2OR1L

Recognition of a dna operator by the repressor of phage 434. a view at high resolution
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
63
structure length
63
Chain Sequence
SISSRVKSKRIQLGLNQAELAQKVGTTQQSIEQLENGKTKRPRFLPELASALGVSVDWLLNGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recognition of a DNA operator by the repressor of phage 434: a view at high resolution.
pubmed rcsb
molecule tags Gene regulation/dna
molecule keywords DNA (5'-D(*AP*AP*GP*TP*AP*CP*AP*AP*AP*CP*TP*TP*TP*CP*TP*TP*G
total genus 18
structure length 63
sequence length 63
chains with identical sequence R
ec nomenclature
pdb deposition date 1989-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF01381 HTH_3 Helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2or1L00
1LQCA 2BNOA 2LYQA 2D5VA 4JCXA 1ZZ7A 1ZZ8A 2IVGA 1ZZ6A 3SCGA 5A7LA 2XCJA 1L1MA 4I6UA 1LCDA 4YBAA 4PU7A 3JXDL 2ICPA 4X4DA 2JCGA 1X2LA 3SCFA 4X4BA 4X4FA 1Y9QA 1E3OC 1QQBA 2IV1A 3ZKCA 4X4CA 2LYJA 3G5GA 3QWGA 2AW6A 3KXAA 4YG4A 1PNRA 2IU7A 1PERL 3KZ3A 2MEZA 3SCHA 4YARA 2CROA 2BJCA 2H8RA 2HSGA 3IVPA 4YG7B 3F51A 1R69A 1PRAA 1B0NA 1QP7A 1ZZCA 2IVBA 3FMYA 2XI8A 2PUFA 1OCTC 4IVZA 3O9XA 2LYSA 2PUGA 1AU7A 2KEIA 1ADRA 4X4GA 3D1NI 1GT0C 2PUBA 2CSFA 1ZZBA 1LCCA 1RZSA 1XWRA 2GRMA 2PIJA 2KZ8A 4GHJA 3TRBA 2EF8A 1UTXA 3GN5B 1R63A 3BS3A 2FJRA 1POUA 4I6RA 4MCXA 4Z5DA 1RPEL 3RZZA 2AUWA 3G7DA 1RZRD 2R1JL 1LMB3 3MLFA 4JCYA 2AWIA 2WIUB 4FN3A 2PE5A 3R1FA 2GRLA 4O8BA 3B7HA 1ZPQA 2A6CA 4JQDA 2PUDA 3GBFA 1NEQA 2LYPA 4Z5HA 1RZRA 1S7EA 4X4IA 1DWKA 2PPXA 2KEJA 1ZAYA 3F52A 3FYAA 4FBIA 1ZUGA 4PU3C 1EFAA 1NERA 2WUSR 3LFPA 1BDHA 2XIUA 3OQNA 1Y7YA 2L49A 3BD1A 2BNMA 2LYKA 1CJGA 2PUCA 1PRUA 1JFTA 3U3WA 3VK0A 2BNNA 4GQMA 3UFDA 3EUSA 2IUOA 3ZHIA 4J1XA 4F8DA 1VPWA 2PUEA 2MQKA 4Y42A 3F6WA 3OQMA 4NDWA 1ZS4A 3GN5A 2AXUA 2EBYA 3KJXA 3PXPA 3L1PA 1OSLA 1BDIA 1ZVVA 2PUAA 1DW9A 4I8TA 1SQ8A 2LCVA 1UXCA 1WIZA 3FYMA 3CLCA 1QQAA 1UXDA 2KPJA 3OQOA 4PU4C 3QYXA 1IC8A 3OP9A 1PRVA 2LYRA 1HF0A 1O4XA 4X4EA 4OB4A 1WETA 2ICTA 3BDNA 4PU8A 4Z59A 1LLIA 1QPZA 2OFYA 3CROL 1JWLA 2XSDC 3JXBC 2OR1L 2AXVA 2GZUA 2R63A 4MCTA 2B5AA 2O38A 1CQTA 2LYLA 2L8NA 1JH9A 3QQ6A 5K98B 4Z5CA 3HZIB 2XJ3A 2O4AA 3CECA 4I6TA 4IA8A 2O49A 3QF3A 1RIOA 1WH8A 1WH6A 1YSEA 3S8QA 3LISA 1QP4A 1QP0A 2EWTA 2IVQA 4J1WA 2HINA 1JFSA 3JXCL 4X4HA 2KEKA 1X57A 2AXZA 3DNVB 2JVLA 3ZHMA 4IWRA 4YG1A 1ZZ9A 4Z58A 3H5TA 3OMTA
