1QPZA

Purine repressor-hypoxanthine-palindromic operator complex
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
339
structure length
339
Chain Sequence
ATIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAAYFAEIIEAVEKNCFQKGYTLILGNAWNNLEKQRAYLSMMAQKRVDGLLVMCSEYPEPLLAMLEEYRHIPMVVMDWGEAKADFTDAVIDNAFEGGYMAGRYLIERGHREIGVIPGPLERNTGAGRLAGFMKAMEEAMIKVPESWIVQGDFEPESGYRAMQQILSQPHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEVHPRLIERRSVADGPFRDYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The role of lysine 55 in determining the specificity of the purine repressor for its operators through minor groove interactions.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription/dna
molecule keywords DNA (5'-D(*TP*AP*CP*GP*CP*AP*AP*AP*CP*GP*TP*TP*TP*GP*CP*GP*T
total genus 120
structure length 339
sequence length 339
ec nomenclature
pdb deposition date 1999-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00356 LacI Bacterial regulatory proteins, lacI family
A PF13377 Peripla_BP_3 Periplasmic binding protein-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 1qpzA01
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1qpzA03
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1qpzA02
3Q15C 2A9PA 1JDNA 2FN9A 2JVLA 3KTOA 4Z4EA 3QWGA 2E4ZA 3LFTA 3N8IA 3OM0A 4MS3A 4O1IA 1W25A 4RY8A 2WWVD 2AXUA 3T8YA 3VNBA 2F8TA 2HQOA 2ICTA 2M98A 1JH9A 3KHTA 4YRZA 2QVGA 4DADA 5JNWA 1DCKA 1JFTA 1Z25A 1UXDA 2WRZA 3LUKA 1P6QA 5BQ3A 3O2SB 2E4XA 1YVUA 2DRIA 4G0ZA 3ROTA 4X4DA 1Z26A 4FN3A 1P6UA 3Q7SA 4W5RA 3IP6A 1B0NA 3ILYA 2MQKA 3KG2A 3QLUA 4PEVA 4KFCA 4MQFB 3EQ2A 3MLFA 3EULA 2HPHA 3LUJA 1O4XA 5EWJA 2JVKA 3MA0A 2B1JA 1FFGA 5DTEA 4YBAA 4X4EA 2FEKA 4MS1B 5IUJC 1KRWA 1GT0C 1R8JA 1F4VA 1LJLA 5E3JA 1IC8A 2VUIB 4JQDA 3OLZA 3CNBA 4O1HA 2BNOA 3CLKA 3SG0A 4D74A 3TB6A 2KYRA 4I6UA 3E3MA 3KLOA 4E7PA 4W5OA 2AW6A 4D6XA 2RJNA 2LYKA 4WXMA 4LDAA 2XCJA 3JPWA 4L85A 2A9OA 4MR8B 5HKOA 3EGCA 4KK3A 4JB0A 4MS1A 3TO5A 5TQ2A 4YLEA 4EVRA 4XAQA 4LE1A 3QX8A 3TD9A 2PUEA 4J1XA 1T34A 4X4CA 2EF8A 1PEYA 3OMWA 3NHZA 4YP9A 4I6RA 3GL9A 3CLCA 4JP1A 3OQOA 2FMKA 2AUWA 1NXWA 2IPAB 1OSLA 1USGA 3QLVA 2QSJA 1DCFA 3QX9A 1ZPQA 3FYMA 4KMRA 3EODA 4RK1A 1QNLA 1IIBA 4Q7EA 2PLNA 4RWEA 3FFXA 1MB0A 3BILA 3I45A 4YO7A 3HJFA 2XI8A 1EFAA 1Z12A 2CHFA 4O5AA 1DZ3A 2IPMA 1PEAA 3JXDL 1PERL 1SD5A 3QYXA 1QQAA 3SCGA 4WUTA 3KS9A 5IX8A 3MM4A 1DJMA 3CZCA 1M2EA 3IPAA 5TPZD 2IDMA 3LUDA 4RDCA 1RZRA 4H60A 4MLDA 3CROL 1DP4A 3CKMA 3RVLA 4Z4HA 3HXMA 1D1PA 1SXHA 2H8RA 4P98A 1L5ZA 2FJRA 3M9WA 3A0RB 2LYRA 4XARA 1C0EA 3RH0A 3CG4A 5JNTA 5KQPA 4JAVC 1VRVA 1YTUA 2IU7A 4FE7A 2PUAA 3KLNA 5TQJA 1I3CA 4RXTA 3RVPA 4ETNA 3RVQA 3U3WA 1ZVVA 1NY5A 5EWJB 3CU5A 2AWIA 4MRMB 1S7EA 2R63A 3C3MA 3OP9A 3TMYA 1ZZBA 2E4VA 2YHAA 4X4FA 3K9CA 2PUGA 5I4CA 4XLTA 2WY2D 4DQDA 1QMPA 3LTEA 3N6VA 4Z9BA 1A04A 4ZMRA 5FBHA 2KEIA 1LCCA 5K98B 3TX6A 2MYTA 2JCGA 3K4HA 4ZYLA 3Q41A 3EAFA 2HSGA 3R0JA 4M88A 3T38A 3JTEA 2FMIA 2IVGA 3GN5A 2PUDA 3TRBA 1U2QA 3LKBA 2VK2A 3GBFA 1RZRD 2FXIA 3GA5A 4FB4A 3CS3A 3OO0A 1NERA 3L1PA 4PU4C 3HZIB 1JFSA 1UDRA 3G85A 4IF4A 1JWLA 3S99A 1YS7A 2AYZA 3UUGA 2L19A 4NV3A 5JS2A 3H6GA 3ZKCA 2FTKE 1BDJA 2MSWA 5JNVA 3CHYA 1USKA 2FSPA 3F52A 3QELB 3MF4A 3MQ4A 1ZGGA 3CTPA 4IILA 4W5NA 1LBHA 2FMHA 1CEYA 4RS3A 4MR9B 4OLAA 4X4BA 2HINA 4RK5A 4Q6WA 1Y7YA 4OATA 3A0UA 4MRMA 1VPWA 1KGSA 3GBVA 3GT7A 4NQRA 1SXIA 5TQ0B 3E61A 4UHKA 2XDYA 3HSYA 1UXCA 1JL3A 2R47A 2PIJA 3ZHMA 2FLWA 2R25B 3LUFA 4LRQA 5TQ2B 1BDHA 1ZS4A 1GLGA 3DLHA 3QEKA 4KRFA 1LJUA 3LUHA 1DBWA 4JB2A 4LX8A 2AXZA 2HQBA 3M9XA 3QLUC 4PE5B 1Z13A 5CHYA 1PRUA 6CHYA 4H3KB 2OFYA 3GN5B 4KZKA 1WETA 1USIA 2LYJA 3RVOA 3HVRA 1ZZ9A 5A7LA 4G0XA 4OLBA 4F8JA 3F6PA 1ZAYA 1ZGZA 4IRXA 3HK2A 5KQGA 1WH6A 2A9RA 4RV5A 4Z4GA 5TPWA 3PXPA 4YV7A 5FWYB 3RZZA 1ZZ6A 2PUCA 3O2JA 1ZN2A 2LBPA 2LPMA 4MS4B 3GWGA 4WWHA 2E4WA 2RDMA 1DC7A 4YG4A 2XSDC 1RIOA 2PMCA 4YG7B 3DGFC 3G1WA 3IP7A 1EWKA 3LOPA 1Z17A 4KREA 5IUNC 1YIOA 2I6FA 2LP4Y 1BVHA 2PL1A 4N47A 1SXGA 2ZAYA 4JA2A 2ID9A 2B5AA 6ABPA 4ML3A 1VLZA 1X57A 3H5VA 3DZDA 4ETIA 1ADRA 4EVQA 3O1IC 3CRNA 4KV7A 4G0MA 1QKKA 2MYUA 5BR1A 2LYPA 2GZUA 3OMTA 4ZMSA 2XJ3A 1JLKA 2IPLA 2A9QA 1URPA 3O75A 3KKEA 3IDOA 4YS6A 4PZ0A 2YHBA 1ZH2A 3LFPA 1RPEL 1BA2A 3ZHIA 1VKRA 2GRMA 2FW0A 2GKGA 2LUOA 3C6QA 3OMXA 2QZJA 3I09A 5DGCA 3EQZA 3W9SA 2EWTA 4H3HB 4MR7A 3JXBC 3H5IA 4G0PA 2L49A 3QQ6A 1L1MA 4EYKA 2FKAA 1QP0A 4NCBA 2RJOA 1HEYA 5HM6A 2PAFA 1MVOA 3IPCA 3DLBA 3VK0A 4EUKA 2PL9A 3OM1A 1NXOA 3H1EA 2RGYA 1QP4A 3L49A 2HJ9A 3OLYA 1GCAA 2O20A 4Z5CA 1ZESA 3A10A 3H1GA 3FGZA 1RXIA 2FEWB 1LLIA 2MYNA 3QEMB 3MYYA 4YCSA 3FFTA 1F51E 4OTZA 3KXAA 1Z2EA 1ZH4A 3JVIA 4KK4A 2KPJA 1M5UA 4ETMA 2A6CA 1NXXA 2JBAB 4RY9A 1D2AA 3D02A 3RVNA 3LMKA 4RSMA 4G0YA 2O4AA 1K68A 1OCTC 2HQRA 4G86A 3O9XA 1ZZCA 4GQMA 2IOYA 3QLVC 3RVJA 4IA8A 4Z5HA 5BRAA 1TLFA 4WZZA 4F06A 4I6TA 3UK0A 1A0OA 3DGEC 3GRCA 1RZSA 1KRXA 1FFSA 1ABFA 1QO0A 3O74A 4MGEA 1ZUGA 1QPZA 2FEPA 4TLMB 3I42A 1EWTA 1XHEA 3BDNA 1UTXA 1OXKB 4JCXA 3MIZA 3LISA 3FMYA 2KEKA 2PE5A 2NZVG 4MAAA 1NXVA 3ILHA 2N9UA 5EWMA 5KC9A 2ICPA 1POUA 2MSLA 2BNNA 1WH8A 2D5VA 3H5LA 2JVJA 