3O9XA

Structure of the e. coli antitoxin mqsa (ygit/b3021) in complex with its gene promoter
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
132
structure length
132
Chain Sequence
HMKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKKLSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Escherichia coli Antitoxin MqsA (YgiT/b3021) Bound to Its Gene Promoter Reveals Extensive Domain Rearrangements and the Specificity of Transcriptional Regulation.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription regulator/dna
molecule keywords Uncharacterized HTH-type transcriptional regulator ygiT
total genus 40
structure length 132
sequence length 132
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF15731 MqsA_antitoxin Antitoxin component of bacterial toxin-antitoxin system, MqsA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 3o9xA02
1.20.58.720 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3o9xA01
3LFPA 2AXUA 4FBIA 4F8DA 4J1WA 4JQDA 2WUSR 2PUCA 2LYSA 3BD1A 3OQNA 1X2LA 2HINA 2XIUA 2KEKA 2PUGA 3CROL 3G7DA 5K98B 1DW9A 4Y42A 4FN3A 4YBAA 4Z58A 3BDNA 3QYXA 4MCXA 4IWRA 2GRMA 3GA8A 3FYAA 1CJGA 2AUWA 2L8NA 3FMYA 2O4AA 1RZRA 3QWGA 1ZZBA 4I6TA 3JXDL 2PE5A 3SCGA 4IVZA 4X4EA 3SCHA 2R1JL 2BJCA 3DNVB 1WH6A 1PRAA 1E3OC 2EWTA 3H5TA 2LYLA 4X4DA 1ZZ8A 3U3WA 1YSEA 2CROA 2PPXA 1QQBA 2O38A 4YARA 1XWRA 2KZ8A 1Y7YA 3F51A 1JWLA 1AU7A 1PERL 1PRVA 2IVBA 3EUSA 2BNNA 3GN5B 2IVGA 3GN5A 3SCFA 4MCTA 3JXBC 2H8RA 1QP7A 4O8BA 2B5AA 1BDIA 1WETA 2PUDA 2BNMA 3MLFA 1O4XA 4PU8A 1LQCA 2OR1L 4YG4A 3RZZA 2L49A 2XSDC 1EFAA 2PUAA 4GHJA 4IA8A 1RZSA 1OSLA 1RIOA 1LCCA 1JFSA 3HI2A 2XJ3A 2A6CA 1UTXA 3O9XA 1ZAYA 2PUEA 3VK0A 4JCXA 3TRBA 2GZUA 2AW6A 1LMB3 1L1MA 4X4HA 1QPZA 2CSFA 2OFYA 1LLIA 1POUA 3ZKCA 1ZS4A 3FYMA 2GRLA 4I6UA 4J1XA 4YG7B 3OQOA 3B7HA 2AXZA 2FJRA 3PXPA 3OQMA 1PRUA 2AXVA 1WH8A 2EF8A 2LYJA 4Z59A 1VPWA 3BS3A 1R69A 4GQMA 2IUOA 4X4IA 4JCYA 4X4CA 1BDHA 3CLCA 1GT0C 3GBFA 2HSGA 1SQ8A 2KEIA 1UXDA 1B0NA 1HF0A 2D5VA 2IU7A 2LYRA 4PU7A 1UXCA 4NDWA 2BNOA 2WIUB 3HZIB 3D1NI 3UFDA 3L1PA 1WIZA 1ZZ6A 3KXAA 1RZRD 1S7EA 1ZZ7A 4X4FA 2LYQA 2EBYA 2JCGA 1Y9QA 1ADRA 2ICPA 3KJXA 2MEZA 4I6RA 3ZHMA 1RPEL 2MQKA 1ZPQA 4Z5HA 1JFTA 2IVQA 1QQAA 2PUFA 1OCTC 1DWKA 4Z5CA 1ZVVA 3OP9A 4Z5DA 2O49A 2R63A 1ZZCA 2AWIA 3KZ3A 4PU3C 1QP0A 5A7LA 1JH9A 2XI8A 3LISA 2ICTA 2IV1A 1NEQA 2JVLA 3F52A 3ZHIA 3G5GA 2LYPA 4PU4C 3IVPA 1CQTA 2KPJA 4X4GA 2XCJA 2KEJA 2PIJA 3CECA 3R1FA 2LCVA 1X57A 2LYKA 1ZUGA 3OMTA 3S8QA 4I8TA 3F6WA 1PNRA 1R63A 3JXCL 2PUBA 4OB4A 1ZZ9A 1LCDA 1IC8A 1NERA 4YG1A 3QQ6A 3QF3A 4X4BA 1QP4A
chains in the Genus database with same CATH superfamily
1WYCA 2DHRA 5CGMA 3ZN1B 1HR0T 5ABFA 3HKEE 3IBPA 2PUGA 2X68A 3IHRA 3O4XE 3FYAA 3HL6A 2CXDA 3HKDE 1CHUA 4IE5A 2PE5A 4LF9T 4PW8A 4PK4A 2LM2A 1NAFA 2JIWA 4TV9E 4LF4T 1XWRA 2KZ8A 2W63A 1T7SA 2HN2A 4QH4A 2BNMA 3BQLA 1MMAA 2BDEA 1O4XA 3ONJA 2M6IA 2ACXA 5KMGP 3PE0A 4DMWA 3HI2A 3O9XA 4HFDA 5HAXA 4ZI3C 4A98A 2XQ4A 2W4XA 4EAHA 5IUXA 3E22E 1ZS4A 3RRWA 4I43B 4U31A 2WAUA 2DL1A 1XDOA 4IREA 2WY2A 3O1JA 4CI1B 4LF7T 5DRTA 4YJ3E 4CXXA 4LF5T 1Z8UA 1XNQT 1HF0A 3M3ZB 4EOZB 4TN7B 3QOFA 5KX5E 2WDVA 1W9RA 4LF6T 3L1PA 3R6NA 4X4FA 3L09A 2PXQA 4L5GA 2ICPA 4X66T 2IVQA 1NENA 2O49A 1FMWA 3KV6A 1MMGA 2JQEA 5AQKB 1ZHCA 4DBRA 1D1BA 4HN9A 3JADA 1MIVA 2KWHA 2K9AA 2LCVA 3OMTA 5AQQB 3QQ6A 2XQ9A 1HFAA 2LM9A 4Z90A 4DUZT 1HCIA 2NTYA 4YFSA 2PXUA 2VVSA 4WVLA 4IWRA 3UU6A 4YXDA 5LXTE 3SCGA 4ZXLA 3PDYA 5HXHA 3D0TA 4ANJA 4O2AE 5TAOA 5L4HA 2VWAA 3CWZB 3A9XA 1ZZ8A 1JNRA 3RHWA 2VEOA 2JQQA 3JAFA 4DBQA 4WBOA 3GN5A 3GN5B 2E5VA 3AEEA 5AQGB 5LJNA 1BDIA 3TLUA 2XXPA 3CQGB 1IZNB 4DUYT 3AA6B 3E08A 3VR8A 2ODVA 1X79A 5FXWA 3AE1A 4GIWA 4TX5A 3CK6A 3FYMA 3PUZF 4IIJE 4DV4T 5JR9A 4X1YE 4WNKA 3MA9A 3GZDC 4NXMT 3RIUA 4QX7B 5AQSB 2BG9A 5LHHB 2XXQA 2LSJA 4CN1A 1XWMA 3AEBA 4U3CA 5LB7B 2MEZA 4GYSA 2CWYA 4EYYR 3N2KE 3PUWF 1KF6A 2WWUA 3RKGA 4I50E 2C5JA 2IV1A 5BR8T 2MOZA 4O8SA 2ODRD 5HXRA 2LHRA 4DR3T 2CLYC 2IW5B 3PUSA 5HXCA 3CX8B 1X2LA 3PUYF 2DWGA 5HEOA 2YK0A 5F3JA 2XQ7A 4HGAA 1W0AA 3HKCE 2V6YB 5CJ5A 3AEFA 2XHEB 1ZV4X 2WDQA 2AE9A 2KINB 5LGUB 1QSDA 2KWIB 2PXPA 3SFDA 3AVRA 2PTFA 1H7CA 4CI3B 2WCAA 3AE2A 3OTOT 2SPCA 1LQCA 2W61A 2D2SA 2M6BA 1KFYA 4X64T 3LDQB 2A2FX 1QZXA 2Z6EA 1DU2A 2IUBA 5FYMA 3ZMTB 1QPZA 4TV8E 3H3MA 3RX6A 4DR6T 3PE5A 3ZSSA 1IJ5A 2X9HA 2J7UA 5AQIB 4B6XA 3MZKB 3AAAB 2CCQA 3P4QA 1SQ8A 3AE7A 2KEIA 3E0ZA 4M1PA 3OKQA 4DR2T 5L3FB 2WIUB 2WMNA 3L8RA 5J2UE 1RZRD 2VKHA 2EBYA 4ZI7E 3RC8A 2VB6A 2ZM2A 4HFEA 2EHOD 1HTJF 5EK2A 2YKSA 4HWIB 1JFTA 1IBLT 2NW9A 1OCTC 4YTMA 3GZCA 2C0SA 3X1DA 1I6ZA 2BKNA 4KP3C 2XI8A 2NW7A 4OBMA 3MKDA 2LYPA 2WMOA 4PAGA 2KPJA 2X9XA 4A97A 2PIJA 3RRCA 2J4GA 4H9QC 3LK2B 3P7IA 2XQAA 1J5ET 1IJ6A 2JJ9A 3QF3A 2L1PA 3EI0A 1UX5A 2PXEA 5CFBA 3OQNA 3N5LA 5FXXA 4Y42A 4PK5A 5JR9B 4IE7A 5DRYA 4H63V 3ZMSB 2O4AA 2Q9QB 3SCHA 4KHZF 5AQNB 1WYBA 2LYLA 3HR0A 4DE8A 5AQFB 1YQ3A 1AU7A 2KZ7B 2PUDA 4ER0A 3SS1A 3NKZA 2L49A 1D1AA 3PUAA 3ZLIA 3AAIA 4XBFB 2HPLA 2V6YA 4MALA 1PRUA 3AE8A 4YTNA 5J1GA 2LKGA 4JBWF 1BR2A 3KV4A 3I1AA 1UURA 5LA6E 5HCJA 2CA5A 2XAFB 2YDSA 2K3WA 2UUCT 2PG8A 4U33A 3ETUA 2I59A 3P4PA 4NIQA 2QYWA 3N9NA 1ADRA 4EV6A 3NROA 5FMNA 2E9XB 5LBQB 2MQKA 3ZT6A 3C51A 2HPJA 2PUFA 1N33T 2YINA 2J1DG 3F52A 1G73A 5C8YE 2V5DA 4ER3A 1MNEA 2J62A 2VKJA 2FUPA 1IAPA 1LKXA 4P0AA 5LHIB 1ZZ9A 1YQ4A 3QUJA 4IDZA 2BG9B 3BD1A 3CROL 4BAYB 2XASB 3F2EA 2L8NA 1N34T 1S94A 2LLWA 5FP3A 4JEHB 3MXZA 4J2CA 4LFAT 2LRLA 3CQCB 4UIGA 4HTEA 2IDOB 4UXNB 4QXCB 4EXTA 5AQOB 2BVMA 1Z0PA 3LSVA 2CPTA 2V7LA 3PUQA 1T98A 5HYAA 1D0XA 4H9OC 4DVDA 3ZMUB 3ZCJA 2Y8DA 2GRLA 4I6UA 2FJRA 4ZS2A 3KFWX 2EF8A 5DSXA 2OLTA 2ZM8A 1MMDA 3PJAA 4IT4A 5JVDE 4TWDA 5JRCA 3N9QA 4U2ZA 3KXAA 2LYQA 4EQZA 3FZLB 4AI6A 4EKIA 1RPEL 2N1GA 1OEDE 1WLXA 5LBMA 2GK9A 1JNZA 3FZFB 1VOMA 4DV2T 5HWYA 2EHOA 1CQTA 3O1HA 1WFDA 1X57A 2LYKA 2CWOA 3GZDA 3JXCL 2UXXB 4ILCA 3QNUA 3K3OA 4FN3A 4Z58A 3QYXA 3VRAA 5HWXA 4QWNB 2PUCA 5DJQC 4YY3T 3DTOA 3C98B 1CJGA 3B13A 3UU5A 