chains in the Genus database with same CATH superfamily
2BNOA 2LYQA 1ZZ7A 3TELA 5A7LA 4ER7A 4YBAA 3JXDL 1E3OC 1QQBA 2LYJA 3NDBB 3QWGA 3KXAA 2IU7A 2J7UA 2ODRD 2MEZA 3SCHA 2H8RA 3IVPA 1R69A 3FMYA 2PUFA 3O9XA 1AU7A 2FFHA 2KEIA 4X4GA 3D1NI 1GT0C 1DULA 1RZSA 1XWRA 3TRBA 1UTXA 3GN5B 4MCXA 2AUWA 2R1JL 2JQEA 2MXDA 3MLFA 4FN3A 4O8BA 2A6CA 4ER3A 4JQDA 1NEQA 1S7EA 1U2ZA 1DWKA 1ZAYA 4FBIA 1NERA 2WUSR 2XXQA 3OQNA 2V3CC 3BD1A 2BNMA 1JFTA 3UFDA 3ZHIA 4Y42A 3PXPA 2PUAA 1HQ1A 3FYMA 5GAHi 3CLCA 1QQAA 3QYXA 1HF0A 4X4EA 2OFYA 4EKIA 4EK9A 2XSDC 3JXBC 1JH9A 4DE8A 4ER0A 4IA8A 3QF3A 3NZLA 1WH8A 2EWTA 2IVQA 1JFSA 4IWRA 1ZZ9A 3H5TA 3DM5A 4JCXA 1ZZ8A 1ZZ6A 3QOXA 4I6UA 1LCDA 1QB2A 1QZXA 2JCGA 1X2LA 4X4BA 3GZDA 2LNMA 2IV1A 5DSXA 2AW6A 1PERL 3KZ3A 3SX0A 2CROA 2PXPA 4WVLA 2PXVA 4YG7B 1OCTC 4IVZA 3ME5A 2PUGA 3GZCA 3GZDC 2PIJA 3BS3A 4ER6A 3G7DA 1LMB3 3UWPA 3R1FA 2PXEA 1ZPQA 2PUDA 2PXDA 2LYPA 1RZRA 2PPXA 3F52A 4PU3C 2XXPA 5JUWA 1Y7YA 1CJGA 2PUCA 1PRUA 4GQMA 3EUSA 2IUOA 3NXHA 4J1XA 2PUEA 3GUUA 3F6WA 1ZVVA 1BDIA 2PXFA 1DW9A 4I8TA 1SQ8A 2LCVA 1WIZA 4Q2JA 4PU4C 3OP9A 1O4XA 5DRYA 3BDNA 4Z59A 1JWLA 2OR1L 2R63A 4MCTA 4EZIA 2B5AA 2O38A 1CQTA 5GAGi 5K98B 4Z5CA 3S8QA 5DRTA 2PXBA 1QP0A 2L1PA 2PXUA 4X4HA 2AXZA 3SR4A 2XCJA 1L1MA 4PU7A 2ICPA 3SCFA 4X4FA 3ZKCA 3G5GA 4YG4A 3R09A 5DT2A 3OKZA 3VWSA 4YARA 4ER5A 2BJCA 1PRAA 1B0NA 1ZZCA 2IVBA 3QOWA 2XI8A 2LYSA 1ADRA 4EQZA 2CSFA 1LCCA 2KZ8A 2EF8A 1R63A 2FJRA 4I6RA 1RPEL 5DTQA 2AWIA 2WIUB 2PE5A 2GRLA 3B7HA 3GBFA 2PXKA 4OBMA 3FYAA 3M9LA 1ZUGA 1EFAA 2XIUA 3TFLA 2L49A 3KL4A 2MQKA 3GN5A 2AXUA 3L1PA 3KJXA 3A9ZA 5DTRA 2KPJA 1IC8A 3PE5A 2LYRA 3NROA 4OB4A 4PU8A 1LLIA 2AXVA 2LYLA 2L8NA 3HZIB 2LLWA 2XJ3A 4I6TA 2O49A 1YSEA 2HFZA 3LISA 1QP4A 2HINA 3JXCL 2KEKA 1X57A 1MFQC 2YBDA 3DNVB 2JVLA 4YG1A 4Z58A 