3O9XA

Structure of the e. coli antitoxin mqsa (ygit/b3021) in complex with its gene promoter
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
132
structure length
132
Chain Sequence
HMKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKKLSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized HTH-type transcriptional regulator ygiT
publication title Structure of the Escherichia coli Antitoxin MqsA (YgiT/b3021) Bound to Its Gene Promoter Reveals Extensive Domain Rearrangements and the Specificity of Transcriptional Regulation.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription regulator/dna
total genus 40
structure length 132
sequence length 132
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF15731 MqsA_antitoxin Antitoxin component of bacterial toxin-antitoxin system, MqsA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 3o9xA02
1.20.58.720 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3o9xA01
1R63A 1WH6A 4MCTA 4GQMA 4I6TA 3MLFA 1PRVA 2OFYA 3SCHA 3JXBC 2MEZA 4I8TA 1LCCA 1O4XA 4YG4A 3CROL 1JFSA 1ZZ9A 2JCGA 3OMTA 2EF8A 2AWIA 4Z5DA 2PUFA 3FMYA 3L1PA 2PUEA 4JCXA 1RZRA 2XIUA 2XCJA 3LISA 1ZZ8A 3KZ3A 1QPZA 4YBAA 2KEIA 3GN5B 1QQAA 4MCXA 3U3WA 1JFTA 2PUAA 2IVGA 2OR1L 2PUBA 1LLIA 2B5AA 4Z59A 2KEJA 3S8QA 2AXUA 4X4DA 2BNOA 3FYAA 3GBFA 1IC8A 1Y9QA 1CJGA 3EUSA 3PXPA 4IWRA 1E3OC 3JXCL 3VK0A 1DWKA 1AU7A 1NEQA 2O38A 3GN5A 3D1NI 1HF0A 1VPWA 1ZPQA 1ZAYA 4O8BA 4IA8A 3QQ6A 3BD1A 3ZKCA 1XWRA 2PE5A 3QYXA 4Z58A 2A6CA 1UXCA 2HINA 2WIUB 3H5TA 1QP0A 3SCGA 3GA8A 1RZRD 1BDIA 2ICTA 1PRUA 1ZZ6A 1S7EA 4YARA 2KZ8A 3F6WA 1ZVVA 4J1WA 1L1MA 1RIOA 2GRLA 3F51A 4OB4A 2CROA 3CLCA 2EWTA 2LCVA 2LYQA 4I6UA 4FBIA 4YG1A 3BDNA 1JH9A 2O49A 3F52A 2FJRA 2LYJA 2MQKA 2HSGA 1ZZ7A 3FYMA 1LCDA 2XJ3A 1SQ8A 1UXDA 2XSDC 2AXZA 3QWGA 2LYKA 1Y7YA 1WETA 2LYLA 2ICPA 1WH8A 2IU7A 4PU7A 1POUA 3SCFA 2AXVA 3R1FA 3LFPA 2PUCA 2L8NA 4Z5CA 3O9XA 1LMB3 4Y42A 2JVLA 3OQMA 1NERA 1ZZCA 2D5VA 2PUDA 5K98B 3G7DA 4FN3A 1PERL 2IV1A 2KPJA 3OP9A 1WIZA 2GZUA 2LYSA 1EFAA 2KEKA 2H8RA 3IVPA 3JXDL 2LYRA 4JCYA 1QP7A 1QQBA 2XI8A 3B7HA 4X4CA 3KXAA 1RPEL 3KJXA 2IVBA 3ZHIA 2EBYA 3HZIB 2BNNA 2CSFA 3ZHMA 2PUGA 2L49A 3QF3A 4X4GA 3UFDA 3CECA 2PIJA 2LYPA 5A7LA 1OCTC 2GRMA 4IVZA 4J1XA 1YSEA 3HI2A 4NDWA 2AUWA 1ADRA 4X4EA 1DW9A 4F8DA 2IVQA 1ZUGA 1R69A 2IUOA 4YG7B 1ZS4A 1ZZBA 1RZSA 1UTXA 4Z5HA 3DNVB 1JWLA 2O4AA 4GHJA 3G5GA 4I6RA 2BJCA 3RZZA 2AW6A 2BNMA 4PU4C 2R1JL 1CQTA 1GT0C 1OSLA 3TRBA 1BDHA 4X4IA 3OQNA 4PU8A 4X4FA 2WUSR 1PRAA 1LQCA 4JQDA 1PNRA 1X57A 4PU3C 1X2LA 3BS3A 4X4HA 1B0NA 2PPXA 4X4BA 2R63A 3OQOA 1QP4A
chains in the Genus database with same CATH superfamily
4JI6T 2W2UA 3H3AA 1O4XA 4X1YE 2BBHA 2EF8A 1WFDA 4JBWF 3PU8A 4I50E 3HKCE 2ZM8A 3ONLC 3RYCE 3U3IA 2V8SV 4UR9A 2CXDA 2XQ7A 3KV5A 4IREA 4X4DA 4P0BA 5J2TE 2M6IA 3IA3A 3CX6B 2HN1A 3M65A 5LCYA 2J4GA 5KXJA 3SCGA 5LOVE 3AXJB 5TAOA 2VWAA 2IW5B 2LCVA 2W4XA 2CMRA 3LQXA 1XMQT 1LCDA 2XPKA 1I6ZA 1UXDA 5FXXA 2MXDA 1Y64B 2CM0A 3GMIA 3UU6A 4ADZA 4DIDB 4WVLA 4OBMA 3Q5XA 5H6QB 2PUDA 3N9MA 1XZYA 5AQUB 4ISTA 3NROA 4UXNB 2LSIA 4QX8B 3EVYA 2NW8A 2Q9QC 4JUYA 5ETWA 5A7LA 3RQUA 5HEJA 1SHZC 5FY0A 1ZUGA 3DNVB 5HXHA 4UF0B 3UU8A 5ABFB 5LGNB 4X1KE 3P4WA 1V9DA 1XWMA 5JTGA 4JEHB 2LKGA 2EHOD 2PXQA 2IAKA 1BR2A 3TLSA 2CPTA 3WAJA 2XQYA 1UGOA 2N9DA 5AFUL 5JRCA 1FIOA 3KZ3A 2WDQA 4MCXA 2X0LB 4A56A 3MXZA 3OYXA 4HKAA 2UXNB 2D2SA 2VKOA 3RH3A 2PXEA 1HCIA 2PXVA 4H9PC 5JDMA 5DRYA 3EUSA 2WDVA 1VPWA 2BVMA 5L4HA 1HNWT 5JVDE 1RZRD 5JDNA 4AKHA 2ICTA 3ZSSA 3I0OA 4H9QC 1ZVVA 3VKGA 4KHZF 2HH7A 3ZLIA 5M4YA 4LMLA 2D5UA 1JNRA 2E9XD 1JH9A 4OYKA 3QOWA 3UULA 1ZZ7A 3AE5A 1S94A 2N2NA 2MAWA 1OEDC 3C64A 4E7ZA 4GK5E 3Q9DA 4GOUA 3A8YC 4LF7T 1LKXA 3TLUA 3ETUA 4YTNA 1X9BA 4TNWA 2YU2A 3LK2B 5F8PA 3SFEA 4I0UA 5LHIB 4ZS3A 4F8DA 4EAHA 4IDNA 4JI5T 2ODVA 3FZFB 4EZHA 4UELA 3ZYKA 4HE8A 2JMKA 2HFZA 2I0MA 4OHFA 3O1JA 4WBNE 1X57A 4PJNA 3BS3A 4X4HA 3SX0A 4IDQA 2KZ7B 1VRBA 2MBGA 2WZIA 1R63A 2PTFA 5FL0A 3UT5E 3PUAA 4ILCA 3OMTA 2XAHB 3FMYA 4DV4T 3QNUA 4MFRA 2XCJA 4HRAA 2VK9A 2JRKA 3WAKA 5BMVE 3ZJ2A 1GQEA 1LRZA 3ZSTA 2PUAA 2BKNA 1FEWA 5CFBA 2ACZA 5JR9C 1MMNA 5L3DB 3AB3B 3RLFF 3FYAA 4V1Av 3RX6A 3PXPA 5L4EA 1E3OC 2D0UA 4EKGA 4AKLA 1ZPQA 3S4UA 5ADXL 4IA8A 2VQFT 4I43B 2NR4A 2H89A 4EGWA 2XUEA 2KZ8A 1RIOA 1WR6A 2BZBA 3OTOT 2OA5A 3QFIA 1OEDE 4QXCB 1NENA 2XJ3A 2LOPA 5CGMA 3V5SA 3QWGA 1HX8A 2LYLA 1OXZA 5GONE 2NP9A 3PUVF 3MJXA 4ZEYA 1NERA 3KV9A 3VU7H 3BQLA 1N33T 3LBXB 4MALA 4GYRA 4DR5T 3P8CD 1S35A 3HZIB 2BNNA 4DV0T 5AQHB 4H9NC 2LYPA 1OCTC 2KWIB 4ER7A 2FJDA 4J1XA 2QYWA 4PW8A 2XQ4A 5EK3A 2GK9A 2XQ8A 4Z5HA 4PK5A 3AAAB 4ER6A 2R1JL 4LF4T 3QOFA 4PJLA 4LF9T 3TRBA 3UUMA 3CIRA 1N32T 3OQNA 2MTQA 5JDQA 3TLTA 2W66A 1LVFA 2OFYA 4P1NA 2JQKA 4JI3T 1LCCA 3L09A 5E0OA 2UU9T 4Z5DA 3BQKA 4PFPA 5JDLA 2KWHA 5C2TA 3TELA 4CI1B 2PXBA 4GIWA 5IWAT 3AEFA 1UX4A 2KEJA 5LJNA 5GAGi 4BJMA 3FBLA 4CXXA 1DULA 4DBRA 3JXCL 1NEQA 3GN5A 4Z58A 1EZ3A 1YD8G 4DV3T 1BDIA 3FZLB 2BBJA 5HWYA 3ZN0B 2LM2A 1ZP0A 3EDVA 2EWTA 4UV8B 2XTLA 4IE5A 4HFVA 2FJRA 3ZMZB 2CBIA 2UXBT 2SPCA 2CEAA 2L3LA 1QZXA 3PDYA 1POUA 3RF1A 1HFAA 3R1FA 2Y48B 2C5IT 2KMFA 2BKPA 3K3OA 5JDFA 4JLEA 2CXFA 3MKDA 4JCYA 3HR0A 3E08A 5HXSA 1G8XA 4OX9T 3PE5A 1Z0PA 3ZMVB 4XBFB 5DJQC 5L3CB 5AQTB 1DW9A 2C5KT 3RZZA 5LMUT 2XQ5A 2R6GF 2JQ9A 2V7IA 2WUSR 2V5CA 3KV4A 2XQ6A 2DI4A 4ZI3D 3IHRA 1ZHCA 5CA1E 4LFCT 4NXNT 4GQMA 4FI5A 1MMDA 3LK42 2AWIA 5ABEA 2YINA 5AQPB 2YBDA 3SRZA 1ZZ8A 3JADA 3VR9A 5HXEA 2VQET 3HKEE 2KSRA 4YY3T 2L9QA 5HEHA 2KXPB 5J2UE 4PJJA 2BNOA 5DTQA 5LBQB 3AAIA 3ZYLA 1MIWA 3LFMA 4PAGA 3I1AA 2O38A 3TKLB 3K3QC 3PUXF 3QQ6A 2PE5A 3MEJA 5L3EB 2W62A 3ZC0A 2W63A 1BR4A 2LKHA 4YG1A 2PXKA 3J9X1 3F52A 5AQRB 3B57A 4IL9A 4HWHA 4B3RT 2AE9A 2PXTA 2K24A 2UUBT 2KNDA 2H88A 3JC6D 2NW9A 4JI1T 3NWIA 1NAFA 2JVLA 2D5VA 2BKOA 3G7DA 2JQQA 1PERL 1T8BA 4HFBA 2XQ9A 3RIAA 2LLYA 4QHOA 3VKHA 3NZLA 4HFCA 5A1LA 2C0SA 2E5LT 5LGUB 1OWAA 4PK4A 4QH1A 4WYVA 3R6NA 1RZSA 1ZV4X 1T72A 3NRYA 4JEUB 4U33A 2LSGA 3EUHA 3J7Yq 3NBXX 