2AUWA 2HH7A 2JQHA 2LT3A 4ER5A 2YDQA 3OYXA 3RC3A 3JXDL 4EB6E 2XJ7A 2XZEA 2BJCA 5HXEA 4JYAT 4OX9T 4HFVA 3C50A 4UEMA 3UU3A 3BK9A 3BQKA 3I0OA 2BZBA 2WWVA 4E7ZA 3PJAJ 2CROA 5AQTB 4Q25A 5JREA 1YW0A 4DV3T 2IVBA 3JXBC 1QP7A 1MIYA 2X9YA 4ZEYA 4IDQA 1RIOA 3VHLA 4CXWA 2CHOA 2H7VC 2WM9A 1JFSA 2J47A 3ZC0A 5FNVE 2YEVC 3F57A 2PFVA 3U3IA 2AW6A 2PXFA 5JDFA 2JQKA 2VKDA 4MFRA 3OQOA 3B7HA 3OQMA 3P50A 4ER7A 2XAHB 1SHZC 2MPKA 5ABGA 4JLEA 4X4CA 2WU5A 1U5PA 3QB5A 5FXZA 5DTQA 3UQ7A 3K8PC 4WYVA 3CX6B 4HFIA 1MFQC 3HZIB 4QXBB 3ZN0B 2VQFT 1ZZ7A 5DT2A 1Y9QA 4KBMB 4MLKA 2FJBA 2DI4A 3RIFA 3AE5A 1ZVVA 2LNMA 4UELA 2NWBA 2NOXA 1BR0A 3B57A 5FY0A 1YKHB 5L3EB 2XCJA 3EVYA 3I0QA 3UU8A 4JI3T 1QP4A 2RA1A 2VK9A 2FFHA 2WZHA 1ZOYA 2HINA 2MXDA 1N32T 2HHHT 4JI7T 2GRMA 4EYUA 3CIRA 3KBTA 2H7OA 4A5XA 2CM0A 3H5TA 2QRXA 2ZM0A 1ZEEA 1G8XA 2BBJA 2PPXA 5L4EA 1MMNA 2XSAA 4KI0F 1PERL 4QH1A 2IVGA 4O8BA 2PXKA 4B3RT 3F31A 1IBKT 4O4HE 1W09A 3JAEA 2A6CA 2LSYA 4X5TA 3TRBA 1X9BA 2CSFA 3ZPXA 2YBDA 4A56A 5AQJB 4GK0E 2X66A 1J5WA 3NBXX 4AISA 3BS3A 1T8BA 4DMVA 2EHOC 2E5LT 5E0OA 2E9XD 3CKDA 1VCSA 2LYRA 4EEDA 5F5WA 4H9NC 3DP7A 3ZCIA 2LOPA 3TFLA 3ZJ1A 3UFDA 2LJLA 5HEUA 3RQWA 2CRBA 3P8CD 1HX8A 3AA7B 1HQ1A 4AQFA 4KHPT 4YHJA 3C4WA 1IBMT 2YOEA 3KZ3A 3NZQA 3LBXA 1WR6A 2CXFA 5LCYA 4X1IE 3LFMA 2KEJA 4Z8XA 3CECA 4YTPA 3VWSA 5GONE 4OB4A 2N9DA 4WBNE 3TELA 3QK6A 4IE6A 2KEKA 3WAKA 3WI3A 2CLYB 5GAGi 2UU9T 2OV9A 5JDNA 2IC9A 3CQXC 2IIUA 4FJOA 3UUBA 2JMHA 1M62A 1N36T 4JI8T 5FVLA 4YJ2E 3AE4A 2KXPB 2VVNA 3ONLC 5L3DB 3RZZA 2Y48B 3ZJ2A 1LCCA 4JI0T 1UX4A 1HS7A 1HNWT 1NWMX 2NP9A 4OFZA 4X20E 3AE9A 4HWDA 2XTLA 4PJMA 2AXVA 1HG2A 4XAXB 4GQMA 3FZHB 3RQUA 2CEAA 3C4ZA 3J7Yq 5LYJE 4NUUA 3P4RA 1B7TA 1WIZA 2FBWA 2V7IA 4I6RA 4C90A 3ZHMA 3OJAA 4F6RC 5JDMA 5LG4A 3AEDA 3KV5A 4H9SE 5CA0E 2FJDA 2Y6XA 3AXJB 2AWIA 3RYHE 2DWKA 1UGOA 4AIUA 2LRKA 2B76A 2UXNB 1PNRA 1R63A 4CZZB 2QGSA 3TKLB 3UQ4A 4YT0A 3ME5A 3TLWA 3UFEA 3BDNA 4DV5T 1HNZT 5DQWA 3RYIE 2E9XA 1ZZBA 2H3RA 4DR5T 3DNVB 3EHZA 2XSBA 2A72A 1UK5A 2BG9C 5AQUB 4X62T 5ETWA 3Q5EA 4YARA 3EDUA 2XQYA 4LMLA 3ZYKA 3NDBB 4MCTA 4ILUA 2H88A 3NZLA 4YG4A 5DABA 1T72A 1J1JA 4Q2JA 5KDMC 4EGWA 2LSIA 1LVKA 4U74A 3PUGA 2FJEA 3KBUA 4PJJA 2VL0A 1POUA 2W2UA 5FY1A 5J0ZA 5LJMA 2AXDS 2LLVA 2PBIA 5F8PA 3EABA 3KVAA 3CLCA 2YU2A 4HEAA 2JRKA 2LOSA 3UUXB 2LSKA 3ZKRA 4AKIA 2BNOA 4B3MT 4UR9A 3UT5E 2BS2A 3ZT5A 1S7EA 2CHNA 5JUWA 3UUMA 3EUHA 3L3PA 2E2AA 3OP9A 2R63A 2ZMAA 2EHOB 4YLHA 3K3QC 1QB2A 4GKJT 3VRBA 3A9ZA 3AEGA 3NVOA 4DIDB 5JH7E 2N2NA 4HWCA 3G06A 3W15B 4AKRB 2UXBT 2DLRA 1LCDA 2L9QA 3ZSTA 4FI5A 1HNXT 5JRCB 5ABEA 4YBAA 1XDPA 4DV1T 5A1LA 2Q9QC 4PK6A 3Q9DA 4ILBA 4LFBT 3QWGA 3JC6D 3DJBA 2MYSA 2X9WA 5LMUT 4AKLA 3PUXF 4DV7T 5FL0A 3MJXA 3SOLA 3U3WA 1LVFA 1KNRA 2CBJA 2O38A 3KVBA 1QUUA 3RIUC 5L2LA 1YKEB 5CB4E 2X0HA 1KEYA 5JTGA 4MHCA 4PU8A 3LG7A 1OSLA 5LOVE 3OWQA 3PTRB 2ZM6T 1ZAYA 5L3GB 2PXLA 3N9PA 5ADXL 4BA9A 4HE8A 4O4LE 3RYCE 4Z59A 3K1SA 3SFEA 1BDHA 2FJAA 2W62A 2VQET 4P1NA 3CVRA 1ZZ6A 5AQLB 3QC9A 3PURA 3SR4A 4UVAB 4EZHA 1FIOA 2PXBA 2IMLA 3AEAA 3IEEA 1LRZA 3KL4A 5ABHA 5C3JA 4Z5CA 3ZPOA 2UXDT 4TWHA 2JVLA 3ZEFB 3GUUA 3ONXA 2HCSA 1D0ZA 4LMKA 5J2TE 2LLYA 2IHR1 4X4GA 3PU3A 3R1FA 1OEDC 2RPAA 2X0YA 4PNIA 3T1HT 4YG1A 4CN4A 2W00A 4EEBA 4QX8B 5K98B 1E2AA 2BVLA 2PXDA 1HF8A 4U72A 3ZT7A 2M67A 4HFHA 4DR1T 4IVZA 1XNRT 3LQXA 1AJ3A 1WH6A 3OYZA 1YSEA 1Y01A 4B3TT 1JWLA 4UF0A 2A9UA 1WRDA 2ACZA 2H8RA 1HX1B 1WETA 2QA7A 3OPCA 3MLFA 3UULA 2LHNA 3NWIA 3P4WA 4U7YA 2PJQA 5LHGB 4GHJA 1RZSA 4JEUB 4EK9A 2XJ3A 2E8IA 2OA5A 1UTXA 2XM1A 3NRYA 4IE4A 2A3DA 3FBZA 4UV9B 4JI6T 2J7WA 2WZIA 4HFBA 4YG7B 4J1XA 4ZI2C 4QH5A 2NR4A 4ADZA 2VL8A 3P4SA 1CUNA 3Q5XA 2V8SV 1KK7A 2BBHA 3H3AA 5BMVE 2HFZA 2HSGA 2X67A 4PU7A 1UXCA 4NDWA 3D1NI 1O3XA 4I4TE 3GWHA 3O1IA 2JCGA 2IAKA 1MIWA 1FJGT 5JQGE 3IF8B 2BG9E 2KMFA 4GOUA 4CN6A 2NW8A 2WSSV 1NEQA 4JI1T 3IVPA 2XAQB 4V1Av 2XM2A 1BR4A 4C91A 3PU8A 2V5CA 3SWHA 5AQRB 3AE6A 4FBIA 4JQDA 3NXHA 5AQPB 4IDOA 3RLFF 2XIUA 3G7DA 3PUVF 4ERRA 3EDVA 3Q5WA 5EK4A 3MEJA 3AAEB 1RZRA 1Y64B 4UV8B 4NXNT 3I9WA 4EZ4A 2UUAT 2I0MA 1E3OC 2Q9QA 4U2YA 5JDHA 4YSZA 3TLSA 3Q5DA 5DTRA 2UXCT 3G0TA 4H63H 2XAGB 4G2AA 2KT9A 2MBGA 4CI2B 5M4YA 5IHYA 4LF8T 2YU1A 4KUMB 5ABFB 3CPZA 2Q9QD 4WW0A 2XSDC 4DNDA 3EAMA 1OEDA 3BQIA 4ZI2D 1WCRA 3ESLA 2L8KA 3RIAA 4X4HA 1R8IA 2W67A 4QHOA 4ZI3D 2VURA 1OEDB 4AKHA 2CXLA 1EZ3A 3FBLA 2R6GF 4X4IA 2JPFA 2IU7A 3CX7B 4TZ4C 4AQYT 4IL9A 5LG3A 3TEPA 1US7B 3N9LA 3OVUA 4KMCA 5EZYE 3PV0F 4BJNA 5LGNB 3N2GE 2XUEA 4U7IA 2K48A 2L3LA 2X51A 1QP0A 2BS3A 3HA4A 4IHJE 3FZMB 1ZUGA 3M65A 4O4IE 2XQ5A 1MNDA 2JMKA 1NERA 2DCFA 4UVBB 4J1WA 4MBQA 4JI2T 2WS3A 3NZPA 2LSGA 2CMRA 4OHFA 4EIWA 3I9YA 3FMYA 2D0TA 2HCNA 1M7KA 2X0LB 1UCUA 3KV9A 4IDNA 1SE7A 3V5SA 4PJNA 4ISTA 4PFOA 4DV0T 4P09A 3SCFA 2WQYA 1FEWA 2WB5A 4IA8A 4CQIA 2WU2A 5KXJA 4YHHT 2W0GA 4QKNA 4JCXA 1L1MA 4AXPA 4YSYA 5AFUL 2KLQA 2B1EA 1R69A 2IUOA 2CE7A 3VKHA 3ETVA 5FKYA 3GBFA 2WP9A 2D5VA 5AQHB 4Z91A 1ZP0A 3RH3A 3N2OA 3KJXA 3OKZA 3A5XA 1D0YA 4IL4A 4Z5DA 2D5UA 4AQGA 1FMVA 1ZZCA 2P9BA 3JC6C 2CBIA 4H9PC 2PXTA 4CXYA 3L39A 1SUMB 2XXAA 3WAJA 2PUBA 3ABVA 4UVCB 4X4BA 3QOXA 3LFPA 4F8DA 4OK0A 2LYSA 2C5IT 3UUNA 5FY7A 3AECA 5L3CB 3UWPA 4MCXA 4ER6A 2VKOA 4HWFA 5C2TA 3GA8A 3A7MA 4ZHQE 3C4XA 2HN1A 3ZC1A 4X4EA 3T8OA 2BS4A 5HCMA 2V1DB 4HRAA 1QQBA 3R84B 3V5UA 1VCTA 3H37A 2LE8A 4EKGA 3RKOA 2OR1L 2UUBT 3QFIA 2PUAA 3FB2A 2LEHA 3ZYMA 3SX0A 2RP4A 4ILAA 2GZUA 4N78D 2K5BB 4NUVA 1LLIA 4E7SA 4GYRA 2ODUA 2AXZA 3JCFA 2F4VT 3A8YC 1W0BA 2XQ8A 4DE9A 1OWAA 4EZIA 4DR7T 2V7JA 4X1KE 1U4QA 1UXDA 1B0NA 3ANWB 3TLVA 2XAJB 3ZMZB 5L47A 2PXVA 1V9DA 3ANWA 3K3NA 5HEGA 1DULA 4Z5HA 1DWKA 5CA1E 4OYJA 5A7LA 4KX6A 3MK7C 5JDGA 3VU7H 4ISSA 3G5GA 4PU4C 4K0UA 4X65T 4OYKA 2XQ6A 5IYZE 3R09A 4NPPA 3VKGA 4HWHA 2C5KT 2V3CC 2WUSR 2QVAA 3C64A 4I0UA 4O2BE 4XZCA 4ASKA 4K0KT 1DW9A 4ZOLE 4QXHB 1HG5A 3T1YT 5HEJA 2H89A 2R1JL 5L3BB 5FVKA 4ZZBA 4X4DA 4AKGA 5DQVA 1U2ZA 2W66A 4DV6T 1YXRA 1Y7YA 5H6QB 2ZLYA 4LFCT 2KSRA 2VASA 3AVSA 1PRVA 3EUSA 1UUSA 2XPKA 2B5AA 1OXZA 2I6HA 