29B 4GI1A 4NX2A 1A4XA 2PS3A 2UUOA 3AK4A 4R41A 5LA6A 4JMLA 4QO7A 3ZZ1A 5K7SA 1EIWA 4MULA 2P27A 4L8FA 5DVZA 3ROZA 1D0SA 3T5CA 5LD2C 1U90A 4MVJE 4AC9A 4ZGGA 3B7GA 2QENA 3EEBA 3MTJA 1YRBA 4IICA 4IUDS 4M46A 4UHBA 5KU7A 4X97A 3IEIA 3K2QA 1PWYE 1VPLA 2VP5A 3CX8A 3N28A 4R9RA 3CGGA 1HMPA 3Q2KA 1D04A 2I6SA 2B4QA 1QS0B 2IPAB 2YZNA 5KYXA 5TVKA 2GBLC 4D43A 4YIKA 5FOVA 3KZXA 1Y63A 1YBAA 2ZKIA 2XZLA 3H8JA 3STXA 1EHIA 3GJRA 4LYHA 5LMUB 4E3ZA 1KP2A 1MMFB 1M1YB 2PY6A 1WBJB 1BCRB 1J8YF 3INGA 4PGGA 4HAVA 3J81k 1GU7A 1ZMXA 1QIHA 2G71A 5HP4A 5CA0A 1IH8A 3CZRA 3DZKA 1SC4A 4RV9A 3K6SB 4D8VA 5SYAA 2D5BA 5GPBA 4JY7A 1FNDA 1K6MA 4KREA 1ZFNA 2IW1A 1MW9X 1NSTA 1USKA 2J5KA 1CC1S 2B1QA 4QBTA 1R0BA 3PQ2A 4JDPA 2H1FA 1WB5A 3J81A 1E8DA 2I6FA 1P1JA 1JR2A 2VPIA 1JU4A 1SKQA 3M5WA 1T8WA 1NW4A 5C51B 3FGPA 3T5MA 4LFBB 1L1RA 1OV4A 2YH2A 4ZV9A 3NEYA 4KHZA 4Y2QA 1CDDA 1BD3A 2CMGA 2P90A 3QEKA 2NU7B 3O4FA 4L4XA 3FUXA 5EAIA 4KXQA 3SZMA 4YRKA 4XVRA 3T9AA 4RLQA 3L04A 4DOMA 3GFTA 3KTOA 2BEWB 2EBYA 4X4GA 3K0AB 2VWPA 3BE5A 4ZCPA 4YT5A 1VHWA 2H92A 2A9PA 2GTPA 2IUEA 3FMVA 3WGNA 5CP8A 2HU7A 1GVNB 5EMLA 3UG7A 1WDLA 3PFGA 4O5OA 3U1BA 3KLPX 4NC9A 3DLBA 3G13A 1Z82A 2BCEA 3AFNA 3IIMA 1RKBA 4PAMA 4YASA 2HK6A 4F4IA 3GRZA 3C6XA 4CCAA 3QNWA 4DIBA 3LUPA 3W34A 2D1SA 1O6BA 2PUTA 2VHCA 3EPLA 1RPTA 4JI6B 5DT2A 1ESZA 1N8NA 3DL4A 1UC8A 4V0ME 1JMVA 3X3HA 1NV9A 5G0SA 4LJAA 5IYZF 4E70A 4UNIA 4G8DA 3IA2A 5DCLA 3ROFA 3OPVA 5AVRA 4E0BA 4WZBE 3DOIA 4HZIA 1ILWA 4V0LA 3GDOA 1DAGA 2IEIA 4K05A 4BGDA 3QU5A 4ARZB 3WYDA 2WIFA 1QG4A 1N3LA 5EE5B 4PQGA 2PL9A 4O8BA 1IB0A 1FXUA 1U5BA 1W8IA 3DV2A 3R7WA 1SD1A 1X14A 4BZWA 2PA0A 1YZNA 4B84A 1AU9A 1NVKA 3EIEA 1LLQA 4WKPA 1PJLA 3FMIA 4ER6A 2ID4A 2YY7A 3EVEA 1NG9A 4QWWA 2FX5A 4OQ4A 4I3GA 5D1HA 4PGHA 4H77A 1IBCA 4QDTA 4YCJA 4LY9A 2N1MA 4MJ7A 4X7RA 3N9IA 3OWQA 1FQWA 1RIOA 1WVGA 1NE7A 1XLUA 1UFOA 4KLCA 3SHOA 3GY0A 1QZ3A 3E7FA 4MPDA 3IT3A 2A0KA 4P5DA 5TPWA 4YMGA 1VL8A 3OZVA 4JJEA 1EP3B 4ZVUA 1YTLA 4C5BA 1N0WA 3PFCA 1II8B 2BDUA 3FPKA 4R9UC 4CMHA 4DXDA 4LHWA 4J43A 2XMBA 2UYYA 3U16A 2LXNA 3KZCA 3FI0A 4RESA 3A9CA 3UFXB 4N5IX 3Q3GE 5LP1A 2Q50A 2XNJA 2OO7A 3KTAA 1LX6A 3M1AA 4YRMA 4Z58A 1WR8A 5G0TA 1EU1A 1DAIA 3QFTA 3H2HA 3JQFC 1ZMOA 1GQOA 1X7WB 4GI5A 1RYEA 4QELA 2JJ8A 3JVVA 4DPMA 1PSZA 2K87A 1WW2A 4YECA 3LQFA 4A0RA 2R00A 1HDGO 1XALA 2X58A 4NYJR 4FBMA 4ZIRB 3HMKA 2AXPA 2ZYIA 4MUKA 3BMCB 3VSDA 2XE4A 3F47A 3KR9A 2OC9A 3TG8A 2QPTA 1T6BY 2INGX 1KVQA 2RHDA 2WF8A 3M4NA 4G67A 1N9ZA 4GMGA 3R1FA 2DLDA 3TZ6A 4DQUA 3GLGB 2CNLA 5IWAB 3PF8A 1SBYA 4RPGA 2FGKA 5EKUA 2PKCA 3TLZA 2ZT6A 4GR4A 5TJ9A 3DTTA 3U56A 3D2AA 1LRKA 3ORHA 4OBBA 1W0KD 2AUTA 1YUBA 2EZ8A 3DKVA 3GD7A 3L8CA 4MKIA 3W8DA 2EG5A 2PUJA 3SOPA 4DLNA 5JFOA 4J6EA 2FX2A 4B6PA 2IVZA 4KR7A 2H4XA 1YA4A 4I4TB 4ZKEA 1YBMA 1E7MA 2XCIA 2Y05A 3DHVA 1P5RA 4QPCA 3HN7A 5FL7A 2VAPA 5F98A 1R9GA 1J8QA 1FTYA 5DE3A 5F1OA 1E6LA 4B45A 3JZFA 1OLUA 4NBSA 1V7CA 2W4MA 1W73A 3PL1A 2PWAA 3IC5A 2NZ2A 3GGDA 4XWKA 4PYQA 1KDZA 4TKVA 1GRRA 4AJ9A 2O20A 4HYEA 3M6IA 1Q20A 5KQRA 4JP1A 2JATA 4MDHA 