4MR8A 4E7OA 2BNMA 4MS3B 1U8TA 4TN5A 5KQLA 4XASA 5KQMA 2H3HA 1X2LA 1K66A 3CFYA 1LCDA 2JVIA 2MEZA 3Q7TA 5IC5A 2IVQA 3SCFA 2GBPA 4HYEA 2ZWMA 3O21A 3RVKA 1Y1LA 1EHCA 3DNVB 4Y42A 1QO0D 4YG1A 3QEMA 4QICA 4KQCA 1U04A 7ABPA 1APBA 4QPJC 4N76A 4EY3A 1NXPA 3F6CA 1Y9QA 2L17A 5JNSA 2MSKA 1SRRA 4UHJA 5C5CA 3EDCA 3O1JC 2O38A 1E6KA 2E4UA 3BD1A 5TE9A 4XFKA 4RXUA 2QU7A 4W5QA 1ZZ8A 1DRKA 4I8TA 3CZ5A 2FVYA 4Z59A 3OO1A 2VYCA 3P9YA 2FN8A 3EJWA 1AB6A 2QV0A 2QW1A 3NBMA 4IGAA 2LIVA 2QVCA 4LDZA 4YR7A 1TJYA 1JX6A 2GX6A 2L18A 2FQXA 4ZPJA 5IEBA 9ABPA 2M1ZA 2NT3A 1S8NA 4NDWA 5IULC 2FQYA 3HM9A 1LBIA 2J48A 1Z16A 5GQSA 2AXVA 5FWXA 4OG2A 3H5WA 4JASB 5DLEA 3Q9SA 3NNNA 3A3KA 2MYPA 3T95A 1E6MA 4KPYA 1YSEA 1U0SY 2IPNA 1DBQA 2IVBA 2L2QA 5KI6A 4HNSA 1GUBA 3NNSA 3QF3A 2O49A 3M6MD 3NNDA 4MPTA 4EGSA 5B3JC 5BRJA 4X4HA 3HZHA 3H6HA 1NEQA 4QYWA 1YS6A 3BRQA 5GOTA 2CWDA 4RU1A 4EYQA 1YMUA 3KSMA 4G97A 2E4YA 1ZDMA 3HEBA 4Q6BA 5CNIA 3RQIA 1DW9A 2CD7A 2PPXA 4RK7A 5DCLA 1JFVA 2P4UA 2TMYA 4G0QA 4MCTA 4D6YA 1CJGA 3JXCL 4NICA 4F8DA 4DN6A 4F3TA 4XXHA 1R63A 1R69A 2EBYA 1TM2A 4O8BA 1TVMA 2OENG 3CG0A 4EYGA 1SQ8A 2JK1A 5HSGA 1Z18A 1W9HA 1MB3A 4N0QA 5EWLB 1RPJA 2LYLA 3HS3A 4CBVA 5KC8A 4IVZA 1ISRA 1BDIA 3KYIB 4X4GA 3N75A 3BS3A 3H5OA 3F6WA 4PYRA 4RK6A 1XWWA 1M5TA 3BREA 3C97A 2L8NA 1AB5A 4TMYA 3FMVA 1JDPA 1NTRA 2QR3A 5CNKA 5TQ0A 3QK7A 5ABPA 3N0WA 2FLKA 4PICA 2PUFA 2R48A 3SNKA 3RVRA 3VNAA 2R4QA 4ZJPA 1TMYA 1J56A 1D5WA 5TPWB 4YWHA 3KCNA 3FFWA 1PUXA 3O2QB 3DBIA 1E2BA 4OB4A 4Z5DA 2CHEA 2Q5CA 1OXBB 4WT7A 4RY0A 4EYOA 5FWXB 2WJWA 3D8UA 4MR7B 4KNYA 3H5TA 1PHRA 3F7NA 3IP9A 4WXEA 3IVPA 4S05A 4N41A 4IWRA 3RVSA 3F73A 4JOQA 1QP7A 1D1QA 3BRSA 3N0RA 5JS1A 1MAVA 1GUDA 1PNTA 3SQNA 3GYBA 2QXYA 4RXMA 3ROFA 2BJCA 2X7XA 4RKQA 1P2FA 2LCVA 3RVMA 5D2CA 5T3YA 4MLCA 1P8AA 4Z9AA 3SY8A 3N0XA 4PU3C 2P9HA 2PJUA 3HCWA 4Y9TA 3SCHA 1H9CA 1WIZA 2WMYA 1XWRA 3HDGA 3C3WA 1JF8A 4IMIB 4J1WA 3LUGA 5FWYA 4MR9A 5KWSA 1DWKA 3UKJA 2WUSR 1YK1A 3OLXA 4MS4A 1PNRA 3JY6A 3N53A 4HNRA 4GHJA 5IBQA 1B00A 3GV0A 4KVFA 1E3OC 1D4ZA 4YGXB 5JNRA 4S04A 2JB9A 2NT4A 4Z4CA 1LMB3 3JS5A 5DKFA 2PKXA 3IP5A 5EWMB 1U2PA 2CSFA 2KEJA 2LYQA 2WIUB 1QQBA 4B09A 3NHMA 2W42A 2IV1A 4G0OA 1ZITA 3HUTA 1FSPA 1JHZA 1NXTA 1ZY2A 2GWRA 4W5TA 1PRVA 1CQTA 4F12A 1EAYA 4MCXA 1ISSA 2WJAA 3T6KA 2CROA 4QYMA 3KYJB 2B4AA 3B7HA 1DCMA 3KJXA 1CHNA 1DRJA 1NXSA 2OR1L 2VUHB 1L5YA 2AYXA 2IYNA 4N0PA 4TLLB 2NZUG 3UFDA 3HV2A 4N03A 4EVSA 4Z99A 2BGGA 3Q7RA 1FQWA 5PNTA 3QLTA 3FDFA 4LE2A 3URMA 4RK0A 1AU7A 4RKRA 4OBBA 2ID7A 3HO1A 4PU8A 3L6UA 1BAPA 4LZLA 2XIUA 3F51A 1LQCA 1RXEA 3LUAA 3SM9A 3G7DA 4PU7A 4YARA 4MYRA 2FMFA 5JNUA 1XHFA 3OLVA 4LE0A 4JCYA 4FE4A 1JYFA 1KMIY 3KZ3A 1C4WA 2KZ8A 2FQWA 4RZSA 5EWLA 5IUKC 5IEJA 3LKVA 3H75A 1LK0A 5HQJA 5F64A 2V0NA 4FBIA 3HUUA 3SAJA 1DC8A 2JRLA 4MQEB 3MMNA 4X4IA 3O1HB 5TPZA 2PUBA 3GBPA 5ED4A 3OQNA 5CNMA 3B2NA 1Z2DA 4NCAA 1NATA 5B3JA 2JBAA 2OQRA 1DG9A 1YK0A 2NUBA 4HNQA 3JVDA 3JPYA 4Z4FA 1M2FA 2F8SA 3FYAA 4KQ9A 1JBEA 3EUSA 1PRAA 2IUOA 1ZHHA 4Z4IA 1RNLA 3HDVA 4MQEA 4MQFA 3S8QA 5CNJA 2H0AA 3CECA 4F11A 5T7BA 1GCGA 4P1ZA 4Z58A 3R1FA 5FBKA 1HF0A 1YMVA 3C3KA 4IMJB 1MIHA 3OLWA 5C5EA 4GPAA 2LYSA 1ABEA 3QELA 1Z15A 3BBLA 4Z0NA 1FFWA 1JYEA 4GNRA 3LUCA 2WB4A 3OQMA 1DBPA 2GI4A 1E6LA 1ZZ7A 3H1FA 4L4UA 4RK4A 8ABPA 3I5AA 1EWVA 2R1JL 2IKSA 3G5GA 2GRLA 1CYEA 1A2OA 3D1NI
chains in the Genus database with same CATH superfamily
4J6EA 1UXKA 3IA2A 1X86B 3Q15C 4ZK2A 3KM0A 1Q95A 3KTOA 4JQOA 3OHMA 4N48A 3DV2A 2FGJA 2YXPX 4J9UE 1MRSA 2XDAA 5EE3A 5DI3A 1E3DA 4DQKA 1FUIA 1NR5A 1RQNA 2EIHA 2VCEA 2Y4NA 2ZBUA 3EY9A 2DM6A 1W6UA 3GLHA 1G5RA 1LX7A 1OQAA 1ZINA 3NEJA 4FONA 3TIIA 4BU1A 1P6QA 4I5IA 4REQA 3CB4A 3F5SA 4MQMA 4F46A 2XJ4A 1VL8A 2G08A 3JX9A 4TQ9A 3VJLA 5TF4A 2FEXA 2Z4SA 4RPHA 2J08A 1NDQA 1SUFA 2YMMA 1G1AA 3B85A 4FGJA 4UU7A 3RJTA 2A57A 2GERA 3PRJA 4IY1A 1IY8A 4L4SA 3YASA 2VJBA 1YFJA 2K5UA 2KJQA 5A05A 2I3BA 3FPFA 3NHBA 5FPSA 3UWDA 3N2KB 3SFVA 4DCGA 2HGSA 4F45A 1L3BA 3ORSA 4X8HA 2PXTA 5L8VA 4QHTA 2H9YA 1YS4A 2FEKA 3EC7A 3FGOA 4K6OA 4MS1B 4BKOA 3NHKA 4BOYA 2DPXA 3ABQB 2OCGA 3HVKA 1F2VA 3PPXA 1NYQA 3EQ8A 5F33A 1PVOA 2B2CA 5E2IA 2B94A 3GFTA 4M1OA 2PMDA 1ZGCA 5C5DA 2DLCX 4I99A 4X84A 4FT2A 1E7MA 3KUKA 5KYVA 1JHPA 3F6EX 4LQLA 4QEDA 3T5MA 5FBWB 4I1UA 2WWIA 3J81k 1OAOA 3AONB 5JXWA 2X0NA 2EWMA 3H5AA 3G88A 4TS9A 4QGGA 4X0EA 3H2GA 3AL3A 3EPLA 5TS3A 2X3FA 3OPYI 3G8YA 2VSFA 2GF2A 3R0ZA 3NP7A 5AKHA 4CCWA 2C5EA 2C57A 2ZB4A 3AERB 3DZHA 3TB4A 1KQ3A 3G02A 1LDEA 4WZAA 1K4MA 5F4ZA 4LJRA 4QWWA 3L4BC 3C85A 3MB5A 2XT0A 2AJTA 4WADA 1U81A 1R4NA 2GH1A 3W5VA 2XI8A 2AOVA 3MOGA 4AG3A 5C8YF 1XCJA 1D4FA 3Q6NA 2FMTA 2EDAA 1FVHA 2UVQA 2VP4A 1K98A 1FCJA 1ADFA 1XP5A 1PL7A 3FBGA 1T9ZA 3I23A 3G59A 5FA8A 2A0UA 4OX9B 5LQNA 1JHDA 3EVCA 3ZDYB 3PTAA 4ZCRA 3A9CA 4LPKA 5C8VA 1AQLA 5CGQB 3NCHA 4D1YA 4ALIA 4KKVA 2CBXA 2H2IA 3B7PA 3E53A 3ZHZA 1CUJA 3HJGA 4HEA6 1O94A 4LF9B 3KAJA 5KNDA 4DKJA 1XJCA 2J7PD 2NZJA 4EM6A 1BJTA 2UZ1B 2Q3BA 2EGGA 1Y3CE 2ZP1A 1GG5A 4KPGA 5KYXA 1P8JA 1N2EA 1L2TA 2QN1A 3VO9A 5K0FA 2W2XA 3RBVA 1H69A 4ZVSA 3O26A 4QVKA 1GFIA 4NJMA 3B89A 1DX9A 2NNLD 4C0HA 1DJPA 1IFXA 3EAFA 1IBCA 2JANA 3HJUA 4QUGA 3C5WP 1GZ7A 