5FL1A 3AA1B 4TWFA 1EFAA 3UTKA 3FXDB 1WR0A 2M4HA 2BKPA 4G63A 3RPUA 1E7PA 2PUEA 1LMB3 3HKBE 4TNVA 1XMQT 5HXSA 3OBVE 1ZKEA 3NRXA 1WH8A 2LYJA 1KNZA 2YDRA 4JCYA 2LKHA 4PJLA 1NW3A 1L0VA 4DR4T 4COFA 5JDLA 4H9RC 2BKOA 1YD8G 3AE3A 4PFPA 2V7MA 1ZPQA 3M9LA 1QQAA 2WBLA 3AB3B 3LBXB 3QB5K 3RGLA 1E1HB 3CMLA 5AQMB 3ZHIA 4BJMA 5DTMA 3ZYLA 5LGTB 3VR9A 2WDRA 4HKAA 4I8TA 5JDQA 3F6WA 1IC8A 3LJCA 2AXUA 4ZS3A 5IWAT 3FZKB 1SA0E 2G0UA 2DNXA 4L0RA 3KINB 4JV5T 3J9X1 2MTQA 4TNWA 5EK3A 1D1CA 2KNDA 3AXJA 5AQVB 4I6TA 4JI4T 4B3ST 3RF1A 5HEHA 2NTXA 2V26A 4UF0B 3LK42 1XZYA 1PRAA 3U78A 2EWTA 1NEKA 2MAWA 4TUYE 1S35A 2IC6A 5GAHi 3SRZA 3F51A 4JUYA 1I94T 4IGUA 2BNNA 3GMIA 2E9XC 1QLBA 3FXEB 3TLTA 3QOWA 2V6XA 2V7KA 4IE0A 4GKKT 2D0UA 4P0BA 4WZXA 4HFCA 3UFGA 3VK0A 2D9DA 2OFYA 2ES0A 2YN6A 3RI5A 5LMNT 3ZKCA 1GQEA 3PXPA 4F8HA 5LP6E 3UU4A 2XQ3A 4O4JE 5FXVA 3Q2MA 3MACA 1VPWA 3LK3B 3N9MA 4GK5E 1GT0C 3IA3A 2XY8B 5H6RB 4L9IA 4DO0A 4AQFC 4I55E 3S4UA 4LMJA 3N9OA 2K24A 4ZZCA 5JR9C 1KNPA 4PU3C 5LNKA 1JH9A 3LISA 2ICTA 4YSXA 3AA0B 3RYFE 4JI5T 3FHNA 4IDPA 1BR1A 3A9YA 3DM5A 3ZMVB 1VRBA 1XMOT 3S8QA 3B5MA 2JQ9A 3KDSE
chains in the Genus database with same CATH topology
1WYCA 2DHRA 4J1WA 3ZN1B 4MBQA 3BD1A 3CROL 3HKEE 3IBPA 2PUGA 2X68A 3IHRA 3NZPA 3O4XE 2LSGA 3UFEA 5HWXA 3BDNA 4BAYB 2XASB 2CMRA 3QUJA 3F2EA 4OHFA 5DQWA 3FYAA 3HL6A 3I9YA 3RYIE 4EIWA 2E9XA 2L8NA 2CXDA 3FMYA 3HKDE 1ZZBA 4IE5A 2PE5A 1S94A 2H3RA 2D0TA 5FP3A 4PW8A 4PK4A 4JEHB 3MXZA 3DNVB 4J2CA 1NAFA 2A72A 2X0LB 3CQCB 4TV9E 1UCUA 3KV9A 4HTEA 4UIGA 4UXNB 3V5SA 4PJNA 5ETWA 4YARA 3EDUA 2XQYA 4QXCB 1XWRA 2KZ8A 4ISTA 4PFOA 2W63A 4EXTA 3ZYKA 4P09A 3SCFA 2BVMA 4MCTA 1Z0PA 4ILUA 2BNMA 3BQLA 1MMAA 2BDEA 2V7LA 1O4XA 1T98A 3PUQA 1D0XA 5HYAA 4YG4A 5DABA 1FEWA 2ACXA 4IA8A 5KDMC 5KMGP 4CQIA 3PE0A 2LSIA 1LVKA 4H9OC 4DVDA 4U74A 3PUGA 2W0GA 4DMWA 3HI2A 3KBUA 3O9XA 4QKNA 4JCXA 5HAXA 4ZI3C 3ZMUB 4PJJA 1L1MA 4AXPA 3ZCJA 2Y8DA 4EAHA 1POUA 3E22E 1ZS4A 5FY1A 3RRWA 2GRLA 4I6UA 4I43B 2WAUA 2FJRA 5AFUL 5LJMA 2KLQA 4ZS2A 3KFWX 2PBIA 2EF8A 2ZM8A 5F8PA 2B1EA 3O1JA 4CI1B 1R69A 2IUOA 2CE7A 3KVAA 3CLCA 3VKHA 1MMDA 4YJ3E 3ETVA 2YU2A 4CXXA 3GBFA 4HEAA 1HF0A 2JRKA 2D5VA 4EOZB 4TN7B 2LOSA 3UUXB 5KX5E 2LSKA 5JVDE 5JRCA 4AKIA 2BNOA 3N9QA 3RH3A 3L1PA 3R6NA 3UT5E 3KXAA 1S7EA 4X4FA 3L09A 2LYQA 3N2OA 4AI6A 4L5GA 2ICPA 3KJXA 3UUMA 1RPEL 3EUHA 3L3PA 3A5XA 2N1GA 1D0YA 1WLXA 5LBMA 2IVQA 2O49A 3OP9A 4Z5DA 1FMWA 2D5UA 1MMGA 2GK9A 3KV6A 4AQGA 2R63A 1ZZCA 1FMVA 1VOMA 2P9BA 2ZMAA 3JC6C 2EHOB 1ZHCA 4YLHA 3K3QC 5HWYA 4H9PC 4DBRA 4CXYA 1D1BA 4HN9A 2EHOA 1CQTA 3O1HA 1MIVA 2N2NA 5JH7E 2KWHA 2K9AA 2LCVA 1X57A 2LYKA 3OMTA 2CWOA 4AKRB 3W15B 3JXCL 2PUBA 3WAJA 2DLRA 2UXXB 1LCDA 4UVCB 3K3OA 4FN3A 4Z58A 3QYXA 3QQ6A 1HFAA 4X4BA 2LM9A 4QWNB 2L9QA 3LFPA 1HCIA 4F8DA 2NTYA 4FI5A 4YFSA 4OK0A 2PUCA 2LYSA 5DJQC 2C5IT 3UUNA 5JRCB 5FY7A 5L3CB 4YBAA 3DTOA 4MCXA 3C98B 4IWRA 2VKOA 3GA8A 5A1LA 1CJGA 2Q9QC 3B13A 4PK6A 2AUWA 2HH7A 2LT3A 3Q9DA 3RC3A 3OYXA 4ZHQE 3RC8A 3QWGA 3JC6D 5LXTE 3JXDL 3C4XA 3DJBA 3SCGA 2MYSA 3ZC1A 2X9WA 4EB6E 3PDYA 4X4EA 5HXHA 2BJCA 5HXEA 4AKLA 3D0TA 4HFVA 4ANJA 3T8OA 4O2AE 3MJXA 3C50A 4UEMA 5TAOA 3SOLA 2VWAA 3CWZB 3BK9A 3BQKA 2V1DB 3I0OA 1ZZ8A 3U3WA 1LVFA 2BZBA 4E7ZA 2CROA 1QQBA 3R84B 2O38A 3KVBA 2JQQA 5JREA 4DBQA 1QUUA 1YW0A 4WBOA 3V5UA 2IVBA 3GN5A 3GN5B 3JXBC 1YKEB 3H37A 2LE8A 5CB4E 5L2LA 5LJNA 1QP7A 1MIYA 1BDIA 4MHCA 3RKOA 4PU8A 2OR1L 2X9YA 3CQGB 3LG7A 2PUAA 1IZNB 3FB2A 1RIOA 3AA6B 1OSLA 3VHLA 4CXWA 5LOVE 2H7VC 2LEHA 2WM9A 1JFSA 3ZYMA 3E08A 5FNVE 3ZC0A 2RP4A 2YEVC 2ODVA 2PFVA 3F57A 3PTRB 1ZAYA 5L3GB 3U3IA 1X79A 2GZUA 2AW6A 4N78D 5FXWA 2K5BB 4GIWA 3N9PA 4NUVA 4TX5A 1LLIA 5JDFA 4E7SA 4GYRA 2ODUA 5ADXL 3FYMA 2VKDA 4IIJE 4MFRA 4BA9A 3OQOA 3B7HA 2AXZA 3OQMA 4X1YE 5JR9A 4HE8A 4O4LE 4WNKA 3RYCE 3MA9A 4Z59A 2XAHB 1SHZC 1OWAA 4JLEA 4QX7B 4X4CA 1BDHA 5LHHB 1U5PA 2LSJA 2V7JA 4X1KE 1U4QA 1UXDA 1B0NA 5FXZA 2W62A 3K8PC 3ANWB 3CX6B 3HZIB 3ZMZB 2XAJB 4QXBB 3ZN0B 3CVRA 1ZZ6A 1ZZ7A 3QC9A 1Y9QA 1V9DA 3ANWA 3PURA 4KBMB 4UVAB 3K3NA 2MEZA 4GYSA 2CWYA 4MLKA 1FIOA 3N2KE 4EYYR 4EZHA 4Z5HA 2DI4A 2WWUA 3IEEA 1LRZA 1DWKA 4Z5CA 1ZVVA 3ZPOA 5CA1E 4OYJA 4UELA 4I50E 2NWBA 5A7LA 2C5JA 2NOXA 3MK7C 5JDGA 2IV1A 2JVLA 1BR0A 3VU7H 4ISSA 3G5GA 3B57A 3ZEFB 3ONXA 4PU4C 4K0UA 5FY0A 1D0ZA 1YKHB 5L3EB 2MOZA 5J2TE 4X4GA 2XCJA 3EVYA 4O8SA 3PU3A 3R1FA 4OYKA 4PNIA 5IYZE 5HXRA 2LHRA 2CLYC 3VKGA 3I0QA 4YG1A 2C5KT 2IW5B 1QP4A 3PUSA 2RA1A 2VK9A 2WUSR 2W00A 3CX8B 5HXCA 3C64A 1X2LA 2HINA 4O2BE 2DWGA 4QX8B 4XZCA 4ASKA 5K98B 2YK0A 5F3JA 1DW9A 2BVLA 4ZOLE 4QXHB 4HGAA 2GRMA 1HF8A 1HG5A 3HKCE 4U72A 2M67A 4EYUA 4IVZA 3KBTA 2XHEB 2R1JL 2H7OA 1AJ3A 1WH6A 1ZV4X 5L3BB 2CM0A 3OYZA 3H5TA 4X4DA 4AKGA 2KINB 1YSEA 2ZM0A 5DQVA 1ZEEA 1G8XA 5LGUB 2PPXA 1QSDA 2KWIB 1JWLA 1Y7YA 1MMNA 3AVRA 2ZLYA 5H6QB 4UF0A 1PERL 1WRDA 1PRVA 3EUSA 2VASA 2H8RA 3AVSA 2IVGA 1H7CA 4CI3B 4O8BA 2B5AA 1WETA 2QA7A 2SPCA 3MLFA 1OXZA 3UULA 2LHNA 3AA1B 1LQCA 2W61A 2D2SA 3F31A 2PJQA 1EFAA 5LHGB 4GHJA 1RZSA 3UTKA 3FXDB 4JEUB 2A2FX 4O4HE 2Z6EA 4G63A 2XJ3A 2E8IA 2A6CA 1UTXA 2OA5A 2LSYA 3RPUA 2PUEA 5FYMA 3NRYA 3TRBA 4IE4A 2A3DA 1LMB3 3FBZA 1QPZA 4UV9B 3HKBE 2CSFA 4TV8E 3ZMTB 4A56A 4GK0E 2X66A 5HXSA 4YG7B 3RX6A 4J1XA 3OBVE 4ZI2C 1IJ5A 1ZKEA 3NRXA 1WH8A 4ADZA 2LYJA 2X9HA 3NBXX 1KNZA 2VL8A 4B6XA 3MZKB 3BS3A 1CUNA 4JCYA 3AAAB 3Q5XA 2CCQA 1KK7A 2EHOC 4PJLA 3H3AA 4DMVA 5BMVE 2HSGA 2X67A 1SQ8A 5E0OA 2KEIA 2E9XD 3CKDA 3E0ZA 2LYRA 3OKQA 4M1PA 5JDLA 4PU7A 4H9NC 3DP7A 1UXCA 3ZCIA 2LOPA 5L3FB 4NDWA 2WIUB 3D1NI 3UFDA 1O3XA 2WMNA 3ZJ1A 2LJLA 4I4TE 5J2UE 3GWHA 3O1IA 1RZRD 4H9RC 2VKHA 2EBYA 2JCGA 1YD8G 2IAKA 3P8CD 4ZI7E 1HX8A 2VB6A 1MIWA 2ZM2A 3AA7B 4PFPA 2V7MA 5JQGE 2EHOD 1HTJF 1ZPQA 3IF8B 4AQFA 5EK2A 4YHJA 1JFTA 1QQAA 2WBLA 2KMFA 1OCTC 3AB3B 3C4WA 3LBXB 2NW9A 4GOUA 2C0SA 2NW8A 1E1HB 3KZ3A 3NZQA 3CMLA 4KP3C 3LBXA 2XI8A 2WSSV 1NEQA 3ZHIA 2NW7A 1WR6A 2CXFA 3MKDA 4BJMA 2LYPA 2WMOA 4PAGA 5LCYA 3IVPA 4X1IE 2XAQB 3ZYLA 2KPJA 2X9XA 2KEJA 3LFMA 4V1Av 1BR4A 2PIJA 4Z8XA 3CECA 3RRCA 