4LF9B 4F45A 1W29A 1WABA 3K35A 1PI3A 3Q7RA 2AMLA 4MR9B 2PCLA 4I6GA 3K8QA 4L3VA 2V7PA 4YJ2B 1AV7A 2H5IA 1ZAYA 3V8QA 2O5CA 1JEJA 1UBEA 3P32A 4X62B 1WCYA 3P97A 3KWJA 5KAMA 2GVZC 4M83A 4M38A 1WTAA 5LB2A 3CF4G 3ISJA 3KETA 2IZ0A 2FWMX 3ON5A 4GYJA 5EJ2A 1DPGA 1TL7C 4QKQA 1YCFA 2JDID 5DNUA 1UXGA 3PDIB 4OKNA 2IH5A 1WKVA 4J4BA 1P39A 1KDYA 1SH7A 4NJMB 3QBJA 2V8OA 5FR1A 1YE8A 4X4HA 1N2HA 2OO5A 4F86A 1OR8A 4D0RA 2ZR7A 3AXSA 4YDSA 1AK9A 1OIVA 2GT1A 2X0KA 4GZLA 4M1SA 5FHQA 5CIWA 3IPYA 2QM7A 3ZWQA 5KCZA 4JQOA 2F64A 5JG7A 4IEFB 2ZUFA 1SUDA 4OHOA 3KAPA 2H4YA 1JEQB 3D4BA 1YRWA 2C8LA 2C3UA 5CX4A 5IAJA 1NU8A 2XITA 3VDXA 5AK0A 1QF7A 4WZBA 3VKFA 3T1OA 1WU7A 1E58A 4G37A 2NV0A 4Q37A 5G40A 1NRWA 2EG9A 4N0PA 4BB6A 9ATCA 1AXEA 2PGOA 4YCMA 1IPHA 3WQHA 3I9FA 2W70A 5E9WA 1DNPA 3ZY5A 3FKSD 1V3TA 3SVZA 2AG5A 1R8JA 5IUJC 1E3TA 3G2JA 3OOHA 5HK8A 2IDKA 1ZS9A 2GLXA 3OZUA 1ISMA 4MYRA 3Q2OA 4H6WA 4UW9A 5AUQA 5JQGA 3QSYA 2PAFA 4TKUB 1JHXA 4F84A 1YFKA 4EHBA 1IBRA 3K20A 4FYPA 3D6HA 3CCFA 3HJGA 4MVJI 1C5KA 3TKAA 1O5IA 4GW3A 4F93B 2VKQA 2XKAA 4BTVA 1U31A 1BHSA 4Q4CA 2AFVA 2JW5A 2HU5A 1NOKA 3OSUA 3VDRA 2PKQO 3G1WA 4IIYA 5FWNA 5B3JA 1NW8A 1XDBA 1JPVA 3IAFA 4WCDA 3ITDA 4PW0A 2QTHA 2WSYB 4QU9A 5EUBA 5LZ5A 3RK0A 3U3DA 5T4HA 2ZM5A 1IULA 1FQKA 2DVMA 1ZI6A 3FNFA 5EI5A 2WU0A 3B7WA 1HM5A 4NMXB 4BO0A 3DC7A 5JBIA 5BW5A 1PVOA 2IS2A 1LSOA 3M89A 5FWYA 5IK2D 2PH3A 4B6RA 1EDZA 2QXUA 3RROA 3C3CA 1URPA 2H52A 1NVGA 3I64A 3LT1A 2GZ1A 4FX2A 4PLFA 4YX9A 1XNRB 4L0CA 3EA4A 4HLQB 4MKHA 2LNDA 3ANXA 1A69A 1TE2A 2OTCA 1SUEA 3GL9A 1ORHA 4PANA 3TSWA 2QTFA 2GH1A 3EXHA 3IHLA 4GZ5A 3OM1A 2VHYA 3MAAC 3QVXA 1YL5A 4IRUB 5JNSA 1TEHA 4S1PA 4WKNA 3TCKA 2D8AA 1BEZA 2IXBA 3A28A 3FSGA 4HKTA 1UZUA 1RSZA 5HCIA 4KQ2A 1B74A 1X0XA 2GEDA 4F12A 1U2RA 2IOQA 1NMQA 3EHDA 3G6KA 4UFOA 1PUIA 2FN7A 4U5XA 5BWLA 1CUHA 3EVNA 4KWTA 3UOAB 3AJRA 3RG2A 1U8TA 3I1IA 4G0XA 3MGGA 2NZWA 2VS1A 3KD3A 2JGIA 3FW1A 2WNIA 4MR8A 2V9ZA 1LTKA 5KSWB 2IJGX 3TRHA 2QTBA 3GLSA 3AILA 4KI7A 4OP2A 4LY6A 4W1QA 5EKTA 2WIUB 1EVLA 4F9TA 1REQB 1B93A 1KYXA 1T0JB 2PX6A 2HRRA 2ZRQA 4Y6RA 5JXIA 4DDWA 4NV3A 1CXZA 5FF9A 2WINI 4MQ6A 4QVGA 3FDJA 1T29A 2ISCA 1VMIA 1Z63A 2BL4A 1KI8A 4H7IA 1WSDA 5T64A 3CN9A 4FSXA 1T4BA 1XZHA 1V6AA 4RIEA 1YJ5A 1YDHA 4GMFA 2H2HA 1S8FA 4WBNA 4B3RB 4CQLA 1X8XA 3OE7D 3O8CA 2VKTA 1NI4B 1AXRA 2P4UA 2ZUBA 3NI2A 1FUIA 1ZN2A 3FR8A 4CWAA 5C2JB 3GIWA 4WRRA 2BP7B 3E23A 3WLIA 1IOWA 1QPBA 4NONA 4ZGBA 3IV7A 4WBXC 4G6ZA 3KQWA 5JDCA 4XLLA 1U65A 1W4BA 3P20A 4OQPA 3P4YA 4CR7A 1K1EA 2I4MA 3S28A 4TXLA 1IXYA 2PSJA 1UKEA 1NQXA 2CB9A 2A1TS 2GPBA 4AO8A 1OXUA 5FEMA 4P82A 5F64A 2PR2A 3OTOB 1OAKA 1P18A 2FWAA 3KJZA 4KQKA 5KNCH 3L8ZA 4WLUA 1KR5A 3MGKA 4G0MA 2F8MA 4Z5DA 3OH8A 5ARCA 3IJ5A 4FYXA 1I2DA 4PE5B 3H97A 5D5HA 5JROA 2OUKA 3ZUGA 4Z4IA 2VP2A 5MFPA 3SC2B 1D1SA 4WMLA 5LA6B 3BB3A 3MMZA 1KI7A 1XDSA 1O6CA 1UBGA 1A9XB 3VR2D 2O49A 4HNTA 2D13A 3UJHA 2AX3A 3DZBA 5E9JA 1USIA 1US8B 2A88A 2CN1A 1CQZA 3BSWA 4KAAA 3LQXA 1OSLA 4FGJA 1PNRA 3JALA 3MG9A 3RW9A 1USVA 2VDJA 1MJGA 5EP2A 3REQB 5HNKA 3VPDA 4NG4A 