4HDKA 4LISA 1NVDA 3T9CA 1OYOA 1P6XA 3BXEA 2PXPA 1E5XA 2K87A 5AI9A 1XVIA 1JHRA 3PC6A 2WYOA 3DXYA 4GH5A 4TMWA 2HA3A 5JSQA 5KTYA 1A1VA 2BTQB 4AAYA 5J43A 5KJ1A 3HQ4O 1Z0FA 4DJ5X 4CLRB 1U1DA 2AC2A 1RRFA 2OZPA 3T0FA 4H1VA 4ENQA 5AVTA 1TZMA 4UHHA 3A6KA 4YRAA 4V02A 5CB6A 3IEUA 3D3WB 1ZR4A 1SOUA 1IG3A 5JS2A 4H7DA 1RQ2A 1XMJA 1YB7A 1TJPB 3B3QA 2D1RA 2BM8A 4RHCA 3SKVA 4MV7A 4K03A 3UB4A 3WB2A 2ZJ3A 3ZCSA 2QTVB 3OOJA 1LSOA 2DBZA 4MVJM 4EECA 3CNEA 2CKDA 5JDCC 5A4MS 3VR3D 4A15A 1K0UA 1GRNA 3C3XA 3I72A 4FFBB 4R9SA 1Y7YA 3A0UA 4FD3A 2PGJA 1X74A 2V6IA 3G9QA 2W2LD 2P2YA 2EJUA 3I9LA 4OFWA 3HSYA 1VYUA 4LRQA 2QYOA 3IRVA 4FDAA 5DULA 2J9GA 1MUUA 4MMYB 3U9LA 5F3WB 1ZS4A 4M89A 3F3YA 4P38A 3EFOA 1N3BA 4ZQHA 2CVPA 4NWIA 2IXAA 2ZEJA 4Y2XA 1HF3A 1P2TA 2VPYA 3NXKA 3O95A 4IIHA 5AOVA 3TK1A 3W6NA 1C3OA 2HW8A 4IIYA 5E7IA 3RYFA 1SVMA 4LCEA 3T1TA 3D2AA 3DZJA 5LD2C 2DMRA 4NOLA 3HXKA 1LPPA 4TKUA 1RLIA 2Q3LA 3EY4A 4B82A 3OI7A 4XD7D 5EHNA 3VR0A 5BORA 5BVHA 4V0NA 3BH7A 4N6GA 4MUJA 3WADA 1AQYA 2J6BA 3UPUA 2P5YA 1E59A 1A8IA 4LXTA 1ARZA 2PGDA 1THMA 4OBMA 2VP5A 2XOXA 4MV1A 1VQ1A 2HBQA 1T0UA 4Q03A 5KDDA 3M83A 1RI5A 4NMWA 2ZKLA 5TQVA 5A04A 3NBYC 2XCOA 1VXRA 5TMDA 4B6SA 4C7KA 2ZJOA 4BGIA 4F4JA 2LP4Y 5K4HA 1IUOA 2UYHA 5JSKA 1R0LA 3FCXA 3NJ8A 3S8YA 2C2WA 1VG8A 5C31A 3C16C 5T4HA 5H8WA 4C4SA 2YVQA 3DZDA 4UD2A 3AEQA 4PGHA 3RPEA 5AI6A 4UM9B 1UBTS 2CVFA 1UPTA 4I50B 5GZ1A 2CHVA 2R9VA 1E6EA 1KO1A 5SY9A 2A1TR 3RKUA 3HRHA 1XD9A 4ANFA 5TX7A 2NTYC 2HC9A 2ZJ2A 3DDNA 2NQTA 3C6QA 4PEVA 1E3JA 3ZHIA 4L8GA 4XD7A 5CX4A 3KR0A 1DRWA 2QZJA 4PBSA 1O6GA 1VBNA 3OQVA 1Z5NA 4QT0A 5HZHA 5BV0A 3ND5A 5IP5A 3CF4A 4G0PA 4WLFA 1UQRA 2L49A 2ZIWB 1SQGA 3FM9A 3PXEA 4Q39A 4L3VA 4IRMA 3TIFA 4ZQGA 1QS0A 2QZ4A 2V5UA 4HDSB 1EDZA 5F5XA 1TO1E 4DUGD 1O6FA 4OHRA 2C0QA 2JAUA 4YRQA 4EG4A 5LDGA 4A03A 4TLEA 2WIAA 2PXCA 4RHXA 1VYHA 3GMDA 1AA9A 1M6EX 1G2QA 1OV4A 2EBHX 2PBLA 3STWA 4CN9A 3X1MA 1BTOA 4LRXA 5EP2A 2IY7A 3T41A 1Z2EA 4RVUA 2ZGVA 1MQSA 3CE9A 5CPFA 5AI5A 4EW1A 4GFDA 3H2BA 1J7JA 2WAYA 4WXPA 2KX7A 1HTWA 1WKVA 3HDJA 2I03A 4C0QC 2ZJ7A 3IAAA 2IV3A 4MUFA 3FSJX 3GQBA 4ZEMA 2ARKA 5J4KA 5E4YA 5GONA 3KQWA 1OJLA 5FQOA 3RARA 5KJ6A 4LC9A 1E4EA 2YRXA 2HT1A 5JO9A 1L8OA 1TIPA 1TLFA 1QYWA 2XOKA 2ZYUX 1GN9A 2MTBA 2PQMA 2NN3C 2VKTA 3GG2A 4ZHQA 3DVQX 3KEMA 3PEYA 2R8BA 3CRRA 4M6WA 1KRXA 1IATA 4RPJA 2PKWA 1JMKC 4LF5B 3COPA 2JI9A 3DNMA 1PYDA 2QE7A 3H2SA 3NTVA 3DEYX 1SMKA 4MGEA 4XIGS 4P83A 4XWGA 3SZLA 3FF4A 3IKJA 2JRCA 5EUQB 4E6EA 3B7GA 2I33A 3FMIA 3JZIA 4LDPA 4ZVPA 5JJLA 4JCXA 1PHPA 1XN4A 1G42A 1WNFA 4WBSA 4ZOLA 5BMVB 1MO5A 1JA0A 2X9LA 4G2TA 3IUJA 4Y2PA 4YIKA 5A5FA 1R0BA 5BN4A 5KC9A 2X8WA 1P0QA 2UYOA 2XTAA 2QD2A 2BNNA 1DG1G 1YT5A 3D8TA 3ZWQA 2HMTA 5DDIP 4B3FX 1GQYA 3EVDA 2PA3A 3PR2B 5AJZA 5ILOA 3KEOA 3EPKA 3NBZC 2EJCA 1VHTA 1ZIXA 4Q48A 4L9WA 5CH8A 1I2CA 5AH0A 3PHIA 2MEZA 5EIOA 4WRRA 5AVVA 1PI3A 2FPSA 1NW3A 3W0LB 1AUOA 1PT6A 2VP3A 3ESRA 4PGGA 3WDMA 3DNVB 5AVXA 2CLKB 1P1KA 1L8LA 2C5GA 2DHDA 4ZV7A 1QVVA 3T1HB 2E1PA 4OMUA 7ABPA 2MR5A 3FJ1A 1V39A 2VWHA 3DOEA 4X71A 1DRVA 2C94A 4MWZA 4PNHA 4RVFA 4AN1A 1HX7A 1Z68A 1R16A 3HMKA 4UM7A 2KLHA 3LU1A 4YJFB 1MN6A 5CDFE 2WU4A 3I8OA 3KU4A 3FKSA 4M6WB 3GGSA 3THRA 4HMOA 1EE2A 3C8MA 4U7PB 3GAZA 1ZMOA 4KQHA 1K4YA 5EKTA 3P9YA 1DT5A 3KWJA 1BMFA 2O2DA 1Z0JA 5DXJA 2FB9A 4KV9A 4PGMA 4IDQA 1ONPA 2HWYA 4RVSA 1Y7PA 2HMAA 3RB8A 3UC5A 1BHJA 1V9CA 2H4WA 4TWZA 3TUZC 5JUWA 4AFNA 5DHSA 1X7YA 2A9KA 5CDTA 5T64A 2CV2A 2P65A 3IUYA 1SEVA 3UM9A 3TAXA 3HV0A 4CEJA 1A2KC 1G7SA 3K32A 4OAOA 3WKCA 5BMVA 3ETDA 2ODQA 4F21A 1XJQA 2ATIA 2XWQA 1FYFA 1K3UB 4E5KA 1LW6E 1Q44A 1E69A 3ECCA 1GUBA 3GK3A 4FS8A 1DAFA 1JVSA 2GEDA 1TIBA 2QEQA 3D3EA 3M5PA 2J87A 3GEDA 5AK3A 2VH5R 1R27A 1IG0A 1XU4A 2DBYA 2P77A 4JJGA 5JXGA 3PGA1 4RTOA 1ZZGA 4JWKA 4B33A 1BH2A 1ZHOA 2CLHB 4D81A 1FP4A 1VI2A 4CV0A 1QG2A 1BMFD 1Z8NA 2QPLA 5DI9A 4LG1A 4E15A 2OV4A 3SSNA 2R5WA 2RGXA 2YX1A 3UWPA 2NG1A 2Z83A 2ZYGA 3OEWA 4QFMA 4YJ2B 1IUKA 1YQ9A 3UW1A 4W63A 3HVIA 4M9UA 4OLFA 4EBFA 3DE5X 4PZPA 2JK1A 2AJ8A 1OI3A 3KQTA 4KZPA 1E89A 1ONOA 3QBEA 1IN1A 1MKYA 1L4MA 3R9IA 3JD2A 3EGDA 2Y76A 5HKAA 2BL4A 1TEHA 2J0UA 4DR3B 1DZIA 1M5TA 4L1KA 3FDZB 3INNA 1UBSB 1QGUA 4REOA 2I2BA 4GOXA 1C14A 1Y1PA 4JYZA 4M1WA 2YV3A 2DF8A 3GLUA 2PQ6A 1T4GA 4Y7DA 4LYJA 1XZDA 1E77A 3TR6A 4OB4A 3JYHA 4CIAA 1SURA 1CS4C 3ZH9B 4CDRA 4JP2A 1FY2A 2XB9A 2CJWB 1VG1A 4NCIA 3GUHA 5FHRA 4AD8A 3AFNA 5BUSA 3WL8A 4LXQA 5HGXA 4Z7OB 4KNYA 3V1YA 4LAFA 2EU8A 3V9PA 2JLZA 1HDZA 4W8GA 3SQLA 4DLBA 4F60A 5JS1A 3HABA 3MJCA 5AXBA 3D8SA 3ROFA 1S2DA 1X0VA 2AEEA 2GM5A 3QMVA 2HJSA 4LHSA 5AW9A 3WOHA 2MSCB 4J16A 4CWAA 1NONA 5JCJA 4BV3A 3LSTA 1Z2OX 1BMDA 2CLMB 1P8AA 2XUGA 4MLCA 4UXJA 4ZP1A 3D7LA 1N3LA 3NIBA 3TD6A 4AJ4A 2NVBA 4A0GA 4YRBA 3QTBA 3E2MA 4KBYA 4MR9A 3HP4A 1MMFB 1NVWQ 2H1SA 2IIPA 3IVXA 2YXBA 4PCAA 5AESA 1H2YA 3QQ5A 1EUDB 2WWRA 3FDXA 4BUCA 4IOMA 5JYBA 4EJ0A 4RA9B 3GZCA 3TLZA 3G0IA 2ERCA 3AUYA 5ALLA 5KNCH 1WDLA 2F3TA 2O23A 3KSBC 5FADA 4EQZA 4IXWA 2Z2ZA 3PQ5A 1GGVA 2B82A 3HUTA 2PNJA 1UMBB 3QE0A 1PZNA 1GAWA 2X7HA 3IEIA 2JFGA 3VR2D 2ZT7A 4MCXA 1EK0A 3OTOB 2CROA 3VYSB 4IYJA 3Q0TA 3LT1A 4EZIA 1JHYA 1WXFA 2ZS7A 3P0IA 3EVFA 4J3JA 4OGWA 