4C91A 4H9QC 4HKAA 5LGTB 4I8TA 3LK2B 3PU8A 5JDQA 3F6WA 3P7IA 1IJ6A 2JJ9A 4OB4A 5GONE 3SWHA 1IC8A 2N9DA 4WBNE 3QF3A 3LJCA 4FBIA 2AXUA 4JQDA 4ZS3A 1UX5A 1SA0E 3QK6A 2G0UA 4IE6A 3OQNA 2KEKA 2DNXA 2XIUA 3N5LA 3KINB 4L0RA 5FXXA 3G7DA 3WI3A 3WAKA 4Y42A 4PK5A 5JR9B 4IE7A 3ZMSB 4H63V 4ERRA 3EDVA 3Q5WA 3J9X1 2MTQA 5EK4A 2CLYB 5EK3A 3AAEB 2O4AA 1RZRA 1D1CA 2KNDA 4I6TA 1Y64B 4UV8B 2Q9QB 5JDNA 3SCHA 2IC9A 2NTXA 2V26A 3I9WA 4UF0B 3LK42 4EZ4A 3CQXC 4FJOA 1PRAA 3U78A 2JMHA 1E3OC 2EWTA 1WYBA 2Q9QA 2LYLA 5JDHA 3HR0A 4TUYE 1S35A 2IC6A 3SRZA 4H63H 3F51A 1AU7A 4JUYA 4IGUA 2XAGB 4G2AA 2KT9A 2MBGA 4CI2B 4YJ2E 2BNNA 5M4YA 5IHYA 2YU1A 3GMIA 2KZ7B 2E9XC 2KXPB 4KUMB 3FXEB 2PUDA 3CPZA 3SS1A 2Q9QD 4WW0A 2V7KA 5L3DB 4IE0A 3RZZA 2L49A 2XSDC 2D0UA 2Y48B 3ZJ2A 1LCCA 4P0BA 4DNDA 1D1AA 3BQIA 4ZI2D 1UX4A 3ESLA 1HS7A 3PUAA 2L8KA 3VK0A 1NWMX 4X4HA 2NP9A 4OFZA 3ZLIA 2OFYA 3AAIA 4QHOA 2ES0A 4XBFB 2HPLA 3ZKCA 4X20E 4ZI3D 4MALA 3PXPA 2XTLA 4PJMA 5LP6E 4AKHA 1PRUA 2AXVA 2CXLA 1EZ3A 3FBLA 4O4JE 1HG2A 3MACA 3Q2MA 4XAXB 1VPWA 5FXVA 4GQMA 4X4IA 3LK3B 3N9MA 4GK5E 5J1GA 2CEAA 1GT0C 1BR2A 3KV4A 3I1AA 2JPFA 3C4ZA 3J7Yq 5LA6E 2IU7A 3CX7B 2CA5A 2XAFB 4TZ4C 4NUUA 5LYJE 2PG8A 3ETUA 2I59A 1US7B 3N9LA 1B7TA 5H6RB 1WIZA 3N9NA 4L9IA 4DO0A 4KMCA 5EZYE 1ADRA 2V7IA 5FMNA 4AQFC 2E9XB 4I6RA 4BJNA 3ZHMA 5LBQB 4C90A 3OJAA 2MQKA 4I55E 4F6RC 5LGNB 3S4UA 5JDMA 5LG4A 3C51A 3N2GE 2XUEA 3KV5A 2HPJA 2PUFA 2K48A 3N9OA 4H9SE 2L3LA 2K24A 5CA0E 5JR9C 2Y6XA 2YINA 2X51A 1QP0A 2AWIA 4PU3C 3RYHE 2DWKA 2J1DG 1JH9A 5LNKA 3LISA 2ICTA 3F52A 1G73A 3HA4A 3AA0B 5C8YE 4IHJE 3RYFE 3FHNA 1MNEA 1BR1A 2VKJA 1IAPA 2UXNB 3ZMVB 1VRBA 1ZUGA 3S8QA 3M65A 4O4IE 1PNRA 1LKXA 4P0AA 1R63A 4CZZB 5LHIB 2QGSA 3TKLB 1MNDA 2JMKA 1ZZ9A 1NERA 2DCFA 4UVBB 3KDSE 4IDZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LFP A;  2AXU A;  4FBI A;  4F8D A;  4J1W A;  4JQD A;  2WUS R;  2PUC A;  2LYS A;  3BD1 A;  3OQN A;  1X2L A;  2HIN A;  2XIU A;  2KEK A;  2PUG A;  3CRO L;  3G7D A;  5K98 B;  1DW9 A;  4Y42 A;  4FN3 A;  4YBA A;  4Z58 A;  3BDN A;  3QYX A;  4MCX A;  4IWR A;  2GRM A;  3GA8 A;  3FYA A;  1CJG A;  2AUW A;  2L8N A;  3FMY A;  2O4A A;  1RZR A;  3QWG A;  1ZZB A;  4I6T A;  3JXD L;  2PE5 A;  3SCG A;  4IVZ A;  4X4E A;  3SCH A;  2R1J L;  2BJC A;  3DNV B;  1WH6 A;  1PRA A;  1E3O C;  2EWT A;  3H5T A;  2LYL A;  4X4D A;  1ZZ8 A;  3U3W A;  1YSE A;  2CRO A;  2PPX A;  1QQB A;  2O38 A;  4YAR A;  1XWR A;  2KZ8 A;  1Y7Y A;  3F51 A;  1JWL A;  1AU7 A;  1PER L;  1PRV A;  2IVB A;  3EUS A;  2BNN A;  3GN5 B;  2IVG A;  3GN5 A;  3SCF A;  4MCT A;  3JXB C;  2H8R A;  1QP7 A;  4O8B A;  2B5A A;  1BDI A;  1WET A;  2PUD A;  2BNM A;  3MLF A;  1O4X A;  4PU8 A;  1LQC A;  2OR1 L;  4YG4 A;  3RZZ A;  2L49 A;  2XSD C;  1EFA A;  2PUA A;  4GHJ A;  4IA8 A;  1RZS A;  1OSL A;  1RIO A;  1LCC A;  1JFS A;  3HI2 A;  2XJ3 A;  2A6C A;  1UTX A;  3O9X A;  1ZAY A;  2PUE A;  3VK0 A;  4JCX A;  3TRB A;  2GZU A;  2AW6 A;  1LMB 3;  1L1M A;  4X4H A;  1QPZ A;  2CSF A;  2OFY A;  1LLI A;  1POU A;  3ZKC A;  1ZS4 A;  3FYM A;  2GRL A;  4I6U A;  4J1X A;  4YG7 B;  3OQO A;  3B7H A;  2AXZ A;  2FJR A;  3PXP A;  3OQM A;  1PRU A;  2AXV A;  1WH8 A;  2EF8 A;  2LYJ A;  4Z59 A;  1VPW A;  3BS3 A;  1R69 A;  4GQM A;  2IUO A;  4X4I A;  4JCY A;  4X4C A;  1BDH A;  3CLC A;  1GT0 C;  3GBF A;  2HSG A;  1SQ8 A;  2KEI A;  1UXD A;  1B0N A;  1HF0 A;  2D5V A;  2IU7 A;  2LYR A;  4PU7 A;  1UXC A;  4NDW A;  2BNO A;  2WIU B;  3HZI B;  3D1N I;  3UFD A;  3L1P A;  1WIZ A;  1ZZ6 A;  3KXA A;  1RZR D;  1S7E A;  1ZZ7 A;  4X4F A;  2LYQ A;  2EBY A;  2JCG A;  1Y9Q A;  1ADR A;  2ICP A;  3KJX A;  2MEZ A;  4I6R A;  3ZHM A;  1RPE L;  2MQK A;  1ZPQ A;  4Z5H A;  1JFT A;  2IVQ A;  1QQA A;  2PUF A;  1OCT C;  1DWK A;  4Z5C A;  1ZVV A;  3OP9 A;  4Z5D A;  2O49 A;  2R63 A;  1ZZC A;  2AWI A;  3KZ3 A;  4PU3 C;  1QP0 A;  5A7L A;  1JH9 A;  2XI8 A;  3LIS A;  2ICT A;  2IV1 A;  1NEQ A;  2JVL A;  3F52 A;  3ZHI A;  3G5G A;  2LYP A;  4PU4 C;  3IVP A;  1CQT A;  2KPJ A;  4X4G A;  2XCJ A;  2KEJ A;  2PIJ A;  3CEC A;  3R1F A;  2LCV A;  1X57 A;  2LYK A;  1ZUG A;  3OMT A;  3S8Q A;  4I8T A;  3F6W A;  1PNR A;  1R63 A;  3JXC L;  2PUB A;  4OB4 A;  1ZZ9 A;  1LCD A;  1IC8 A;  1NER A;  4YG1 A;  3QQ6 A;  3QF3 A;  4X4B A;  1QP4 A; 
#chains in the Genus database with same CATH topology
 1WYC A;  2DHR A;  5CGM A;  3ZN1 B;  1HR0 T;  5ABF A;  3HKE E;  3IBP A;  2PUG A;  2X68 A;  3IHR A;  3O4X E;  3FYA A;  3HL6 A;  2CXD A;  3HKD E;  1CHU A;  4IE5 A;  2PE5 A;  4LF9 T;  4PW8 A;  4PK4 A;  2LM2 A;  1NAF A;  2JIW A;  4TV9 E;  4LF4 T;  1XWR A;  2KZ8 A;  2W63 A;  1T7S A;  2HN2 A;  4QH4 A;  2BNM A;  3BQL A;  1MMA A;  2BDE A;  1O4X A;  3ONJ A;  2M6I A;  2ACX A;  5KMG P;  3PE0 A;  4DMW A;  3HI2 A;  3O9X A;  4HFD A;  5HAX A;  4ZI3 C;  4A98 A;  2XQ4 A;  2W4X A;  4EAH A;  5IUX A;  3E22 E;  1ZS4 A;  3RRW A;  4I43 B;  4U31 A;  2WAU A;  2DL1 A;  1XDO A;  4IRE A;  2WY2 A;  3O1J A;  4CI1 B;  4LF7 T;  5DRT A;  4YJ3 E;  4CXX A;  4LF5 T;  1Z8U A;  1XNQ T;  1HF0 A;  3M3Z B;  4EOZ B;  4TN7 B;  3QOF A;  5KX5 E;  2WDV A;  1W9R A;  4LF6 T;  3L1P A;  3R6N A;  4X4F A;  3L09 A;  2PXQ A;  4L5G A;  2ICP A;  4X66 T;  2IVQ A;  1NEN A;  2O49 A;  1FMW A;  3KV6 A;  1MMG A;  2JQE A;  5AQK B;  1ZHC A;  4DBR A;  1D1B A;  4HN9 A;  3JAD A;  1MIV A;  2KWH A;  2K9A A;  2LCV A;  3OMT A;  5AQQ B;  3QQ6 A;  2XQ9 A;  1HFA A;  2LM9 A;  4Z90 A;  4DUZ T;  1HCI A;  2NTY A;  4YFS A;  2PXU A;  2VVS A;  4WVL A;  4IWR A;  3UU6 A;  4YXD A;  5LXT E;  3SCG A;  4ZXL A;  3PDY A;  5HXH A;  3D0T A;  4ANJ A;  4O2A E;  5TAO A;  5L4H A;  2VWA A;  3CWZ B;  3A9X A;  1ZZ8 A;  1JNR A;  3RHW A;  2VEO A;  2JQQ A;  3JAF A;  4DBQ A;  4WBO A;  3GN5 A;  3GN5 B;  2E5V A;  3AEE A;  5AQG B;  5LJN A;  1BDI A;  3TLU A;  2XXP A;  3CQG B;  1IZN B;  4DUY T;  3AA6 B;  3E08 A;  3VR8 A;  2ODV A;  1X79 A;  5FXW A;  3AE1 A;  4GIW A;  4TX5 A;  3CK6 A;  3FYM A;  3PUZ F;  4IIJ E;  4DV4 T;  5JR9 A;  4X1Y E;  4WNK A;  3MA9 A;  3GZD C;  4NXM T;  