4CL3A 5LWQA 1JHVA 1Z6AA 3HXLA 1UKZA 4X4CA 1MPXA 3IIEA 2G7MC 3VO1A 3RUDA 5BXQC 3MLFA 1YS6A 4UOZA 1SOWA 1GAWA 2QE6A 4W5HA 4GSKA 3M4ZA 4PVCA 3NNDA 2I4TA 4DEYA 1MQ8B 4Q1CA 1M6YA 3PIRA 3F7NA 1G5PA 3N3AC 3CSDA 1GNTA 3H13A 3LPCA 3QEMA 4N6GA 3RIGA 4QAJA 2X9NA 4YAIA 2JAQA 1P73A 1SGWA 5JS8A 2JIMA 3KZNA 4K9PA 1DBSA 1MB0A 1N6OA 1YR8A 3QU2A 4E11A 3VM6A 2GZSA 3B1YA 2N9UA 4GXRA 4IMPA 4Y2PA 1NQWA 3AF4A 5TGTA 1Z3CA 1EE9A 1G4UR 2OR1L 2X4DA 2DG2A 5D6NA 1H2BA 3T12A 3UA4A 3KPYA 2I4RA 1Y3AA 2XZTA 2YHAA 2FF7A 3AUYA 1TM1E 2C0CA 2OL4A 2VUHB 1DV2A 1T2FA 3LHIA 3JVUA 4MYHA 1ZEJA 4GL4A 1YZTA 3VKGA 1S2DA 5F51A 4NCBA 2QSYA 4BNXA 3PBKA 4DCPA 5BR4A 2ZRJA 2QLJA 4TYQA 5ILGA 4UASA 4Q9HA 3QIVA 4ALMA 3V7YA 2BEWA 5K51A 2R1VB 1VJ5A 2V54A 2ATVA 2V98A 1FUEA 5JPIA 1C9NA 3MCTA 3D7MA 4GLJA 2NTNA 3BUSA 3HKDA 4WNYA 4AZVA 5JDIC 1L5WA 3I58A 3L6UA 3VVBA 3GFQA 2LDXA 3GWZA 5AJHA 4ZI3A 2E4UA 3TLMA 5LU9A 2C2MA 3U4QB 1VIVA 2G40A 5CT5A 5AXBA 1STOA 1E6EA 1HE3A 1Z2OX 1G8YA 1B0ZA 3LS2A 3NEAA 3NH9A 5DSTA 4ZJYA 1BH2A 2RHOA 4IHJB 2VJLA 3PR3A 3EW7A 3FF4A 1ISHA 3GK3A 4JR1A 4L8VA 4NBKA 4R8KA 1VGVA 3LX5A 2A30A 4GMDA 2OC4A 1LK0A 3DHEA 2GF2A 5EJMA 4RZSA 1IK4A 3W2IA 3ZHMA 1FNCA 1QPZA 1YL7A 2FWBA 2G9QA 4KVFA 4RY0A 3CPEA 1JDUA 2Y8EA 3Q9SA 3O1HB 5A7HA 1MJHA 1OZGA 4LQCA 1KI3A 4WD3A 3STYA 4TYNA 1JQBA 3ZPXA 4BLSA 1Y1KE 2C1EA 2F3TA 3R2JA 2JJ1A 4TT3A 4MVJM 3SG0A 3F73A 1T1IA 2QI9F 4JT8A 5EWLB 4NE7A 5IVHA 1RU3A 1TZCA 4A36A 1EHYA 3DHWC 1JYEA 1CW2B 3A3NA 2P78A 1U0OC 1WE2A 1YIOA 4N3NA 1OFUX 1AH2A 2ACEA 2JD1A 1GTJ1 5CPBA 4YUZA 3N7UA 5IDVA 1I5EA 1NX6A 5DM2A 1O95D 1UDWA 3GRCA 1I36A 2X3UA 1WSAA 1DAFA 3U80A 1XTZA 1DJNA 3HYSA 2FHSA 3B3GA 2YXLA 4PU4C 3NWJA 2GK6A 4IDOA 4U4AA 3QYAA 4NOJA 4W99A 2O7SA 2Q7OE 3VR3D 4F6CA 2VUUA 1NQ5A 2BRUC 1H1LA 1ZP6A 1WBDA 4TTQA 5E7MA 4ZVTA 4W63A 1RWVA 1USUA 2HMSA 4HX2A 3GB9A 5CA1A 4TM8A 1VKZA 3MWFA 2PHZA 4AWBA 4OMUA 3I1FA 5CEEA 3R40A 4OHBA 4UUAA 1BJKA 2HJSA 4HYYA 3AGPA 4D92A 1COWA 1OBFO 3F9CA 4PCLA 4WOBA 4XUCA 1PHPA 4RDCA 4OJTA 4S0ZA 3TPZA 3X1MA 1K86A 4DDHA 2CLLB 2PGIA 1NYTA 2QP3A 3THWB 4ZTBA 3UK6A 4OLHA 5A6SB 5A0VA 1Q1BA 1E9DA 5F7JA 2FF5A 2LPMA 5SZJA 1G2OA 2FLVA 5COBA 1X1CA 4I5IA 4PWYA 3VK0A 1JH9A 2FW1A 2VJCA 2L82A 3DV0A 1UPXA 1G0NA 4IX1A 1ADGA 3SX2A 2CD9A 2O2SA 2PO7A 4DUGA 5MN6A 3I01A 1A7KA 1N2CE 3FHJA 4LZZA 5CH3A 5FI3A 2O2DA 2B37A 3U3ZA 4OYLA 10MHA 1U2GA 1VCHA 1X80B 3P4XA 4UEQA 3T5AA 2BI4A 3ET4A 3EWSA 3GFGA 1FFBA 2VH2A 3F6PA 5FB3A 3TLAA 1M8PA 1JR6A 1W59A 3ZGNA 1FLVA 3JQGA 1EXMA 4FLFA 2B61A 4JVNA 4K8RB 4R1SA 5JMTA 4H0CA 4JR2A 3HGMA 1V16A 4O3FA 5IW8A 5CB4A 1PZGA 2DHQA 3BXXA 5MGBA 4RF3A 2GARA 1I3OA 1QGOA 1ZUD1 3LCMA 4LOJA 4OV6B 4RKRA 5B4UA 3ND5A 2GEFA 1AKWA 1CUCA 2JHPA 6CHYA 5DULA 4O0LA 1Y8AA 2X41A 2CDNA 5FD8A 3TXYA 5MHTA 5BMVA 4ZFNA 2BFWA 3AHEA 1ZMBA 2WTXA 3LQYA 3QW2A 4KN9S 5LM3A 4MUHA 4YJDA 4BBZA 3ENKA 1UMKA 1RC0A 2VOEA 1E5DA 4HNHA 1GQYA 2WICA 1POXA 3MWEB 1KAEA 4OPMA 3LFUA 1HKUA 2ZK7A 2C95A 1TC2A 4HNGA 1PW7A 3QVJA 3WNZA 4LNAA 1IXRC 1NMSA 4PLCA 5BW4A 3PGVA 1QGED 2GAOA 3HWSA 5G4LA 1BO6A 3WL3A 4QM6A 1SQSA 4Q4LA 