3UFDA 5BV7A 3SZRA 2BGGA 3FVQA 4MCHA 5HKKA 5GP1A 5I3CA 2BD0A 4KC0A 2IW1A 4R3WA 1CUVA 2RD2A 3EZ6A 1B76A 1QO7A 2WNIA 2YY7A 3HO1A 2BELA 3F51A 2EIXA 2PS9A 4HNAA 1KYVA 3KQOA 5G4KA 3SM9A 4EFNA 4KR2A 1V3VA 5J47A 1Q3HA 3OLVA 1AKTA 2JFWA 4FR2A 4FE4A 4K40A 1KMIY 4P93A 3ZN2A 2KZ8A 2PXDA 4TV9B 4MWTA 4KLZA 3C7TA 2GPNA 4RL6A 2ZS8A 4MVJD 2NPFA 1L7VC 1ZUHA 3M82A 4XYEA 4DNXA 1OXMA 3OE1A 5ECDA 3O8BA 4HBZA 2Q8NA 1WMFA 5HRAA 5JD4A 5JAZA 1BX1A 2ISCA 4UVDA 1S2IA 1Z4OA 3CKKA 2BFDB 3HM2A 4GX5A 2VXBA 4RCVA 1CUCA 2O48X 5FI3A 2P0YA 3FUTA 3IKTA 1Z4NA 1K89A 4IEIA 1FNSA 1FDWA 4I3FA 1XXHE 4V0KA 4A8JB 1CYDA 5C3MA 3KPYA 3HDVA 3PTZA 5FEUA 2YZ7A 1AKWA 3R6WA 3ANTA 4ZT4A 3RRZA 1GCGA 2Q62A 2WD8A 3G0OA 5FNVA 2PX6A 1MC8A 1NI3A 2E4AA 2XMZA 4OBXA 5AICA 1YB4A 2J0SA 1E94E 2KWIA 1HFEL 4MROA 5HBRA 4RD6A 1VKNA 4IM7A 5BUCA 2CLLB 1JAHA 2MMGA 2F3QA 3WS7A 3CCCA 1DJOA 1EK6A 4CM9A 2QRQA 1M8GA 1SUDA 3R3UA 3HL4A 1V5IA 4FMPA 2JLUA 1OLUB 4HAOA 2CKMA 2E2WA 4I66A 1EWVA 3N8IA 3OZXA 4JNCA 4KX3A 4FFLA 3TKLA 3TGWA 2I2DA 4OQYA 5LXTF 1U6KA 2EKQA 1CP3A 2HCBA 3DLIA 4B6QA 3RC7A 4FJ1A 5HRCA 3O73A 1YACA 3KHTA 4I81A 2PUTA 4EHNA 1IRIA 1P45A 1QDEA 4YUWA 3AR4A 2G5GX 1E2DA 1H1TA 4DCUA 9ATCA 4RMGA 4IHQA 1K5DA 2VT7A 1HI9A 2IPXA 1NRXA 1BKSB 2BN4A 4KXNA 2H3EA 4WOPA 2XITA 5L6MB 2V98A 3VBEA 5FFMA 3T7AA 4LSZA 2F3SA 1PFWA 1OSNA 2XEDA 3H16A 3IV9A 3QFTA 4MQFB 1EJ2A 1H0KA 1U7HA 1T2AA 1XCOA 3HUDA 3IQZA 3KD2A 3MS4A 2H51A 2MIIA 2XD4A 3JQPA 1WOMA 4JD5A 1DIOB 2LXNA 3ZWPA 2PL3A 1PFVA 4AJOA 3Q9UA 2BE9A 3TECE 4YRSA 1H05A 3P5SA 4G1BA 1P5RA 3G3EA 3JYNA 1GPLA 5KX5A 3KO8A 1BQ3A 4M7PA 1Y5MA 2GFHA 5E4JA 3HU5A 5HFJA 4BLVA 2RJNA 3QW4B 5BT9A 3VA7A 2FN7A 4ZO8A 4EJSC 4J7UA 2CNLA 1RM4A 2WLSA 3DTNA 3PS9A 4FLMA 4KK3A 4JB0A 1LQTA 3OCWA 4TMXA 4XPIB 3RT1A 1KO8A 3COYA 3IMEA 3NH6A 3E9NA 3LT4A 4HXYA 2JFYA 1RWVA 1M6WA 4YDHB 3DYBA 3OMWA 4EG3A 1DVRA 4BBJA 5BSHA 2ZYDA 1U1GA 4KMRA 4OJQA 4RENA 4ENUA 4LJ9A 1IIBA 5FWDA 3GJTA 4OQMA 1YZVA 4IDFA 3H2HA 3L7OA 3I45A 4G1CA 2D1SA 2Z9BA 2C4UA 4GX1A 3W05A 1BXGB 3ZJTA 1QG6A 4GZ6A 4Y2QA 1Q22A 3WRYC 1ZA1A 1HH4A 3AIIA 2ZB7A 2O5EA 4KBFA 5IX8A 3TE6A 2Q5FA 5DBFA 4ER7A 5F7OA 4UC0A 2O52A 4YRFA 3EXIA 3CKMA 5EFOA 4Z4HA 5K6RA 1WB9A 3HYSA 2RG7A 3C5HA 3TSCA 6ABPA 1XZ8A 2MDTA 1RFLA 3CG4A 4NBWA 4F86A 2PUAA 1F8GA 5TRTA 5EOVA 1KTVA 2EZUA 2VVTA 4PX2A 4CNQA 1I30A 4MP8A 3LVFO 1W2WB 2ZPAA 1L5SA 3S4YA 4UHFA 2X58A 1WB4A 1QQ6A 1U9CA 5CDSA 2GAFA 1PR0A 3K5PA 1KIFA 1GWNA 2QVLA 2W2VA 1DU4A 3AEKB 3M7IA 4CW7A 2FPIA 4X3OA 1J2EA 1ZCBA 1T2FA 4Y6SA 2B1QA 2JCGA 4AKSA 4ADSG 2GF9A 4MW9A 3REQA 3TLMA 5HUQA 1UKAA 3P9IA 1T91A 2ZWOA 4I9GA 1QANA 4PQRA 4V0ME 1GD1O 2HA4A 3QYAA 2PUDA 1B93A 3EZFA 4S1VA 4W7IA 1GPKA 4IH1A 3KOOA 3H2IA 3KQSA 1GZ5A 1VHQA 2VK2A 4OGLA 2NZWA 3VM6A 4EVIA 5CCEA 3HPQA 3H65A 4H77A 4YP0A 3UCFA 4FB4A 1Y8RA 1NERA 3S99A 1UDRA 3ENQA 3R6TA 1U8FO 2A0FA 4EABA 5E6UB 3C1TA 2OBMA 2DY1A 3BIOA 2OXTA 3RUEA 3S2YA 2P4QA 1XIVA 1Z34A 4FR0A 2HCNA 3T94A 1R10A 5JATA 1PTJC 3R9XB 3U3OA 2I71A 3QF4B 2X9NA 1B0PA 1OILA 1IVYA 3B6EA 3FNQA 3GLRA 4DDMA 1U2GA 4J8PA 5CLLA 3HP1A 2PJZA 1CEYA 1FQKA 3DZ8A 5DCYA 2ZI7A 1D2MA 5E7MA 3TW4A 4Q4HA 1UEJA 3PDUA 1U3DA 4E11A 4E88A 1C9DB 1CJVC 2IP1A 1JIJA 1RYZA 2VYND 5C34B 4UHKA 2PSSA 4M36A 4XLLA 5GAHi 2AUTA 2R25B 3NUQA 3WIDA 4Y1GA 2H7XA 5KEIA 3QFRA 4D7AA 3AU8A 3I5YA 2R3SA 4EG8A 3RIMA 3AJ9A 2P7HA 4YAKA 1YOBA 4I1PA 1Q83A 3CLRD 4P3XA 3BUSA 2FDCA 3D6NB 2QRNA 3CRQA 1PT8A 3A6HA 5CXXA 2RHWA 4UTNA 4JQCA 1RAHA 3LTNC 3RF7A 1BA3A 2ZBEA 4RGBA 1DAEA 2A94A 3ZJYA 2FN3A 2UUCB 4O4LF 4CM6A 3UG7A 6REQB 2HIHA 4ZC8A 1Y1QA 4ER5A 1BS2A 1SCIA 2O5VA 4M2LA 5H3HA 2W6PA 1EU1A 5KPDA 3T1NA 1EG7A 3AR9A 4KYUA 5CBPA 3PHCA 1RJ9B 5EMMA 1SN7A 4JLOA 3B9PA 2LPMA 3PXDA 4IGIA 4PU0A 2PH1A 1DC7A 2PMCA 1RIOA 1M7HA 2BEVB 4UTVA 3DBRA 3S0JA 1RSZA 1YIOA 1YKFA 4CV3A 4CUKA 2YYSA 4U2BA 1CQIA 3Q3IA 4ML3A 1BCSB 4TLBA 3VR6H 1N4AA 3UMVA 1H6BA 1RAEA 4QZVA 3PF9A 5E38A 3MC1A 1ML4A 1T1SA 1UT8A 1KY2A 4KV7A 3ICVA 5E3HA 2XJ3A 1BHQ1 2P2ZA 4Z54A 2C4VA 1AD2A 2A9QA 5P21A 3ADCA 4H0CA 3DSRA 4YS6A 3IDOA 3HB9A 4PZ0A 2ZVDA 1I5RA 1R9MA 2PLFA 2ZB2A 1HNNA 3L7MA 4KGXA 3EFBA 4R2JA 2OV8A 5EJ6A 5IDXA 3AI1A 3SF8A 5GJCA 1NBMA 4MIOA 4QJBA 2EWTA 1KP3A 3FAKA 1FDRA 1H2ZA 5DNAA 5FQNA 3WLNA 3HU3A 1NVVR 4K8OA 4OKSA 4Y7CA 4QLBA 6GPBA 2IW3A 4Z6KA 4GKVA 3RUDA 2HPAA 1UP6A 4A3SA 3SJBA 1IQRA 3LVRE 2OP0A 1V1MA 4H7FA 2C92A 3NIFB 3V8NA 5LXTB 3RR2A 3VZPA 4EUKA 3OM1A 2EL7A 3H1EA 3OFND 1QP4A 1Z47A 5CDGA 2DWQA 2JJ1A 3A10A 1Y8AA 3Q10A 2L1PA 1RXIA 4KU4A 4MGKR 2WQ7A 2YCLA 3MYYA 3MWYW 4N9WA 4EA6A 1WQ4A 1VDZA 1ZH4A 2NO4A 3ZDZB 4Z7JA 4KN9S 3MMXA 4OMDA 1YB5A 2ATXA 2IUUA 2HKIA 2CLSA 1NXXA 3TKYA 3RG2A 1LBTA 2QVYX 4TLAA 3WGLA 4AUMA 3BWXA 4LRWA 2Z1DA 2Y1EA 1M0WA 3QVTA 3CN7A 2CD9A 3TN7A 4D9CA 3LVQE 2FWMX 3UQYS 1CPYA 4JUBA 2B5OA 3MILA 4YLGA 3QJ5A 3ZIAD 4V0RA 1UKZA 4MKIA 2WAMA 4EGQA 4JI8B 4E22A 1GZVA 2AFIE 3A6LA 3BDNA 2H1LA 1UTXA 3JQ9C 2RMKA 3OFNA 4AWXA 5C52B 1XHLA 3BC1A 1H8HA 2C9BA 3OPMA 2PE5A 1J9EA 1JLLB 2NSHA 1RZ3A 2NZVG 2WVHA 1XN1A 3HFJA 3KKZA 3HG7A 4PTYA 1ZW1A 3BMCA 3DA8A 2G80A 2V55B 3B8EA 3FCOA 1EJ6A 1RLUA 4E7OA 1QWOA 1USUA 3LHSA 1FTQA 2BR4A 2BNMA 1OTHA 2P0EA 4HG2A 3SF0A 3WKDA 1H4VB 1P9RA 1X7WB 2H3HA 2ZE6A 2NO6A 