3RIU A;  4QX7 B;  5AQS B;  2BG9 A;  5LHH B;  2XXQ A;  2LSJ A;  4CN1 A;  1XWM A;  3AEB A;  4U3C A;  5LB7 B;  2MEZ A;  4GYS A;  2CWY A;  4EYY R;  3N2K E;  3PUW F;  1KF6 A;  2WWU A;  3RKG A;  4I50 E;  2C5J A;  2IV1 A;  5BR8 T;  2MOZ A;  4O8S A;  2ODR D;  5HXR A;  2LHR A;  4DR3 T;  2CLY C;  2IW5 B;  3PUS A;  5HXC A;  3CX8 B;  1X2L A;  3PUY F;  2DWG A;  5HEO A;  2YK0 A;  5F3J A;  2XQ7 A;  4HGA A;  1W0A A;  3HKC E;  2V6Y B;  5CJ5 A;  3AEF A;  2XHE B;  1ZV4 X;  2WDQ A;  2AE9 A;  2KIN B;  5LGU B;  1QSD A;  2KWI B;  2PXP A;  3SFD A;  3AVR A;  2PTF A;  1H7C A;  4CI3 B;  2WCA A;  3AE2 A;  3OTO T;  2SPC A;  1LQC A;  2W61 A;  2D2S A;  2M6B A;  1KFY A;  4X64 T;  3LDQ B;  2A2F X;  1QZX A;  2Z6E A;  1DU2 A;  2IUB A;  5FYM A;  3ZMT B;  1QPZ A;  4TV8 E;  3H3M A;  3RX6 A;  4DR6 T;  3PE5 A;  3ZSS A;  1IJ5 A;  2X9H A;  2J7U A;  5AQI B;  4B6X A;  3MZK B;  3AAA B;  2CCQ A;  3P4Q A;  1SQ8 A;  3AE7 A;  2KEI A;  3E0Z A;  4M1P A;  3OKQ A;  4DR2 T;  5L3F B;  2WIU B;  2WMN A;  3L8R A;  5J2U E;  1RZR D;  2VKH A;  2EBY A;  4ZI7 E;  3RC8 A;  2VB6 A;  2ZM2 A;  4HFE A;  2EHO D;  1HTJ F;  5EK2 A;  2YKS A;  4HWI B;  1JFT A;  1IBL T;  2NW9 A;  1OCT C;  4YTM A;  3GZC A;  2C0S A;  3X1D A;  1I6Z A;  2BKN A;  4KP3 C;  2XI8 A;  2NW7 A;  4OBM A;  3MKD A;  2LYP A;  2WMO A;  4PAG A;  2KPJ A;  2X9X A;  4A97 A;  2PIJ A;  3RRC A;  2J4G A;  4H9Q C;  3LK2 B;  3P7I A;  2XQA A;  1J5E T;  1IJ6 A;  2JJ9 A;  3QF3 A;  2L1P A;  3EI0 A;  1UX5 A;  2PXE A;  5CFB A;  3OQN A;  3N5L A;  5FXX A;  4Y42 A;  4PK5 A;  5JR9 B;  4IE7 A;  5DRY A;  4H63 V;  3ZMS B;  2O4A A;  2Q9Q B;  3SCH A;  4KHZ F;  5AQN B;  1WYB A;  2LYL A;  3HR0 A;  4DE8 A;  5AQF B;  1YQ3 A;  1AU7 A;  2KZ7 B;  2PUD A;  4ER0 A;  3SS1 A;  3NKZ A;  2L49 A;  1D1A A;  3PUA A;  3ZLI A;  3AAI A;  4XBF B;  2HPL A;  2V6Y A;  4MAL A;  1PRU A;  3AE8 A;  4YTN A;  5J1G A;  2LKG A;  4JBW F;  1BR2 A;  3KV4 A;  3I1A A;  1UUR A;  5LA6 E;  5HCJ A;  2CA5 A;  2XAF B;  2YDS A;  2K3W A;  2UUC T;  2PG8 A;  4U33 A;  3ETU A;  2I59 A;  3P4P A;  4NIQ A;  2QYW A;  3N9N A;  1ADR A;  4EV6 A;  3NRO A;  5FMN A;  2E9X B;  5LBQ B;  2MQK A;  3ZT6 A;  3C51 A;  2HPJ A;  2PUF A;  1N33 T;  2YIN A;  2J1D G;  3F52 A;  1G73 A;  5C8Y E;  2V5D A;  4ER3 A;  1MNE A;  2J62 A;  2VKJ A;  2FUP A;  1IAP A;  1LKX A;  4P0A A;  5LHI B;  1ZZ9 A;  1YQ4 A;  3QUJ A;  4IDZ A;  2BG9 B;  3BD1 A;  3CRO L;  4BAY B;  2XAS B;  3F2E A;  2L8N A;  1N34 T;  1S94 A;  2LLW A;  5FP3 A;  4JEH B;  3MXZ A;  4J2C A;  4LFA T;  2LRL A;  3CQC B;  4UIG A;  4HTE A;  2IDO B;  4UXN B;  4QXC B;  4EXT A;  5AQO B;  2BVM A;  1Z0P A;  3LSV A;  2CPT A;  2V7L A;  3PUQ A;  1T98 A;  5HYA A;  1D0X A;  4H9O C;  4DVD A;  3ZMU B;  3ZCJ A;  2Y8D A;  2GRL A;  4I6U A;  2FJR A;  4ZS2 A;  3KFW X;  2EF8 A;  5DSX A;  2OLT A;  2ZM8 A;  1MMD A;  3PJA A;  4IT4 A;  5JVD E;  4TWD A;  5JRC A;  3N9Q A;  4U2Z A;  3KXA A;  2LYQ A;  4EQZ A;  3FZL B;  4AI6 A;  4EKI A;  1RPE L;  2N1G A;  1OED E;  1WLX A;  5LBM A;  2GK9 A;  1JNZ A;  3FZF B;  1VOM A;  4DV2 T;  5HWY A;  2EHO A;  1CQT A;  3O1H A;  1WFD A;  1X57 A;  2LYK A;  2CWO A;  3GZD A;  3JXC L;  2UXX B;  4ILC A;  3QNU A;  3K3O A;  4FN3 A;  4Z58 A;  3QYX A;  3VRA A;  5HWX A;  4QWN B;  2PUC A;  5DJQ C;  4YY3 T;  3DTO A;  3C98 B;  1CJG A;  3B13 A;  3UU5 A;  2AUW A;  2HH7 A;  2JQH A;  2LT3 A;  4ER5 A;  2YDQ A;  3OYX A;  3RC3 A;  3JXD L;  4EB6 E;  2XJ7 A;  2XZE A;  2BJC A;  5HXE A;  4JYA T;  4OX9 T;  4HFV A;  3C50 A;  4UEM A;  3UU3 A;  3BK9 A;  3BQK A;  3I0O A;  2BZB A;  2WWV A;  4E7Z A;  3PJA J;  2CRO A;  5AQT B;  4Q25 A;  5JRE A;  1YW0 A;  4DV3 T;  2IVB A;  3JXB C;  1QP7 A;  1MIY A;  2X9Y A;  4ZEY A;  4IDQ A;  1RIO A;  3VHL A;  4CXW A;  2CHO A;  2H7V C;  2WM9 A;  1JFS A;  2J47 A;  3ZC0 A;  5FNV E;  2YEV C;  3F57 A;  2PFV A;  3U3I A;  2AW6 A;  2PXF A;  5JDF A;  2JQK A;  2VKD A;  4MFR A;  3OQO A;  3B7H A;  3OQM A;  3P50 A;  4ER7 A;  2XAH B;  1SHZ C;  2MPK A;  5ABG A;  4JLE A;  4X4C A;  2WU5 A;  1U5P A;  3QB5 A;  5FXZ A;  5DTQ A;  3UQ7 A;  3K8P C;  4WYV A;  3CX6 B;  4HFI A;  1MFQ C;  3HZI B;  4QXB B;  3ZN0 B;  2VQF T;  1ZZ7 A;  5DT2 A;  1Y9Q A;  4KBM B;  4MLK A;  2FJB A;  2DI4 A;  3RIF A;  3AE5 A;  1ZVV A;  2LNM A;  4UEL A;  2NWB A;  2NOX A;  1BR0 A;  3B57 A;  5FY0 A;  1YKH B;  5L3E B;  2XCJ A;  3EVY A;  3I0Q A;  3UU8 A;  4JI3 T;  1QP4 A;  2RA1 A;  2VK9 A;  2FFH A;  2WZH A;  1ZOY A;  2HIN A;  2MXD A;  1N32 T;  2HHH T;  4JI7 T;  2GRM A;  4EYU A;  3CIR A;  3KBT A;  2H7O A;  4A5X A;  2CM0 A;  3H5T A;  2QRX A;  2ZM0 A;  1ZEE A;  1G8X A;  2BBJ A;  2PPX A;  5L4E A;  1MMN A;  2XSA A;  4KI0 F;  1PER L;  4QH1 A;  2IVG A;  4O8B A;  2PXK A;  4B3R T;  3F31 A;  1IBK T;  4O4H E;  1W09 A;  3JAE A;  2A6C A;  2LSY A;  4X5T A;  3TRB A;  1X9B A;  2CSF A;  3ZPX A;  2YBD A;  4A56 A;  5AQJ B;  4GK0 E;  2X66 A;  1J5W A;  3NBX X;  4AIS A;  3BS3 A;  1T8B A;  4DMV A;  2EHO C;  2E5L T;  5E0O A;  2E9X D;  3CKD A;  1VCS A;  2LYR A;  4EED A;  5F5W A;  4H9N C;  3DP7 A;  3ZCI A;  2LOP A;  3TFL A;  3ZJ1 A;  3UFD A;  2LJL A;  5HEU A;  3RQW A;  2CRB A;  3P8C D;  1HX8 A;  3AA7 B;  1HQ1 A;  4AQF A;  4KHP T;  4YHJ A;  3C4W A;  1IBM T;  2YOE A;  3KZ3 A;  3NZQ A;  3LBX A;  1WR6 A;  2CXF A;  5LCY A;  4X1I E;  3LFM A;  2KEJ A;  4Z8X A;  3CEC A;  4YTP A;  3VWS A;  5GON E;  4OB4 A;  2N9D A;  4WBN E;  3TEL A;  3QK6 A;  4IE6 A;  2KEK A;  3WAK A;  3WI3 A;  2CLY B;  5GAG i;  2UU9 T;  2OV9 A;  5JDN A;  2IC9 A;  3CQX C;  2IIU A;  4FJO A;  3UUB A;  2JMH A;  1M62 A;  1N36 T;  4JI8 T;  5FVL A;  4YJ2 E;  3AE4 A;  2KXP B;  2VVN A;  3ONL C;  5L3D B;  3RZZ A;  2Y48 B;  3ZJ2 A;  1LCC A;  4JI0 T;  1UX4 A;  1HS7 A;  1HNW T;  1NWM X;  2NP9 A;  4OFZ A;  4X20 E;  3AE9 A;  4HWD A;  2XTL A;  4PJM A;  2AXV A;  1HG2 A;  4XAX B;  4GQM A;  3FZH B;  3RQU A;  2CEA A;  3C4Z A;  3J7Y q;  5LYJ E;  4NUU A;  3P4R A;  1B7T A;  1WIZ A;  2FBW A;  2V7I A;  4I6R A;  4C90 A;  3ZHM A;  3OJA A;  4F6R C;  5JDM A;  5LG4 A;  3AED A;  3KV5 A;  4H9S E;  5CA0 