2CHOA 2LNMA 2OV9A 2CWOA 2PPXA 2YEVC 3JAFA 2X9WA 4DR1T 2X51A 1UURA 3Q5WA 4DUZT 2V7JA 1QLBA 2V6XA 5ABGA 4HWDA 4F6RC 2BG9E 3LISA 1QPZA 4H9RC 4YBAA 2KEIA 2J62A 3PJAA 4X1IE 3AA1B 1D1CA 4AQGA 4CN6A 4Z59A 2B1EA 4JI2T 3L8RA 4DR2T 2E9XC 3KDSE 2KLQA 2A9UA 1ZAYA 3TLWA 5DTRA 1J5WA 2CWYA 3SR4A 1MMAA 3FZHB 3F6WA 4J1WA 5GAHi 3X1DA 4UV9B 4EQZA 3LDQB 3ZJ1A 5LG4A 4JI7T 4AIUA 3P4RA 1WH8A 2WU2A 4Y42A 2PFVA 1G73A 3ABVA 4ERRA 3VHLA 2IIUA 4HFDA 3UUBA 2ZM6T 1QP7A 2YOEA 3RRWA 2YK0A 1IBLT 3AE6A 3KJXA 3RIFA 4KX6A 3V5UA 2L49A 3CECA 1IZNB 4GKJT 2GRMA 2MOZA 2FUPA 2QVAA 2WMNA 4NDWA 3UU4A 4ER5A 4PNIA 4X4EA 1E7PA 2IUOA 1SUMB 1ZS4A 1ZZBA 3F57A 2DLRA 4LF5T 1CQTA 1GT0C 1WR0A 3PUWF 4EEDA 5L2LA 4AXPA 3M9LA 4PU3C 4LFAT 2PBIA 2WM9A 3OQOA 2CLYC 5FYMA 1W0AA 1UUSA 1X79A 1XNQT 4I6TA 1BR0A 1PRVA 3SCHA 2LSYA 2N1GA 4ZI2D 4ZXLA 3NZPA 4ZHQE 4AI6A 2W61A 2VL8A 2FJBA 3HA4A 3A7MA 5IYZE 4IE0A 1LLIA 2B5AA 2ES0A 3NRXA 4DV5T 1IC8A 4ZI7E 2AXDS 3AAEB 1Z8UA 4YT0A 3G0TA 3AVRA 4EEBA 3ZC1A 2IDOB 2OLTA 4O2BE 3ZT6A 4ASKA 3L39A 4LF8T 3RI5A 2E8IA 4X5TA 2GRLA 1KFYA 3ONXA 3CLCA 4K0KT 4KBMB 5AQQB 2PXDA 1XDOA 2PXLA 2V3CC 3C51A 4CXYA 5LNKA 2LT3A 4QH5A 3QB5K 2PUCA 4IE4A 2L8NA 4JV5T 4DUYT 2PXPA 3SS1A 3FXDB 4EIWA 1J5ET 4FN3A 4TV9E 1EFAA 3RYIE 3IVPA 2I6HA 4TWDA 2BG9B 2Z6EA 2QRXA 4DR3T 1I94T 5FNVE 3HI2A 4PK6A 3P4PA 3EABA 4YG7B 2UXCT 1UTXA 3CVRA 4I6RA 3RRCA 4C90A 5LHHB 4YSXA 4M1PA 5AQGB 5LG3A 4U31A 4DE8A 1YKEB 4ZS2A 3CKDA 2CCQA 4I8TA 3ANWB 4DR7T 3OWQA 3T1YT 3RC3A 4LMJA 4X62T 1E1HB 1UK5A 5FY1A 2BS4A 2K9AA 5LMNT 2PUBA 3QOXA 3MK7C 2DCFA 3LSVA 1KNZA 1IBMT 5AQJB 1AU7A 3AE3A 4EB6E 3BD1A 1XWRA 4DR6T 2A6CA 1UXCA 3A9ZA 3ZCJA 1T98A 2CROA 5DQVA 3I0QA 4U2ZA 3KVAA 3LJCA 2FJAA 2XSDC 4QXHB 3ZMUB 3UFGA 3OKZA 3ZMSB 4U3CA 5AQMB 2PJQA 2V7KA 4WNKA 2WB5A 4QH4A 2LSJA 5H6RB 1FMWA 4IDZA 2H8RA 4U2YA 2LYRA 5FKYA 2XAQB 5F3JA 2CSFA 2EHOA 2NWBA 2XHEB 2FFHA 4G2AA 4P0AA 3N2GE 4ZI3C 2CRBA 2WMOA 3T1HT 4X66T 1KNPA 1D0ZA 4JI8T 5AQVB 2H7VC 2E2AA 4X4FA 2M67A 1LQCA 4O4LE 1YQ4A 3N9OA 3C50A 5F5WA 4Z90A 3GZCA 2X66A 5LJMA 2C5JA 4OFZA 3W15B 5DT2A 2WY2A 1RZRA 1HNZT 5L47A 3AE4A 3P50A 3GN5B 2E9XA 1M62A 4I4TE 4EV6A 4HWFA 2XSBA 5HXRA 2AXUA 4YJ2E 4PJMA 5L3GB 4DMWA 1DWKA 1HF0A 2ZMAA 5HYAA 3GA8A 2CE7A 2NTYA 1D0YA 4UVBB 1LVKA 5LA6E 2VKJA 2LOSA 2PG8A 5AQIB 3SOLA 5LGTB 2LYJA 4O4HE 2Q9QB 4HWCA 1W9RA 2W00A 3K8PC 2AXZA 4IL4A 5HXCA 3CQGB 4CN4A 3LBXA 4PFOA 3RKGA 2X9XA 3LFPA 4ER0A 3VRBA 3O9XA 4XAXB 3N9LA 3KL4A 3QUJA 3PURA 2KPJA 3AECA 3C4WA 4OK0A 2LYSA 3NDBB 2BVLA 3KVBA 3ZHMA 3AA6B 5CJ5A 2PIJA 4HFIA 5LB7B 1U5PA 3K1SA 4CI3B 1ZEEA 2XSAA 4TUYE 4X20E 4GHJA 3G5GA 3EI0A 4BA9A 2HCNA 1YXRA 3AEBA 4PU8A 2IC9A 2W0GA 4DR4T 3I9WA 1X2LA 2NW7A 2H7OA 2R63A 1NEKA 4I55E 4MCTA 4Q2JA 2Y8DA 3QK6A 3TFLA 4ER3A 1HG2A 3CWZB 2X9HA 2JCGA 3DM5A 1WLXA 3R09A 2ZLYA 2J47A 4DMVA 1IBKT 1QUUA 3PTRB 4AKIA 3RYHE 1JFTA 1Y01A 4HN9A 2J1DG 4DNDA 1R8IA 3PU3A 5DTMA 5IUXA 5IHYA 2V6YA 4IWRA 2V1DB 1UCUA 3RGLA 1OEDB 4AISA 4TWFA 2CHNA 4E7SA 1QP0A 3H5TA 5HWXA 3UTKA 5LXTE 1S7EA 2M6BA 2IHR1 1D1BA 4OB4A 2X0YA 1MIYA 4FBIA 3BDNA 4KI0F 3FYMA 4YJ3E 3U78A 3RIUA 1MFQC 1HNXT 5LHGB 2RP4A 3CPZA 4Z5CA 2WCAA 5HCMA 3OPCA 2A2FX 2X9YA 2KEKA 2WS3A 4GKKT 1D0XA 4AKGA 3NKZA 4X4CA 4JI0T 3OYZA 5AQOB 1HX1B 2FJEA 3H37A 1YW0A 1R69A 4O4IE 4LF6T 2BNMA 5C8YE 3KBUA 3AE2A 3ZKRA 3OJAA 1VCSA 4ZI2C 4TN7B 1WYBA 5DQWA 4YTMA 4X4BA 2V5DA 1MMGA 5JR9B 1WH6A 2DWGA 4IIJE 3JXBC 4H63H 4DV7T 3CROL 2G0UA 1ZZ9A 2PUFA 2EHOC 2XQ3A 3ZEFB 4YFSA 1AJ3A 3MACA 2CA5A 3OVUA 2LLVA 2MPKA 4KP3C 4U7YA 2KT9A 1HR0T 3AA0B 5LBMA 1Y9QA 1WCRA 3OKQA 3KV6A 5AQNB 4X64T 2XM1A 2WQYA 3A5XA 3PUZF 3UUXB 2UXXB 1B7TA 4ILBA 3C98B 3Q2MA 1PRUA 5HCJA 2LSKA 4WW0A 3PJAJ 3CQXC 3FB2A 2LYKA 3T8OA 5HEOA 4LFBT 3VR8A 4A5XA 5JQGE 4NPPA 4NXMT 3AEEA 1N34T 2IV1A 2H3RA 3C4ZA 1WIZA 4MLKA 5CB4E 2K3WA 2EBYA 2VVNA 4X4GA 1SA0E 2YU1A 3LG7A 2A72A 3MA9A 3RQWA 2D9DA 2HHHT 3FXEB 3Q5DA 5JREA 4YHJA 2AW6A 5DRTA 4NUVA 2I59A 2JQEA 1MNEA 4NUUA 2ZM2A 3CQCB 5HEUA 3AE8A 2X68A 2DHRA 4ZZBA 2V7MA 3KBTA 4P09A 5FXWA 4EZIA 3GZDA 2YDRA 3RYFE 1KNRA 4IT4A 2KINB 3TEPA 1QQAA 4C91A 5JRCB 1U2ZA 3L3PA 2VB6A 3BQIA 2XAJB 1CJGA 5ABHA 2O49A 2WDRA 4ISSA 1XNRT 1ZZ6A 4QKNA 2V26A 3B5MA 2YDSA 1L1MA 4ZZCA 3F51A 4ILUA 1CUNA 4DV1T 4NIQA 1NW3A 3CMLA 3EAMA 1Y7YA 2E5VA 2IU7A 3AXJA 1J1JA 2J7WA 3AEGA 1UX5A 2ODRD 2UXDT 4TV8E 4KUMB 1IJ6A 3ZPXA 2FBWA 2LEHA 1M7KA 3O4XE 3B7HA 3QB5A 3KXAA 3UFDA 2IC6A 2HCSA 3P4QA 3PUYF 5EK2A 4KMCA 4IDOA 3N2OA 2AUWA 4DE9A 2VVSA 2K5BB 3FHNA 3RIUC 3NXHA 3IF8B 3R84B 4EYYR 4HTEA 2XM2A 4UVCB 2YDQA 2YKSA 4MBQA 4X4IA 4GK0E 4DBQA 1QP4A 4FJOA 3PV0F 4UF0A 3AE9A 1WRDA 5ABFA 3C4XA 2PUEA 4TX5A 4UIGA 3BK9A 2QA7A 2UUAT 3O1HA 3ZT7A 2VKDA 5L3FB 3U3WA 4HGAA 2IVGA 1H7CA 4N78D 3S8QA 2VL0A 2Y6XA 4YXDA 2LHNA 4DV2T 3P4SA 2K48A 5JUWA 3AEDA 2VEOA 3QYXA 2XAFB 4CZZB 5FVLA 4L9IA 3QC9A 3CX8B 4YARA 2LRKA 2ZM0A 4O8SA 2HSGA 4WBOA 2JPFA 4G63A 3EHZA 3UQ4A 4TNVA 4AQFA 4QXBB 4L5GA 4PU7A 1D1AA 4OYJA 2LHRA 2X67A 2EHOB 2BG9A 3FZMB 3MZKB 3OP9A 4AKRB 4K0UA 4YSYA 2IVBA 3DP7A 2XXQA 3QF3A 2HN2A 2VASA 1YSEA 4GYSA 3PE0A 2IMLA 3F2EA 3GWHA 1JWLA 5JDHA 4B3TT 4WZXA 2JIWA 2X0HA 3N5LA 4IDPA 2Q9QD 2WU5A 1HF8A 3DJBA 2YN6A 5LYJE 3UU3A 3A9YA 4JQDA 1PRAA 4CI2B 3ANWA 4O2AE 2XXPA 4QWNB 3DTOA 2MYSA 2VKHA 2LRLA 5J0ZA 3PUGA 2E9XB 4JI4T 3HKDE 2NTXA 1JNZA 3A9XA 4JCXA 2XIUA 4XZCA 2PXUA 3OBVE 2WAUA 3KINB 2BS2A 4ZOLE 5AQSB 4H9SE 4F8HA 5DABA 4HFEA 5FVKA 2WP9A 4B3ST 3D1NI 4O8BA 3HKBE 1FJGT 3KFWX 3RHWA 4I6UA 4A98A 4Z8XA 3GZDC 2WBLA 1WETA 5CA0E 2ICPA 4H63V 4ANJA 2AXVA 3HL6A 3RC8A 1VCTA 2L1PA 3OQMA 4TWHA 1ZZCA 2JQHA 3GUUA 4YLHA 5K98B 4IGUA 4DVDA 2LJLA 2ODUA 4EOZB 1XMOT 3JC6C 5JH7E 3UFEA 2XAGB 3K3NA 4IE6A 2CLYB 1MNDA 2CBJA 5EZYE 2WWUA 4IVZA 5FXVA 3EDUA 5BR8T 1QSDA 2IVQA 3B13A 2O4AA 1CHUA 3SFDA 4EXTA 1E2AA 1OSLA 2WWVA 4EK9A 2DNXA 1BDHA 1XDPA 4COFA 4UEMA 1PNRA 3ME5A 3Q5EA 4YSZA 3CX7B 4IE7A 3MLFA 5FXZA 1BR1A 4U74A 3ETVA 2LM9A 3L1PA 2HPLA 2V6YB 2XXAA 3N2KE 4O4JE 2XY8B 2BS3A 1US7B 1O3XA 2XJ7A 2D0TA 4TZ4C 4CN1A 2WSSV 4QX7B 2IUBA 3VK0A 3D0TA 3ZKCA 1VOMA 3E0ZA 5KMGP 2Q9QA 2WIUB 