2PQ2A 1Q0RA 5CLIA 5DLEA 3G3EA 3GUCA 4A23A 4N8DA 2FSHA 1KFCB 4KVAA 4P32A 1EEXB 5JFTA 2OCPA 2E7ZA 2V55B 3ZN2A 2C98A 4PR3A 1IOZA 2AMYA 4BLUA 1C9DB 2IHJA 1LV7A 3GJ0A 1TQ8A 4W5QA 1NFQA 1HGXA 2FW6A 4OQFA 2ZRCA 4KYVA 3NCHA 4TSKA 2VK8A 3RYIA 3DDUA 4ZVSA 1MC8A 4EI2A 3BQNB 1DU4A 1WV1A 3T4PA 5JXWA 4GMXA 3W9SA 4M99A 1K89A 2YVKA 1GPH1 1PTJC 1X9GA 5FAXA 1AC5A 1GGEA 2A5LA 2FPIB 1EJ0A 4OKIA 3UMMA 1Z75A 4D45A 4FEGA 2FJPA 3VH1A 4BO6A 4LZOA 4FFLA 3NUZA 3KQPA 3VU3A 4ID9A 1E2GA 1EVJA 1SVLA 2ZWMA 1UK6A 1YK1A 3UWOA 4D9KA 1JKFA 3WB1A 1FTWA 3NYIA 4G1MB 4CF5A 1L3CA 1BDIA 1NSFA 4W8GA 5HIMA 3CVXA 1F8GA 2AI2A 2WUFA 4OAOA 4J9VA 2DUMA 2I3ZA 5DW3A 3OZTA 3F5SA 2WJAA 4RS4A 5D00A 4BC1A 3U5TA 2IYZA 4DSNA 3WG9A 1IPEA 1NL3A 1M1NA 4F60A 1NPDA 3RRBA 3TIGA 1M0WA 5TNXA 4ECEA 4Z4QA 1Y8RA 4DQVA 1XZPA 2WLTA 1XR3A 1Z6GA 2D8MA 3NC0C 1ZRNA 2QYSA 3VYTB 2IZ6A 4QEKA 3FNBA 3AR5A 3C8MA 4C43A 4ZCMA 1QGUB 2FFBA 5FPTA 4R6XA 3RNOA 2ZUSA 1A97A 3BWXA 3LXRA 3AM5A 1KEZA 4LJ7A 3UUGA 4D8YA 5I9SA 4MARA 2UYOA 2X2FA 4QC2A 1OWPA 1JEQA 2O0MA 3JTMA 3B1JA 3CT4A 3DR5A 1PG2A 1YUMA 3AC0A 1OZAA 4TTPA 4YUVA 2C2OA 2XLCA 1CRPA 5HMLA 2H9YA 1LLUA 5B57C 3ZV7A 3D4PA 4MCXA 1SVMA 4B73A 1Y8ZA 1Q91A 3ADBA 4D25A 2ANBA 2GYUA 4TMWA 5KREA 2P9FA 3CH5A 3DOUA 3MBKA 3GMTA 5C7LO 4J0DA 1YMVA 1R0YA 3ROEA 5M7EA 1I0LA 3PXGA 5G4KB 4GWGA 1G9TA 4QSHA 4E5VA 4WASA 2V59A 2XXAB 2XUOA 4JASB 3CLHA 3A6FA 3WOHA 1AB5A 4LBVA 1K3FA 2PL1A 4MV7A 3PPVA 5EZYB 3HZHA 1C50A 1GTL1 5CM2Z 4A4DA 3LBAA 2VPYA 3S2YA 3NVKI 1LDNA 1DULA 1LZKA 3FNRA 2QTZA 4Q03A 4ZXFA 3SXUA 1MX3A 1IWPB 2H0AA 2TMGA 1WNTA 4B3MB 4LFAB 1TUEA 5GGYA 3LX8A 3KOMA 4DR2B 4US1R 4DHWA 1XDUA 3GQBB 2HJRA 2QSUA 5TIIA 1DT5A 1S4MA 3EMVA 3WMGA 5EPOA 1TW3A 2QR3A 4L16A 3UCXA 1U2SA 4NZNA 3BOSA 3HCCA 3LG2A 2G17A 5KC9A 3KXAA 1HNNA 1KO7A 1PDVA 1UXOA 1WU8A 3EGDB 1T26A 3ISVA 3DTYA 3QLUA 1XMOB 5KTRA 4RLSA 3K0FA 3QG1A 1XZFA 4QPJC 1SUFA 4M55A 4KN5A 4Z53A 1WKCA 5I4BA 4I1RA 4O2AB 5EYPA 3RI3A 1ID1A 1GYPA 2EIXA 2I2BA 3EZ7A 1N5LA 3W9YA 4BMCA 2IPMA 2XD9A 3VTFA 3RC8A 4M1TA 4XX0B 4UEWA 4ODIA 3PENA 1JDNA 1D9ZA 5D85A 4B6OA 1B0NA 4TTTS 2VQFB 2QW8A 4JA0A 4C30A 1RW4A 2RC5A 3WLJA 3O4JA 3MC1A 2FTKE 4Q82A 3RKUA 4O8CA 3WDKA 3KU4A 3AINA 5ECYA 1V2GA 4IV0A 2PWZA 5TQJA 4Z1OA 1SKMA 3UWKA 1CUJA 1KU6A 1V4NA 2JVJA 4R83A 1SKBA 4LA4A 1IN4A 3UGKA 4I08A 4C76A 1YBVA 2NM0A 1Z4KA 2OCDA 2IYUA 4AZ0B 5HRCA 1D2HA 4FEAA 3UFXA 2PK3A 3CVYA 3SF0A 2DUJA 5HZKA 2QGZA 2XGOA 2WJJA 3D5EA 2QN6A 3W4IA 1YZLA 2D5LA 3N2YA 2WT4A 4XM2A 5EHGA 5CRIA 4WX2B 2UYHA 3FYMA 2JAXA 2NZXA 2G72A 3Q5GA 3Q3EA 3H9CA 3U0BA 4FPXA 4PLVA 5LOVA 4TUYA 1P19A 2ABWA 1LFDB 1CZRA 4JN6B 4UUQA 1QSGA 3QPCA 5EIOA 2OCBA 1LY1A 1KO8A 3NWOA 4ABYA 4HH3C 3WK9A 3MVEA 2V5AA 3GOQA 4PU7A 1BXRB 4NCJA 2EQ5A 1AMUA 1M8KA 1P81A 3X43A 4WBNB 2E48A 1XIVA 2BD0A 1L1EA 2IUOA 2WD7A 3IOMA 4PPNA 3ZWBA 4B7ZA 4LV5B 4D9NA 3EZ6A 3WTCA 4C89A 1OZFA 2PXLA 4LPSA 4OJQA 1TU3A 5F7XA 1KFBB 5DLQC 3DWGA 1WUHS 2OE2A 4OHZA 2HMAA 2PX3A 4HDNA 2XWPA 1JLMA 4IJ6A 1L7QA 3CECA 1DWQA 1QCCA 4BJ5A 1TFRA 4OUDB 3EZ9A 5ENZA 4UDXX 8ADHA 4ARSA 3LHDA 5AJXA 3NOOA 