E;  2FJD A;  2Y6X A;  3AXJ B;  2AWI A;  3RYH E;  2DWK A;  1UGO A;  4AIU A;  2LRK A;  2B76 A;  2UXN B;  1PNR A;  1R63 A;  4CZZ B;  2QGS A;  3TKL B;  3UQ4 A;  4YT0 A;  3ME5 A;  3TLW A;  3UFE A;  3BDN A;  4DV5 T;  1HNZ T;  5DQW A;  3RYI E;  2E9X A;  1ZZB A;  2H3R A;  4DR5 T;  3DNV B;  3EHZ A;  2XSB A;  2A72 A;  1UK5 A;  2BG9 C;  5AQU B;  4X62 T;  5ETW A;  3Q5E A;  4YAR A;  3EDU A;  2XQY A;  4LML A;  3ZYK A;  3NDB B;  4MCT A;  4ILU A;  2H88 A;  3NZL A;  4YG4 A;  5DAB A;  1T72 A;  1J1J A;  4Q2J A;  5KDM C;  4EGW A;  2LSI A;  1LVK A;  4U74 A;  3PUG A;  2FJE A;  3KBU A;  4PJJ A;  2VL0 A;  1POU A;  2W2U A;  5FY1 A;  5J0Z A;  5LJM A;  2AXD S;  2LLV A;  2PBI A;  5F8P A;  3EAB A;  3KVA A;  3CLC A;  2YU2 A;  4HEA A;  2JRK A;  2LOS A;  3UUX B;  2LSK A;  3ZKR A;  4AKI A;  2BNO A;  4B3M T;  4UR9 A;  3UT5 E;  2BS2 A;  3ZT5 A;  1S7E A;  2CHN A;  5JUW A;  3UUM A;  3EUH A;  3L3P A;  2E2A A;  3OP9 A;  2R63 A;  2ZMA A;  2EHO B;  4YLH A;  3K3Q C;  1QB2 A;  4GKJ T;  3VRB A;  3A9Z A;  3AEG A;  3NVO A;  4DID B;  5JH7 E;  2N2N A;  4HWC A;  3G06 A;  3W15 B;  4AKR B;  2UXB T;  2DLR A;  1LCD A;  2L9Q A;  3ZST A;  4FI5 A;  1HNX T;  5JRC B;  5ABE A;  4YBA A;  1XDP A;  4DV1 T;  5A1L A;  2Q9Q C;  4PK6 A;  3Q9D A;  4ILB A;  4LFB T;  3QWG A;  3JC6 D;  3DJB A;  2MYS A;  2X9W A;  5LMU T;  4AKL A;  3PUX F;  4DV7 T;  5FL0 A;  3MJX A;  3SOL A;  3U3W A;  1LVF A;  1KNR A;  2CBJ A;  2O38 A;  3KVB A;  1QUU A;  3RIU C;  5L2L A;  1YKE B;  5CB4 E;  2X0H A;  1KEY A;  5JTG A;  4MHC A;  4PU8 A;  3LG7 A;  1OSL A;  5LOV E;  3OWQ A;  3PTR B;  2ZM6 T;  1ZAY A;  5L3G B;  2PXL A;  3N9P A;  5ADX L;  4BA9 A;  4HE8 A;  4O4L E;  3RYC E;  4Z59 A;  3K1S A;  3SFE A;  1BDH A;  2FJA A;  2W62 A;  2VQE T;  4P1N A;  3CVR A;  1ZZ6 A;  5AQL B;  3QC9 A;  3PUR A;  3SR4 A;  4UVA B;  4EZH A;  1FIO A;  2PXB A;  2IML A;  3AEA A;  3IEE A;  1LRZ A;  3KL4 A;  5ABH A;  5C3J A;  4Z5C A;  3ZPO A;  2UXD T;  4TWH A;  2JVL A;  3ZEF B;  3GUU A;  3ONX A;  2HCS A;  1D0Z A;  4LMK A;  5J2T E;  2LLY A;  2IHR 1;  4X4G A;  3PU3 A;  3R1F A;  1OED C;  2RPA A;  2X0Y A;  4PNI A;  3T1H T;  4YG1 A;  4CN4 A;  2W00 A;  4EEB A;  4QX8 B;  5K98 B;  1E2A A;  2BVL A;  2PXD A;  1HF8 A;  4U72 A;  3ZT7 A;  2M67 A;  4HFH A;  4DR1 T;  4IVZ A;  1XNR T;  3LQX A;  1AJ3 A;  1WH6 A;  3OYZ A;  1YSE A;  1Y01 A;  4B3T T;  1JWL A;  4UF0 A;  2A9U A;  1WRD A;  2ACZ A;  2H8R A;  1HX1 B;  1WET A;  2QA7 A;  3OPC A;  3MLF A;  3UUL A;  2LHN A;  3NWI A;  3P4W A;  4U7Y A;  2PJQ A;  5LHG B;  4GHJ A;  1RZS A;  4JEU B;  4EK9 A;  2XJ3 A;  2E8I A;  2OA5 A;  1UTX A;  2XM1 A;  3NRY A;  4IE4 A;  2A3D A;  3FBZ A;  4UV9 B;  4JI6 T;  2J7W A;  2WZI A;  4HFB A;  4YG7 B;  4J1X A;  4ZI2 C;  4QH5 A;  2NR4 A;  4ADZ A;  2VL8 A;  3P4S A;  1CUN A;  3Q5X A;  2V8S V;  1KK7 A;  2BBH A;  3H3A A;  5BMV E;  2HFZ A;  2HSG A;  2X67 A;  4PU7 A;  1UXC A;  4NDW A;  3D1N I;  1O3X A;  4I4T E;  3GWH A;  3O1I A;  2JCG A;  2IAK A;  1MIW A;  1FJG T;  5JQG E;  3IF8 B;  2BG9 E;  2KMF A;  4GOU A;  4CN6 A;  2NW8 A;  2WSS V;  1NEQ A;  4JI1 T;  3IVP A;  2XAQ B;  4V1A v;  2XM2 A;  1BR4 A;  4C91 A;  3PU8 A;  2V5C A;  3SWH A;  5AQR B;  3AE6 A;  4FBI A;  4JQD A;  3NXH A;  5AQP B;  4IDO A;  3RLF F;  2XIU A;  3G7D A;  3PUV F;  4ERR A;  3EDV A;  3Q5W A;  5EK4 A;  3MEJ A;  3AAE B;  1RZR A;  1Y64 B;  4UV8 B;  4NXN T;  3I9W A;  4EZ4 A;  2UUA T;  2I0M A;  1E3O C;  2Q9Q A;  4U2Y A;  5JDH A;  4YSZ A;  3TLS A;  3Q5D A;  5DTR A;  2UXC T;  3G0T A;  4H63 H;  2XAG B;  4G2A A;  2KT9 A;  2MBG A;  4CI2 B;  5M4Y A;  5IHY A;  4LF8 T;  2YU1 A;  4KUM B;  5ABF B;  3CPZ A;  2Q9Q D;  4WW0 A;  2XSD C;  4DND A;  3EAM A;  1OED A;  3BQI A;  4ZI2 D;  1WCR A;  3ESL A;  2L8K A;  3RIA A;  4X4H A;  1R8I A;  2W67 A;  4QHO A;  4ZI3 D;  2VUR A;  1OED B;  4AKH A;  2CXL A;  1EZ3 A;  3FBL A;  2R6G F;  4X4I A;  2JPF A;  2IU7 A;  3CX7 B;  4TZ4 C;  4AQY T;  4IL9 A;  5LG3 A;  3TEP A;  1US7 B;  3N9L A;  3OVU A;  4KMC A;  5EZY E;  3PV0 F;  4BJN A;  5LGN B;  3N2G E;  2XUE A;  4U7I A;  2K48 A;  2L3L A;  2X51 A;  1QP0 A;  2BS3 A;  3HA4 A;  4IHJ E;  3FZM B;  1ZUG A;  3M65 A;  4O4I E;  2XQ5 A;  1MND A;  2JMK A;  1NER A;  2DCF A;  4UVB B;  4J1W A;  4MBQ A;  4JI2 T;  2WS3 A;  3NZP A;  2LSG A;  2CMR A;  4OHF A;  4EIW A;  3I9Y A;  3FMY A;  2D0T A;  2HCN A;  1M7K A;  2X0L B;  1UCU A;  3KV9 A;  4IDN A;  1SE7 A;  3V5S A;  4PJN A;  4IST A;  4PFO A;  4DV0 T;  4P09 A;  3SCF A;  2WQY A;  1FEW A;  2WB5 A;  4IA8 A;  4CQI A;  2WU2 A;  5KXJ A;  4YHH T;  2W0G A;  4QKN A;  4JCX A;  1L1M A;  4AXP A;  4YSY A;  5AFU L;  2KLQ A;  2B1E A;  1R69 A;  2IUO A;  2CE7 A;  3VKH A;  3ETV A;  5FKY A;  3GBF A;  2WP9 A;  2D5V A;  5AQH B;  4Z91 A;  1ZP0 A;  3RH3 A;  3N2O A;  3KJX A;  3OKZ A;  3A5X A;  1D0Y A;  4IL4 A;  4Z5D A;  2D5U A;  4AQG A;  1FMV A;  1ZZC A;  2P9B A;  3JC6 C;  2CBI A;  4H9P C;  2PXT A;  4CXY A;  3L39 A;  1SUM B;  2XXA A;  3WAJ A;  2PUB A;  3ABV A;  4UVC B;  4X4B A;  3QOX A;  3LFP A;  4F8D A;  4OK0 A;  2LYS A;  2C5I T;  3UUN A;  5FY7 A;  3AEC A;  5L3C B;  3UWP A;  4MCX A;  4ER6 A;  2VKO A;  4HWF A;  5C2T A;  3GA8 A;  3A7M A;  4ZHQ E;  3C4X A;  2HN1 A;  3ZC1 A;  4X4E A;  3T8O A;  2BS4 A;  5HCM A;  2V1D B;  4HRA A;  1QQB A;  3R84 B;  3V5U A;  1VCT A;  3H37 A;  2LE8 A;  4EKG A;  3RKO A;  2OR1 L;  2UUB T;  3QFI A;  2PUA A;  3FB2 A;  2LEH A;  3ZYM A;  3SX0 A;  2RP4 A;  4ILA A;  2GZU A;  4N78 D;  2K5B B;  4NUV A;  1LLI A;  4E7S A;  4GYR A;  2ODU A;  2AXZ A;  3JCF A;  2F4V T;  3A8Y C;  1W0B A;  2XQ8 A;  4DE9 A;  1OWA A;  4EZI A;  4DR7 T;  2V7J A;  4X1K E;  1U4Q A;  1UXD A;  1B0N A;  3ANW B;  3TLV A;  2XAJ B;  3ZMZ B;  5L47 A;  2PXV A;  1V9D A;  3ANW A;  3K3N A;  5HEG A;  1DUL A;  4Z5H A;  1DWK A;  5CA1 E;  4OYJ A;  5A7L A;  4KX6 A;  3MK7 C;  5JDG A;  3VU7 H;  4ISS A;  3G5G A;  4PU4 C;  4K0U A;  4X65 T;  4OYK A;  2XQ6 A;  5IYZ E;  3R09 A;  4NPP A;  3VKG A;  4HWH A;  2C5K T;  2V3C C;  2WUS R;  2QVA A;  3C64 A;  4I0U A;  4O2B E;  4XZC A;  4ASK