1YKHB 1KK7A 3FZKB 4U72A 5FMNA 4AQYT 3N9NA 1WYCA 2QGSA 1L0VA 3PUQA 2MQKA 1W0BA 5HEGA 2ACXA 4UVAB 4U7IA 1LMB3 1HQ1A 3JCFA 4KHPT 2VURA 4B3MT 3N9QA 2LLWA 3AE7A 1W09A 2GZUA 1QQBA 3ZHIA 4IHJE 2XASB 3G06A 2PUGA 1YQ3A 2RA1A 4X65T 2A3DA 4J2CA 3CK6A 2J7UA 3M3ZB 5J1GA 2DL1A 1KF6A 3UWPA 3ZT5A 2M4HA 3E22E 4AQFC 3ZN1B 1N36T 2JMHA 5FY7A 2BG9C 3IBPA 4BJNA 4EYUA 5AQKB 5KX5E 1B0NA 1FMVA 2DWKA 2MEZA 4YG4A 2BDEA 2W67A 5L3BB 3UQ7A 1JFSA 5JDGA 3O1IA 1T7SA 3JAEA 4DO0A 4EZ4A 4CQIA 4L0RA 4CXWA 1OEDA 2OR1L 1HTJF 2CXLA 3ESLA 4BAYB 3UUNA 5DSXA 1IJ5A 1MIVA 3GBFA 4YHHT 3H3MA 4DV6T 4MHCA 3N9PA 3PUSA 4H9OC 4HEAA 3ZYMA 2XZEA 3RPUA 4B6XA 2NOXA 4YTPA 2HINA 1SE7A 3AEAA 5AQFB 3AA7B 2LYQA 1HG5A 2F4VT 3ZMTB 5C3JA 3VRAA 3ZCIA 3NZQA 1U4QA 5FP3A 3FBZA 1SQ8A 1ZOYA 4EKIA 1ZKEA 1KEYA 1DU2A 3WI3A 1NWMX 3SCFA 3ZPOA 2WZHA 3LK3B 4JYAT 3UU5A 4ILAA 3IEEA 4HWIB 2LE8A 3TLVA 3JXDL 2RPAA 3NVOA 5FL1A 2XI8A 1RPEL 2XQAA 2B76A 3I9YA 4A97A 3AE1A 3SWHA 4LMKA 2HPJA 4Z91A 2L8KA 3P7IA 2P9BA 1ADRA 3F31A 4HFHA 2BJCA 4PU4C 5JR9A 5HAXA 2V7LA 1HS7A 3AVSA 1QB2A 5AQLB 3VWSA 3ONJA 5KDMC 3RKOA 2PXFA 5LP6E 2JJ9A 2UUCT 1IAPA 4Q25A 5EK4A
chains in the Genus database with same CATH topology
4UF0A 3N9OA 3C50A 4GQMA 1WRDA 4FI5A 3H3AA 1MMDA 1O4XA 3LK42 2X66A 4X1YE 3C4XA 5LJMA 2C5JA 4OFZA 2EF8A 2AWIA 2PUEA 3W15B 2YINA 1RZRA 3PU8A 4TX5A 3SRZA 4UIGA 3BK9A 2QA7A 1ZZ8A 3O1HA 2VKDA 3GN5B 5HXEA 4I50E 5L3FB 2E9XA 3HKEE 3U3WA 4HGAA 3HKCE 2IVGA 1H7CA 2ZM8A 4I4TE 3RYCE 4N78D 2L9QA 3U3IA 5HXRA 3S8QA 2KXPB 5J2UE 2AXUA 2CXDA 2Y6XA 3KV5A 4PJJA 2LHNA 4YJ2E 4X4DA 2BNOA 4P0BA 4PJMA 5LBQB 3AAIA 5J2TE 3ZYLA 2K48A 5L3GB 3CX6B 4DMWA 1MIWA 1DWKA 3LFMA 3M65A 4PAGA 3I1AA 2O38A 1HF0A 5LCYA 2ZMAA 3TKLB 3K3QC 3QQ6A 2PE5A 3QYXA 2XAFB 4CZZB 5HYAA 5L3EB 3SCGA 3GA8A 4L9IA 2W62A 2CE7A 3QC9A 5LOVE 2NTYA 3CX8B 3ZC0A 1D0YA 4UVBB 4YARA 1LVKA 2W63A 2ZM0A 5LA6E 5TAOA 1BR4A 2VWAA 2IW5B 2LCVA 4YG1A 4O8SA 3J9X1 2CMRA 2LOSA 2PG8A 3F52A 2VKJA 3SOLA 2LYJA 5LGTB 4O4HE 2HSGA 2Q9QB 1LCDA 4WBOA 2JPFA 3B57A 1UXDA 4G63A 2W00A 3K8PC 5FXXA 2AXZA 2K24A 1Y64B 2CM0A 5HXCA 3CQGB 2KNDA 3LBXA 4QXBB 4AQFA 3GMIA 4L5GA 4PFOA 4PU7A 1D1AA 4ADZA 3JC6D 4OYJA 2X9XA 2NW9A 3LFPA 2LHRA 2EHOB 2X67A 3O9XA 1NAFA 3Q5XA 2JVLA 4XAXB 3N9LA 3QUJA 2D5VA 2PUDA 3N9MA 5H6QB 3MZKB 3G7DA 2JQQA 1PERL 3OP9A 2KPJA 3C4WA 3PURA 4ISTA 4OK0A 4AKRB 2LYSA 4K0UA 2BVLA 4UXNB 2LSIA 3KVBA 4QX8B 2IVBA 3ZHMA 3EVYA 3AA6B 2NW8A 3DP7A 4QHOA 3QF3A 2Q9QC 4JUYA 5ETWA 3VKHA 2PIJA 5A7LA 5A1LA 2C0SA 1U5PA 4CI3B 1ZEEA 5LGUB 1OWAA 2VASA 1YSEA 4GYSA 4PK4A 1SHZC 5FY0A 4TUYE 3R6NA 1ZUGA 3PE0A 3F2EA 1RZSA 3DNVB 1ZV4X 3GWHA 1JWLA 4X20E 4GHJA 5HXHA 5JDHA 3G5GA 4UF0B 3NRYA 4JEUB 4BA9A 3N5LA 2Q9QD 2LSGA 1HF8A 3EUHA 3J7Yq 3DJBA 5LGNB 3NBXX 5LYJE 4X1KE 4PU8A 4JQDA 1PRAA 2IC9A 2W0GA 4CI2B 3ANWA 1V9DA 1X2LA 2CWOA 3DTOA 3I9WA 4O2AE 2NW7A 4QWNB 2H7OA 2MYSA 2VKHA 2PPXA 2YEVC 2R63A 4JEHB 2X9WA 2EHOD 4I55E 3PUGA 2E9XB 4MCTA 2X51A 2IAKA 1BR2A 3Q5WA 3HKDE 2Y8DA 3QK6A 3WAJA 2XQYA 2V7JA 1HG2A 3CWZB 2NTXA 2JCGA 2X9HA 1WLXA 4JCXA 2N9DA 2ZLYA 2XIUA 4DMVA 5AFUL 4F6RC 5JRCA 4XZCA 3LISA 1FIOA 1QUUA 3KZ3A 3PTRB 1QPZA 4H9RC 4YBAA 2KEIA 4AKIA 3RYHE 3OBVE 4X1IE 3AA1B 4MCXA 1JFTA 2WAUA 2X0LB 1D1CA 4A56A 4AQGA 3MXZA 3KINB 3OYXA 4HKAA 2UXNB 2D2SA 4Z59A 2B1EA 4HN9A 2J1DG 4DNDA 2VKOA 3RH3A 3PU3A 1HCIA 4H9PC 4ZOLE 5JDMA 5IHYA 2E9XC 4IWRA 3KDSE 3EUSA 2KLQA 2V1DB 4H9SE 1UCUA 5DABA 3D1NI 1ZAYA 1VPWA 4O8BA 2BVMA 3HKBE 5JVDE 4E7SA 1QP0A 3H5TA 2CWYA 1MMAA 1RZRD 5HWXA 5JDNA 2ICTA 3UTKA 3I0OA 4AKHA 4H9QC 5LXTE 1S7EA 1ZVVA 3F6WA 3VKGA 4J1WA 3KFWX 1D1BA 4OB4A 2HH7A 4UV9B 2D5UA 1MIYA 3ZLIA 4I6UA 4FBIA 4OYKA 2E9XD 3BDNA 1JH9A 4Z8XA 3UULA 3ZJ1A 5LG4A 1ZZ7A 3FYMA 4YJ3E 3U78A 1S94A 2WBLA 1WETA 5LHGB 5CA0E 2RP4A 2ICPA 1WH8A 3CPZA 4H63V 4ANJA 2N2NA 2AXVA 3HL6A 3C64A 4E7ZA 4GK5E 4Z5CA 3RC8A 3Q9DA 4Y42A 4GOUA 3OQMA 1ZZCA 1G73A 2PFVA 4YLHA 4ERRA 5K98B 1LKXA 4IGUA 4DVDA 2LJLA 3ETUA 2ODUA 2A2FX 4EOZB 2YU2A 3JC6C 2X9YA 5JH7E 2KEKA 3VHLA 3LK2B 3UFEA 1D0XA 4AKGA 1QP7A 4X4CA 2YK0A 3RRWA 2XAGB 3KJXA 3K3NA 3OYZA 3V5UA 4IE6A 5F8PA 2L49A 3CECA 1IZNB 2CLYB 1MNDA 2GRMA 5EZYE 2MOZA 2WWUA 3H37A 4IVZA 5LHIB 2WMNA 4NDWA 5FXVA 3EDUA 4ZS3A 1QSDA 4PNIA 4X4EA 1YW0A 4F8DA 2IVQA 1R69A 2IUOA 4EAHA 4O4IE 3B13A 1ZS4A 1ZZBA 2O4AA 3F57A 2DLRA 2ODVA 4EZHA 4UELA 2BNMA 3ZYKA 1CQTA 4HE8A 2JMKA 4EXTA 5C8YE 1GT0C 3KBUA 1OSLA 4OHFA 3OJAA 2DNXA 5L2LA 1BDHA 3O1JA 4AXPA 4ZI2C 4UEMA 4TN7B 1PNRA 1X57A 1WYBA 4PJNA 4PU3C 5DQWA 4WBNE 3BS3A 4X4HA 2PBIA 2WM9A 4X4BA 3OQOA 1MMGA 2KZ7B 5JR9B 1VRBA 2CLYC 5FYMA 2MBGA 1X79A 1R63A 1WH6A 3CX7B 4IE7A 2DWGA 4IIJE 4I6TA 3MLFA 1BR0A 1PRVA 3SCHA 3JXBC 5FXZA 1BR1A 4H63H 4U74A 3UT5E 3PUAA 3CROL 3ETVA 2G0UA 2LSYA 2LM9A 1ZZ9A 2N1GA 2PUFA 3OMTA 2EHOC 2XAHB 3FMYA 3L1PA 4ZI2D 3ZEFB 3NZPA 2HPLA 4MFRA 2XCJA 2VK9A 2JRKA 4YFSA 3WAKA 5BMVE 4ZHQE 4AI6A 2W61A 3ZJ2A 1AJ3A 2VL8A 3N2KE 4O4JE 1LRZA 3HA4A 5IYZE 2PUAA 4IE0A 1FEWA 1US7B 1LLIA 2B5AA 2CA5A 3MACA 2ES0A 1O3XA 5JR9C 3NRXA 4KP3C 1MMNA 5L3DB 2D0TA 3AB3B 2KT9A 3AA0B 3FYAA 1IC8A 4ZI7E 4V1Av 4TZ4C 5LBMA 3AAEB 1Y9QA 2WSSV 3RX6A 3PXPA 1E3OC 4QX7B 3VK0A 2D0UA 3OKQA 3KV6A 4AKLA 1ZPQA 3D0TA 3ZKCA 4IA8A 3S4UA 1VOMA 4I43B 5ADXL 3A5XA 3AVRA 3E0ZA 3ZC1A 3UUXB 2UXXB 2Q9QA 1B7TA 2WIUB 1YKHB 4O2BE 5KMGP 3C98B 1KK7A 4ASKA 3Q2MA 1PRUA 2XUEA 2KZ8A 2E8IA 2LSKA 1RIOA 1WR6A 2GRLA 2BZBA 4U72A 4WW0A 3ONXA 3CLCA 5FMNA 2OA5A 3N9NA 4KBMB 1WYCA 2QGSA 3PUQA 2MQKA 3CQXC 4QXCB 2XJ3A 2LOPA 2ACXA 3V5SA 3FB2A 3QWGA 2LYKA 3T8OA 4UVAB 1HX8A 2LYLA 1OXZA 3C51A 5LNKA 2LT3A 4CXYA 5GONE 2NP9A 2PUCA 4IE4A 2L8NA 3MJXA 1LMB3 3SS1A 1NERA 3KV9A 3FXDB 3VU7H 4EIWA 5JQGE 3N9QA 3BQLA 4FN3A 2IV1A 4TV9E 2H3RA 3C4ZA 1WIZA 3LBXB 2GZUA 4MALA 1EFAA 4MLKA 5CB4E 4GYRA 3RYIE 3IVPA 1QQBA 3P8CD 1S35A 3WI3A 3ZHIA 2EBYA 3HZIB 2BNNA 2XASB 2Z6EA 4IHJE 2PUGA 4X4GA 1SA0E 4H9NC 2LYPA 1OCTC 2KWIB 2YU1A 2RA1A 3LG7A 2A72A 3MA9A 5FNVE 2A3DA 4J1XA 3HI2A 4J2CA 4PK6A 4PW8A 3FXEB 5J1GA 5EK3A 5JREA 4YHJA 4YG7B 2GK9A 1UTXA 4Z5HA 3CVRA 4PK5A 4I6RA 3AAAB 3RRCA 4C90A 5LHHB 2AW6A 2R1JL 