3OMTA 1LQCA 2D5VA 2IVGA 3SCGA 2HCSA 3G0TA 4X4DA 2M4HA 1Y9QA 4X4CA 1PNRA 2HSGA 2PXQA 3F51A 1QP7A 2PXLA 3A9XA 2PUBA 1ZZBA 4GHJA 2GRMA 2XXAA 3A9YA 4Z5DA 1POUA 3RZZA 1RZRD 4JCYA 3ZPXA 3OWQA 4X4IA 2KEJA 1NW3A 3LFPA 1BDHA 2J7WA 2LYKA 2VEOA 3U3WA 2PXTA 3VK0A 2BNNA 3LQXA 4F8DA 1VPWA 3OQMA 4NDWA 1ZS4A 1OSLA 2EBYA 2HCNA 1UXCA 1UXDA 3OQOA 1PRVA 3QFIA 2ICTA 1WETA 1QPZA 3CROL 2GZUA 3QQ6A 5DTMA 4DE9A 2O4AA 3CECA 4HRAA 2LLVA 1RIOA 1WH6A 4J1WA 3MEJA 4EKGA 3ZHMA 3TEPA 4Z5HA
chains in the Genus database with same CATH topology
1LQCA 2BNOA 2LYQA 2D5VA 4JCXA 1ZZ7A 1ZZ8A 2IVGA 1ZZ6A 3SCGA 5A7LA 2XCJA 1L1MA 4I6UA 1LCDA 4YBAA 4PU7A 3JXDL 2ICPA 4X4DA 2JCGA 1X2LA 3SCFA 4X4BA 4X4FA 1Y9QA 1E3OC 1QQBA 2IV1A 3ZKCA 4X4CA 2LYJA 3G5GA 3QWGA 2AW6A 3KXAA 4YG4A 1PNRA 2IU7A 1PERL 3KZ3A 2MEZA 3SCHA 4YARA 2CROA 2BJCA 2H8RA 2HSGA 3IVPA 4YG7B 3F51A 1R69A 1PRAA 1B0NA 1QP7A 1ZZCA 2IVBA 3FMYA 2XI8A 2PUFA 1OCTC 4IVZA 3O9XA 2LYSA 2PUGA 1AU7A 2KEIA 1ADRA 4X4GA 3D1NI 1GT0C 2PUBA 2CSFA 1ZZBA 1LCCA 1RZSA 1XWRA 2GRMA 2PIJA 2KZ8A 4GHJA 3TRBA 2EF8A 1UTXA 3GN5B 1R63A 3BS3A 2FJRA 1POUA 4I6RA 4MCXA 4Z5DA 1RPEL 3RZZA 2AUWA 3G7DA 1RZRD 2R1JL 1LMB3 3MLFA 4JCYA 2AWIA 2WIUB 4FN3A 2PE5A 3R1FA 2GRLA 4O8BA 3B7HA 1ZPQA 2A6CA 4JQDA 2PUDA 3GBFA 1NEQA 2LYPA 4Z5HA 1RZRA 1S7EA 4X4IA 1DWKA 2PPXA 2KEJA 1ZAYA 3F52A 3FYAA 4FBIA 1ZUGA 4PU3C 1EFAA 1NERA 2WUSR 3LFPA 1BDHA 2XIUA 3OQNA 1Y7YA 2L49A 3BD1A 2BNMA 2LYKA 1CJGA 2PUCA 1PRUA 1JFTA 3U3WA 3VK0A 2BNNA 4GQMA 3UFDA 3EUSA 2IUOA 3ZHIA 4J1XA 4F8DA 1VPWA 2PUEA 2MQKA 4Y42A 3F6WA 3OQMA 4NDWA 1ZS4A 3GN5A 2AXUA 2EBYA 3KJXA 3PXPA 3L1PA 1OSLA 1BDIA 1ZVVA 2PUAA 1DW9A 4I8TA 1SQ8A 2LCVA 1UXCA 1WIZA 3FYMA 3CLCA 1QQAA 1UXDA 2KPJA 3OQOA 4PU4C 3QYXA 1IC8A 3OP9A 1PRVA 2LYRA 1HF0A 1O4XA 4X4EA 4OB4A 1WETA 2ICTA 3BDNA 4PU8A 4Z59A 1LLIA 1QPZA 2OFYA 3CROL 1JWLA 2XSDC 3JXBC 2OR1L 2AXVA 2GZUA 2R63A 4MCTA 2B5AA 2O38A 1CQTA 2LYLA 2L8NA 1JH9A 3QQ6A 5K98B 4Z5CA 3HZIB 2XJ3A 2O4AA 3CECA 4I6TA 4IA8A 2O49A 3QF3A 1RIOA 1WH8A 1WH6A 1YSEA 3S8QA 3LISA 1QP4A 1QP0A 2EWTA 2IVQA 4J1WA 2HINA 1JFSA 3JXCL 4X4HA 2KEKA 1X57A 2AXZA 3DNVB 2JVLA 