3O9XA

Structure of the e. coli antitoxin mqsa (ygit/b3021) in complex with its gene promoter
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
132
structure length
132
Chain Sequence
HMKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKKLSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator/dna
molecule keywords Uncharacterized HTH-type transcriptional regulator ygiT
publication title Structure of the Escherichia coli Antitoxin MqsA (YgiT/b3021) Bound to Its Gene Promoter Reveals Extensive Domain Rearrangements and the Specificity of Transcriptional Regulation.
pubmed doi rcsb
source organism Escherichia coli
total genus 40
structure length 132
sequence length 132
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF15731 MqsA_antitoxin Antitoxin component of bacterial toxin-antitoxin system, MqsA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 3o9xA02
1.20.58.720 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3o9xA01
2IUOA 1RZSA 3QYXA 2AXUA 1DW9A 3OMTA 3SCFA 1PERL 4J1WA 1ZS4A 4MCTA 4PU3C 2EF8A 4PU4C 3SCHA 1OSLA 2KEKA 2PUCA 1IC8A 4X4IA 2IVQA 3QF3A 1Y9QA 1YSEA 3LFPA 4X4FA 1EFAA 3OQMA 1LCDA 1QP0A 4X4CA 1LQCA 2AXVA 3FYAA 2OR1L 2LYJA 2XSDC 3OQOA 1QP7A 1QQBA 3RZZA 2PUGA 2BNNA 2LYQA 3F52A 4J1XA 3GBFA 2LYPA 4Z5DA 4NDWA 3U3WA 3F51A 1JWLA 3IVPA 3KXAA 2A6CA 1WH8A 1WH6A 2MQKA 3VK0A 1RZRA 1SQ8A 1ZZ7A 3OQNA 4YG1A 3G5GA 1UTXA 3GN5B 3ZKCA 1NERA 1L1MA 3HI2A 3G7DA 5A7LA 2JVLA 2WIUB 2PIJA 1ZZ6A 2AXZA 3H5TA 3L1PA 1LLIA 3QQ6A 2H8RA 4X4GA 2XJ3A 2PPXA 4O8BA 3PXPA 4YARA 1ZAYA 2O49A 4JCYA 3KJXA 2GZUA 3ZHIA 2PUAA 3F6WA 4F8DA 2OFYA 1UXDA 4JQDA 1ZZBA 2KEJA 2AUWA 1BDHA 3UFDA 1CQTA 2FJRA 1ZZCA 2PE5A 2CSFA 2ICPA 4I6TA 1LCCA 2KZ8A 1R69A 2EBYA 2IU7A 3GN5A 2PUFA 4IVZA 1OCTC 2KPJA 3GA8A 4IA8A 1ZVVA 2GRMA 1CJGA 1XWRA 4JCXA 2ICTA 4Z59A 2AWIA 2B5AA 