4NUVA 2I59A 3E22E 4M1PA 1MNEA 3TRBA 4PJLA 3UUMA 4NUUA 2ZM2A 3CQCB 3ZN1B 4AQFC 2JMHA 3OQNA 2X68A 2MTQA 5FY7A 2DHRA 5JDQA 3IBPA 4BJNA 2V7MA 4EYUA 5KX5E 1B0NA 1YKEB 4ZS2A 3CKDA 1FMVA 3KBTA 1LVFA 2OFYA 2DWKA 2CCQA 2MEZA 4P09A 5FXWA 4I8TA 3ANWB 1LCCA 3L09A 4YG4A 2BDEA 5E0OA 5L3BB 1JFSA 5JDGA 4Z5DA 3BQKA 3O1IA 3RC3A 4DO0A 4EZ4A 3RYFE 1E1HB 4CQIA 4PFPA 5FY1A 5JDLA 2KWHA 2KINB 2K9AA 1QQAA 4L0RA 4CXWA 4CI1B 4GIWA 2OR1L 2PUBA 4C91A 1UX4A 1HTJF 2CXLA 2KEJA 3ESLA 5LJNA 4BAYB 5JRCB 3MK7C 3UUNA 3L3PA 2DCFA 4BJMA 1IJ5A 2VB6A 1MIVA 3GBFA 3BQIA 2XAJB 3FBLA 4MHCA 4CXXA 1CJGA 1KNZA 4DBRA 3JXCL 3N9PA 3PUSA 4H9OC 4HEAA 1AU7A 1NEQA 3GN5A 3ZYMA 4EB6E 2O49A 3BD1A 3RPUA 1XWRA 4B6XA 4Z58A 2A6CA 2NOXA 1UXCA 2HINA 1EZ3A 1YD8G 3ZCJA 4ISSA 1BDIA 1ZZ6A 4QKNA 5HWYA 2V26A 3ZN0B 1L1MA 1T98A 3F51A 2CROA 3EDVA 2EWTA 2LYQA 1HG5A 2XTLA 3AA7B 4IE5A 4UV8B 4ILUA 5DQVA 3ZMTB 3I0QA 4HFVA 3ZCIA 1CUNA 2FJRA 3ZMZB 3KVAA 3LJCA 3NZQA 1U4QA 5FP3A 3FBZA 1SQ8A 2XSDC 3CMLA 4QXHB 3ZMUB 2SPCA 2CEAA 2L3LA 3ZMSB 1Y7YA 1ZKEA 2IU7A 1NWMX 2PJQA 1POUA 2V7KA 3PDYA 3SCFA 1HFAA 3R1FA 2Y48B 4WNKA 2C5IT 3ZPOA 3LK3B 2KMFA 1UX5A 3K3OA 2LSJA 3IEEA 5H6RB 5JDFA 1FMWA 4TV8E 4JLEA 2CXFA 2LE8A 4KUMB 1IJ6A 4IDZA 2H8RA 5M4YA 2LEHA 3JXDL 3MKDA 2LYRA 4JCYA 3O4XE 2XI8A 3B7HA 1RPEL 3KXAA 2XAQB 3HR0A 5F3JA 3I9YA 2CSFA 3E08A 5HXSA 2EHOA 3UFDA 1G8XA 3SWHA 2IC6A 2NWBA 5EK2A 2HPJA 1Z0PA 3ZMVB 2XHEB 4XBFB 2L8KA 5DJQC 4G2AA 3P7IA 4P0AA 4KMCA 5L3CB 2P9BA 3N2OA 2AUWA 1ADRA 3N2GE 2K5BB 1DW9A 3FHNA 4ZI3C 2WMOA 3F31A 2BJCA 1D0ZA 3RZZA 2C5KT 3IF8B 4PU4C 5JR9A 3R84B 5HAXA 2H7VC 4EYYR 2V7LA 4HTEA 4UVCB 2V7IA 1HS7A 3AVSA 4X4IA 4MBQA 4X4FA 2WUSR 1LQCA 2M67A 3KV4A 4GK0E 4O4LE 5KDMC 3RKOA 2DI4A 4ZI3D 3IHRA 1ZHCA 4DBQA 2JJ9A 5CA1E 1QP4A 1IAPA 4FJOA 5LP6E 5EK4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R63 A;  1WH6 A;  4MCT A;  4GQM A;  4I6T A;  3MLF A;  1PRV A;  2OFY A;  3SCH A;  3JXB C;  2MEZ A;  4I8T A;  1LCC A;  1O4X A;  4YG4 A;  3CRO L;  1JFS A;  1ZZ9 A;  2JCG A;  3OMT A;  2EF8 A;  2AWI A;  4Z5D A;  2PUF A;  3FMY A;  3L1P A;  2PUE A;  4JCX A;  1RZR A;  2XIU A;  2XCJ A;  3LIS A;  1ZZ8 A;  3KZ3 A;  1QPZ A;  4YBA A;  2KEI A;  3GN5 B;  1QQA A;  4MCX A;  3U3W A;  1JFT A;  2PUA A;  2IVG A;  2OR1 L;  2PUB A;  1LLI A;  2B5A A;  4Z59 A;  2KEJ A;  3S8Q A;  2AXU A;  4X4D A;  2BNO A;  3FYA A;  3GBF A;  1IC8 A;  1Y9Q A;  1CJG A;  3EUS A;  3PXP A;  4IWR A;  1E3O C;  3JXC L;  3VK0 A;  1DWK A;  1AU7 A;  1NEQ A;  2O38 A;  3GN5 A;  3D1N I;  1HF0 A;  1VPW A;  1ZPQ A;  1ZAY A;  4O8B A;  4IA8 A;  3QQ6 A;  3BD1 A;  3ZKC A;  1XWR A;  2PE5 A;  3QYX A;  4Z58 A;  2A6C A;  1UXC A;  2HIN A;  2WIU B;  3H5T A;  1QP0 A;  3SCG A;  3GA8 A;  1RZR D;  1BDI A;  2ICT A;  1PRU A;  1ZZ6 A;  1S7E A;  4YAR A;  2KZ8 A;  3F6W A;  1ZVV A;  4J1W A;  1L1M A;  1RIO A;  2GRL A;  3F51 A;  4OB4 A;  2CRO A;  3CLC A;  2EWT A;  2LCV A;  2LYQ A;  4I6U A;  4FBI A;  4YG1 A;  3BDN A;  1JH9 A;  2O49 A;  3F52 A;  2FJR A;  2LYJ A;  2MQK A;  2HSG A;  1ZZ7 A;  3FYM A;  1LCD A;  2XJ3 A;  1SQ8 A;  1UXD A;  2XSD C;  2AXZ A;  3QWG A;  2LYK A;  1Y7Y A;  1WET A;  2LYL A;  2ICP A;  1WH8 A;  2IU7 A;  4PU7 A;  1POU A;  3SCF A;  2AXV A;  3R1F A;  3LFP A;  2PUC A;  2L8N A;  4Z5C A;  3O9X A;  1LMB 3;  4Y42 A;  2JVL A;  3OQM A;  1NER A;  1ZZC A;  2D5V A;  2PUD A;  5K98 B;  3G7D A;  4FN3 A;  1PER L;  2IV1 A;  2KPJ A;  3OP9 A;  1WIZ A;  2GZU A;  2LYS A;  1EFA A;  2KEK A;  2H8R A;  3IVP A;  3JXD L;  2LYR A;  4JCY A;  1QP7 A;  1QQB A;  2XI8 A;  3B7H A;  4X4C A;  3KXA A;  1RPE L;  3KJX A;  2IVB A;  3ZHI A;  2EBY A;  3HZI B;  2BNN A;  2CSF A;  3ZHM A;  2PUG A;  2L49 A;  3QF3 A;  4X4G A;  3UFD A;  3CEC A;  2PIJ A;  2LYP A;  5A7L A;  1OCT C;  2GRM A;  4IVZ A;  4J1X A;  1YSE A;  3HI2 A;  4NDW A;  2AUW A;  1ADR A;  4X4E A;  1DW9 A;  4F8D A;  2IVQ A;  1ZUG A;  1R69 A;  2IUO A;  4YG7 B;  1ZS4 A;  1ZZB A;  1RZS A;  1UTX A;  4Z5H A;  3DNV B;  1JWL A;  2O4A A;  4GHJ A;  3G5G A;  4I6R A;  2BJC A;  3RZZ A;  2AW6 A;  2BNM A;  4PU4 C;  2R1J L;  1CQT A;  1GT0 C;  1OSL A;  3TRB A;  1BDH A;  4X4I A;  3OQN A;  4PU8 A;  4X4F A;  2WUS R;  1PRA A;  1LQC A;  4JQD A;  1PNR A;  1X57 A;  4PU3 C;  1X2L A;  3BS3 A;  4X4H A;  1B0N A;  2PPX A;  4X4B A;  2R63 A;  3OQO A;  1QP4 A; 
#chains in the Genus database with same CATH topology
 4JI6 T;  2W2U A;  3H3A A;  1O4X A;  4X1Y E;  2BBH A;  2EF8 A;  1WFD A;  4JBW F;  3PU8 A;  4I50 E;  3HKC E;  2ZM8 A;  3ONL C;  3RYC E;  3U3I A;  2V8S V;  4UR9 A;  2CXD A;  2XQ7 A;  3KV5 A;  4IRE A;  4X4D A;  4P0B A;  5J2T E;  2M6I A;  3IA3 A;  3CX6 B;  2HN1 A;  3M65 A;  5LCY A;  2J4G A;  5KXJ A;  3SCG A;  5LOV E;  3AXJ B;  5TAO A;  2VWA A;  2IW5 B;  2LCV A;  2W4X A;  2CMR A;  3LQX A;  1XMQ T;  1LCD A;  2XPK A;  1I6Z A;  1UXD A;  5FXX A;  2MXD A;  1Y64 B;  2CM0 A;  3GMI A;  3UU6 A;  4ADZ A;  4DID B;  4WVL A;  4OBM A;  3Q5X A;  5H6Q B;  2PUD A;  3N9M A;  1XZY A;  5AQU B;  4IST A;  3NRO A;  4UXN B;  2LSI A;  4QX8 B;  3EVY A;  2NW8 A;  2Q9Q C;  4JUY A;  5ETW A;  5A7L A;  3RQU A;  5HEJ A;  1SHZ C;  5FY0 A;  1ZUG A;  3DNV B;  5HXH A;  4UF0 B;  3UU8 A;  5ABF B;  5LGN B;  4X1K E;  3P4W A;  1V9D A;  1XWM A;  5JTG A;  4JEH B;  2LKG A;  2EHO D;  2PXQ A;  2IAK A;  1BR2 A;  3TLS A;  2CPT A;  3WAJ A;  2XQY A;  1UGO A;  2N9D A;  5AFU L;  5JRC A;  1FIO A;  3KZ3 A;  2WDQ A;  4MCX A;  2X0L B;  4A56 A;  3MXZ A;  3OYX A;  4HKA A;  2UXN B;  2D2S A;  2VKO A;  3RH3 A;  2PXE A;  1HCI A;  2PXV A;  4H9P C;  5JDM A;  5DRY A;  3EUS A;  2WDV A;  1VPW A;  2BVM A;  5L4H A;  1HNW T;  5JVD E;  1RZR D;  5JDN A;  4AKH A;  2ICT A;  3ZSS A;  3I0O A;  4H9Q C;  1ZVV A;  3VKG A;  4KHZ F;  2HH7 A;  3ZLI A;  5M4Y A;  4LML A;  2D5U A;  1JNR A;  2E9X D;  1JH9 A;  4OYK A;  3QOW A;  3UUL A;  1ZZ7 A;  3AE5 A;  1S94 A;  2N2N A;  2MAW A;  1OED C;  3C64 A;  4E7Z A;  4GK5 E;  3Q9D A;  4GOU A;  3A8Y C;  4LF7 T;  1LKX A;  3TLU A;  3ETU A;  4YTN A;  1X9B A;  4TNW A;  2YU2 A;  3LK2 B;  5F8P A;  3SFE A;  4I0U A;  5LHI B;  