3ZHMA 4IWRA 4YG1A 1ZZ9A 4Z58A 3H5TA 3OMTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LQC A;  2BNO A;  2LYQ A;  2D5V A;  4JCX A;  1ZZ7 A;  1ZZ8 A;  2IVG A;  1ZZ6 A;  3SCG A;  5A7L A;  2XCJ A;  1L1M A;  4I6U A;  1LCD A;  4YBA A;  4PU7 A;  3JXD L;  2ICP A;  4X4D A;  2JCG A;  1X2L A;  3SCF A;  4X4B A;  4X4F A;  1Y9Q A;  1E3O C;  1QQB A;  2IV1 A;  3ZKC A;  4X4C A;  2LYJ A;  3G5G A;  3QWG A;  2AW6 A;  3KXA A;  4YG4 A;  1PNR A;  2IU7 A;  1PER L;  3KZ3 A;  2MEZ A;  3SCH A;  4YAR A;  2CRO A;  2BJC A;  2H8R A;  2HSG A;  3IVP A;  4YG7 B;  3F51 A;  1R69 A;  1PRA A;  1B0N A;  1QP7 A;  1ZZC A;  2IVB A;  3FMY A;  2XI8 A;  2PUF A;  1OCT C;  4IVZ A;  3O9X A;  2LYS A;  2PUG A;  1AU7 A;  2KEI A;  1ADR A;  4X4G A;  3D1N I;  1GT0 C;  2PUB A;  2CSF A;  1ZZB A;  1LCC A;  1RZS A;  1XWR A;  2GRM A;  2PIJ A;  2KZ8 A;  4GHJ A;  3TRB A;  2EF8 A;  1UTX A;  3GN5 B;  1R63 A;  3BS3 A;  2FJR A;  1POU A;  4I6R A;  4MCX A;  4Z5D A;  1RPE L;  3RZZ A;  2AUW A;  3G7D A;  1RZR D;  2R1J L;  1LMB 3;  3MLF A;  4JCY A;  2AWI A;  2WIU B;  4FN3 A;  2PE5 A;  3R1F A;  2GRL A;  4O8B A;  3B7H A;  1ZPQ A;  2A6C A;  4JQD A;  2PUD A;  3GBF A;  1NEQ A;  2LYP A;  4Z5H A;  1RZR A;  1S7E A;  4X4I A;  1DWK A;  2PPX A;  2KEJ A;  1ZAY A;  3F52 A;  3FYA A;  4FBI A;  1ZUG A;  4PU3 C;  1EFA A;  1NER A;  2WUS R;  3LFP A;  1BDH A;  2XIU A;  3OQN A;  1Y7Y A;  2L49 A;  3BD1 A;  2BNM A;  2LYK A;  1CJG A;  2PUC A;  1PRU A;  1JFT A;  3U3W A;  3VK0 A;  2BNN A;  4GQM A;  3UFD A;  3EUS A;  2IUO A;  3ZHI A;  4J1X A;  4F8D A;  1VPW A;  2PUE A;  2MQK A;  4Y42 A;  3F6W A;  3OQM A;  4NDW A;  1ZS4 A;  3GN5 A;  2AXU A;  2EBY A;  3KJX A;  3PXP A;  3L1P A;  1OSL A;  1BDI A;  1ZVV A;  2PUA A;  1DW9 A;  4I8T A;  1SQ8 A;  2LCV A;  1UXC A;  1WIZ A;  3FYM A;  3CLC A;  1QQA A;  1UXD A;  2KPJ A;  3OQO A;  4PU4 C;  3QYX A;  1IC8 A;  3OP9 A;  1PRV A;  2LYR A;  1HF0 A;  1O4X A;  4X4E A;  4OB4 A;  1WET A;  2ICT A;  3BDN A;  4PU8 A;  4Z59 A;  1LLI A;  1QPZ A;  2OFY A;  3CRO L;  1JWL A;  2XSD C;  3JXB C;  2OR1 L;  2AXV A;  2GZU A;  2R63 A;  4MCT A;  2B5A A;  