4X4BA 1HF0A 3JXDL 2BNMA 2O4AA 5K98B 4Y42A 2HSGA 4Z5CA 3KZ3A 1S7EA 1JH9A 1AU7A 3S8QA 1JFSA 1RZRD 4YBAA 2MEZA 2XIUA 4Z5HA 3TRBA 2XI8A 4I6RA 1LMB3 3BS3A 1B0NA 2D5VA 2AW6A 1VPWA 2KEIA 2PUEA 4MCXA 4YG7B 1QQAA 3ZHMA 3LISA 4X4EA 2IVBA 3CLCA 3CECA 3HZIB 2XCJA 3DNVB 1X2LA 4FBIA 2LYLA 1JFTA 2PUBA 2HINA 1ADRA 3SCGA 2L49A 3R1FA 2IV1A 3EUSA 1X57A 3O9XA 3QWGA 4PU8A 2CROA 1R63A 2IVGA 2LYRA 4I6UA 1BDIA 3MLFA 4GQMA 1PRVA 2WUSR 1DWKA 2EWTA 3JXBC 3BDNA 1E3OC 1POUA 4PU7A 1WETA 3FMYA 3BD1A 1PRUA 1ZZ8A 3OP9A 4OB4A 2R1JL 1NEQA 2PUDA 4IWRA 2BNOA 2LYKA 1RIOA 1ZPQA 2LYSA 1GT0C 1RPEL 1QP4A 4X4HA 1UXCA 1WIZA 1ZZ9A 4FN3A 1PNRA 3JXCL 4YG4A 4I8TA 2JCGA 4X4DA 2BJCA 1O4XA 3D1NI 3FYMA 4GHJA 1ZUGA 1QPZA 2O38A 2L8NA 3CROL 2LCVA 1Y7YA 2GRLA 2R63A 4Z58A 3B7HA 1PRAA
chains in the Genus database with same CATH superfamily
1RZSA 4U2ZA 1PERL 1HR0T 3AA1B 2P9BA 3C50A 4JUYA 2ACXA 3ZYLA 3AE7A 5HEOA 3FYAA 2ZMAA 2YU1A 2XSDC 2ZM0A 1OXZA 3HKDE 5LNKA 4J1XA 1QUUA 3GBFA 5JTGA 2CEAA 2PJQA 2PXKA 1UTXA 1LRZA 4AQYT 3AE1A 3PU3A 2DCFA 2X9HA 3ZPOA 4IGUA 5TAOA 1W9RA 4TUYE 5DTQA 3CPZA 3N2OA 2XAQB 3AEEA 2ODVA 3ZMVB 3ZMZB 4K0UA 1R69A 3GUUA 4DR6T 1J1JA 4ER6A 3NZQA 4DR2T 3D0TA 4U31A 2SPCA 4WNKA 4Z90A 2ACZA 2BVMA 3CK6A 1BR0A 4YT0A 5J0ZA 1HX8A 5AQFB 1UX4A 3IF8B 4DBRA 4O2AE 1Z0PA 3KINB 5KXJA 4TV8E 3FZLB 1W0BA 3PJAA 2BBJA 3AAAB 4O4IE 1VCSA 1PRVA 1DWKA 4NUVA 4IDNA 2XQ3A 2M67A 1S94A 4PK5A 4K0KT 4JBWF 4DVDA 4QX8B 2XXAA 2L8NA 2NOXA 2WMOA 3AXJB 2R6GF 3UULA 3ZEFB 1NEKA 3SFDA 1XMOT 3CX7B 1OSLA 3AAEB 5JREA 4JI7T 1UX5A 4YSZA 3ZT5A 3QF3A 4X4FA 2KINB 5LJMA 5GONE 4QH1A 3RLFF 3LFMA 5HEUA 4ZEYA 3IVPA 2X66A 3ZKCA 4GOUA 1D0YA 2JQKA 4PK4A 2J62A 3L1PA 1LLIA 3BQLA 2PPXA 3PXPA 2X9YA 2WP9A 1XNRT 5FY1A 3LG7A 5FL0A 1CQTA 1XMQT 4U3CA 3LK42 3ZCIA 5AQQB 2BG9C 4TV9E 3C98B 3PUQA 1H7CA 1XWRA 4JV5T 3UFGA 5HWYA 3NXHA 4X4BA 4WYVA 