A;  4K0K T;  1DW9 A;  4ZOL E;  4QXH B;  1HG5 A;  3T1Y T;  5HEJ A;  2H89 A;  2R1J L;  5L3B B;  5FVK A;  4ZZB A;  4X4D A;  4AKG A;  5DQV A;  1U2Z A;  2W66 A;  4DV6 T;  1YXR A;  1Y7Y A;  5H6Q B;  2ZLY A;  4LFC T;  2KSR A;  2VAS A;  3AVS A;  1PRV A;  3EUS A;  1UUS A;  2XPK A;  2B5A A;  1OXZ A;  2I6H A;  5FL1 A;  3AA1 B;  4TWF A;  1EFA A;  3UTK A;  3FXD B;  1WR0 A;  2M4H A;  2BKP A;  4G63 A;  3RPU A;  1E7P A;  2PUE A;  1LMB 3;  3HKB E;  4TNV A;  1XMQ T;  5HXS A;  3OBV E;  1ZKE A;  3NRX A;  1WH8 A;  2LYJ A;  1KNZ A;  2YDR A;  4JCY A;  2LKH A;  4PJL A;  1NW3 A;  1L0V A;  4DR4 T;  4COF A;  5JDL A;  4H9R C;  2BKO A;  1YD8 G;  3AE3 A;  4PFP A;  2V7M A;  1ZPQ A;  3M9L A;  1QQA A;  2WBL A;  3AB3 B;  3LBX B;  3QB5 K;  3RGL A;  1E1H B;  3CML A;  5AQM B;  3ZHI A;  4BJM A;  5DTM A;  3ZYL A;  5LGT B;  3VR9 A;  2WDR A;  4HKA A;  4I8T A;  5JDQ A;  3F6W A;  1IC8 A;  3LJC A;  2AXU A;  4ZS3 A;  5IWA T;  3FZK B;  1SA0 E;  2G0U A;  2DNX A;  4L0R A;  3KIN B;  4JV5 T;  3J9X 1;  2MTQ A;  4TNW A;  5EK3 A;  1D1C A;  2KND A;  3AXJ A;  5AQV B;  4I6T A;  4JI4 T;  4B3S T;  3RF1 A;  5HEH A;  2NTX A;  2V26 A;  4UF0 B;  3LK4 2;  1XZY A;  1PRA A;  3U78 A;  2EWT A;  1NEK A;  2MAW A;  4TUY E;  1S35 A;  2IC6 A;  5GAH i;  3SRZ A;  3F51 A;  4JUY A;  1I94 T;  4IGU A;  2BNN A;  3GMI A;  2E9X C;  1QLB A;  3FXE B;  3TLT A;  3QOW A;  2V6X A;  2V7K A;  4IE0 A;  4GKK T;  2D0U A;  4P0B A;  4WZX A;  4HFC A;  3UFG A;  3VK0 A;  2D9D A;  2OFY A;  2ES0 A;  2YN6 A;  3RI5 A;  5LMN T;  3ZKC A;  1GQE A;  3PXP A;  4F8H A;  5LP6 E;  3UU4 A;  2XQ3 A;  4O4J E;  5FXV A;  3Q2M A;  3MAC A;  1VPW A;  3LK3 B;  3N9M A;  4GK5 E;  1GT0 C;  3IA3 A;  2XY8 B;  5H6R B;  4L9I A;  4DO0 A;  4AQF C;  4I55 E;  3S4U A;  4LMJ A;  3N9O A;  2K24 A;  4ZZC A;  5JR9 C;  1KNP A;  4PU3 C;  5LNK A;  1JH9 A;  3LIS A;  2ICT A;  4YSX A;  3AA0 B;  3RYF E;  4JI5 T;  3FHN A;  4IDP A;  1BR1 A;  3A9Y A;  3DM5 A;  3ZMV B;  1VRB A;  1XMO T;  3S8Q A;  3B5M A;  2JQ9 A;  3KDS E; 
#chains in the Genus database with same CATH homology
 1WYC A;  2DHR A;  4J1W A;  3ZN1 B;  4MBQ A;  3BD1 A;  3CRO L;  3HKE E;  3IBP A;  2PUG A;  2X68 A;  3IHR A;  3NZP A;  3O4X E;  2LSG A;  3UFE A;  5HWX A;  3BDN A;  4BAY B;  2XAS B;  2CMR A;  3QUJ A;  3F2E A;  4OHF A;  5DQW A;  3FYA A;  3HL6 A;  3I9Y A;  3RYI E;  4EIW A;  2E9X A;  2L8N A;  2CXD A;  3FMY A;  3HKD E;  1ZZB A;  4IE5 A;  2PE5 A;  1S94 A;  2H3R A;  2D0T A;  5FP3 A;  4PW8 A;  4PK4 A;  4JEH B;  3MXZ A;  3DNV B;  4J2C A;  1NAF A;  2A72 A;  2X0L B;  3CQC B;  4TV9 E;  1UCU A;  3KV9 A;  4HTE A;  4UIG A;  4UXN B;  3V5S A;  4PJN A;  5ETW A;  4YAR A;  3EDU A;  2XQY A;  4QXC B;  1XWR A;  2KZ8 A;  4IST A;  4PFO A;  2W63 A;  4EXT A;  3ZYK A;  4P09 A;  3SCF A;  2BVM A;  4MCT A;  1Z0P A;  4ILU A;  2BNM A;  3BQL A;  1MMA A;  2BDE A;  2V7L A;  1O4X A;  1T98 A;  3PUQ A;  1D0X A;  5HYA A;  4YG4 A;  5DAB A;  1FEW A;  2ACX A;  4IA8 A;  5KDM C;  5KMG P;  4CQI A;  3PE0 A;  2LSI A;  1LVK A;  4H9O C;  4DVD A;  4U74 A;  3PUG A;  2W0G A;  4DMW A;  3HI2 A;  3KBU A;  3O9X A;  4QKN A;  4JCX A;  5HAX A;  4ZI3 C;  3ZMU B;  4PJJ A;  1L1M A;  4AXP A;  3ZCJ A;  2Y8D A;  4EAH A;  1POU A;  3E22 E;  1ZS4 A;  5FY1 A;  3RRW A;  2GRL A;  4I6U A;  4I43 B;  2WAU A;  2FJR A;  5AFU L;  5LJM A;  2KLQ A;  4ZS2 A;  3KFW X;  2PBI A;  2EF8 A;  2ZM8 A;  5F8P A;  2B1E A;  3O1J A;  4CI1 B;  1R69 A;  2IUO A;  2CE7 A;  3KVA A;  3CLC A;  3VKH A;  1MMD A;  4YJ3 E;  3ETV A;  2YU2 A;  4CXX A;  3GBF A;  4HEA A;  1HF0 A;  2JRK A;  2D5V A;  4EOZ B;  4TN7 B;  2LOS A;  3UUX B;  5KX5 E;  2LSK A;  5JVD E;  5JRC A;  4AKI A;  2BNO A;  3N9Q A;  3RH3 A;  3L1P A;  3R6N A;  3UT5 E;  3KXA A;  1S7E A;  4X4F A;  3L09 A;  2LYQ A;  3N2O A;  4AI6 A;  4L5G A;  2ICP A;  3KJX A;  3UUM A;  1RPE L;  3EUH A;  3L3P A;  3A5X A;  2N1G A;  1D0Y A;  1WLX A;  5LBM A;  2IVQ A;  2O49 A;  3OP9 A;  4Z5D A;  1FMW A;  2D5U A;  1MMG A;  2GK9 A;  3KV6 A;  4AQG A;  2R63 A;  1ZZC A;  1FMV A;  1VOM A;  2P9B A;  2ZMA A;  3JC6 C;  2EHO B;  1ZHC A;  4YLH A;  3K3Q C;  5HWY A;  4H9P C;  4DBR A;  4CXY A;  1D1B A;  4HN9 A;  2EHO A;  1CQT A;  3O1H A;  1MIV A;  2N2N A;  5JH7 E;  2KWH A;  2K9A A;  2LCV A;  1X57 A;  2LYK A;  3OMT A;  2CWO A;  4AKR B;  3W15 B;  3JXC L;  2PUB A;  3WAJ A;  2DLR A;  2UXX B;  1LCD A;  4UVC B;  3K3O A;  4FN3 A;  4Z58 A;  3QYX A;  3QQ6 A;  1HFA A;  4X4B A;  2LM9 A;  4QWN B;  2L9Q A;  3LFP A;  1HCI A;  4F8D A;  2NTY A;  4FI5 A;  4YFS A;  4OK0 A;  2PUC A;  2LYS A;  5DJQ C;  2C5I T;  3UUN A;  5JRC B;  5FY7 A;  5L3C B;  4YBA A;  3DTO A;  4MCX A;  3C98 B;  4IWR A;  2VKO A;  3GA8 A;  5A1L A;  1CJG A;  2Q9Q C;  3B13 A;  4PK6 A;  2AUW A;  2HH7 A;  2LT3 A;  3Q9D A;  3RC3 A;  3OYX A;  4ZHQ E;  3RC8 A;  3QWG A;  3JC6 D;  5LXT E;  3JXD L;  3C4X A;  3DJB A;  3SCG A;  2MYS A;  3ZC1 A;  2X9W A;  4EB6 E;  3PDY A;  4X4E A;  5HXH A;  2BJC A;  5HXE A;  4AKL A;  3D0T A;  4HFV A;  4ANJ A;  3T8O A;  4O2A E;  3MJX A;  3C50 A;  4UEM A;  5TAO A;  3SOL A;  2VWA A;  3CWZ B;  3BK9 A;  3BQK A;  2V1D B;  3I0O A;  1ZZ8 A;  3U3W A;  1LVF A;  2BZB A;  4E7Z A;  2CRO A;  1QQB A;  3R84 B;  2O38 A;  3KVB A;  2JQQ A;  5JRE A;  4DBQ A;  1QUU A;  1YW0 A;  4WBO A;  3V5U A;  2IVB A;  3GN5 A;  3GN5 B;  3JXB C;  1YKE B;  3H37 A;  2LE8 A;  5CB4 E;  5L2L A;  5LJN A;  1QP7 A;  1MIY A;  1BDI A;  4MHC A;  3RKO A;  4PU8 A;  2OR1 L;  2X9Y A;  3CQG B;  3LG7 A;  2PUA A;  1IZN B;  3FB2 A;  1RIO A;  3AA6 B;  1OSL A;  3VHL A;  4CXW A;  5LOV E;  2H7V C;  2LEH A;  2WM9 A;  1JFS A;  3ZYM A;  3E08 A;  5FNV E;  3ZC0 A;  2RP4 A;  2YEV C;  2ODV A;  2PFV A;  3F57 A;  3PTR B;  1ZAY A;  5L3G B;  3U3I A;  1X79 A;  2GZU A;  2AW6 A;  4N78 D;  5FXW A;  2K5B B;  4GIW A;  3N9P A;  4NUV A;  4TX5 A;  1LLI A;  5JDF A;  4E7S A;  4GYR A;  2ODU A;  5ADX L;  3FYM A;  2VKD A;  4IIJ E;  4MFR A;  4BA9 A;  3OQO A;  3B7H A;  2AXZ A;  3OQM A;  4X1Y E;  5JR9 A;  4HE8 A;  4O4L E;  4WNK A;  3RYC E;  3MA9 A;  4Z59 A;  2XAH B;  1SHZ C;  1OWA A;  4JLE A;  4QX7 B;  4X4C A;  1BDH A;  5LHH B;  1U5P A;  2LSJ A;  2V7J A;  4X1K E;  1U4Q A;  1UXD A;  1B0N A;  5FXZ A;  2W62 A;  3K8P C;  3ANW B;  3CX6 B;  3HZI B;  3ZMZ B;  2XAJ B;  4QXB B;  3ZN0 B;  3CVR A;  1ZZ6 A;  1ZZ7 A;  3QC9 A;  1Y9Q A;  1V9D A;  3ANW A;  3PUR A;  4KBM B;  4UVA B;  3K3N A;  2MEZ A;  4GYS A;  2CWY A;  4MLK A;  1FIO A;  3N2K E;  4EYY R;  4EZH A;  4Z5H A;  2DI4 A;  2WWU A;  3IEE A;  1LRZ A;  1DWK A;  4Z5C A;  1ZVV A;  3ZPO A;  5CA1 E;  4OYJ A;  4UEL A;  4I50 E;  2NWB A;  5A7L A;  2C5J A;  2NOX A;  3MK7 C;  5JDG A;  2IV1 A;  2JVL A;  1BR0 A;  3VU7 H;  4ISS A;  3G5G A;  3B57 A;  3ZEF B;  3ONX A;  4PU4 C;  4K0U A;  5FY0 A;  1D0Z A;  1YKH B;  5L3E B;  2MOZ A;  5J2T E;  4X4G A;  2XCJ A;  3EVY A;  4O8S A;  3PU3 A;  3R1F A;  4OYK A;  4PNI A;  5IYZ E;  5HXR A;  2LHR A;  2CLY C;  3VKG A;  3I0Q A;  4YG1 A;  2C5K T;  2IW5 B;  1QP4 A;  3PUS A;  2RA1 A;  2VK9 A;  2WUS R;  2W00 A;  3CX8 B;  5HXC A;  3C64 A;  1X2L A;  2HIN A;  4O2B E;  2DWG A;  4QX8 B;  4XZC A;  4ASK A;  5K98 B;  2YK0 A;  5F3J A;  1DW9 A;  2BVL A;  4ZOL E;  4QXH B;  4HGA A;  2GRM A;  1HF8 A;  1HG5 A;  3HKC E;  4U72 A;  2M67 A;  4EYU A;  4IVZ A;  3KBT A;  2XHE B;  2R1J L;  2H7O A;  1AJ3 A;  1WH6 A;  1ZV4 X;  5L3B B;  2CM0 A;  3OYZ A;  3H5T A;  4X4D A;  4AKG A;  2KIN B;  1YSE A;  2ZM0 A;  5DQV A;  1ZEE A;  1G8X A;  5LGU B;  2PPX A;  1QSD A;  2KWI B;  1JWL A;  1Y7Y A;  1MMN A;  3AVR A;  2ZLY A;  5H6Q B;  4UF0 A;  1PER L;  1WRD A;  1PRV A;  3EUS A;  2VAS A;  2H8R A;  3AVS A;  2IVG A;  1H7C A;  4CI3 B;  4O8B A;  2B5A A;  1WET A;  2QA7 A;  2SPC A;  3MLF A;  1OXZ A;  3UUL A;  2LHN A;  3AA1 B;  1LQC A;  2W61 A;  2D2S A;  3F31 A;  2PJQ A;  1EFA A;  5LHG B;  4GHJ A;  1RZS A;  3UTK A;  3FXD B;  4JEU B;  2A2F X;  4O4H E;  2Z6E A;  4G63 A;  2XJ3 A;  2E8I A;  2A6C A;  1UTX A;  2OA5 A;  2LSY A;  3RPU A;  2PUE A;  5FYM A;  3NRY A;  3TRB A;  4IE4 A;  2A3D A;  1LMB 3;  3FBZ A;  1QPZ A;  4UV9 B;  3HKB E;  2CSF A;  4TV8 E;  3ZMT B;  4A56 A;  4GK0 E;  2X66 A;  5HXS A;  4YG7 B;  3RX6 A;  4J1X A;  3OBV E;  4ZI2 C;  1IJ5 A;  1ZKE A;  3NRX A;  1WH8 A;  4ADZ A;  2LYJ A;  2X9H A;  3NBX X;  1KNZ A;  2VL8 A;  4B6X A;  3MZK B;  3BS3 A;  1CUN A;  4JCY A;  3AAA B;  3Q5X A;  2CCQ A;  1KK7 A;  2EHO C;  4PJL A;  3H3A A;  4DMV A;  5BMV E;  2HSG A;  2X67 A;  1SQ8 A;  5E0O A;  2KEI A;  2E9X D;  3CKD A;  3E0Z A;  2LYR A;  3OKQ A;  4M1P A;  5JDL A;  4PU7 A;  4H9N C;  3DP7 A;  1UXC A;  3ZCI A;  2LOP A;  5L3F B;  4NDW A;  2WIU B;  3D1N I;  3UFD A;  1O3X A;  2WMN A;  3ZJ1 A;  2LJL A;  4I4T E;  5J2U E;  3GWH A;  3O1I A;  1RZR D;  4H9R C;  2VKH A;  2EBY A;  2JCG A;  1YD8 G;  2IAK A;  3P8C D;  4ZI7 E;  1HX8 A;  2VB6 A;  1MIW A;  2ZM2 A;  3AA7 B;  4PFP A;  2V7M A;  5JQG E;  2EHO D;  1HTJ F;  1ZPQ A;  3IF8 B;  4AQF A;  5EK2 A;  4YHJ A;  1JFT A;  1QQA A;  2WBL A;  2KMF A;  1OCT C;  3AB3 B;  3C4W A;  3LBX B;  2NW9 A;  4GOU A;  2C0S A;  2NW8 A;  1E1H B;  3KZ3 A;  3NZQ A;  3CML A;  4KP3 C;  3LBX A;  2XI8 A;  2WSS V;  1NEQ A;  3ZHI A;  2NW7 A;  1WR6 A;  2CXF A;  3MKD A;  4BJM A;  2LYP A;  2WMO A;  4PAG A;  5LCY A;  3IVP A;  4X1I E;  2XAQ B;  3ZYL A;  2KPJ A;  2X9X A;  2KEJ A;  3LFM A;  4V1A v;  1BR4 A;  2PIJ A;  4Z8X A;  3CEC A;  3RRC A;  4C91 A;  4H9Q C;  4HKA A;  5LGT B;  4I8T A;  3LK2 B;  3PU8 A;  5JDQ A;  3F6W A;  3P7I A;  1IJ6 A;  2JJ9 A;  4OB4 A;  5GON E;  3SWH A;  1IC8 A;  2N9D A;  4WBN E;  3QF3 A;  3LJC A;  4FBI A;  2AXU A;  4JQD A;  4ZS3 A;  1UX5 A;  1SA0 E;  3QK6 A;  2G0U A;  4IE6 A;  3OQN A;  2KEK A;  2DNX A;  2XIU A;  3N5L A;  3KIN B;  4L0R A;  5FXX A;  3G7D A;  3WI3 A;  3WAK A;  4Y42 A;  4PK5 A;  5JR9 B;  4IE7 A;  3ZMS B;  4H63 V;  4ERR A;  3EDV A;  3Q5W A;  3J9X 1;  2MTQ A;  5EK4 A;  2CLY B;  5EK3 A;  3AAE B;  2O4A A;  1RZR A;  1D1C A;  2KND A;  4I6T A;  1Y64 B;  4UV8 B;  2Q9Q B;  5JDN A;  3SCH A;  2IC9 A;  2NTX A;  2V26 A;  3I9W A;  4UF0 B;  3LK4 2;  4EZ4 A;  3CQX C;  4FJO A;  1PRA A;  3U78 A;  2JMH A;  1E3O C;  2EWT A;  1WYB A;  2Q9Q A;  2LYL A;  5JDH A;  3HR0 A;  4TUY E;  1S35 A;  2IC6 A;  3SRZ A;  4H63 H;  3F51 A;  1AU7 A;  4JUY A;  4IGU A;  2XAG B;  4G2A A;  2KT9 A;  2MBG A;  4CI2 B;  4YJ2 E;  2BNN A;  5M4Y A;  5IHY A;  2YU1 A;  3GMI A;  2KZ7 B;  2E9X C;  2KXP B;  4KUM B;  3FXE B;  2PUD A;  3CPZ A;  3SS1 A;  2Q9Q D;  4WW0 A;  2V7K A;  5L3D B;  4IE0 A;  3RZZ A;  2L49 A;  2XSD C;  2D0U A;  2Y48 B;  3ZJ2 A;  1LCC A;  4P0B A;  4DND A;  1D1A A;  3BQI A;  4ZI2 D;  1UX4 A;  3ESL A;  1HS7 A;  3PUA A;  2L8K A;  3VK0 A;  1NWM X;  4X4H A;  2NP9 A;  4OFZ A;  3ZLI A;  2OFY A;  3AAI A;  4QHO A;  2ES0 A;  4XBF B;  2HPL A;  3ZKC A;  4X20 E;  4ZI3 D;  4MAL A;  3PXP A;  2XTL A;  4PJM A;  5LP6 E;  4AKH A;  1PRU A;  2AXV A;  2CXL A;  1EZ3 A;  3FBL A;  4O4J E;  1HG2 A;  3MAC A;  3Q2M A;  4XAX B;  1VPW A;  5FXV A;  4GQM A;  4X4I A;  3LK3 B;  3N9M A;  4GK5 E;  5J1G A;  2CEA A;  1GT0 C;  1BR2 A;  3KV4 A;  3I1A A;  2JPF A;  3C4Z A;  3J7Y q;  5LA6 E;  2IU7 A;  3CX7 B;  2CA5 A;  2XAF B;  4TZ4 C;  4NUU A;  5LYJ E;  2PG8 A;  3ETU A;  2I59 A;  1US7 B;  3N9L A;  1B7T A;  5H6R B;  1WIZ A;  3N9N A;  4L9I A;  4DO0 A;  4KMC A;  5EZY E;  1ADR A;  2V7I A;  5FMN A;  4AQF C;  2E9X B;  4I6R A;  4BJN A;  3ZHM A;  5LBQ B;  4C90 A;  3OJA A;  2MQK A;  4I55 E;  4F6R C;  5LGN B;  3S4U A;  5JDM A;  5LG4 A;  3C51 A;  3N2G E;  2XUE A;  3KV5 A;  2HPJ A;  2PUF A;  2K48 A;  3N9O A;  4H9S E;  2L3L A;  2K24 A;  5CA0 E;  5JR9 C;  2Y6X A;  2YIN A;  2X51 A;  1QP0 A;  2AWI A;  4PU3 C;  3RYH E;  2DWK A;  2J1D G;  1JH9 A;  5LNK A;  3LIS A;  2ICT A;  3F52 A;  1G73 A;  3HA4 A;  3AA0 B;  5C8Y E;  4IHJ E;  3RYF E;  3FHN A;  1MNE A;  1BR1 A;  2VKJ A;  1IAP A;  2UXN B;  3ZMV B;  1VRB A;  1ZUG A;  3S8Q A;  3M65 A;  4O4I E;  1PNR A;  1LKX A;  4P0A A;  1R63 A;  4CZZ B;  5LHI B;  2QGS A;  3TKL B;  1MND A;  2JMK A;  1ZZ9 A;  1NER A;  2DCF A;  4UVB B;  3KDS E;  4IDZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...