3TEFA 2QD2A 5F5XA 3UEOA 3VR4A 2FI1A 1U9ZA 4QTUB 4QUBA 1XDZA 3I62A 2JFXA 1UUFA 5IAAA 2QRPA 1UBUS 4YP7A 3U17A 1Y8CA 4M49A 3UXMA 4YYZA 3ZY6A 4MRMA 5FEUA 1ORDA 1MG0A 3V46A 3LZ6A 3QFSA 4B71A 4BJ1A 4ONEA 3KQYA 2Y6VA 4DBZA 2FA9A 3KSAC 3QY0A 3E0QA 3I5MA 1A8QA 4O4IF 4ZI7F 4E15A 2VF8A 3VO8A 4DLXA 4DMKA 2A5YB 2IHBA 1BWSA 2ZU6A 1XK7A 4FS3A 5ITVA 3JQAD 5DXJA 2JAHA 3AX6A 2XVMA 3OQVA 4FSDA 4I3FA 4KGDA 5FBLB 3REQA 3F51A 1NASA 1P2UA 3F1KA 4P7JA 5EJGA 2VNSA 3WGUA 2YV4A 5E7JA 1DUSA 3QVVA 5JYDA 5DNEA 3PFFA 3RG8A 1IYZA 4S1WA 2E9SA 5KNCA 2HFKA 4R2LA 1G42A 3RR2A 2NU9A 2VBIA 5LQJA 1CFZA 1WSBA 5DHUA 3HRIA 4XWOA 2GO7A 3N2LA 3HUTA 3P0JA 3BWVA 4HMPA 2HSJA 4R84A 3T7TA 5LMZA 3BXHA 1FRFS 3KV1A 2VYCA 3I9V1 2A5DA 1GPAA 2A0WA 3M6WA 2CXHA 3G0BA 4RH1A 2XQKA 5FNVF 3BL5A 1EDBA 2P69A 3E5MA 3R6WA 3UJCA 1GKLA 2XA2A 4RHFA 3K9WA 4TTIA 2I5PO 4HNUA 3T1HB 3UMCA 4FK8A 2H0RA 1F5NA 1CEEA 1KEVA 1VE3A 2VYVA 4ND8A 4C78A 721PA 3ZZMA 2IDJA 4G0YA 1Y5LA 1FA9A 3IVMA 3KCQA 3N2GA 4L85A 4Q7KA 3SS7X 4CN9A 1KWKA 1U98A 2OV8A 3D8SA 4R5HA 1AJEA 4CIDA 3SY8A 4QLBA 3BZWA 1X8JA 1E92A 3WO1A 3DNPA 4F8EA 2O9JA 4EYGA 3DD1A 5IJAA 3SC2A 2CXNA 4UOEA 5GAHi 3W79A 3IOEA 1R9JA 4WQMA 4RSGA 3L41A 1H8ED 1ZNWA 2FVXA 3QVGA 4GXQA 1T10A 3QU7A 3T9BA 3I23A 1EIZA 1GFIA 5NULA 5B4TA 3ADCA 2OBLA 2HA6A 3OZAA 4BO1A 1N32B 1CUXA 4PX5A 2XYHA 1VYVA 2BISA 2RK3A 3FCSB 3P9ZA 5DKFA 3VR5H 2XDAA 4HY3A 2KLBA 4CKEB 3EWNA 5H4HA 2R1ZA 4FCVA 1XRJA 3NH6A 4O2BB 1UWKA 1QIJA 4KWHA 3WQSB 3UMRA 5JCOC 2ZIXA 1NVVR 4I50B 3I4LA 2D1RA 4YMVA 1Y3IA 2X1VA 1DC5A 4M6WA 2P65A 1LVUA 4JBGA 4ZAFA 3WRYC 4D26A 3LKZA 3TI7A 2CDBA 3TCXB 5HS4A 2HV8A 5KDOA 4IIDA 1G8AA 3DEJA 4PAQA 4Q1DA 1QRRA 2I8AA 1BX1A 3PVCA 3C2QA 3UBMA 4HNRA 4HWRA 2ZSKA 5JATA 4UMVA 4ARZA 4JEMA 5HF9A 2FXIA 2GZRA 3QP9A 2IKSA 4LZLA 1S6YA 3DH0A 3TKLA 3UMVA 2VK4A 3DEIA 4FFMA 4LE0A 1TNDA 1E69A 1NUTA 2AVDA 3M6VA 1IY0A 5JCPA 1ZSYA 2ZRLA 1KP9A 2QD4A 4QOJA 4Q7JB 1CIVA 5LKRA 1RHMA 3TDNA 3IELA 3GR6A 2WAXA 3CVWA 1JLLA 2JIQA 3QBTA 1DJLA 1Q44A 1QIKA 1DRJA 1QR6A 3VNRA 4AZWA 4UTVA 4C2UA 3TEJA 4BKRA 4QUJA 3V4FA 3ZBQA 3DFZA 3MGBA 2V0GA 1J42A 3DXYA 3RC3A 2AUNA 3OEEA 3A14A 1Q1QA 2QW1A 1M1XB 3OAAD 3RFTA 4BOYA 1V3UA 2PN1A 4MR8B 3L92A 4BXOB 2J3IA 3BBLA 5IVDA 1WPRA 3ELUA 1OLXA 3HB4X 4WPGA 1O4XA 2H4ZA 4XD2A 3UB3A 4YRCA 1XEWY 3HVRA 3BF8A 5AI9A 1YRQA 2FUEA 4H1TA 4UMEA 1R88A 2OGUA 2MWMA 2PMWB 4IS3A 1P2SA 2BFDA 2YMLA 1RYNA 3HJFA 5DX8A 3MXTA 4BIMA 4EHJA 3GAAA 1XPUA 2MSDB 1YZYA 1C9JA 1G8MA 4PNPA 1Z6ZA 4E12A 5FX2A 4RPHA 1I1QB 1R50A 4UDNA 3H17A 4A73A 4RCZA 4C01A 5JDCC 2UXCB 1B26A 2MXDA 2JKYA 4BX9A 3V4VB 3ESZA 3VKWA 4A0GA 3E9CA 5FTNA 3PJGA 4RJTA 4OUKX 2GLTA 4FKBA 5TQ0B 3L7OA 4OFWA 3BMCA 2FW0A 4QGGA 3M1IA 3FRIA 4FI3C 3TPFA 2XF2A 5FJIA 1XEXB 3R3WA 1F2TA 2BKLA 2GJKA 3PHHA 3D6AA 2AOUA 1JILA 3KAJA 5CDTA 1ZOLA 2JANA 3H4VA 3NBFA 3K32A 4L5AA 1HTWA 3J7AC 1HUQA 2YJTD 2EEZA 5IKOA 3H9GA 3PX2A 2DFLA 1U6KA 2C94A 4QVKA 4AUKA 1KF0A 2VZLA 4BE7B 2OO5C 3N87A 2DKOA 4RPIA 4XYEA 1ENYA 2JH9A 4P3KA 2CZCA 1GGHA 2QZ9A 4FFNA 4E51A 1RJEA 1YJQA 3STWA 2XRYA 2L19A 2JJYA 4MW7A 1DEKA 3BRCA 3RRYA 1F8FA 1M74A 4WHMA 4D0LB 5L4NA 3WFJA 4N0QA 5CXXA 4FM9A 4M8KA 2A9JA 4IFIA 1QAMA 1BXGB 4TKVB 1E2QA 4ND6A 3VNAA 3LCJA 4KOEC 4RM3A 1A9TA 4TLAA 4DLSA 1I33A 2GZHA 4CN8A 4Z9FA 2A84A 1E4OA 4MSUA 1XZQA 4D97A 3N0TA 3G82C 4KBFA 3T1QA 4AFNA 5EZ6B 4Z4HA 1CUIA 1N2GA 1C1DB 2J59A 4KXWA 1K2WA 1X3LA 5ADWA 4GX1A 2YR0A 2YFKA 2IX3A 2XJ4A 4D9MA 2JFGA 1JIXA 4GX2A 1H65A 1UKCA 4I36A 3S8EA 5BVHA 5E6UB 3N6VA 2OORC 4BP8A 1FEZA 1I2AA 2W4QA 3Q8XB 4NNPA 1ACJA 2SBTA 1ZNZA 3TQFA 4BZZA 3IUJA 2IXTA 4JA2A 3TTSA 1R10A 3BT7A 3OPMA 4MTLA 2J5RA 4C7OA 3LCUA 1ZNXA 3DE7X 4GG1A 5CK4A 1V35A 3EUFA 4TS9A 1G1MA 2GDJA 1BYUA 4YO8A 5JU6A 5AKYA 4ABTA 4YRQA 1QQ6A 1ZRMA 5BQOA 2GZMA 3AL0C 5LLSA 2ZT8A 3MT0A 4Y7DA 3EFOA 1KDTA 5AIBA 4ZJZA 4XCXA 2D1YA 2H7YA 2ZSUA 1U7UA 4GOMD 4Z0HO 1OCEA 4MB0A 3AM3A 5JCXA 5DTJA 2PXAA 1KQPA 2IZ1A 1E9AA 4PC2A 2IVBA 4HX9A 3RYCA 2JFWA 4O29A 4J03A 4UC0A 5B1DA 3P8ZA 4BMYA 4EFNA 2P6RA 3GUUA 1PS8A 2IY9A 2JHCA 4QYIB 2IWHA 1T8SA 2EZUA 5EFOA 4ZYWA 1C7ZA 4PCVA 2J0UA 2WFMA 4RJIA 1O2DA 5AI8A 3WK7A 2IXDA 5IWCA 2VT3A 5H3CA 2NXCA 2XCQA 1YQUA 4UFPA 1FNBA 1OJLA 2ZI6A 2FEOA 2XDQB 4TLBA 5J2UA 3OTGA 2KHZA 3VZDA 5JUWA 1NJ5A 4CKEA 2QW0X 3FWYA 5L3ZA 3A0UA 2XIQA 3Q1LA 3A31A 2NSLA 1HF0A 2VL7A 2ZUEA 1RAGA 2CKMA 2QRJA 4HLNA 3ZIAA 4BIIA 1MQSA 1JV2B 5A0FA 3ZNQA 4BP9A 2PKRA 3PQEA 3B3JA 4II3A 4LZPA 5CD1A 2VYNA 5FPPA 2BGGA 3UW1A 3NT2A 1A95A 4FFSA 4LVUA 4U2CA 3RLFA 2MINB 2HWKA 4JVLA 4M0FA 4MP8A 3FM9A 3LBNA 5C5CA 1VPDA 4YBAA 3KXDA 3SYMA 1JMKC 1DTWA 4AKSA 1N3IA 1MP0A 3AEUB 4V3BA 4XJTA 2GI4A 2XUQA 3DZCA 4Y1RB 3KQLA 3FZGA 1ZCZA 3LAWA 2X6RA 3PWSA 5HQJA 3SYNA 5TEVA 4RFSA 4U9UA 3ZHZA 1MZPA 1U2ZA 2Q4TA 3H2JA 3G2IA 3E53A 4DJFC 1E2BA 1VG8A 1R6DA 1XF9A 1O58A 1PS0A 3QYXA 3BGDA 4U6QA 1JXQA 3DE4X 3P0IA 3Q88A 4YB8A 3TIFA 4C3UA 3HV0A 1H3EA 3B2QA 3EXHB 3EMDA 5LB4A 3RJTA 3N6XA 2G1JA 121PA 2H8RA 2PH7A 1TU0A 1BQEA 1U2PA 3JWHA 1ORWA 4HTFB 3K3PA 4JFAA 3CSSA 3R3UA 2CMKA 1XRPA 2VDMB 5E3HA 3ECAA 8LDHA 3SGLA 3UG6A 4MRAA 1B43A 2O2HA 4BVLA 1P6XA 2ATCA 4ZREA 1ONBA 1NFRA 1SIBE 2Y66A 1GGFA 2AK2A 3L05A 1NXXA 3L6EA 4J94A 4ZVVA 3RSGA 2AIRA 3SIPA 2ZI4A 1ESEA 3HY6A 3N8GA 3UKJA 1U0BB 3R09A 3NMUF 5JAQA 5B2ZA 3HE3A 4U2GA 3BS4A 4D79A 5I4CA 3IBYA 4FHGA 1OX5A 1NMXA 5KX5A 3ZJTA 2IPLA 3RIYA 1VP9A 3L8HA 3NT4A 2CNNA 1H6DA 4YI5A 2I9KA 4YWJA 2H1RA 2PRIA 4TQGA 1K7YA 5L3SB 3G1TA 4RCVA 1XPJA 2ZJOA 4O5AA 5AICA 4AP5A 1KA9H 3ONVA 3ETCA 5CAEA 1N78A 1X8KA 1ZC4A 1DLIA 2QVXX 4J75A 1J2TA 2F1OA 4RHTA 3CNNA 1P1KA 4KTTE 4A27A 4CCWA 1OX4A 4FDAA 4GGOA 7REQA 5CVTA 5DSXA 2G1KA 4WERA 1H2EA 3WLHA 3DDOA 1QHYA 3ESXA 1U5CA 1N92A 3DEAA 3TBKA 4BGIA 2QTNA 4TTAA 3S5UA 1MJNA 1L5YA 5EHXA 4BX8A 2QEQA 1CR1A 5DP1A 2HA5A 4I1SA 4LWPA 2HZ7A 2AW3A 1ZYUA 3ZLJA 4II7A 3E7PA 3YASA 4HXFB 2ZTMA 1YIAA 3BAFA 3LHSA 2XDYA 1NC1A 1W76A 4B7AA 4YG1A 4L4ZA 2ZPTX 3DZIA 4ZOQI 4K6KA 1IM2A 4H18A 4TL6A 2PUFA 1DUIA 5GJBA 1W49A 3DT9A 1G17A 3K73O 2M32A 2FMUA 3CH7A 4N3AA 4ENRA 3EQ6A 3RZZA 3L8DA 2JCGA 1XQ6A 2ZI5A 4EO9A 1IAQA 4FGZA 1HFWA 1LDGA 3F2VA 4J1QA 4JNCA 1L8QA 1H9CA 4QYMA 1GO2A 3O1LA 4D80A 3ZE1B 5ARDA 