1S7EA 1HFAA 3S8QA 3DM5A 4ISTA 2CBJA 2LOSA 2D5VA 5FXVA 4UV9B 2M6IA 4X4EA 1X9BA 1MMGA 1JFTA 1ZEEA 4QXBB 2XQ6A 2FJEA 3BDNA 2E8IA 1POUA 1HNXT 4QXCB 2UXDT 2IMLA 1IJ6A 3VWSA 4IDPA 3LQXA 1WR0A 2YN6A 2VEOA 2WQYA 2XASB 4KP3C 2YINA 2WU5A 1IJ5A 4HFEA 1JNZA 3QYXA 1ZS4A 2CPTA 4AKGA 4PU4C 2KLQA 3U3IA 4AXPA 2C5IT 2XAFB 4YHHT 3P4SA 2E5VA 2NW8A 5L47A 1YSEA 5JR9B 4ZI3D 2LYJA 3M65A 3UQ4A 5ABEA 2BNNA 2JQQA 1SA0E 4NDWA 2I6HA 4CN6A 1JNRA 5C2TA 3ZSTA 4B3ST 1ZP0A 3DP7A 2PIJA 5L3CB 3AAIA 5HYAA 4ADZA 3UUMA 2W63A 3C64A 2DI4A 3WI3A 3B5MA 2CSFA 1FMVA 2JPFA 4A98A 1D0XA 4X1IE 3AE4A 4HGAA 2BNMA 2H7OA 2MOZA 2YDQA 4WZXA 4EGWA 4I6RA 2PFVA 2AW6A 3ZHMA 1J5ET 3CECA 2XCJA 2I0MA 2Q9QA 3ONXA 2E9XA 3IBPA 1D0ZA 5KX5E 3RYHE 3MLFA 1CHUA 4TWFA 3NZLA 1W0AA 4HN9A 2LYKA 4ZI2D 1ZZ9A 2LSKA 4YXDA 2EHOA 2KWIB 2HPJA 3C4WA 4UV8B 4IE0A 4OK0A 2NW9A 2IUOA 2L9QA 3JC6D 3ZN0B 4F6RC 4MCTA 3KVAA 4CI2B 4LFCT 5CA1E 2PXVA 5DQVA 3J9X1 3TLVA 1Y9QA 3PU8A 1YKHB 4YFSA 5EK4A 3VRAA 2OR1L 2FBWA 3OYXA 2X67A 2LLWA 3ETVA 2JQ9A 4YHJA 2V6YA 2MQKA 1D1AA 1SQ8A 2K9AA 4QXHB 3CKDA 4OYKA 2DNXA 5A7LA 3P4WA 5FVKA 3AEAA 1YW0A 3QQ6A 2IUBA 5AQSB 2XJ3A 4CXWA 4IL9A 3ZYKA 1WLXA 4H63V 1OEDC 1YQ4A 1IZNB 2GZUA 4JQDA 3ABVA 3UFDA 3B13A 2ZM2A 3FZMB 1KNZA 2KZ8A 5CGMA 1CJGA 2H7VC 3OPCA 3GZDC 2PTFA 3AA6B 5LP6E 2DWGA 2LLVA 1VRBA 3BQKA 1JH9A 2HSGA 5DQWA 1JFSA 2WWUA 3RC3A 4P09A 2PUEA 4QH5A 2YDSA 1FEWA 2MTQA 2X51A 3AVRA 2LYLA 4ER0A 2XAGB 3EUSA 4UF0A 4I43B 2VASA 5L2LA 4M1PA 4G2AA 1WETA 2JIWA 4OB4A 2V7MA 4FJOA 4PNIA 2BNOA 2XY8B 3SFEA 3TEPA 4FN3A 4A97A 2BJCA 5H6QB 5LMUT 3ZN1B 4IIJE 4L0RA 3ONLC 2W62A 3PDYA 2DL1A 4X4IA 4MFRA 2BVLA 2W67A 3A9ZA 1KEYA 3QB5A 2E9XD 5FXXA 2X0YA 1LQCA 2PXQA 3A7MA 4DIDB 4IE5A 4Z5DA 2X9WA 3OKQA 2IDOB 2EHOD 4ASKA 4DO0A 1T98A 2VQFT 2JVLA 3AE9A 3AEGA 3ZJ2A 4DV0T 2WBLA 3N2GE 3R6NA 4IREA 2V8SV 5AFUL 4WBOA 3AEDA 4LF9T 1ZAYA 3F57A 