2O38 A;  1CQT A;  2LYL A;  2L8N A;  1JH9 A;  3QQ6 A;  5K98 B;  4Z5C A;  3HZI B;  2XJ3 A;  2O4A A;  3CEC A;  4I6T A;  4IA8 A;  2O49 A;  3QF3 A;  1RIO A;  1WH8 A;  1WH6 A;  1YSE A;  3S8Q A;  3LIS A;  1QP4 A;  1QP0 A;  2EWT A;  2IVQ A;  4J1W A;  2HIN A;  1JFS A;  3JXC L;  4X4H A;  2KEK A;  1X57 A;  2AXZ A;  3DNV B;  2JVL A;  3ZHM A;  4IWR A;  4YG1 A;  1ZZ9 A;  4Z58 A;  3H5T A;  3OMT A; 
#chains in the Genus database with same CATH topology
 2BNO A;  2LYQ A;  1ZZ7 A;  3TEL A;  5A7L A;  4ER7 A;  4YBA A;  3JXD L;  1E3O C;  1QQB A;  2LYJ A;  3NDB B;  3QWG A;  3KXA A;  2IU7 A;  2J7U A;  2ODR D;  2MEZ A;  3SCH A;  2H8R A;  3IVP A;  1R69 A;  3FMY A;  2PUF A;  3O9X A;  1AU7 A;  2FFH A;  2KEI A;  4X4G A;  3D1N I;  1GT0 C;  1DUL A;  1RZS A;  1XWR A;  3TRB A;  1UTX A;  3GN5 B;  4MCX A;  2AUW A;  2R1J L;  2JQE A;  2MXD A;  3MLF A;  4FN3 A;  4O8B A;  2A6C A;  4ER3 A;  4JQD A;  1NEQ A;  1S7E A;  1U2Z A;  1DWK A;  1ZAY A;  4FBI A;  1NER A;  2WUS R;  2XXQ A;  3OQN A;  2V3C C;  3BD1 A;  2BNM A;  1JFT A;  3UFD A;  3ZHI A;  4Y42 A;  3PXP A;  2PUA A;  1HQ1 A;  3FYM A;  5GAH i;  3CLC A;  1QQA A;  3QYX A;  1HF0 A;  4X4E A;  2OFY A;  4EKI A;  4EK9 A;  2XSD C;  3JXB C;  1JH9 A;  4DE8 A;  4ER0 A;  4IA8 A;  3QF3 A;  3NZL A;  1WH8 A;  2EWT A;  2IVQ A;  1JFS A;  4IWR A;  1ZZ9 A;  3H5T A;  3DM5 A;  4JCX A;  1ZZ8 A;  1ZZ6 A;  3QOX A;  4I6U A;  1LCD A;  1QB2 A;  1QZX A;  2JCG A;  1X2L A;  4X4B A;  3GZD A;  2LNM A;  2IV1 A;  5DSX A;  2AW6 A;  1PER L;  3KZ3 A;  3SX0 A;  2CRO A;  2PXP A;  4WVL A;  2PXV A;  4YG7 B;  1OCT C;  4IVZ A;  3ME5 A;  2PUG A;  3GZC A;  3GZD C;  2PIJ A;  3BS3 A;  4ER6 A;  3G7D A;  1LMB 3;  3UWP A;  3R1F A;  2PXE A;  1ZPQ A;  2PUD A;  2PXD A;  2LYP A;  1RZR A;  2PPX A;  3F52 A;  4PU3 C;  2XXP A;  5JUW A;  1Y7Y A;  1CJG A;  2PUC A;  1PRU A;  4GQM A;  3EUS A;  2IUO A;  3NXH A;  4J1X A;  2PUE A;  3GUU A;  3F6W A;  1ZVV A;  1BDI A;  2PXF A;  1DW9 A;  4I8T A;  1SQ8 A;  2LCV A;  1WIZ A;  4Q2J A;  4PU4 C;  3OP9 A;  1O4X A;  5DRY A;  3BDN A;  4Z59 A;  1JWL A;  2OR1 L;  2R63 A;  4MCT A;  4EZI A;  