4ZS3 A;  4F8D A;  4EAH A;  4IDN A;  4JI5 T;  2ODV A;  3FZF B;  4EZH A;  4UEL A;  3ZYK A;  4HE8 A;  2JMK A;  2HFZ A;  2I0M A;  4OHF A;  3O1J A;  4WBN E;  1X57 A;  4PJN A;  3BS3 A;  4X4H A;  3SX0 A;  4IDQ A;  2KZ7 B;  1VRB A;  2MBG A;  2WZI A;  1R63 A;  2PTF A;  5FL0 A;  3UT5 E;  3PUA A;  4ILC A;  3OMT A;  2XAH B;  3FMY A;  4DV4 T;  3QNU A;  4MFR A;  2XCJ A;  4HRA A;  2VK9 A;  2JRK A;  3WAK A;  5BMV E;  3ZJ2 A;  1GQE A;  1LRZ A;  3ZST A;  2PUA A;  2BKN A;  1FEW A;  5CFB A;  2ACZ A;  5JR9 C;  1MMN A;  5L3D B;  3AB3 B;  3RLF F;  3FYA A;  4V1A v;  3RX6 A;  3PXP A;  5L4E A;  1E3O C;  2D0U A;  4EKG A;  4AKL A;  1ZPQ A;  3S4U A;  5ADX L;  4IA8 A;  2VQF T;  4I43 B;  2NR4 A;  2H89 A;  4EGW A;  2XUE A;  2KZ8 A;  1RIO A;  1WR6 A;  2BZB A;  3OTO T;  2OA5 A;  3QFI A;  1OED E;  4QXC B;  1NEN A;  2XJ3 A;  2LOP A;  5CGM A;  3V5S A;  3QWG A;  1HX8 A;  2LYL A;  1OXZ A;  5GON E;  2NP9 A;  3PUV F;  3MJX A;  4ZEY A;  1NER A;  3KV9 A;  3VU7 H;  3BQL A;  1N33 T;  3LBX B;  4MAL A;  4GYR A;  4DR5 T;  3P8C D;  1S35 A;  3HZI B;  2BNN A;  4DV0 T;  5AQH B;  4H9N C;  2LYP A;  1OCT C;  2KWI B;  4ER7 A;  2FJD A;  4J1X A;  2QYW A;  4PW8 A;  2XQ4 A;  5EK3 A;  2GK9 A;  2XQ8 A;  4Z5H A;  4PK5 A;  3AAA B;  4ER6 A;  2R1J L;  4LF4 T;  3QOF A;  4PJL A;  4LF9 T;  3TRB A;  3UUM A;  3CIR A;  1N32 T;  3OQN A;  2MTQ A;  5JDQ A;  3TLT A;  2W66 A;  1LVF A;  2OFY A;  4P1N A;  2JQK A;  4JI3 T;  1LCC A;  3L09 A;  5E0O A;  2UU9 T;  4Z5D A;  3BQK A;  4PFP A;  5JDL A;  2KWH A;  5C2T A;  3TEL A;  4CI1 B;  2PXB A;  4GIW A;  5IWA T;  3AEF A;  1UX4 A;  2KEJ A;  5LJN A;  5GAG i;  4BJM A;  3FBL A;  4CXX A;  1DUL A;  4DBR A;  3JXC L;  1NEQ A;  3GN5 A;  4Z58 A;  1EZ3 A;  1YD8 G;  4DV3 T;  1BDI A;  3FZL B;  2BBJ A;  5HWY A;  3ZN0 B;  2LM2 A;  1ZP0 A;  3EDV A;  2EWT A;  4UV8 B;  2XTL A;  4IE5 A;  4HFV A;  2FJR A;  3ZMZ B;  2CBI A;  2UXB T;  2SPC A;  2CEA A;  2L3L A;  1QZX A;  3PDY A;  1POU A;  3RF1 A;  1HFA A;  3R1F A;  2Y48 B;  2C5I T;  2KMF A;  2BKP A;  3K3O A;  5JDF A;  4JLE A;  2CXF A;  3MKD A;  4JCY A;  3HR0 A;  3E08 A;  5HXS A;  1G8X A;  4OX9 T;  3PE5 A;  1Z0P A;  3ZMV B;  4XBF B;  5DJQ C;  5L3C B;  5AQT B;  1DW9 A;  2C5K T;  3RZZ A;  5LMU T;  2XQ5 A;  2R6G F;  2JQ9 A;  2V7I A;  2WUS R;  2V5C A;  3KV4 A;  2XQ6 A;  2DI4 A;  4ZI3 D;  3IHR A;  1ZHC A;  5CA1 E;  4LFC T;  4NXN T;  4GQM A;  4FI5 A;  1MMD A;  3LK4 2;  2AWI A;  5ABE A;  2YIN A;  5AQP B;  2YBD A;  3SRZ A;  1ZZ8 A;  3JAD A;  3VR9 A;  5HXE A;  2VQE T;  3HKE E;  2KSR A;  4YY3 T;  2L9Q A;  5HEH A;  2KXP B;  5J2U E;  4PJJ A;  2BNO A;  5DTQ A;  5LBQ B;  3AAI A;  3ZYL A;  1MIW A;  3LFM A;  4PAG A;  3I1A A;  2O38 A;  3TKL B;  3K3Q C;  3PUX F;  3QQ6 A;  2PE5 A;  3MEJ A;  5L3E B;  2W62 A;  3ZC0 A;  2W63 A;  1BR4 A;  2LKH A;  4YG1 A;  2PXK A;  3J9X 1;  3F52 A;  5AQR B;  3B57 A;  4IL9 A;  4HWH A;  4B3R T;  2AE9 A;  2PXT A;  2K24 A;  2UUB T;  2KND A;  2H88 A;  3JC6 D;  2NW9 A;  4JI1 T;  3NWI A;  1NAF A;  2JVL A;  2D5V A;  2BKO A;  3G7D A;  2JQQ A;  1PER L;  1T8B A;  4HFB A;  2XQ9 A;  3RIA A;  2LLY A;  4QHO A;  3VKH A;  3NZL A;  4HFC A;  5A1L A;  2C0S A;  2E5L T;  5LGU B;  1OWA A;  4PK4 A;  4QH1 A;  4WYV A;  3R6N A;  1RZS A;  1ZV4 X;  1T72 A;  3NRY A;  4JEU B;  4U33 A;  2LSG A;  3EUH A;  3J7Y q;  3NBX X;  2CHO A;  2LNM A;  2OV9 A;  2CWO A;  2PPX A;  2YEV C;  3JAF A;  2X9W A;  4DR1 T;  2X51 A;  1UUR A;  3Q5W A;  4DUZ T;  2V7J A;  1QLB A;  2V6X A;  5ABG A;  4HWD A;  4F6R C;  2BG9 E;  3LIS A;  1QPZ A;  4H9R C;  4YBA A;  2KEI A;  2J62 A;  3PJA A;  4X1I E;  3AA1 B;  1D1C A;  4AQG A;  4CN6 A;  4Z59 A;  2B1E A;  4JI2 T;  3L8R A;  4DR2 T;  2E9X C;  3KDS E;  2KLQ A;  2A9U A;  1ZAY A;  3TLW A;  5DTR A;  1J5W A;  2CWY A;  3SR4 A;  1MMA A;  3FZH B;  3F6W A;  4J1W A;  5GAH i;  3X1D A;  4UV9 B;  4EQZ A;  3LDQ B;  3ZJ1 A;  5LG4 A;  4JI7 T;  4AIU A;  3P4R A;  1WH8 A;  2WU2 A;  4Y42 A;  2PFV A;  1G73 A;  3ABV A;  4ERR A;  3VHL A;  2IIU A;  4HFD A;  3UUB A;  2ZM6 T;  1QP7 A;  2YOE A;  3RRW A;  2YK0 A;  1IBL T;  3AE6 A;  3KJX A;  3RIF A;  4KX6 A;  3V5U A;  2L49 A;  3CEC A;  1IZN B;  4GKJ T;  2GRM A;  2MOZ A;  2FUP A;  2QVA A;  2WMN A;  4NDW A;  3UU4 A;  4ER5 A;  4PNI A;  4X4E A;  1E7P A;  2IUO A;  1SUM B;  1ZS4 A;  1ZZB A;  3F57 A;  2DLR A;  4LF5 T;  1CQT A;  1GT0 C;  1WR0 A;  3PUW F;  4EED A;  5L2L A;  4AXP A;  3M9L A;  4PU3 C;  4LFA T;  2PBI A;  2WM9 A;  3OQO A;  2CLY C;  5FYM A;  1W0A A;  1UUS A;  1X79 A;  1XNQ T;  4I6T A;  1BR0 A;  1PRV A;  3SCH A;  2LSY A;  2N1G A;  4ZI2 D;  4ZXL A;  3NZP A;  4ZHQ E;  4AI6 A;  2W61 A;  2VL8 A;  2FJB A;  3HA4 A;  3A7M A;  5IYZ E;  4IE0 A;  1LLI A;  2B5A A;  2ES0 A;  3NRX A;  4DV5 T;  1IC8 A;  4ZI7 E;  2AXD S;  3AAE B;  1Z8U A;  4YT0 A;  3G0T A;  3AVR A;  4EEB A;  3ZC1 A;  2IDO B;  2OLT A;  4O2B E;  3ZT6 A;  4ASK A;  3L39 A;  4LF8 T;  3RI5 A;  2E8I A;  4X5T A;  2GRL A;  1KFY A;  3ONX A;  3CLC A;  4K0K T;  4KBM B;  5AQQ B;  2PXD A;  1XDO A;  2PXL A;  2V3C C;  3C51 A;  4CXY A;  5LNK A;  2LT3 A;  4QH5 A;  3QB5 K;  2PUC A;  4IE4 A;  2L8N A;  4JV5 T;  4DUY T;  2PXP A;  3SS1 A;  3FXD B;  4EIW A;  1J5E T;  4FN3 A;  4TV9 E;  1EFA A;  3RYI E;  3IVP A;  2I6H A;  4TWD A;  2BG9 B;  2Z6E A;  2QRX A;  4DR3 T;  1I94 T;  5FNV E;  3HI2 A;  4PK6 A;  3P4P A;  3EAB A;  4YG7 B;  2UXC T;  1UTX A;  3CVR A;  4I6R A;  3RRC A;  4C90 A;  5LHH B;  4YSX A;  4M1P A;  5AQG B;  5LG3 A;  4U31 A;  4DE8 A;  1YKE B;  4ZS2 A;  3CKD A;  2CCQ A;  4I8T A;  3ANW B;  4DR7 T;  3OWQ A;  3T1Y T;  3RC3 A;  4LMJ A;  4X62 T;  1E1H B;  1UK5 A;  5FY1 A;  2BS4 A;  2K9A A;  5LMN T;  2PUB A;  3QOX A;  3MK7 C;  2DCF A;  3LSV A;  1KNZ A;  1IBM T;  5AQJ B;  1AU7 A;  3AE3 A;  4EB6 E;  3BD1 A;  1XWR A;  4DR6 T;  2A6C A;  1UXC A;  3A9Z A;  3ZCJ A;  1T98 A;  2CRO A;  5DQV A;  3I0Q A;  4U2Z A;  3KVA A;  3LJC A;  2FJA A;  2XSD C;  4QXH B;  3ZMU B;  3UFG A;  3OKZ A;  3ZMS B;  4U3C A;  5AQM B;  2PJQ A;  2V7K A;  4WNK A;  2WB5 A;  4QH4 A;  2LSJ A;  5H6R B;  