4ISSA 4JCYA 5FL1A 3ZPXA 4Q25A 2BG9B 1KF6A 4H63H 3N9NA 2GRMA 4DE9A 4U2YA 2XQ7A 4Z59A 2B5AA 2W4XA 1HF0A 2BBHA 4NXMT 4ILUA 4YBAA 1B0NA 2QRXA 5L3FB 3G06A 5HXHA 2WS3A 2NR4A 2VKOA 2J4GA 2XAJB 4X1KE 5JQGE 2WZIA 3W15B 3FZFB 3KDSE 5AQPB 3UU4A 4X62T 1HNZT 2L1PA 3RIUC 4PU7A 4GK5E 2IHR1 2LKHA 4UVCB 5JDNA 4IWRA 1O3XA 2RPAA 4UELA 2X68A 4QHOA 1HNWT 4X4DA 2YOEA 5JRCA 3KV6A 4ER5A 2VB6A 4YTPA 3LFPA 3NVOA 4IE4A 3OMTA 4LF7T 2BG9E 2VVNA 4HFBA 4EIWA 4QX7B 2KZ7B 5DABA 2UXNB 2J7WA 3KL4A 2ZM6T 1WRDA 5HAXA 1U5PA 3U3WA 4KMCA 4HWCA 4DE8A 3K3NA 4L9IA 2BDEA 4IE6A 2HN2A 2WIUB 2LRKA 2AXZA 2UXXB 5HXCA 3H37A 5EK2A 2ZLYA 2K24A 4DV7T 2PUAA 3Q5WA 3F6WA 4EOZB 3T1YT 4EZ4A 1QLBA 3TLWA 3FHNA 3GA8A 4JI0T 1MIYA 4AKLA 4B3MT 3TFLA 4EEBA 4DR4T 2M6BA 2XQ5A 1FJGT 4LFBT 2XI8A 4JLEA 3VKGA 1T8BA 4YG7B 4HWHA 3UTKA 1X2LA 3SX0A 2MXDA 4JEUB 5AQRB 2CROA 2IVGA 2LKGA 2WUSR 2EWTA 2CBIA 5JDHA 4QH4A 5JVDE 2LLYA 5LHGB 2WWVA 4HFIA 3AXJA 5LOVE 3KV4A 2LE8A 1UK5A 3N2KE 2CCQA 3GMIA 5EK3A 1Y7YA 4J2CA 1N34T 1QP0A 4U7IA 3ZC1A 2CWYA 2VKHA 2XQAA 2PUCA 4ZZCA 3CWZB 4IDQA 4YLHA 1J5WA 4JI1T 4NPPA 4AI6A 2AXVA 2IIUA 4CXXA 4BA9A 4ZI7E 1JWLA 2CMRA 4GKJT 4EK9A 3CQXC 5LBMA 3UU6A 1ZHCA 3SRZA 2F4VT 2LNMA 3CX6B 3DTOA 2CRBA 3OWQA 2FUPA 3Q5EA 4EAHA 1OEDB 3I0QA 1ZOYA 2AXDS 3Q9DA 4PJLA 5AQUB 4LMKA 2V3CC 4XZCA 2FJRA 3SR4A 2EBYA 4TX5A 4PJNA 1B7TA 2CE7A 3PUGA 3NROA 5DRTA 5AQOB 1GQEA 4Z91A 3JXDL 3T1HT 3AB3B 2A2FX 2J7UA 3AE5A 3V5UA 2UXCT 2PXTA 3HZIB 1NW3A 2FJAA 2XPKA 5LGUB 4IE7A 1ADRA 2IV1A 3QWGA 2L3LA 5JDMA 2E5LT 1HF8A 1EZ3A 2LJLA 3JXBC 4AIUA 4IHJE 4AKHA 2PXFA 2VL8A 2XXPA 3GWHA 4JYAT 3CIRA 1RIOA 4ANJA 1WYCA 2V5CA 2LT3A 4YG4A 1OEDE 5ABGA 1ZUGA 4CI3B 1MNDA 1W09A 3CVRA 3N9PA 2XAHB 4J1WA 1BR4A 3C4ZA 1HS7A 5ABHA 4YY3T 5JR9A 3ZCJA 2QGSA 4U74A 1NWMX 2UU9T 2V1DB 2YBDA 2WDVA 4TN7B 3IEEA 2VURA 1MMNA 2D5UA 5EZYE 1HTJF 4ILAA 3AEBA 4ILBA 