2ZJ1A 4OGKA 3L7NA 1TT5B 1ACJA 1U3GA 1JLSA 4U39A 1MAWA 2B2XA 2ZZNA 1JALA 3DKKA 1Z62A 4C20A 3ZQJA 5KWJA 3P19A 2IV7A 1ZU5A 5DM70 3ITEA 2KS6A 2O5CA 1ZOIA 3KQVA 1YDGA 1NXPA 3F6CA 1Z22A 3NBXX 2PRIA 4E2YA 5B2FA 5JDIA 5J2UA 4DNFA 3HMQA 4GDMA 4WEOA 2Q29A 4BNXA 3VZCA 3B1FA 1Y3BE 5J2TB 1M6VA 3KOMA 1PWXA 2GJ8A 3FVTA 1CX9B 2XZTA 3AVVA 2L42A 3G9XA 4RD3A 2ZYAA 3RTGA 4PIMA 3RKRA 4YR7A 1ADJA 3KYCB 3VWSA 4BIIA 4BP1A 2FZWA 4BX8A 2M1ZA 4KXMA 2GJ4A 4NDWA 3ABOB 5DLQC 5E2BA 2WF5A 3LDGA 5LMNB 2ZTLA 1QKJA 3UAVA 4BMNA 2PZBA 1OXTA 2D0DA 4LV6A 2FQQA 1GAEO 2A59A 4Q1VA 2P90A 5ALUA 1IZYA 2B5VA 3A3KA 4TYNA 4RF3A 5KTPA 1AV6A 3N6XA 4ZWNA 4UKDA 5F5LA 1M66A 3GQVA 5ALHA 2OTCA 3G79A 4ZICA 2QA5A 2C8VA 5C4GB 2CDAA 4RMNA 2UXDB 4HNSA 3NNSA 5JO0A 2XODA 3DOFA 4U8GA 1CF4A 4ESEA 2WF6A 3NFYA 2CWDA 3VRHA 2Q9BA 4JCOA 3CX7A 4FEGA 1KORA 521PA 5TS2A 2AE1A 5B30A 1J2TA 1KOLA 4X93A 1C3OB 2B9VA 3H9QA 2VJAA 3KZVA 1V95A 2AOWA 2HT6A 5HFAA 3TW8B 1NYLA 3CX3A 3VC1A 1JQEA 1MVLA 1OHHD 3WLLA 3EFHA 4LW8A 5BW8A 4WZ6A 3HKBB 1OE0A 3DL0A 7MDHA 4QUHA 5C8YB 1SCDA 1BVRA 2FFRA 2O2SA 2RGCA 3MB8A 4RK6A 4Y18A 4BXOB 1ZD2P 1TUBA 2IEBA 4XH9B 2LKCA 2CXNA 5TQ0A 2IUTA 4KG7A 1QGED 5ED0A 1ODSA 1RXVA 4IIGA 4CF3A 4LQ4A 5A0VA 3ZV3A 4JDUA 3O90A 2RI0A 2V5VA 2G6BA 1GPNA 3QWFA 2JGEA 1D5CA 1DQSA 4NECA 3NW9A 2TSYB 3KKOA 3SYNA 3VKVA 1EXMA 3GHYA 1V7PC 1G6OA 3ZE6A 4JJ6A 2H4ZA 3P71T 4BWYA 1VA4A 1N1MA 2XXAA 2R1ZA 4N5DA 3O93A 4FIDA 4GNKA 1QZZA 4OKNA 1N0IA 4F3RA 3BX1A 1VKZA 1H2HA 2AI1A 2G8NA 2GBCA 3COVA 4CU2A 1UKBA 4RGYA 5CB8A 2FG6C 3GLSA 3ED5A 3ZY3A 2EJWA 3KOWA 1WLSA 1FFAA 1YA4A 1DAKA 2CF6A 1TQ2A 3EQ7A 5BUQA 5D2CA 1GPAA 1ECBA 3A1FA 4KI7A 1UK9A 1T8UA 4DCNA 3SC4A 1RQXA 1XA4A 1T2NA 3OFKA 5DBGA 5ER6A 2BGJA 5IXJA 4PGFA 5FO0A 1F7UA 1JLLA 2PCLA 3LCRA 1D09A 4IKPA 3L0OA 2HNAA 4GD3Q 3ERCA 4LXYA 2V4ZA 3JY6A 2BFFA 1A50B 1M2VA 1BXRA 3LCUA 5K8JB 2ESRA 2VRCD 3EVTA 4XYMA 2OO5C 1OKKA 1SB9A 2D3WA 2YUIA 5KX5F 2V59A 3U80A 5A4DA 2C9OA 4MGYR 3IXMA 1LNSA 3IP5A 1MB9A 3URKA 3ZU5A 3C48A 1Q6ZA 4AROA 1JWAB 5BXQC 1EHYA 5KYWA 4FI3C 4DCJA 1CY6A 1O96B 2QGFA 3GQBB 2JFZA 4LHYA 5AXAA 4MW1A 3T0GA 4CG3A 2IU3A 3S28A 5TLSA 5ICSA 2BRUA 3QXCA 2OR1L 3OM8A 5SYNA 2IYNA 2HJHA 1IWBB 2VDVE 3WAGA 5DNYB 1U3VA 4N03A 3NOXA 1EUCA 3C7KA 4FC6A 3GLQA 5F7XA 2AFHA 2ET6A 4CIBA 4R71A 2QL7A 1B8UA 1JZSA 2YNMA 2ISQA 1GRQA 1BYIA 3M6UA 1GR0A 5K0LA 1YE3A 4YQZA 2IYEA 3ND6A 1HKUA 3CY6A 3IP8A 2VRCA 4RDIA 1QUEA 1VYVA 1LS6A 1ZH8A 2YZGA 4PFQA 1C4WA 4DE5A 2WHQA 3PSAA 2C20A 5I4IA 2HFJA 1SBIA 2HDNB 4WW0A 4Z4QA 3H75A 1T4BA 1KOJA 3SEAA 3PFBA 2JAQA 4PLWA 3CO0S 2ZUBA 2CNBA 4OU4A 2QPAA 3OVMA 4P7GA 1P2UA 4ZKDA 1ZN8A 1E79A 5ED4A 3ZCVA 1GRVA 3T7SA 5CA1A 3K4PA 2JBAA 3BHJA 4F6CA 3DDOA 3T5BA 4ES6A 3AV0B 1QU2A 3MWGA 1HUQA 1CERA 1R0CA 1U1EA 2FPXA 2W00A 4YRDA 1AUPA 1UJ5A 4PSAA 3TRJA 4IMRA 4DW8A 1NNI1 2WP8J 3QVOA 4KQ9A 4HTFB 1PRAA 1QHGA 3H83A 3HFGA 3SYRA 3ZKWB 2FZ5A 2YJ5A 4MQEA 3HUEA 1GTZA 5I9LA 3QITA 2GHTA 3CVJA 3G49A 3VVBA 3HR8A 3K0CA 3NBUA 1J70A 4QECA 3QU2A 1BGVA 3NASA 3I52A 3QI2A 2BFFB 3ZXSA 5K4AA 1KTIA 3QFSA 1Z33A 5JSFA 2ZRKA 1LC3A 3BQMB 3TQQA 4NI5A 2EDCA 5C4MA 3DWGA 2OZLB 1TA0A 1HQYE 3SDSA 1T1EA 5F52A 1RQRA 1YVPA 1JAYA 3ZV4A 3ORRA 2R1JL 3RS0A 5HPYB 2GRLA 2V58A 3HYLA 5IARA 3LHFA 4D43A 4GMKA 4JA0A 2XUQA 4PYKA 4KGDA 2FF7A 1KC3A 2J4DA 3JQFA 1WDKA 4MS3A 3OF2A 4DZZA 3Q12A 1FVXA 4RY8A 5BYBA 4DRXB 5K4GA 2GKSA 1BJRE 1IQUA 1JH9A 3BH6A 3DZCA 2W90A 5CXQA 3HKDB 1A8QA 2J67A 4GR5A 1I7PA 5L7TA 4I36A 3FTQA 4Y2SA 6NULA 3PPVA 1F3LA 2AW5A 1EG2A 2PD6A 4HQKA 4NZZA 2QRHA 3UPDA 2CNKA 5EIXA 2XZLA 5CPBA 3ZZ1A 1P6UA 1FA9A 1GAQA 1PJBA 1VSBA 3MNFA 1N8SA 4WGGA 4GZMA 3JD0A 5JU6A 1GDTA 4PBRA 1P2DA 3U0VA 4C08A 3EULA 1DXHA 1TNDA 1O4XA 1VLQA 4FN4A 4OHXA 3E15A 1UK6A 2X9QA 1TKRA 4JCCA 2RI1A 4DLVA 1W0JD 1J49A 4JT8A 3U44A 1L8XA 3Q9NA 2YXLA 1BROA 2DCUA 3HB1A 2XCSB 1SCAA 4GBJA 2B7BA 3IMFA 4QSMA 3SG0A 2C97A 1W75A 1RRPA 3K8YA 1MNAA 2ZCUA 3QHPA 3GRAA 2KYRA 1XQ9A 4JLVA 3IEVA 2POCA 2C8JA 1EQ2A 1X70A 1YGYA 1Q11A 1ZK3A 4QYXA 5D5PA 3RS8A 1VI5A 3JPWA 2P3OA 2A35A 1JG6A 2QORA 2QRJA 3BS4A 5A6SB 3KT8A 1ISJA 2R97A 3WFZA 1IDN1 3PPYA 4LE1A 5E2AA 1DB3A 5L51A 2ZIFA 2FSFA 3BJZA 2FPOA 5CCDA 4E5UA 4YP9A 5JVDA 1O6BA 1Q7EA 4MA5A 1NBIA 1WVGA 3OQOA 4B71A 2BSXA 5AQEA 5CDFA 2W7TA 2JJMA 3BZBA 3OZCA 2AK3A 2QROA 4V1CB 1D4OA 4MQLA 1GZUA 2ZTUA 4NESA 1JVNA 3I9NA 1RAIA 3PJGA 3HCOA 3MN1A 1QQAA 3DNPA 2ONJA 1RW4A 1PU2A 1M2EA 2PUVA 1PT9A 4M8SA 2ZJ4A 1J2RA 1EVLA 2BH9A 2A6PA 3HXMA 2FJRA 2WJYA 3EBOA 3VH2A 4I4TA 2KMLA 3FTPA 1KFCB 4RPGA 4DSOA 1W88B 1BHO1 2RCYA 4E1VA 3WWCA 4DC9A 1NBME 1BU5A 2JFPA 3FNIA 1JTFA 5CVCA 4B0OA 1V3UA 5JPIA 2CLCX 1XJ0A 4WESB 1QR6A 4HK4A 2IXEA 3H7AA 4CQLA 4HH0A 1BQEA 1K8RA 5EXXA 4YUVA 1HZZA 1KK2A 2CBGA 3HDYA 3T3PB 1WABA 9LDBA 4HB0A 4US1R 4H4DA 4G5XA 2OO3A 5HK9A 1KYQA 1L7PA 2RKBA 3L05A 4G5HA 4B7ZA 2PYDA 5A4FS 1HA3A 1ZFNA 5JTUA 3VNUA 4DLZA 4EY8A 4H7EA 2EV9A 2X1VA 4QKQA 4LGMA 1IOWA 2J5BA 1IHDA 1UFVA 3HSKA 3PFIA 1U2QA 1POXA 4EKYA 3CSSA 3GBFA 5JDCA 4HCJA 4P5DA 4XGKA 2WJVA 3WLKX 4RDXA 4H9GA 3DD5A 3QENA 4Q0MA 3FDJA 2JHFA 5LNK1 3PEFA 2K4MA 4L8VA 2Q0SA 4NBLA 1NMQA 4PINA 4J76A 3FCCA 3V9AA 4AM8A 2ZRQA 3L6RA 5H9WA 3F9RA 1M6HA 2H00A 1D2EA 2JCVA 3ZLJA 3IQEA 