3M2PA 1E3QA 4L2IB 2R6R1 1GKKA 4N0EA 1EFDN 3B5JA 2H7CA 5DCUA 4MRPA 4CM9D 4INZA 2R5FA 1EK1A 2BGLA 3AERB 2JCYA 3ORSA 4WOCA 1ONPA 1P9RA 3QKUA 1ZESA 2NVUB 2QP9X 4MMZB 4Q7QA 1YFLA 1HEIA 2QVBA 1Z5VA 3L1UA 4GH5A 5FULA 3KKQA 5GP1A 3V55A 1JJAA 5K3EA 4IDAA 1C0PA 1TIPA 1K75A 3NBKA 3AFHA 5CNKA 1JFLA 2WU4A 3GLTA 3IDFA 2CNWA 1YQTA 4TWBA 3X1WA 4JWKA 1TOAA 5INTA 1T6YA 2IBMA 2HCTA 1L5LA 1GCIA 3HO6A 1SHLA 1YDEA 4TM7A 5F76A 2OLEA 2IEZA 4JGGA 2JVLA 3R6LA 1GLGA 4RK1A 2RAUA 4HLDA 1AU7A 5GWXA 5EP3A 1X7YB 2BCJQ 1O96B 3VU8A 1A50B 3E5NA 3JCZA 3G17A 1SVOA 2DSTA 3IDSA 5B7PA 4GBGA 3RC7A 4F6LA 2YUIA 5AI6A 5J40A 2P7IA 2ZSIA 1UZNA 3EFHA 3M70A 4S0XA 2QQ0A 1RM4A 1VLHA 1PFWA 3EPPA 1V1MA 5AJZA 4MS3B 3ZTTA 3S44A 2J5XA 1U28C 1SOVA 4EWLA 2GRAA 5AM0A 1E1RD 4RW0A 1H69A 3U40A 1G60A 2WSIA 5K1ZA 1TJ4A 1QRUA 2GCOB 4MPTA 2XMQA 3ZW7A 2H4HA 4KXLA 2WQ6A 3PR1A 3AKEA 3QWAA 1VB5A 5IT9A 4MGHA 3VAZA 3KYDA 2WKSA 3N07A 2J08A 1D5CA 2PQMA 2AKYA 4CMJA 3C48A 2XIJA 2DJIA 1Z26A 4H7DA 1JKJA 1QV7A 2RIRA 3BB4A 3PXCX 2HJHA 3M3HA 2DTEA 4TS1A 3RS9A 4CMKA 3P0RA 6REQB 5AVUA 3G0GA 2JFZA 4AG6A 3KYIB 4C0WA 4ETMA 4FFWA 4P58A 5BRJA 5F9HA 4K9QA 4OMCA 2PFGA 3T7KA 1RPEL 2ZANA 1HLGA 1W47A 4RTKA 5H80A 1NVEA 3LQQA 4BTEA 3QYFA 3VHXB 3V1NA 4ARBA 4LDJA 1SKUA 2Q2VA 4K6FA 2JCXA 4P4TA 1UIRA 1UAYA 2LV8A 4IW3B 5LQKA 1GZ5A 1RRPA 3UH0A 2YMMA 2VAWA 2VHWA 3HKCA 4DM3A 3HDHA 3ZXYA 1P8JA 3L9WA 3C3BA 2Q29A 2PBFA 3OJ0A 2V0CA 4UZSA 1OH8A 2PXFA 3URMA 2NU6B 2PU7A 2IVFA 3HCOA 4ER3A 1RVV1 2C9MA 3NDJA 4LBZA 5FFFA 3LYUA 2JGMA 1QTQA 5BT8A 1XLTC 1CY4A 1OGJA 3LKVA 1E66A 1UJBA 1PO7A 2OK7A 4IQGA 2O3RA 4R2IA 3KCNA 3DFFA 2ZSAA 4KYUA 4RMIA 5E4TA 5J4KA 2VQSA 4MDFA 4Q4AB 3E22B 4XGQA 4OCZA 4KK3A 4U8GA 2EX1A 2I6QA 2XB8A 5FIUA 2X8JB 3Q7QA 1G20E 4AG3A 5IT4A 3JRWA 4Q18A 1ADBA 2J6BA 1KJ9A 2RKBA 3ANLA 3GQBA 4KQMA 3II6X 1SIOA 1DIHA 4O4JA 1L2TA 1S96A 3LYHA 1MC5A 2GVNA 3STTA 1CS0A 1MO2A 4FB4A 1PFQA 4FFOA 1IUOA 4OQDA 4DJDC 1DX9A 2BBTA 1DEHA 3DG9A 3LY5A 3O31A 4UUBA 2WWRA 1Y4AE 3MPOA 4UTXA 4DDKA 3U13A 1T9KA 4C4AA 4I99A 1W5SA 1N57A 1AMNA 3GX1A 1BCSB 1JHOA 3O3NB 4MVJF 2ORED 4EZIA 5KAPA 1QQ7A 5LBTA 5ICFA 1EUCB 4PLHA 4B74A 3EPHA 1Z8DA 3AESA 2AC7A 5JO0A 1E94E 1A5TA 1CJGA 1DC7A 4IHJF 2WMYA 3V8VA 5A4AA 4PFSA 3HA3A 3P52A 1AX9A 1YH3A 3KPUA 4N1AA 4EDFA 3JQDA 4JHXA 2PM8A 4CGZA 4RKQA 3H5WA 1J1ZA 1DIGA 5SICE 4D7AA 4QJ4A 5K3AA 4MLPA 4ZO7A 1LMB3 4YPFA 3IR7A 3EUEA 1E9EA 2FN4A 1GITA 1W4LA 1KFKB 3NKVA 2KEJA 1D9XA 4GI2A 1MV5A 4KU4A 1RYMA 1U7DA 1WPXA 1FP4A 4Z9YA 5F52A 2RBEA 3KUDA 1VMAA 4X20A 4AL4A 2EX0A 1QJCA 2VJAA 1JBEA 3OP9A 1ZM3A 1WB6A 4CIVA 3LYLA 4F6RA 4L78A 3SJZA 2W58A 5CDUA 3UHAA 3OM9A 1E3EA 3JY6A 1M9NA 1UK7A 4EDHA 2OAEA 3KKMA 3VDQA 4D74A 1PR2A 3ZLTA 4W5TA 4PYRA 2M6RA 3A04A 3VI4B 2VTVA 1CEYA 1GPUA 3H5VA 4BZQA 1ZL0A 2NPFA 3IB6A 1GPNA 3K70B 1N5IA 1OJ7A 1V9CA 1RIIA 3NNSA 4IDDA 2FUNB 4A16A 1XPOA 4LQDA 1CBUA 1SKYB 2C07A 5LZ8A 4CM4B 1XC7A 2JFVA 2QNRA 4CG0A 3WIVA 1Z6TA 2VNKA 3GXBA 1ORRA 3QELA 4GPEA 5GVRA 4O0MA 5HE9A 2XXJA 4HDQB 4EJSB 2BFCA 2R68A 1KRHA 3D7NA 5ILQA 2BFCB 4IVQA 3SFZA 3N2ZB 5FPKA 2BFBA 