1FMW A;  4IDZ A;  2H8R A;  4U2Y A;  2LYR A;  5FKY A;  2XAQ B;  5F3J A;  2CSF A;  2EHO A;  2NWB A;  2XHE B;  2FFH A;  4G2A A;  4P0A A;  3N2G E;  4ZI3 C;  2CRB A;  2WMO A;  3T1H T;  4X66 T;  1KNP A;  1D0Z A;  4JI8 T;  5AQV B;  2H7V C;  2E2A A;  4X4F A;  2M67 A;  1LQC A;  4O4L E;  1YQ4 A;  3N9O A;  3C50 A;  5F5W A;  4Z90 A;  3GZC A;  2X66 A;  5LJM A;  2C5J A;  4OFZ A;  3W15 B;  5DT2 A;  2WY2 A;  1RZR A;  1HNZ T;  5L47 A;  3AE4 A;  3P50 A;  3GN5 B;  2E9X A;  1M62 A;  4I4T E;  4EV6 A;  4HWF A;  2XSB A;  5HXR A;  2AXU A;  4YJ2 E;  4PJM A;  5L3G B;  4DMW A;  1DWK A;  1HF0 A;  2ZMA A;  5HYA A;  3GA8 A;  2CE7 A;  2NTY A;  1D0Y A;  4UVB B;  1LVK A;  5LA6 E;  2VKJ A;  2LOS A;  2PG8 A;  5AQI B;  3SOL A;  5LGT B;  2LYJ A;  4O4H E;  2Q9Q B;  4HWC A;  1W9R A;  2W00 A;  3K8P C;  2AXZ A;  4IL4 A;  5HXC A;  3CQG B;  4CN4 A;  3LBX A;  4PFO A;  3RKG A;  2X9X A;  3LFP A;  4ER0 A;  3VRB A;  3O9X A;  4XAX B;  3N9L A;  3KL4 A;  3QUJ A;  3PUR A;  2KPJ A;  3AEC A;  3C4W A;  4OK0 A;  2LYS A;  3NDB B;  2BVL A;  3KVB A;  3ZHM A;  3AA6 B;  5CJ5 A;  2PIJ A;  4HFI A;  5LB7 B;  1U5P A;  3K1S A;  4CI3 B;  1ZEE A;  2XSA A;  4TUY E;  4X20 E;  4GHJ A;  3G5G A;  3EI0 A;  4BA9 A;  2HCN A;  1YXR A;  3AEB A;  4PU8 A;  2IC9 A;  2W0G A;  4DR4 T;  3I9W A;  1X2L A;  2NW7 A;  2H7O A;  2R63 A;  1NEK A;  4I55 E;  4MCT A;  4Q2J A;  2Y8D A;  3QK6 A;  3TFL A;  4ER3 A;  1HG2 A;  3CWZ B;  2X9H A;  2JCG A;  3DM5 A;  1WLX A;  3R09 A;  2ZLY A;  2J47 A;  4DMV A;  1IBK T;  1QUU A;  3PTR B;  4AKI A;  3RYH E;  1JFT A;  1Y01 A;  4HN9 A;  2J1D G;  4DND A;  1R8I A;  3PU3 A;  5DTM A;  5IUX A;  5IHY A;  2V6Y A;  4IWR A;  2V1D B;  1UCU A;  3RGL A;  1OED B;  4AIS A;  4TWF A;  2CHN A;  4E7S A;  1QP0 A;  3H5T A;  5HWX A;  3UTK A;  5LXT E;  1S7E A;  2M6B A;  2IHR 1;  1D1B A;  4OB4 A;  2X0Y A;  1MIY A;  4FBI A;  3BDN A;  4KI0 F;  3FYM A;  4YJ3 E;  3U78 A;  3RIU A;  1MFQ C;  1HNX T;  5LHG B;  2RP4 A;  3CPZ A;  4Z5C A;  2WCA A;  5HCM A;  3OPC A;  2A2F X;  2X9Y A;  2KEK A;  2WS3 A;  4GKK T;  1D0X A;  4AKG A;  3NKZ A;  4X4C A;  4JI0 T;  3OYZ A;  5AQO B;  1HX1 B;  2FJE A;  3H37 A;  1YW0 A;  1R69 A;  4O4I E;  4LF6 T;  2BNM A;  5C8Y E;  3KBU A;  3AE2 A;  3ZKR A;  3OJA A;  1VCS A;  4ZI2 C;  4TN7 B;  1WYB A;  5DQW A;  4YTM A;  4X4B A;  2V5D A;  1MMG A;  5JR9 B;  1WH6 A;  2DWG A;  4IIJ E;  3JXB C;  4H63 H;  4DV7 T;  3CRO L;  2G0U A;  1ZZ9 A;  2PUF A;  2EHO C;  2XQ3 A;  3ZEF B;  4YFS A;  1AJ3 A;  3MAC A;  2CA5 A;  3OVU A;  2LLV A;  2MPK A;  4KP3 C;  4U7Y A;  2KT9 A;  1HR0 T;  3AA0 B;  5LBM A;  1Y9Q A;  1WCR A;  3OKQ A;  3KV6 A;  5AQN B;  4X64 T;  2XM1 A;  2WQY A;  3A5X A;  3PUZ F;  3UUX B;  2UXX B;  1B7T A;  4ILB A;  3C98 B;  3Q2M A;  1PRU A;  5HCJ A;  2LSK A;  4WW0 A;  3PJA J;  3CQX C;  3FB2 A;  2LYK A;  3T8O A;  5HEO A;  4LFB T;  3VR8 A;  4A5X A;  5JQG E;  4NPP A;  4NXM T;  3AEE A;  1N34 T;  2IV1 A;  2H3R A;  3C4Z A;  1WIZ A;  4MLK A;  5CB4 E;  2K3W A;  2EBY A;  2VVN A;  4X4G A;  1SA0 E;  2YU1 A;  3LG7 A;  2A72 A;  3MA9 A;  3RQW A;  2D9D A;  2HHH T;  3FXE B;  3Q5D A;  5JRE A;  4YHJ A;  2AW6 A;  5DRT A;  4NUV A;  2I59 A;  2JQE A;  1MNE A;  4NUU A;  2ZM2 A;  3CQC B;  5HEU A;  3AE8 A;  2X68 A;  2DHR A;  4ZZB A;  2V7M A;  3KBT A;  4P09 A;  5FXW A;  4EZI A;  3GZD A;  2YDR A;  3RYF E;  1KNR A;  4IT4 A;  2KIN B;  3TEP A;  1QQA A;  4C91 A;  5JRC B;  1U2Z A;  3L3P A;  2VB6 A;  3BQI A;  2XAJ B;  1CJG A;  5ABH A;  2O49 A;  2WDR A;  4ISS A;  1XNR T;  1ZZ6 A;  4QKN A;  2V26 A;  3B5M A;  2YDS A;  1L1M A;  4ZZC A;  3F51 A;  4ILU A;  1CUN A;  4DV1 T;  4NIQ A;  1NW3 A;  3CML A;  3EAM A;  1Y7Y A;  2E5V A;  2IU7 A;  3AXJ A;  1J1J A;  2J7W A;  3AEG A;  1UX5 A;  2ODR D;  2UXD T;  4TV8 E;  4KUM B;  1IJ6 A;  3ZPX A;  2FBW A;  2LEH A;  1M7K A;  3O4X E;  3B7H A;  3QB5 A;  3KXA A;  3UFD A;  2IC6 A;  2HCS A;  3P4Q A;  3PUY F;  5EK2 A;  4KMC A;  4IDO A;  3N2O A;  2AUW A;  4DE9 A;  2VVS A;  2K5B B;  3FHN A;  3RIU C;  3NXH A;  3IF8 B;  3R84 B;  4EYY R;  4HTE A;  2XM2 A;  4UVC B;  2YDQ A;  2YKS A;  4MBQ A;  4X4I A;  4GK0 E;  4DBQ A;  1QP4 A;  4FJO A;  3PV0 F;  4UF0 A;  3AE9 A;  1WRD A;  5ABF A;  3C4X A;  2PUE A;  4TX5 A;  4UIG A;  3BK9 A;  2QA7 A;  2UUA T;  3O1H A;  3ZT7 A;  2VKD A;  5L3F B;  3U3W A;  4HGA A;  2IVG A;  1H7C A;  4N78 D;  3S8Q A;  2VL0 A;  2Y6X A;  4YXD A;  2LHN A;  4DV2 T;  3P4S A;  2K48 A;  5JUW A;  3AED A;  2VEO A;  3QYX A;  2XAF B;  4CZZ B;  5FVL A;  4L9I A;  3QC9 A;  3CX8 B;  4YAR A;  2LRK A;  2ZM0 A;  4O8S A;  2HSG A;  4WBO A;  2JPF A;  4G63 A;  3EHZ A;  3UQ4 A;  4TNV A;  4AQF A;  4QXB B;  4L5G A;  4PU7 A;  1D1A A;  4OYJ A;  2LHR A;  2X67 A;  2EHO B;  2BG9 A;  3FZM B;  3MZK B;  3OP9 A;  4AKR B;  4K0U A;  4YSY A;  2IVB A;  3DP7 A;  2XXQ A;  3QF3 A;  2HN2 A;  2VAS A;  1YSE A;  4GYS A;  3PE0 A;  2IML A;  3F2E A;  3GWH A;  1JWL A;  5JDH A;  4B3T T;  4WZX A;  2JIW A;  2X0H A;  3N5L A;  4IDP A;  2Q9Q D;  2WU5 A;  1HF8 A;  3DJB A;  2YN6 A;  5LYJ E;  3UU3 A;  3A9Y A;  4JQD A;  1PRA A;  4CI2 B;  3ANW A;  4O2A E;  2XXP A;  4QWN B;  3DTO A;  2MYS A;  2VKH A;  2LRL A;  5J0Z A;  3PUG A;  2E9X B;  4JI4 T;  3HKD E;  2NTX A;  1JNZ A;  3A9X A;  4JCX A;  2XIU A;  4XZC A;  2PXU A;  3OBV E;  2WAU A;  3KIN B;  2BS2 A;  4ZOL E;  5AQS B;  4H9S E;  4F8H A;  5DAB A;  4HFE A;  5FVK A;  2WP9 A;  4B3S T;  3D1N I;  4O8B A;  3HKB E;  1FJG T;  3KFW X;  3RHW A;  4I6U A;  4A98 A;  4Z8X A;  3GZD C;  2WBL A;  1WET A;  5CA0 E;  2ICP A;  4H63 V;  4ANJ A;  2AXV A;  3HL6 A;  3RC8 A;  1VCT A;  2L1P A;  3OQM A;  4TWH A;  1ZZC A;  2JQH A;  3GUU A;  4YLH A;  5K98 B;  4IGU A;  4DVD A;  2LJL A;  2ODU A;  4EOZ B;  1XMO T;  3JC6 C;  5JH7 E;  3UFE A;  2XAG B;  3K3N A;  4IE6 A;  2CLY B;  1MND A;  2CBJ A;  5EZY E;  2WWU A;  4IVZ A;  5FXV A;  3EDU A;  5BR8 T;  1QSD A;  2IVQ A;  3B13 A;  2O4A A;  1CHU A;  3SFD A;  4EXT A;  1E2A A;  1OSL A;  2WWV A;  4EK9 A;  2DNX A;  1BDH A;  1XDP A;  4COF A;  4UEM A;  1PNR A;  3ME5 A;  3Q5E A;  4YSZ A;  3CX7 