3DZKA 1DAOA 1DE0A 4B87A 4BV9A 5CR9A 1DJQA 1G63A 1NM5C 3W8NA 3UOAB 4NTZA 3I2FA 1NR7A 4X4BA 1TTQB 2ADFA 2OCYC 4EYEA 1LV7A 3TFWA 4HH1A 4WESA 3UANA 4NDNE 1Q3KA 5L4NA 1HDOA 2R47A 3OEYA 1DC4A 1RBYA 2MHCA 3M0EA 1X80A 3CR8A 1ZM4A 3MJSA 2EHDA 3VPCA 2EOAA 2ZXEA 2JAXA 2DKNA 1BGWA 1PTJA 1AXRA 1RRGA 1BEZA 1Z13A 3IXQA 3WGYA 2WSLA 2FZKA 3DMHA 4IX1A 4KQWA 4EO7A 4F9TA 2OFYA 4N3GA 2AC4A 2H7VA 1ZD1A 3QOFA 4OA8A 2IU0A 4X00A 5CURA 4AVYA 3K1TA 5IVHA 3FNGA 1O94C 1P1JA 1VMAA 4N49A 5MFZA 1ZZ9A 1H66A 3UZUA 4MRVA 4IV5A 3E9RA 4PO8A 4OLBA 2ZR9A 4FGKA 1P1CA 5ELLA 4RM3A 2OP1A 3FZGA 1II9A 4XX0A 4Z4GA 5ENDA 2V6JA 4ERNA 5AKIA 3V8RA 3ADBA 2GZMA 2NM0A 4IKOA 2JKYA 1Q7GA 1VIYA 1GEEA 1O57A 1YS1X 2RDMA 3CLVA 4KSCA 3FPGA 4DCCA 2HO5A 2BFEB 3H4TA 2GK7A 5A2GA 3V7FA 2DX7A 1AKYA 4PWZA 2I6FA 4AF8A 3D0OA 3OZWA 2PFSA 2X1MA 4JA2A 2GCPA 1R3UA 2GHRA 2V7UA 2WMNB 4WA8A 2JIMA 3FPBA 1E2IA 3G0HA 4W9NC 4YJGA 1PR2A 3A04A 2BWJA 4HNTA 4TV8F 1LPSA 2QHXA 4G0MA 2MYUA 3R77A 5IAKA 4ZMSA 4JR0A 3A37A 1YO6A 3U1BA 3R3VA 4CLRA 1BN6A 3SX2A 1ECPA 1UT6A 1K6EA 4WNAB 2XNCA 4F9FA 3OOSA 3C6KA 4BRSA 2LNMA 1NX6A 1VJRA 3NJRA 2WTAA 4RC9A 1HLPA 5IYZF 1OU0A 2KQUA 4DY6A 1YR9A 2QQEA 4YC7A 1SGWA 3LPAA 1X2BA 1GGFA 2I2XB 2QVXX 2VLBA 2VT6A 2ZRBA 3AR8A 2R65A 3O4RA 4GYKA 5DLYA 1R74A 4JKIA 3IPCA 4JJAA 3L0PA 3QVLA 2J0UB 1ICIA 1U28A 2VDKB 3P2JA 4U2KA 2PUHA 1SOVA 4L6IA 4N8DA 3K1ZA 3D64A 2XTMA 2YW9A 3AESB 3H1GA 4YCSA 3GMTA 1X7XA 1I1NA 3OAAD 3DMTA 4L5CA 1G7RA 1G21E 3MRXA 1TCUA 3SC2A 1TGVA 1K86A 2OBLA 2ZSJA 1XL1A 4AL4A 1WW3A 2XGGA 7AT1A 4PSVA 1SZPA 3SHQA 2BTEA 4OM8A 1KAQA 1Z38A 2A88A 4TL9A 5AK0A 2SECE 3QIVA 2F9LA 3FR7A 2GO7A 1G9XA 3NRJA 4UVHA 1NW5A 3P9ZA 4E5PA 1XTIA 1Z37A 4MVJI 4P81A 3V8VA 4P4GA 1U5BA 2P41A 3DGEC 4TS3A 4ZEXA 5AW1A 2XYHA 3U49A 3EH1A 1O5OA 3A27A 1KO7A 2QX7A 4X20A 1A1SA 4KBGA 3NB0A 4BZZA 4P4UA 3I2JA 3OUUA 1AURA 1XD2A 1GGJA 3AETA 4GGMX 4M7WA 5KTNA 1EUDA 3VR5A 2Y1DA 4ZI7F 5JTTA 3W5BA 1A9TA 3ICCA 1D7OA 2PGNA 4WY2A 1FZTA 1J0EA 2XECA 1MH9A 2R751 3ZDRA 2FOIA 4H4CA 1N5KA 5IJ9A 4GWKA 4YR9A 1U4OA 5CHEA 3L1IA 1TI7A 2HRRA 2DLNA 1CJKC 2IPOA 2IHVA 2XVAA 2VDQB 3H9CA 1EQAA 4HF7A 4YUAA 1KEEA 1TC2A 4IHJA 1WUKS 4ZVMA 3LBAA 5IDWA 1IC6A 1WCIB 3ZX5A 2P1ZA 2V65A 3GI1A 4JBLA 2FX2A 4RLSA 4FMDB 2FCAA 3K0BA 3E5MA 5AW4A 5IC5A 5I7RA 1M34E 5JIBA 4QOEA 5FI5A 4UE3S 3BG5A 5I7AA 3HXOA 2P27A 3PBKA 2BMDA 4IFEA 4KQCA 2DPMA 4YP6A 4EHFA 1T3SA 2V6GA 3KLPX 4EL0A 4WJKB 5GV8A 3P2YA 4CTMA 2A1IA 1B8VA 3AKCA 1XDGA 5G4KB 3RJ5A 5IM4F 3CH4B 4G8CA 4Q9JA 3ZCXA 5J4HA 4RAOA 3DP7A 2VOJA 4YO8A 4TL7A 9MHTA 5TE9A 2X2EA 3OZEA 4AZVA 3HBJA 4DJEC 2QU7A 3F3MA 2JJ2D 2OM6A 2NU8B 4ZYVA 3IURA 3JARA 4B7XA 1U02A 3DR3A 3G0GA 3HPRA 2W6NA 1FBNA 5KBYA 5KNBH 4LJ7A 3DFMA 2DFKB 3HCEA 1JTVA 4XWAA 1EM6A 3K16A 1KXZA 4ID3A 4F0JA 2RGAA 2J46A 1JEQA 3NBMA 2VJCA 1QH8B 4NOJA 3I92A 4X5OA 3RUIA 2PZAA 4BLUA 1CJTC 1OX5A 2EP8A 1ODJA 3JW8A 5TGDA 1S8NA 1E2LA 3GVPA 4ZFNA 4L02A 5BPHA 4X6UA 3UMFA 1PG2A 1W5AA 2O50A 5GQSA 2ZAMA 4LOJA 4ZANA 2OV1A 1P3DA 1BOFA 1KOGA 1JG1A 4JASB 3FYDA 2MSDB 1R6AA 3Q9SA 3BQNB 1OZGA 1SVWA 5EXSA 2FW8A 2JAWA 4E70A 4UTZA 5DBHX 1KMQA 1NYTA 2WINI 4TZKA 4XGRA 2XKJE 4YCAA 3GZJA 2BGIA 2IVBA 1P9LA 4L3OA 2PD4A 1SXJA 5D3ZA 4R16A 3PDJA 2ODWA 4R2WA 3NHYA 4OHPA 3ZQ4A 4DQ0A 4XWWA 1W581 4JZYA 2C7BA 1MR3F 2FUCA 5EP3A 1QH9A 3MBKA 2H4FA 1H2FA 4DIBA 2BKVA 4CGZA 4ZI7B 2VJPA 4I19A 1TQDA 4FWBA 4WKNA 1BXKA 1KYWA 3GU3A 5DM1A 5K3DA 3ZVRA 4FLEA 2DB3A 2QL6A 2WFMA 5D1HA 4ZQBA 1JQ5A 5ESDA 4FYVA 4R0NA 5A3SA 4BNDA 1R69A 3KPVA 4KR7A 2OENG 4OHWA 3ZZ0A 1K5HA 1FTGA 3K92A 1P60A 1KS9A 1I1OA 2V7VA 4CBVA 3KQUA 1XTRA 5J9FA 4O63O 3V1NA 2QJFA 5HF6A 4GGPA 5E6UA 1T5BA 3USES 3EVGA 1CS0B 1JDPA 1TW2A 1XVVA 4HUQA 4LHXA 1TRHA 4DIFA 4E51A 1AH2A 3ADOA 3O8QB 1MCZA 1GGNA 3RIEA 4YJFA 1TK2A 3CRVA 1KEUA 3CTMA 3DB1A 2FDRA 2WG2A 2O8CA 4KVGA 2AFHB 3FLMA 1PR1A 2OFWA 2CHEA 2GFIA 1UZLA 3TLXA 3WGTA 1Y9EA 5HEKA 1YHYA 2ORIA 4EJFA 3CEMA 1NVUQ 2G9UA 1XQXA 2GEKA 3VBCA 5LA6A 4BLTA 3N2LA 4YAGA 5LC1A 1UPBA 3GYBA 3OIYA 2OM2A 5HE8A 4ZZ1A 4KLCA 5C8ZA 2F6RA 4NFHA 3AB3A 3WGQA 4BATA 2ZYRA 2FRXA 3UWSA 5HP4A 2ANCA 4DC1A 1EMDA 4QT4A 5JQGF 4OHUA 5LDHA 2REXB 8LDHA 3F97A 3PLNA 2WZBA 4URHA 5H81A 3NJ4A 4RFLA 3TD2A 4IQFA 1SBYA 3HDGA 2FETA 2R87A 5FWYA 4UVGA 1YBHA 2K2WA 2ZBVA 3UKJA 4EI2A 2UZIR 5GADl 1Z0DA 3IOMA 1TQ6A 1K8ZB 2CBZA 4YRMA 3S2FA 4J4HA 4KXWA 3MINA 1LMB3 5AW7A 5JAHA 1JG7A 1XSEA 4XTCS 2BVNA 3AR2A 2LYQA 5JARA 2IVFA 2NV2B 3K2IA 4LC1A 2QS9A 1A82A 2OILA 2IOQA 1HDCA 4KX5A 1U8YA 4CM8A 4F97A 5BOSA 5LUAA 3R7FA 3F8WA 1EZ1A 4F12A 1Q20A 1HM5A 1W5SA 2DSNA 3I32A 1KSGA 3ZR4B 5B12A 4IQ8A 3BXPA 1U7WA 4C6SA 4ARUA 4PIPA 3WLTA 1Q7BA 1P61B 1D07A 1G7TA 1PDOA 2DTEA 1HO3A 2ZRNA 4FFWA 4J1NA 4TLLB 3R40A 3G0TA 2FAXA 1J07A 1P7CA 2E82A 3QEBZ 4EUNA 3QG5A 5I9BA 3SLRA 1W1UA 1A8SA 1DO2A 2VA9A 1QX3A 2B36A 5AJXA 4OK5A 3L5KA 1N6KA 10MHA 1XWFA 1C2TA 1N7JA 2OV3A 4YP1A 1C1DA 3G8BA 5JNUA 4GRIA 1JYFA 1T3GA 1H1LA 1G8FA 1XLTC 4C7XA 1X19A 2IZ1A 5E1BA 2R6ZA 2WDPA 3PQ8A 5F64A 2Y92A 2VP0A 3DEIA 4IGFA 3QPAA 2X22A 3PK0A 4RBNA 5LYYA 3D0KA 5TPZA 1JG3A 3V4ZA 1NFQA 1OWNA 1W36C 3PGMA 4ZCQA 2VPPA 3KR9A 5BPFA 4RYLA 4EX7A 3HLYA 4R1UA 2IY8A 4NCHA 3NH9A 3C3BA 1HORA 1EFRD 5AOAA 5B4UA 4RHUA 