2B5A A;  2O38 A;  1CQT A;  5GAG i;  5K98 B;  4Z5C A;  3S8Q A;  5DRT A;  2PXB A;  1QP0 A;  2L1P A;  2PXU A;  4X4H A;  2AXZ A;  3SR4 A;  2XCJ A;  1L1M A;  4PU7 A;  2ICP A;  3SCF A;  4X4F A;  3ZKC A;  3G5G A;  4YG4 A;  3R09 A;  5DT2 A;  3OKZ A;  3VWS A;  4YAR A;  4ER5 A;  2BJC A;  1PRA A;  1B0N A;  1ZZC A;  2IVB A;  3QOW A;  2XI8 A;  2LYS A;  1ADR A;  4EQZ A;  2CSF A;  1LCC A;  2KZ8 A;  2EF8 A;  1R63 A;  2FJR A;  4I6R A;  1RPE L;  5DTQ A;  2AWI A;  2WIU B;  2PE5 A;  2GRL A;  3B7H A;  3GBF A;  2PXK A;  4OBM A;  3FYA A;  3M9L A;  1ZUG A;  1EFA A;  2XIU A;  3TFL A;  2L49 A;  3KL4 A;  2MQK A;  3GN5 A;  2AXU A;  3L1P A;  3KJX A;  3A9Z A;  5DTR A;  2KPJ A;  1IC8 A;  3PE5 A;  2LYR A;  3NRO A;  4OB4 A;  4PU8 A;  1LLI A;  2AXV A;  2LYL A;  2L8N A;  3HZI B;  2LLW A;  2XJ3 A;  4I6T A;  2O49 A;  1YSE A;  2HFZ A;  3LIS A;  1QP4 A;  2HIN A;  3JXC L;  2KEK A;  1X57 A;  1MFQ C;  2YBD A;  3DNV B;  2JVL A;  4YG1 A;  4Z58 A;  3OMT A;  1LQC A;  2D5V A;  2IVG A;  3SCG A;  2HCS A;  3G0T A;  4X4D A;  2M4H A;  1Y9Q A;  4X4C A;  1PNR A;  2HSG A;  2PXQ A;  3F51 A;  1QP7 A;  2PXL A;  3A9X A;  2PUB A;  1ZZB A;  4GHJ A;  2GRM A;  2XXA A;  3A9Y A;  4Z5D A;  1POU A;  3RZZ A;  1RZR D;  4JCY A;  3ZPX A;  3OWQ A;  4X4I A;  2KEJ A;  1NW3 A;  3LFP A;  1BDH A;  2J7W A;  2LYK A;  2VEO A;  3U3W A;  2PXT A;  3VK0 A;  2BNN A;  3LQX A;  4F8D A;  1VPW A;  3OQM A;  4NDW A;  1ZS4 A;  1OSL A;  2EBY A;  2HCN A;  1UXC A;  1UXD A;  3OQO A;  1PRV A;  3QFI A;  2ICT A;  1WET A;  1QPZ A;  3CRO L;  2GZU A;  3QQ6 A;  5DTM A;  4DE9 A;  2O4A A;  3CEC A;  4HRA A;  2LLV A;  1RIO A;  1WH6 A;  4J1W A;  3MEJ A;  4EKG A;  3ZHM A;  3TEP A;  4Z5H A; 
#chains in the Genus database with same CATH homology
 1LQC A;  2BNO A;  2LYQ A;  2D5V A;  4JCX A;  1ZZ7 A;  1ZZ8 A;  2IVG A;  1ZZ6 A;  3SCG A;  5A7L A;  2XCJ A;  1L1M A;  4I6U A;  1LCD A;  4YBA A;  4PU7 A;  3JXD L;  2ICP A;  4X4D A;  2JCG A;  1X2L A;  3SCF A;  4X4B A;  4X4F A;  1Y9Q A;  1E3O C;  1QQB A;  2IV1 A;  3ZKC A;  4X4C A;  2LYJ A;  3G5G A;  3QWG A;  2AW6 A;  3KXA A;  4YG4 A;  1PNR A;  2IU7 