2PXUA 3PV0F 4GYSA 3ZSSA 4LMLA 4X4GA 3N9MA 2WCAA 4U7YA 4C90A 3KJXA 3UWPA 4HWFA 1VCTA 4MLKA 1CUNA 4I50E 2KT9A 1XWMA 2UUBT 4I6TA 2PUFA 2XZEA 2XM1A 3QNUA 2PXPA 5FY0A 5AQLB 5JDFA 4I55E 4NXNT 4Z5CA 2IC9A 4AQFC 4DV2T 2W2UA 1Z8UA 3RPUA 4UR9A 2IVBA 4EB6E 5DRYA 5ABFB 2DWKA 5HXEA 1X57A 5DJQC 3LK2B 2XTLA 3V5SA 3SWHA 3IHRA 2NW7A 2W0GA 4UVAB 2Z6EA 1PRUA 4DNDA 2Y48B 1GT0C 2LYSA 4PFPA 5LHIB 1QP4A 1UXCA 2VK9A 1WFDA 3JXCL 2BS2A 3N5LA 3CMLA 2R63A 4CN4A 5FKYA 3JAEA 2OA5A 3FB2A 2BZBA 5L3BB 3HL6A 4KBMB 1IC8A 4DV1T 3RYCE 3H3MA 2M4HA 5L3GB 4GKKT 5HXRA 2BKNA 3B57A 4PW8A 5LXTE 3VKHA 2DHRA 3RX6A 4B3RT 4UIGA 3OQNA 3NWIA 3OKZA 4ZXLA 4Z8XA 2JMKA 3O1JA 5DSXA 3EVYA 4C91A 3RQUA 3NBXX 4DR1T 4QKNA 3K8PC 3GN5A 4KHPT 4TZ4C 2KPJA 5GAGi 4IA8A 2Q9QB 1LVFA 4PJJA 4UEMA 2D0UA 2XM2A 5IUXA 5FP3A 3MKDA 4ERRA 4TWHA 4OX9T 1M7KA 3KBTA 2LHRA 1AJ3A 2CM0A 2XIUA 1G73A 2BS3A 2N2NA 2EHOB 4YJ2E 4EZIA 2HINA 3RHWA 3PE0A 5L3DB 1UUSA 2KXPB 2YK0A 4O4LE 3VR8A 3QK6A 1SUMB 3FMYA 2CXDA 2WU2A 4ZI3C 3VHLA 5LG4A 2I59A 2HN1A 3L8RA 2VVSA 4I8TA 2JCGA 2LSJA 2BKPA 5F3JA 3VU7H 2NWBA 2HH7A 3TLUA 4CN1A 2HCSA 4DV5T 5AQMB 4HFHA 4JI8T 1Y64B 1DW9A 3SCFA 1MNEA 2W61A 4O4JE 3A5XA 2WY2A 3LSVA 4B6XA 2XQ4A 3O1HA 3RF1A 3AVSA 4H9QC 4X4CA 4HWDA 2BS4A 3RRWA 4AKRB 4O2BE 3ZKRA 4JI6T 3MJXA 2LYPA 2A72A 2IW5B 3CQGB 5AQIB 2JRKA 1WH8A 2VL0A 3UFEA 4CZZB 4KHZF 3G5GA 1L1MA 2FJBA 3ZMUB 2FJDA 5DT2A 2WB5A 3CX8B 1XDOA 5AQNB 4JEHB 3G0TA 3TKLB 3ZHIA 4XAXB 1LKXA 2BG9A 2CLYC 2FFHA 3MEJA 1HX1B 1LVKA 2NTXA 4DR5T 2MYSA 1D1CA 5AQTB 1MIVA 4BJMA 4BAYB 2VQET 4Z5HA 3RC8A 2PXBA 3BS3A 4HKAA 3PUVF 1HG2A 3T8OA 1D1BA 3CLCA 1OWAA 3AE3A 5LYJE 2PUBA 3JC6C 4TWDA 3RYIE 2H89A 2UUAT 3ANWB 1R8IA 4H9NC 2PG8A 2LRLA 4IT4A 3SOLA 2JQEA 3PUZF 3FBZA 1Y01A 5L3EB 3UU5A 4X5TA 3GZCA 3LJCA 2MPKA 5JH7E 2GRLA 4EXTA 1NENA 1YD8G 3PTRB 2EF8A 1N36T 5ETWA 4HFDA 4CXYA 2IVQA 1XNQT 