3IC5A 3KYDB 5DP1A 3T5DA 1RHUA 2WWFA 3WQRA 5DX0A 4ALJA 3E9EA 1ZHHA 3GYGA 3WP1B 1RNLA 4EJSA 3S8QA 2EKDA 2RHCA 4G9BA 1P17A 4P1ZA 3RG8A 4Z58A 2C96A 4DSZA 2GXAA 2IS2A 5JYEA 4X1YB 1SPBS 1MX3A 4UCQA 5LD2B 5LQSA 1NJGA 3UQZA 3DFUA 1L8AA 2HMVA 3I73A 3LZ6A 4RJIA 4E5YA 3PWTA 3V3KA 4EY7A 4M9RA 3WLPA 2FZ4A 1RADA 1H1DA 4NQZA 4QBIA 4EH1A 3ZWVA 1E98A 1KU0A 1O9GA 2G63A 3H11B 4KWCA 1CQXA 4PSKA 2I9PA 4O2BF 4RD1A 5EZQA 3TOCA 1RM0A 1Y3IA 2AH5A 5K0NA 1A2OA 4YT2A 3I0ZA 5K3AA 3GT4A 4DF3A 1GNTA 1BZYA 3GCDA 4PR3A 3LLSA 4UZFA 4LBVA 2FVXA 2IEIA 2DQ4A 1UWKA 1E8DA 5A4IS 1O4WA 4P22A 1PZXA 3UB3A 3HH8A 1XZNA 3IE0A 3A4YA 1UZAA 3L07A 3JYLA 3PVSA 3VXKA 4BV2A 3KKLA 4ALKA 5IXSA 1F0NA 4TVKA 3A6ZA 2LLWA 2E87A 4CXMA 4W9MC 4R0VA 3G2IA 2XVXA 3OE7A 1F12A 3MRVA 5BR8B 3T5TA 2VJDA 4H16A 4NV1A 5ALSA 4DR6B 1JJ7A 4GUDA 4YYZA 4M98A 3NOVA 4J2OA 1B8OA 4Q66C 2WTEA 3C2QA 3FE2A 2EP5A 2GN1A 3F7MA 4X3CA 1QU3A 5AM3A 3WLMA 2OPHA 5I01A 1FBTA 3NLLA 1I10A 1PR3A 5BNFA 1Y9ZA 1RXSA 1XAJA 1YONA 2WAXA 3A4MA 3LQKA 1ECGA 1KDOA 2PSJA 4MARA 1GT0C 4A27A 5IK2D 1IM8A 4K2AA 1HDIA 1PJSA 1BFUA 2ST1A 2ADMA 2ZT6A 1GFWA 3Q87B 4FLFA 2RC6A 2QG6A 4KXQA 3QU4A 1TW3A 4NARA 3BERA 2X7JA 4FK8A 5ANRB 4M22A 5AOBA 2WJZB 3UCEA 5LVAA 2WFZA 2A92A 3CR3C 1N3YA 2A9OA 1SVUA 1MGPA 4HAXA 3AF3A 1Z88A 1GKLA 3IMKA 4C21A 2Q9AA 4PR0A 4O4JF 2CVOA 3RSSA 4DYHA 1XFDA 2PXAA 3GXBA 4ZU6X 2F59A 3UW3A 4J1XA 2GD6A 3LWZA 2XMRA 2R6CA 2CHUA 1EK1A 1GRCA 1NI4B 1HDEA 1ISHA 2FR0A 3CM0A 3DE6X 3OPYA 4K87A 1OSLA 1SXJB 2IQ5A 4WCFC 4EQ6A 5JOQA 4BHTA 3K6SA 1XEXB 2W48A 4R41A 2JA2A 3HXTA 2R8RA 3GLKA 1U63A 1RHRA 3O8CA 5AMXA 3DZIA 1SHJA 1N6RA 4QDOA 1ADBA 3U1VA 4CKXA 1RFGE 1U5BB 4B79A 4O5AA 3VH4A 3HKEA 3B5JA 1CHDA 1IEXA 1KNQA 2RKWA 2VHEA 5FBRB 2WWHA 4JV5B 1GRRA 3H3XA 4TTTS 1XLUA 4JI5B 3UJ9A 2NO1A 3CROL 3PR1A 4O4JA 3RVLA 4CCYB 4P98A 2H8RA 3A0RB 1QCYA 2B1IA 2W6CX 3RH0A 5ILGA 3D59A 4ZRMA 3L8DA 5F78A 2FU5C 1N8KA 5LOVF 4EG7A 1P4JA 3DYIA 2QW8A 3RVQA 3N7UA 1XQYA 2YHIA 2WAAA 5FT9A 1DS6A 3U7IA 2ZXUA 2IDJA 5E6SB 5K01A 2L82A 4FKMA 3X2SA 3PLRA 1HLFA 2QMZA 2VP2A 4IEEA 3EDOA 2JH3A 3ZNOA 4DG8A 4F72A 2D74A 4G0WA 3GP5A 3WI7A 4TV8B 1ODCA 1LSJA 4TXNA 2OC9A 1F06A 2B8WA 2B1GA 2CF5A 2C82A 1MVNA 1J22A 3N39C 2DOKA 1KJIA 4IDDA 4MP3A 2BSQA 1KMHA 3NUZA 4H27A 3O82A 1JKMA 1N8NA 1VMEA 1YUBA 3VSCA 1BCRB 3IBFA 3BE4A 3BM5A 3NIWA 1T3LA 1BE6A 4JQSA 4ONEA 3ESBA 3IOYA 4JB8A 5GZ6A 3TIGA 1L5LA 3OLQA 1E0SA 2ZUSA 2OMEA 3RYHA 1NOJA 3R5KA 2YC4C 2JHPA 3DL4A 2PPVA 3ND7A 5E3IA 2P4SA 2DXIA 1TQ8A 1G64A 1ZX1A 2Z57A 2AYZA 4J07A 3UMGA 3CNOA 3TZHA 3H99A 4RMHA 2WTUA 2AW3A 3TSOA 2IT1A 3NV9A 1R9NA 3FI9A 4DLSA 2H4XA 1HBJA 3TDMA 3FYUB 1L4EA 3LYUA 3IOBA 5BMVF 1XTZA 2ZREA 2CLEB 4NZMA 4AP6A 4NYJQ 3C8UA 3QKTA 3TZKA 4MR9B 3ECSA 3EGXB 4WK0B 2O8EB 4YXFA 1MJHA 2BYTA 4RK5A 1XF1A 1T15A 4UEWA 2AL7A 1KGSA 1MHTA 2IHNA 3PX7A 2G72A 2O4UX 2XDYA 1JL3A 3LV8A 1QM5A 1G8GA 2H57A 1VJDA 3OZAA 1PJ2A 3IDAA 4HTFA 5E4FA 3TLAA 2GM9A 1TXGA 1WV0A 3F71A 2JGDB 1YFLA 4AY6A 4ABYA 4HZIA 4KRFA 1IVNA 5AFSA 1E2NA 1DAPA 5E1DA 1Y82A 1Z0ZA 2W93A 4LJKA 4CL2A 1CV2A 1ZL2A 4F4UA 3AOEA 1I4DD 2FR1A 4CMEA 1U7OA 3R5TA 1UC5B 2X5OA 5AW6A 1GFSA 2XDQA 1R4NB 1T0IA 1U2SA 2F2TA 2YNMC 5FTNA 4BO0A 5TB5A 2VOEA 4JXXA 4MVJH 1GQQA 5EQJB 2A9RA 2DFDA 5TPWA 4BMPB 2CFOA 4YV7A 5C8DA 4FCTA 2Q2QA 5J5AA 1N7IA 1YI1A 3Q5GA 5INTA 2XA9A 5K0EA 3OJLA 1FIUA 1FP6A 1Y6ZA 3AUKA 1YJXA 1CRWG 4RJLA 3STXA 3WXMA 3IJEB 3I1JA 1FMFA 2B5AA 1C8KA 3PI6A 1S9HA 2ZTVA 2Z08A 4C4ZA 3BJMA 2Q6OA 2E5FA 1G3QA 4OUKX 5JPCA 1J42A 2DYKA 5TV2A 2C4MA 4L08A 1H85A 2ZUUA 3TCXB 2JD0A 3UH1A 3D4NA 3HB4X 1SEPA 4TTIA 5HX7A 4HQOA 4P0QB 2P2GA 2GKGA 4M0PA 3MGCA 1J2UA 1LK5A 1VE5A 4F3KA 1MA3A 1YKSA 4HWOA 4F7DA 3UH0A 1QG0A 4TWRA 3B1XA 1Z39A 4RNDB 2J3HA 2OGZA 3N8NA 4KRGA 1NBWB 2R1VB 4GZLA 5JSYA 4BNHA 1NPTO 8ADHA 3ID6C 5CD9A 4MI1A 4B45A 1TM1E 3DLBA 4JFAA 5KOHB 2GAAA 3PNBA 2CJYA 3OZSA 3W5SA 1Y0BA 5D5QA 4D8VA 1XZBA 3SU8A 2FEWB 1NQXA 3CZPA 4X62B 2YZKA 4YX9A 1ENOA 3JR7A 1E2QA 2VQDA 4UREA 2OKGA 2QP3A 4YAEA 3ZWXA 1LF5A 3WA7A 3QKSA 1QLWA 3NT5A 5FNVF 2E6UX 1D2AA 2RGDA 4ENSA 4ARSA 3EJ6A 4JYMA 4N3AA 3FETA 4XFDA 2G09A 4XJTA 1XCLA 1BS1A 3PPIA 4YJHA 2PGLA 3ROEA 1H23A 2XXAB 4KYTA 1EHIA 1CXZA 4NMMA 2IOYA 5LLSA 3KJZA 4Z5HA 2GN8A 3DVAA 3I6IA 3K9LA 3OX1A 3R7WA 5BRAA 1JKJA 3GPCA 4KKXB 3VTAA 3MD0A 4QA9A 1PCXA 1PN3A 1QCDA 3G0BA 3W9YA 3AHEA 2I4NA 1FFSA 1QO0A 3Q8LA 1NULA 1QNFA 3CZ9A 3JYQA 2OAGA 2HIGA 2VYVD 4PCLA 1XHEA 1MAUA 3N8DA 2AG5A 5E9WA 3ESDA 4D25A 3H2KA 1FF9A 5DHQA 2OLKA 1TJNA 2JD2A 3A4VA 4CHGA 4IWXA 1NXVA 1V7ZA 3RFFA 5DX8A 3FSEA 2P6MA 4NKRA 4OBEA 3IEMA 3ZCUA 1WDMA 2IYFA 3O4HA 1O03A 1HKHA 2P3QA 3OLCX 1JJVA 2Y68A 2ZR7A 3DE1X 3HJRA 4W1RA 2PIAA 4TN5A 3O9MA 1I33A 3P9PA 3V48A 5K8VA 1AKVA 2R68A 3CFYA 4J4TA 5CRIA 4EDHA 2AR0A 3ENKA 4NSNA 5ALRA 2HJVA 1I6WA 2QUZA 2PKYX 4QPDA 3C3AA 4TN1A 4PLVA 1WZCA 2G7ZA 4AP5A 1QO0D 3OESA 3NAQA 1G20A 1RU3A 2QJOA 3FHLA 3QWBA 3F5FA 3K2QA 3ROGA 1S96A 3GWZA 5LIRA 4NL4H 4TROA 5KYKA 1QB8A 1WHTA 1E3IA 2MSKA 3O5AA 2PVPA 2Q6LA 1EGQA 3KU1A 5A1TA 3BD1A 3UMRA 3SR0A 4DIUA 3COZA 1Y4AE 5BRNA 1GXSA 1I3LA 1YL5A 1YHZA 3S1AA 2IYXA 2XEXA 3PUHA 2D8AA 3L9WA 1RC8A 2HR1A 2GPJA 3N2GB 3OFVA 3R0VA 1T8PA 1TZCA 3CZ5A 3M2PA 1GSOA 4HLDA 4DPKA 