A;  1PER L;  3KZ3 A;  2MEZ A;  3SCH A;  4YAR A;  2CRO A;  2BJC A;  2H8R A;  2HSG A;  3IVP A;  4YG7 B;  3F51 A;  1R69 A;  1PRA A;  1B0N A;  1QP7 A;  1ZZC A;  2IVB A;  3FMY A;  2XI8 A;  2PUF A;  1OCT C;  4IVZ A;  3O9X A;  2LYS A;  2PUG A;  1AU7 A;  2KEI A;  1ADR A;  4X4G A;  3D1N I;  1GT0 C;  2PUB A;  2CSF A;  1ZZB A;  1LCC A;  1RZS A;  1XWR A;  2GRM A;  2PIJ A;  2KZ8 A;  4GHJ A;  3TRB A;  2EF8 A;  1UTX A;  3GN5 B;  1R63 A;  3BS3 A;  2FJR A;  1POU A;  4I6R A;  4MCX A;  4Z5D A;  1RPE L;  3RZZ A;  2AUW A;  3G7D A;  1RZR D;  2R1J L;  1LMB 3;  3MLF A;  4JCY A;  2AWI A;  2WIU B;  4FN3 A;  2PE5 A;  3R1F A;  2GRL A;  4O8B A;  3B7H A;  1ZPQ A;  2A6C A;  4JQD A;  2PUD A;  3GBF A;  1NEQ A;  2LYP A;  4Z5H A;  1RZR A;  1S7E A;  4X4I A;  1DWK A;  2PPX A;  2KEJ A;  1ZAY A;  3F52 A;  3FYA A;  4FBI A;  1ZUG A;  4PU3 C;  1EFA A;  1NER A;  2WUS R;  3LFP A;  1BDH A;  2XIU A;  3OQN A;  1Y7Y A;  2L49 A;  3BD1 A;  2BNM A;  2LYK A;  1CJG A;  2PUC A;  1PRU A;  1JFT A;  3U3W A;  3VK0 A;  2BNN A;  4GQM A;  3UFD A;  3EUS A;  2IUO A;  3ZHI A;  4J1X A;  4F8D A;  1VPW A;  2PUE A;  2MQK A;  4Y42 A;  3F6W A;  3OQM A;  4NDW A;  1ZS4 A;  3GN5 A;  2AXU A;  2EBY A;  3KJX A;  3PXP A;  3L1P A;  1OSL A;  1BDI A;  1ZVV A;  2PUA A;  1DW9 A;  4I8T A;  1SQ8 A;  2LCV A;  1UXC A;  1WIZ A;  3FYM A;  3CLC A;  1QQA A;  1UXD A;  2KPJ A;  3OQO A;  4PU4 C;  3QYX A;  1IC8 A;  3OP9 A;  1PRV A;  2LYR A;  1HF0 A;  1O4X A;  4X4E A;  4OB4 A;  1WET A;  2ICT A;  3BDN A;  4PU8 A;  4Z59 A;  1LLI A;  1QPZ A;  2OFY A;  3CRO L;  1JWL A;  2XSD C;  3JXB C;  2OR1 L;  2AXV A;  2GZU A;  2R63 A;  4MCT A;  2B5A A;  2O38 A;  1CQT A;  2LYL A;  2L8N A;  1JH9 A;  3QQ6 A;  5K98 B;  4Z5C A;  3HZI B;  2XJ3 A;  2O4A A;  3CEC A;  4I6T A;  4IA8 A;  2O49 A;  3QF3 A;  1RIO A;  1WH8 A;  1WH6 A;  1YSE A;  3S8Q A;  3LIS A;  1QP4 A;  1QP0 A;  2EWT A;  2IVQ A;  4J1W A;  2HIN A;  1JFS A;  3JXC L;  4X4H A;  2KEK A;  1X57 A;  2AXZ A;  3DNV B;  2JVL A;  3ZHM A;  4IWR A;  4YG1 A;  1ZZ9 A;  4Z58 A;  3H5T A;  3OMT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...