B;  4IE7 A;  3MLF A;  5FXZ A;  1BR1 A;  4U74 A;  3ETV A;  2LM9 A;  3L1P A;  2HPL A;  2V6Y B;  2XXA A;  3N2K E;  4O4J E;  2XY8 B;  2BS3 A;  1US7 B;  1O3X A;  2XJ7 A;  2D0T A;  4TZ4 C;  4CN1 A;  2WSS V;  4QX7 B;  2IUB A;  3VK0 A;  3D0T A;  3ZKC A;  1VOM A;  3E0Z A;  5KMG P;  2Q9Q A;  2WIU B;  1YKH B;  1KK7 A;  3FZK B;  4U72 A;  5FMN A;  4AQY T;  3N9N A;  1WYC A;  2QGS A;  1L0V A;  3PUQ A;  2MQK A;  1W0B A;  5HEG A;  2ACX A;  4UVA B;  4U7I A;  1LMB 3;  1HQ1 A;  3JCF A;  4KHP T;  2VUR A;  4B3M T;  3N9Q A;  2LLW A;  3AE7 A;  1W09 A;  2GZU A;  1QQB A;  3ZHI A;  4IHJ E;  2XAS B;  3G06 A;  2PUG A;  1YQ3 A;  2RA1 A;  4X65 T;  2A3D A;  4J2C A;  3CK6 A;  2J7U A;  3M3Z B;  5J1G A;  2DL1 A;  1KF6 A;  3UWP A;  3ZT5 A;  2M4H A;  3E22 E;  4AQF C;  3ZN1 B;  1N36 T;  2JMH A;  5FY7 A;  2BG9 C;  3IBP A;  4BJN A;  4EYU A;  5AQK B;  5KX5 E;  1B0N A;  1FMV A;  2DWK A;  2MEZ A;  4YG4 A;  2BDE A;  2W67 A;  5L3B B;  3UQ7 A;  1JFS A;  5JDG A;  3O1I A;  1T7S A;  3JAE A;  4DO0 A;  4EZ4 A;  4CQI A;  4L0R A;  4CXW A;  1OED A;  2OR1 L;  1HTJ F;  2CXL A;  3ESL A;  4BAY B;  3UUN A;  5DSX A;  1IJ5 A;  1MIV A;  3GBF A;  4YHH T;  3H3M A;  4DV6 T;  4MHC A;  3N9P A;  3PUS A;  4H9O C;  4HEA A;  3ZYM A;  2XZE A;  3RPU A;  4B6X A;  2NOX A;  4YTP A;  2HIN A;  1SE7 A;  3AEA A;  5AQF B;  3AA7 B;  2LYQ A;  1HG5 A;  2F4V T;  3ZMT B;  5C3J A;  3VRA A;  3ZCI A;  3NZQ A;  1U4Q A;  5FP3 A;  3FBZ A;  1SQ8 A;  1ZOY A;  4EKI A;  1ZKE A;  1KEY A;  1DU2 A;  3WI3 A;  1NWM X;  3SCF A;  3ZPO A;  2WZH A;  3LK3 B;  4JYA T;  3UU5 A;  4ILA A;  3IEE A;  4HWI B;  2LE8 A;  3TLV A;  3JXD L;  2RPA A;  3NVO A;  5FL1 A;  2XI8 A;  1RPE L;  2XQA A;  2B76 A;  3I9Y A;  4A97 A;  3AE1 A;  3SWH A;  4LMK A;  2HPJ A;  4Z91 A;  2L8K A;  3P7I A;  2P9B A;  1ADR A;  3F31 A;  4HFH A;  2BJC A;  4PU4 C;  5JR9 A;  5HAX A;  2V7L A;  1HS7 A;  3AVS A;  1QB2 A;  5AQL B;  3VWS A;  3ONJ A;  5KDM C;  3RKO A;  2PXF A;  5LP6 E;  2JJ9 A;  2UUC T;  1IAP A;  4Q25 A;  5EK4 A; 
#chains in the Genus database with same CATH homology
 4UF0 A;  3N9O A;  3C50 A;  4GQM A;  1WRD A;  4FI5 A;  3H3A A;  1MMD A;  1O4X A;  3LK4 2;  2X66 A;  4X1Y E;  3C4X A;  5LJM A;  2C5J A;  4OFZ A;  2EF8 A;  2AWI A;  2PUE A;  3W15 B;  2YIN A;  1RZR A;  3PU8 A;  4TX5 A;  3SRZ A;  4UIG A;  3BK9 A;  2QA7 A;  1ZZ8 A;  3O1H A;  2VKD A;  3GN5 B;  5HXE A;  4I50 E;  5L3F B;  2E9X A;  3HKE E;  3U3W A;  4HGA A;  3HKC E;  2IVG A;  1H7C A;  2ZM8 A;  4I4T E;  3RYC E;  4N78 D;  2L9Q A;  3U3I A;  5HXR A;  3S8Q A;  2KXP B;  5J2U E;  2AXU A;  2CXD A;  2Y6X A;  3KV5 A;  4PJJ A;  2LHN A;  4YJ2 E;  4X4D A;  2BNO A;  4P0B A;  4PJM A;  5LBQ B;  3AAI A;  5J2T E;  3ZYL A;  2K48 A;  5L3G B;  3CX6 B;  4DMW A;  1MIW A;  1DWK A;  3LFM A;  3M65 A;  4PAG A;  3I1A A;  2O38 A;  1HF0 A;  5LCY A;  2ZMA A;  3TKL B;  3K3Q C;  3QQ6 A;  2PE5 A;  3QYX A;  2XAF B;  4CZZ B;  5HYA A;  5L3E B;  3SCG A;  3GA8 A;  4L9I A;  2W62 A;  2CE7 A;  3QC9 A;  5LOV E;  2NTY A;  3CX8 B;  3ZC0 A;  1D0Y A;  4UVB B;  4YAR A;  1LVK A;  2W63 A;  2ZM0 A;  5LA6 E;  5TAO A;  1BR4 A;  2VWA A;  2IW5 B;  2LCV A;  4YG1 A;  4O8S A;  3J9X 1;  2CMR A;  2LOS A;  2PG8 A;  3F52 A;  2VKJ A;  3SOL A;  2LYJ A;  5LGT B;  4O4H E;  2HSG A;  2Q9Q B;  1LCD A;  4WBO A;  2JPF A;  3B57 A;  1UXD A;  4G63 A;  2W00 A;  3K8P C;  5FXX A;  2AXZ A;  2K24 A;  1Y64 B;  2CM0 A;  5HXC A;  3CQG B;  2KND A;  3LBX A;  4QXB B;  4AQF A;  3GMI A;  4L5G A;  4PFO A;  4PU7 A;  1D1A A;  4ADZ A;  3JC6 D;  4OYJ A;  2X9X A;  2NW9 A;  3LFP A;  2LHR A;  2EHO B;  2X67 A;  3O9X A;  1NAF A;  3Q5X A;  2JVL A;  4XAX B;  3N9L A;  3QUJ A;  2D5V A;  2PUD A;  3N9M A;  5H6Q B;  3MZK B;  3G7D A;  2JQQ A;  1PER L;  3OP9 A;  2KPJ A;  3C4W A;  3PUR A;  4IST A;  4OK0 A;  4AKR B;  2LYS A;  4K0U A;  2BVL A;  4UXN B;  2LSI A;  3KVB A;  4QX8 B;  2IVB A;  3ZHM A;  3EVY A;  3AA6 B;  2NW8 A;  3DP7 A;  4QHO A;  3QF3 A;  2Q9Q C;  4JUY A;  5ETW A;  3VKH A;  2PIJ A;  5A7L A;  5A1L A;  2C0S A;  1U5P A;  4CI3 B;  1ZEE A;  5LGU B;  1OWA A;  2VAS A;  1YSE A;  4GYS A;  4PK4 A;  1SHZ C;  5FY0 A;  4TUY E;  3R6N A;  1ZUG A;  3PE0 A;  3F2E A;  1RZS A;  3DNV B;  1ZV4 X;  3GWH A;  1JWL A;  4X20 E;  4GHJ A;  5HXH A;  5JDH A;  3G5G A;  4UF0 B;  3NRY A;  4JEU B;  4BA9 A;  3N5L A;  2Q9Q D;  2LSG A;  1HF8 A;  3EUH A;  3J7Y q;  3DJB A;  5LGN B;  3NBX X;  5LYJ E;  4X1K E;  4PU8 A;  4JQD A;  1PRA A;  2IC9 A;  2W0G A;  4CI2 B;  3ANW A;  1V9D A;  1X2L A;  2CWO A;  3DTO A;  3I9W A;  4O2A E;  2NW7 A;  4QWN B;  2H7O A;  2MYS A;  2VKH A;  2PPX A;  2YEV C;  2R63 A;  4JEH B;  2X9W A;  2EHO D;  4I55 E;  3PUG A;  2E9X B;  4MCT A;  2X51 A;  2IAK A;  1BR2 A;  3Q5W A;  3HKD E;  2Y8D A;  3QK6 A;  3WAJ A;  2XQY A;  2V7J A;  1HG2 A;  3CWZ B;  2NTX A;  2JCG A;  2X9H A;  1WLX A;  4JCX A;  2N9D A;  2ZLY A;  2XIU A;  4DMV A;  5AFU L;  4F6R C;  5JRC A;  4XZC A;  3LIS A;  1FIO A;  1QUU A;  3KZ3 A;  3PTR B;  1QPZ A;  4H9R C;  4YBA A;  2KEI A;  4AKI A;  3RYH E;  3OBV E;  4X1I E;  3AA1 B;  4MCX A;  1JFT A;  2WAU A;  2X0L B;  1D1C A;  4A56 A;  4AQG A;  3MXZ A;  3KIN B;  3OYX A;  4HKA A;  2UXN B;  2D2S A;  4Z59 A;  2B1E A;  4HN9 A;  2J1D G;  4DND A;  2VKO A;  3RH3 A;  3PU3 A;  1HCI A;  4H9P C;  4ZOL E;  5JDM A;  5IHY A;  2E9X C;  4IWR A;  3KDS E;  3EUS A;  2KLQ A;  2V1D B;  4H9S E;  1UCU A;  5DAB A;  3D1N I;  1ZAY A;  1VPW A;  4O8B A;  2BVM A;  3HKB E;  5JVD E;  4E7S A;  1QP0 A;  3H5T A;  2CWY A;  1MMA A;  1RZR D;  5HWX A;  5JDN A;  2ICT A;  3UTK A;  3I0O A;  4AKH A;  4H9Q C;  5LXT E;  1S7E A;  1ZVV A;  3F6W A;  3VKG A;  4J1W A;  3KFW X;  1D1B A;  4OB4 A;  2HH7 A;  4UV9 B;  2D5U A;  1MIY A;  3ZLI A;  4I6U A;  4FBI A;  4OYK A;  2E9X D;  3BDN A;  1JH9 A;  4Z8X A;  3UUL A;  3ZJ1 A;  5LG4 A;  1ZZ7 A;  3FYM A;  4YJ3 E;  3U78 A;  1S94 A;  2WBL A;  1WET A;  5LHG B;  5CA0 E;  2RP4 A;  2ICP A;  1WH8 A;  3CPZ A;  4H63 V;  4ANJ A;  2N2N A;  2AXV A;  3HL6 A;  3C64 A;  4E7Z A;  4GK5 E;  4Z5C A;  3RC8 A;  3Q9D A;  4Y42 