2JIZD 1RXWA 3QBVA 3AF0A 5T8KC 3L1VA 4AS3A 5EP1A 1SXPA 4GRDA 4I1SA 4AI6A 5A62A 2QVCA 1PR9A 2OHXA 4JC4A 3B3JA 3ZI4A 1S8OA 1Q2UA 4IR7A 5BSUA 5IULC 1VJGA 3V7UA 4DV2B 1GSHA 2DTDA 2GZ1A 2EFHB 2J48A 4BB5A 4DGQA 4P3OA 1E7SA 1DJNA 3KB8A 3RFXA 4EX6A 3KOUA 1U11A 3KV3O 2DERA 1CY8A 1EFVB 5HBGA 4XYLA 5THQA 5AM2A 4IZ6A 5EXDA 5TMEA 3TXXA 1U0SY 4OOFA 1WBBA 3G13A 3D54D 4FGWA 4DTCA 2D4AA 3VKWA 5L9AA 1XRRA 4AKTA 3C39A 1TLTA 1T6BY 1ZW6A 3NNDA 4B2LA 1N6NA 4EHDA 4BECA 3HZHA 2QJTA 1M74A 3N87A 2Q7DA 3EZYA 5LJIA 5LMUB 5D3KA 3WLSA 4DYDA 2PD3A 3DCIA 3H87A 3H2ZA 2RHGB 4XR9A 5JMTA 3A3PA 4MO2A 4GMGA 3HEBA 2XXJA 4AP9A 3IPRA 4LF4B 2IIQA 3RE1A 2X8BA 4FFNA 4L75A 5FL7A 3WC4A 3AWDA 5HCIA 2NVOA 4M21A 3EXHA 1Z0AA 1UMDB 2W8BB 1RM5A 3TZBA 4LDNA 3GFGA 1R63A 1YR3A 2OCDA 3HCRA 1I80A 3MWKA 3PFCA 4NJEA 4NYMR 1RWXA 2XKAA 4CTKA 3E27A 3N8GA 4RVOA 1MB3A 3VU9B 1L5KA 2J9FB 4D5GA 4IVZA 1LDGA 1CW2B 3GF4A 4GSYA 4ZI5A 4AKEA 1KPGA 3BS3A 5IDVA 3KTAB 3AT1A 2O8BB 4U3JA 1RYFA 1V3QE 2O3TA 2YINC 4RIIA 1U3UA 2E0IA 3UC9A 3ZIAA 2Q5QA 2BAGA 3MJEA 2NTVA 2XXQA 1A71A 4WCVA 2WAOA 1J56A 3CINA 4H6WA 4NU5A 3ZE1B 1KERA 1Q92A 1Y4UA 3EOBI 3PGVA 4ITRC 2JI4A 1HZZC 2NPOA 3WQQA 4AQDA 5FORA 2WT8A 1JI0A 2VKQA 2AB0A 3I1IA 4LNHA 1MH1A 1YDEA 1UIRA 4MUYA 1PGJA 2WJWA 5FL7D 3MSXA 2QRVA 2Y71A 1W5BA 3ZHUA 4DR1B 2Z5VA 4E09A 4FQ7A 4OIMA 3LCJA 3RVSA 4DT1A 2ZTHA 4KO3S 3A9XA 4KODA 2FDXA 4OMCA 4MTCA 5KAPA 1C0LA 3MQFA 1MAVA 2PBFA 4A7PA 3TEPA 3EZ7A 3TJZA 1RXCA 5I45A 1KJZA 2C2OA 1UC8A 5D8DA 2BGWA 1E4OA 3S68A 3EDRA 1UZUA 5IZ4A 3TRFA 1VI6A 3A1VA 3ELDA 3TVDA 4CIXA 4KFSA 1XWRA 1ECCA 1U8UA 4D9KA 3RYCB 4B48A 1D1SA 3V32A 3NP9A 4BQSA 2VI5A 5BN1A 3QKWA 2HWWA 4UUBA 4I4CA 3LVBA 3A2KA 4ERXA 1B00A 4KVFA 1OVGA 4QQKA 5JI3E 4GL2A 2GYUA 2EFEB 5G40A 2PFKA 4U6NA 2X4IA 2X0IA 4L74A 4ND7A 4LQCA 4V2UA 5J2UF 5CH3A 3NXSA 3DUWA 3I61A 1ZITA 3PC3A 4J0JA 1ZD5A 4KPFC 5C37A 1QF7A 1K2VN 2UAGA 3WHPA 4N41A 4EFLA 5JCXA 4Q9LA 1ZNZA 4GC9A 4YQEA 2FMUA 1FX0A 4DHEA 4UDYX 2R8PA 2B4AA 2O1WA 3B7HA 1BOOA 1VB5A 3FVVA 3QVJA 2RGWA 4CLXA 4A0SA 4D0SA 5JAIA 3CVUA 3L8EA 3ZJUA 4RKWA 2XE4A 2PBZA 4MV0A 4A2PA 1UBHS 3HEAA 2YUTA 3FOCA 5CT9A 1RZUA 2A3RA 3W04A 5KSYA 1K7XB 2BGUA 3E8MA 3PDIA 5DO9A 2H31A 2YICA 3GGGA 1PV4A 5H7XA 4HDRB 4O4HA 1FX1A 1PRYA 1QXSA 5KYXB 2UZAA 3WK4A 1GQFA 4DMGA 2ZIXB 4D98A 1PFQA 1TCBA 4IV0A 4R84A 1DOAA 2E9SA 4H4EA 4M7OA 4MW7A 3RC1A 2ERYA 3SLKA 3ZUGA 3LKVA 3RYCA 1SVNA 1RWWA 1NVKA 1ID1A 2BI8A 3F7TA 4J2TA 1QDUA 3T34A 1EM8B 2GN0A 4K26A 4MRRA 4FZ3A 3AF6A 1PE0A 2A9FA 2EFCB 1JR3E 3B7WA 3TTWA 1Z6PA 4BFWA 1S2NA 4GEGA 3SBDA 4LA4A 4NP6A 2P69A 1DUVG 1XO1A 4W6ZA 3CUSA 5HDQA 1AHNA 1QOPB 3AUUA 3AQ4A 1MO4A 2JJQA 5AOCA 3W77A 4JOBA 4LOLA 2JARA 1JE0A 5AIAA 1E9FA 5T4EA 4R40A 1JR3A 4CR7A 3GPDG 2ZSFA 4QXPA 3CX4A 2P2SA 1H2AS 2AOUB 3MINB 3R6DA 3QVWA 4JUAA 3VDQA 2QN7A 1IEQA 4J1TC 1POWA 3A1SA 4JC0A 4Q1EA 4CE6A 4AJNA 3KVOA 3N05A 3AJEA 4KMOA 1ND6A 1NRIA 2LYSA 1JW9B 3IYLW 1EDDA 4LV8B 3EBLA 5JQGB 1F9AA 4JI3B 2RHBA 3Q6IA 4MZXA 1UCFA 4L27A 3GNTA 3A36A 1HEIA 1DDOA 3A05A 1Z36A 2PKRA 1OYYA 1QAMA 2C4TA 1PEKE 2GDZA 2PS1A 4TT3A 5FUXA 2OZKA 4Y2JA 4B2PA 2ZRHA 3GRUA 4ZCMA 2FPWA 3LX8A 3KEGA 1NBOA 4O4IA 3V2HA 3OM0A 2LTAA 2H1HA 4GR9A 2WWVD 2GEJA 1LZLA 1OIXA 2PZEA 3BCRA 2DWOA 3PLAE 3I01M 1UDWA 4RL4A 3HBAA 5F2EA 2P79A 2L0XA 2OD7A 2XW6A 3NDRA 4RZHA 2IYQA 4Y2TA 5SV2A 2JHAA 1YD7A 2IC5A 1EUZA 2O7VA 1EX7A 2Q3EA 1J4AA 3B1VA 4BTEA 1KL7A 3HYNA 1ACMA 2ZDHA 5AJHA 3P9SA 3U40A 4YROA 4X4DA 3L1JA 5AI4A 3U13A 3Q7SA 5EE5B 3DWFA 5FPYA 1H93A 1EDBA 3QM1A 4I4LA 1JEYB 3TCNA 4CZ2A 2ZZMA 2LDBA 3OOHA 3A1CA 3EWNA 4PRLA 1EP9A 4K05A 3Q0EA 3ER9A 3UTDA 3AVOA 3DHVA 2I3AA 3RJMA 4DQXA 5BURA 1SBNE 3BWMA 3GJ7A 3QPBA 2FGKA 3FWPA 1UOEA 3L0YA 1IC8A 3B1KA 3LBIA 4IJWA 1E58A 3A1EA 4LMBA 1NKTA 2C61A 2QT9A 3ICPA 3AVPA 3IE2A 4UHEA 1EP3B 1IN4A 2HK7A 3KSAC 2KBEA 3BICA 1AG9A 3LCMA 3GLFB 4LFAB 1QV7A 1W85B 2P2DA 4WXMA 4D57A 4O33A 4ZGGA 1OOEA 2FW9A 3R8FA 2HYIC 3K70D 1ZICA 4C7OB 3JWEA 2XB2A 1MQAA 4OXKA 1JDBC 1JUDA 1DADA 1G3RA 2J9YB 5ITVA 2PXVA 1FRNA 2YNMD 3FAZA 4WE3A 3WZLA 1HLDA 5IDQA 1W36D 3LQXA 4FINA 3X1KA 2GD1O 1YQEA 4REMA 3BEOA 3GNSA 4UAGA 4IX9A 5CVEA 4EZEA 5FEMA 4UUOA 3W5CA 3GIDA 4ZVVA 4A8JA 3RNLA 2FXVA 5KAMA 2C7RA 3BE6A 3ZLTA 4B9EA 1R18A 2I65A 3FUUA 1EVZA 4JBNA 4URWR 2D2VA 3L8GA 3I28A 2J3LA 4FDTA 4D02A 1I14A 1VPEA 3IV6A 3RYIA 3ZW7A 4PPQA 2VWPA 3JTMA 2QENA 1T5HX 1DJMA 3H84A 1L5MA 1NMZA 2OT3B 3V4RA 4CL0A 5H0IA 1HE2A 2NU6A 1THGA 1V96A 2BM0A 4RTRA 2LYRA 1XXHA 2J33A 3MS7A 1VBMA 5A5GA 1RYNA 5KTSA 3JASA 2HRQA 3OOEA 5FLYA 3IO5A 5BVGB 3ZXXA 3C1AA 5BSTA 1C2YA 3DDHA 4BLWA 3FROA 1NPYA 4FMDF 4WKBA 2J07A 4UM5A 5EWJB 1KS2A 5AK6A 2P4EA 2IX3A 1DO0A 3CW2A 1Y81A 4KN8A 3W1VA 2NAFA 3ZQUA 4URXR 3LT0A 3VJMA 4IKEA 4IAOA 2K7ZA 2QTBA 4NNJA 2P9TA 1HGXA 4A91A 2J0VA 3LTEA 6PFKA 3MUFA 3HVHA 2FCRA 4P6VF 1U7PA 3VI4B 2MYTA 3R7LA 1JQKA 4CF4A 2FPUA 4M88A 2HSGA 3N86A 2V3WA 4P36A 5ALJA 1F48A 1QK3A 2QU8A 4C05A 3W2HA 2QTFA 1JPUA 3GRZA 3I9V1 3K9GA 3MWFA 4NFSA 5ALNA 1UUFA 3LZDA 1PLKA 5KINB 3A7EA 4QXMA 1E3WA 3ZD7A 2FRDC 1H4SA 3NHPA 4JN6B 1NVGA 3BEDA 4XGNA 4RA6A 3AHJA 3U9SA 3L1PA 3G85A 3PZRA 3K94A 3K6KA 3RABA 2QDKA 3L46A 4UNIA 3VAAA 5M7EA 1MF7A 3OPQA 1PAUA 1YC2A 5D87A