2CLSA 3SSOA 3E3AA 5JIBA 2ODQA 1PEAA 4EAQA 1V9LA 1ADYA 1L3BA 3HXPA 4EBBA 4G5YA 4ZO9A 3SBEA 2FUG1 2WKPA 1D7OA 1OKKA 1UANA 4BS9A 4X44A 4Q1BA 5CG1A 1QYWA 1XZAA 5DM4A 4CVNA 2UYCA 2GBCA 2HC9A 3N5CA 4MEAA 5CJ2A 1AGXA 1RRMA 3ICCA 4XGIA 3AVOA 3H9UA 5BVHB 4NEGA 2I3DA 2JGDA 3CKMA 4EY8A 4D4HA 5AYVA 4ARVA 4M8NE 4DCNA 3QU9A 3THRA 5ELLA 1C7QA 5DW0A 2VN8A 1GLNA 4G36A 5B58T 3E7XA 2YV3A 2X13A 4C7OB 3WGZA 1BVHA 2V7WA 1SQ0A 2LW7A 5LP6A 3M3DA 3LO8A 2P5UA 2FB9A 4B87A 2EW8A 1F6WA 4ENSA 1Z47A 2DZDA 1D2RA 2C9OA 5F9FA 4MCTA 1LA2A 1JKMA 2WT8A 4CMAA 2JLWA 1ZDMA 1FZTA 2F7SA 5BSKA 3SS9X 2WUSR 1NKTA 1XCMA 4B6FA 1GU0A 1H42A 3WLOA 4EKGA 2GHQA 2CVPA 3AF6A 2D54A 3GYGA 3IPAA 3KBBA 1K8QA 3NIGB 2O2YA 5J2TA 1K2VN 2JGNA 2W71A 3OJWA 4KQCA 3RTCA 1YWGO 3SYTA 4P33A 1B7GO 2QOEA 5TMBA 3PE5A 4MKRA 2P9CA 4NP6A 3C3JA 1PV2A 4C4ZA 2VRWA 3QXSA 4QLOA 1GGNA 4MIYA 3NDBB 3BWYA 1NM5C 4TLCA 3PZRA 1FNNA 4TMXA 2ZBGA 4XW2A 2LCVA 1YZ3A 4PGFA 3QF7A 3I12A 2DB3A 2BOVA 2J31A 4ZTZB 1R5BA 2ZLBA 2PLWA 4DJTA 3SLKA 4IUYA 3WWDA 2CNDA 4YG7B 1X1EA 2RG1A 2BUBA 3EXFA 4HS9A 4OU4A 4UULA 5EP1A 5UKDA 4EW3A 5IM4A 1J23A 4YRPA 2DERA 2GDZA 1XZGA 4J9UE 1MRNA 4AB1A 1NNI1 1UBHS 4AKTA 4HH4A 4OBXA 2QG9A 3HP7A 4UHCA 2R97A 5A71A 1ODKA 1HZZA 1CUFA 1AKQA 1KR2A 1U1EA 2YUTA 3R20A 1XZEA 3E2IA 1XN1A 1H4VB 1F4PA 2IGBA 2JB9A 5JHHB 3PJDA 5IJZA 3T52A 4OGFA 5K0LA 4D9CA 1XQWA 3HCRA 1F12A 3BE8A 3MMPA 4QGAA 3REOA 2DHDA 1M6VA 2P9GA 3D7KA 3QTTA 3GJ7A 4E03A 4N76A 3TYXA 2FQQA 2GBLA 3C6KA 4M86A 3UVEA 2XDQA 2QN8A 1I32A 2VRCA 3LIPA 2PFSA 1BTOA 2W98A 1SCUB 5D2CA 3V4PB 4QUAA 3H11A 1R15A 1T43A 2I80A 5CXQA 3NDIA 1RYHA 1WW3A 1U8FO 2F3SA 3T41A 3M6MD 4KO2S 1T4MA 1Z88A 1UEXC 1JEOA 1LWOA 4YAFA 2OWEA 5GADl 1UPUA 5CM9C 3KZMA 2GX6A 3G2NA 4H6XA 4B76A 4D6YA 3UH1A 1E9SA 3L01A 2ZTLA 3UV3A 2ZVDA 2O5VA 3VYRB 2A8YA 3LY9A 1NA5A 3KZVA 1S02A 3RYFB 4G89A 4I1PA 7GPBA 3VVCA 3SEZA 1XAHA 4EKEA 2KPOA 3NPMA 1NR7A 4B32A 1FP7A 1VKHA 5D01A 3WISA 1XYYA 3F90A 4AN0A 1EH5A 4HEA6 2YJ3A 4XWWA 1J5XA 4UM9B 1A04A 3CF2A 3RSCA 4J2HA 5IH3A 4OX9Y 1FTQA 5CJJA 4R1NA 1KDPA 3O9XA 1RPZA 5J4LA 2Q8NA 1M6EX 1UFRA 2X0RA 3G85A 2V7QA 1GUYA 3ND7A 5CPFA 4M0UA 3AFOA 1QFMA 3DBRB 1M2JA 4H08A 1G3RA 1MA0A 4N39A 3TEMA 1T5TA 4Q66C 3UK2A 2WYWA 1BW9B 1NJ6A 2BF4A 3A27A 1N8SA 1CB0A 2O4AA 1ZIDA 5H9VA 2WAAA 3CCBA 3IAXA 1JG7A 4YMIA 3GLGA 5KYWA 1MAVA 3KQHA 4F3YA 1EJBA 3ZWOA 3KZ3A 1XRLA 2YVUA 3GRAA 3OVMA 2D62A 1YHZA 4HWPA 3WNCA 1QH1B 2NSJA 2OYCA 3C39A 1FU4A 5T7BA 2WKQA 1Z4LA 1ZZBA 3OU6A 4NZYA 4PC7A 4UBNA 2I2XB 3UAGA 2CVQA 5COAA 4AMGA 1G63A 1T0PA 2XHZA 4ARAA 2J87A 3C43A 1P1FA 3PNLA 3ZXUB 1AQJA 4LJLA 1CUEA 1N2XA 2C88A 1I7SB 1PEDA 4K40A 5ALHA 3WYEA 1UP4A 3T1NA 4QDZA 3DFIA 1Q2UA 1EWTA 2J9FA 4JBLA 4IJQA 3V7UA 3NASA 5CUQA 1U3CA 4K7JA 5IABA 2DE0X 1JSLA 1KDRA 4HH1A 4WI1A 4YMWA 4MEBA 1JZQA 1RC8A 3E1KA 4BVFA 4FE4A 3L8MA 3P9SA 3ZWDA 3MQ2A 5AESA 1YACA 3OSZA 1HL7A 2ZTVA 4OHVA 2HW8A 5DNDA 4H0NA 2WD7B 4J0EA 1I3KA 3DWEX 2CL5A 2BKAA 4MV5A 5L7YA 1PV4A 1A72A 1V1RA 3D3WA 3ND9A 1TD9A 2WVGA 1KZ4A 1HMYA 1QM5A 1UJCA 4RYDA 2JKZA 3GD5A 4RA9B 5FI5A 2IHVA 1I0ZA</