A;  4GOU A;  3OQM A;  1ZZC A;  1G73 A;  2PFV A;  4YLH A;  4ERR A;  5K98 B;  1LKX A;  4IGU A;  4DVD A;  2LJL A;  3ETU A;  2ODU A;  2A2F X;  4EOZ B;  2YU2 A;  3JC6 C;  2X9Y A;  5JH7 E;  2KEK A;  3VHL A;  3LK2 B;  3UFE A;  1D0X A;  4AKG A;  1QP7 A;  4X4C A;  2YK0 A;  3RRW A;  2XAG B;  3KJX A;  3K3N A;  3OYZ A;  3V5U A;  4IE6 A;  5F8P A;  2L49 A;  3CEC A;  1IZN B;  2CLY B;  1MND A;  2GRM A;  5EZY E;  2MOZ A;  2WWU A;  3H37 A;  4IVZ A;  5LHI B;  2WMN A;  4NDW A;  5FXV A;  3EDU A;  4ZS3 A;  1QSD A;  4PNI A;  4X4E A;  1YW0 A;  4F8D A;  2IVQ A;  1R69 A;  2IUO A;  4EAH A;  4O4I E;  3B13 A;  1ZS4 A;  1ZZB A;  2O4A A;  3F57 A;  2DLR A;  2ODV A;  4EZH A;  4UEL A;  2BNM A;  3ZYK A;  1CQT A;  4HE8 A;  2JMK A;  4EXT A;  5C8Y E;  1GT0 C;  3KBU A;  1OSL A;  4OHF A;  3OJA A;  2DNX A;  5L2L A;  1BDH A;  3O1J A;  4AXP A;  4ZI2 C;  4UEM A;  4TN7 B;  1PNR A;  1X57 A;  1WYB A;  4PJN A;  4PU3 C;  5DQW A;  4WBN E;  3BS3 A;  4X4H A;  2PBI A;  2WM9 A;  4X4B A;  3OQO A;  1MMG A;  2KZ7 B;  5JR9 B;  1VRB A;  2CLY C;  5FYM A;  2MBG A;  1X79 A;  1R63 A;  1WH6 A;  3CX7 B;  4IE7 A;  2DWG A;  4IIJ E;  4I6T A;  3MLF A;  1BR0 A;  1PRV A;  3SCH A;  3JXB C;  5FXZ A;  1BR1 A;  4H63 H;  4U74 A;  3UT5 E;  3PUA A;  3CRO L;  3ETV A;  2G0U A;  2LSY A;  2LM9 A;  1ZZ9 A;  2N1G A;  2PUF A;  3OMT A;  2EHO C;  2XAH B;  3FMY A;  3L1P A;  4ZI2 D;  3ZEF B;  3NZP A;  2HPL A;  4MFR A;  2XCJ A;  2VK9 A;  2JRK A;  4YFS A;  3WAK A;  5BMV E;  4ZHQ E;  4AI6 A;  2W61 A;  3ZJ2 A;  1AJ3 A;  2VL8 A;  3N2K E;  4O4J E;  1LRZ A;  3HA4 A;  5IYZ E;  2PUA A;  4IE0 A;  1FEW A;  1US7 B;  1LLI A;  2B5A A;  2CA5 A;  3MAC A;  2ES0 A;  1O3X A;  5JR9 C;  3NRX A;  4KP3 C;  1MMN A;  5L3D B;  2D0T A;  3AB3 B;  2KT9 A;  3AA0 B;  3FYA A;  1IC8 A;  4ZI7 E;  4V1A v;  4TZ4 C;  5LBM A;  3AAE B;  1Y9Q A;  2WSS V;  3RX6 A;  3PXP A;  1E3O C;  4QX7 B;  3VK0 A;  2D0U A;  3OKQ A;  3KV6 A;  4AKL A;  1ZPQ A;  3D0T A;  3ZKC A;  4IA8 A;  3S4U A;  1VOM A;  4I43 B;  5ADX L;  3A5X A;  3AVR A;  3E0Z A;  3ZC1 A;  3UUX B;  2UXX B;  2Q9Q A;  1B7T A;  2WIU B;  1YKH B;  4O2B E;  5KMG P;  3C98 B;  1KK7 A;  4ASK A;  3Q2M A;  1PRU A;  2XUE A;  2KZ8 A;  2E8I A;  2LSK A;  1RIO A;  1WR6 A;  2GRL A;  2BZB A;  4U72 A;  4WW0 A;  3ONX A;  3CLC A;  5FMN A;  2OA5 A;  3N9N A;  4KBM B;  1WYC A;  2QGS A;  3PUQ A;  2MQK A;  3CQX C;  4QXC B;  2XJ3 A;  2LOP A;  2ACX A;  3V5S A;  3FB2 A;  3QWG A;  2LYK A;  3T8O A;  4UVA B;  1HX8 A;  2LYL A;  1OXZ A;  3C51 A;  5LNK A;  2LT3 A;  4CXY A;  5GON E;  2NP9 A;  2PUC A;  4IE4 A;  2L8N A;  3MJX A;  1LMB 3;  3SS1 A;  1NER A;  3KV9 A;  3FXD B;  3VU7 H;  4EIW A;  5JQG E;  3N9Q A;  3BQL A;  4FN3 A;  2IV1 A;  4TV9 E;  2H3R A;  3C4Z A;  1WIZ A;  3LBX B;  2GZU A;  4MAL A;  1EFA A;  4MLK A;  5CB4 E;  4GYR A;  3RYI E;  3IVP A;  1QQB A;  3P8C D;  1S35 A;  3WI3 A;  3ZHI A;  2EBY A;  3HZI B;  2BNN A;  2XAS B;  2Z6E A;  4IHJ E;  2PUG A;  4X4G A;  1SA0 E;  4H9N C;  2LYP A;  1OCT C;  2KWI B;  2YU1 A;  2RA1 A;  3LG7 A;  2A72 A;  3MA9 A;  5FNV E;  2A3D A;  4J1X A;  3HI2 A;  4J2C A;  4PK6 A;  4PW8 A;  3FXE B;  5J1G A;  5EK3 A;  5JRE A;  4YHJ A;  4YG7 B;  2GK9 A;  1UTX A;  4Z5H A;  3CVR A;  4PK5 A;  4I6R A;  3AAA B;  3RRC A;  4C90 A;  5LHH B;  2AW6 A;  2R1J L;  4NUV A;  2I59 A;  3E22 E;  4M1P A;  1MNE A;  3TRB A;  4PJL A;  3UUM A;  4NUU A;  2ZM2 A;  3CQC B;  3ZN1 B;  4AQF C;  2JMH A;  3OQN A;  2X68 A;  2MTQ A;  5FY7 A;  2DHR A;  5JDQ A;  3IBP A;  4BJN A;  2V7M A;  4EYU A;  5KX5 E;  1B0N A;  1YKE B;  4ZS2 A;  3CKD A;  1FMV A;  3KBT A;  1LVF A;  2OFY A;  2DWK A;  2CCQ A;  2MEZ A;  4P09 A;  5FXW A;  4I8T A;  3ANW B;  1LCC A;  3L09 A;  4YG4 A;  2BDE A;  5E0O A;  5L3B B;  1JFS A;  5JDG A;  4Z5D A;  3BQK A;  3O1I A;  3RC3 A;  4DO0 A;  4EZ4 A;  3RYF E;  1E1H B;  4CQI A;  4PFP A;  5FY1 A;  5JDL A;  2KWH A;  2KIN B;  2K9A A;  1QQA A;  4L0R A;  4CXW A;  4CI1 B;  4GIW A;  2OR1 L;  2PUB A;  4C91 A;  1UX4 A;  1HTJ F;  2CXL A;  2KEJ A;  3ESL A;  5LJN A;  4BAY B;  5JRC B;  3MK7 C;  3UUN A;  3L3P A;  2DCF A;  4BJM A;  1IJ5 A;  2VB6 A;  1MIV A;  3GBF A;  3BQI A;  2XAJ B;  3FBL A;  4MHC A;  4CXX A;  1CJG A;  1KNZ A;  4DBR A;  3JXC L;  3N9P A;  3PUS A;  4H9O C;  4HEA A;  1AU7 A;  1NEQ A;  3GN5 A;  3ZYM A;  4EB6 E;  2O49 A;  3BD1 A;  3RPU A;  1XWR A;  4B6X A;  4Z58 A;  2A6C A;  2NOX A;  1UXC A;  2HIN A;  1EZ3 A;  1YD8 G;  3ZCJ A;  4ISS A;  1BDI A;  1ZZ6 A;  4QKN A;  5HWY A;  2V26 A;  3ZN0 B;  1L1M A;  1T98 A;  3F51 A;  2CRO A;  3EDV A;  2EWT A;  2LYQ A;  1HG5 A;  2XTL A;  3AA7 B;  4IE5 A;  4UV8 B;  4ILU A;  5DQV A;  3ZMT B;  3I0Q A;  4HFV A;  3ZCI A;  1CUN A;  2FJR A;  3ZMZ B;  3KVA A;  3LJC A;  3NZQ A;  1U4Q A;  5FP3 A;  3FBZ A;  1SQ8 A;  2XSD C;  3CML A;  4QXH B;  3ZMU B;  2SPC A;  2CEA A;  2L3L A;  3ZMS B;  1Y7Y A;  1ZKE A;  2IU7 A;  1NWM X;  2PJQ A;  1POU A;  2V7K A;  3PDY A;  3SCF A;  1HFA A;  3R1F A;  2Y48 B;  4WNK A;  2C5I T;  3ZPO A;  3LK3 B;  2KMF A;  1UX5 A;  3K3O A;  2LSJ A;  3IEE A;  5H6R B;  5JDF A;  1FMW A;  4TV8 E;  4JLE A;  2CXF A;  2LE8 A;  4KUM B;  1IJ6 A;  4IDZ A;  2H8R A;  5M4Y A;  2LEH A;  3JXD L;  3MKD A;  2LYR A;  4JCY A;  3O4X E;  2XI8 A;  3B7H A;  1RPE L;  3KXA A;  2XAQ B;  3HR0 A;  5F3J A;  3I9Y A;  2CSF A;  3E08 A;  5HXS A;  2EHO A;  3UFD A;  1G8X A;  3SWH A;  2IC6 A;  2NWB A;  5EK2 A;  2HPJ A;  1Z0P A;  3ZMV B;  2XHE B;  4XBF B;  2L8K A;  5DJQ C;  4G2A A;  3P7I A;  4P0A A;  4KMC A;  5L3C B;  2P9B A;  3N2O A;  2AUW A;  1ADR A;  3N2G E;  2K5B B;  1DW9 A;  3FHN A;  4ZI3 C;  2WMO A;  3F31 A;  2BJC A;  1D0Z A;  3RZZ A;  2C5K T;  3IF8 B;  4PU4 C;  5JR9 A;  3R84 B;  5HAX A;  2H7V C;  4EYY R;  2V7L A;  4HTE A;  4UVC B;  2V7I A;  1HS7 A;  3AVS A;  4X4I A;  4MBQ A;  4X4F A;  2WUS R;  1LQC A;  2M67 A;  3KV4 A;  4GK0 E;  4O4L E;  5KDM C;  3RKO A;  2DI4 A;  4ZI3 D;  3IHR A;  1ZHC A;  4DBQ A;  2JJ9 A;  5CA1 E;  1QP4 A;  1IAP A;  4FJO A;  5LP6 E;  5EK4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...