3P4QA 1XDPA 3EAMA 1LCDA 5AQVB 2XQYA 1QP7A 3NRYA 3P50A 1T7SA 4P0AA 3F51A 3KXAA 3K1SA 4WBNE 2IC6A 3KV9A 1NERA 5CA0E 4JI3T 2LM9A 3HA4A 4PFOA 2D9DA 4YARA 1I94T 3BK9A 3NKZA 5FY7A 2OFYA 4GYRA 1QSDA 3MZKB 1IBMT 2RA1A 3PURA 2IU7A 5JDGA 3UQ7A 1OCTC 2LOPA 3DJBA 3E08A 1WYBA 2QVAA 3VRBA 2MAWA 5AQGB 5GAHi 2O4AA 4DV6T 4Y42A 3KZ3A 2HHHT 5KMGP 2MEZA 3TRBA 1YQ3A 3QOFA 1QQAA 3K3OA 5FMNA 3N9OA 3I0OA 3RIAA 4E7SA 2V5DA 4EZHA 2PXDA 3I9YA 3JAFA 2GK9A 4NUUA 2Q9QC 1E3OC 2E9XC 3P8CD 4EEDA 2YKSA 4N78D 1ZZ8A 3OP9A 1VOMA 2R1JL 2PUDA 4V1Av 1ZPQA 4QWNB 1PNRA 3KV5A 3JCFA 1KNPA 2H88A 2EHOC 4A56A 4GK0E 4WW0A 5LJNA 4OBMA 2LHNA 3LBXB 4AQGA 3PUYF 2N9DA 5C8YE 2NTYA 3MXZA 3AEFA 2YEVC 3HR0A 3RZZA 1HQ1A 5C3JA 4G63A 5E0OA 3QFIA 4DMWA 3EDUA 1YXRA 3HKCE 1IBLT 2ES0A 3L39A 3AE8A 3UUXB 4UVBB 1OEDA 1NAFA 4O8BA 4LMJA 2AE9A 3FZKB 4P1NA 5IHYA 3I9WA 2KEJA 5JUWA 3GZDA 3E22E 4IVZA 2XUEA 2CXLA 4HFVA 3PUXF 2NP9A 4OFZA 4YJ3E 3RGLA 2YDRA 5K98B 1HCIA 2XSBA 2QYWA 3ONJA 1LMB3 4GIWA 5LMNT 5J2TE 2K5BB 2PXLA 4FBIA 4ER7A 4PAGA 3PE5A 2IAKA 3KVBA 1R63A 5HEJA 2LYRA 5HXSA 1T72A 3RH3A 4YSXA 2WSSV 5IWAT 3EABA 1WIZA 1SE7A 4YSYA 3ZT6A 5L4HA 1O4XA 3D1NI 2W66A 3FYMA 4Q2JA 1QPZA 2JJ9A 2K48A 3L3PA 1I6ZA 5JDLA 5LBQB 4HEAA 4B3TT 4PJMA 2BKOA 5FYMA 2ZM8A 3S4UA 1EFAA 3ETUA 3Q5DA 2OLTA 3N9QA 3J7Yq 1N32T 2CWOA 2WDQA 4LF5T 1KFYA 3M3ZB 1BR2A 4F8HA 4CI1B 3ZC0A 3VK0A 3RKOA 4JI2T 1S35A 2X9XA 1U4QA 2K3WA 1G8XA 4X64T 2N1GA 3G7DA 3LDQB 3H5TA 5LGTB 3A8YC 2LEHA 2V26A 3WAJA 5CFBA 5LG3A 4DUZT 2CLYB 1ZZBA 2PXEA 5FVLA 4JI4T 1ZZCA 2ICPA 3QOWA 2XQ8A 1ZVVA 2KSRA 1UGOA 2WAUA 2ODUA 4JCXA 2ICTA 2V7LA 4KI0F 2AWIA 3OYZA 5IYZE 4EKIA 3AA0B 3OJAA 2D0TA 2C5KT 5L4EA 4TNVA 3QUJA 4ILCA 1VPWA 2LSGA 3U78A 4ZZBA 5ABFA 4YTMA 4NIQA 1UCUA 4HE8A 2DLRA 2LM2A 2CHOA 2L49A 3R1FA 3RIUA 4I0UA 2XJ7A 2OV9A 2WZHA 4DR3T 2C0SA 2UXBT 1WR6A 5A1LA 5LCYA 4ZOLE 3MACA 1SHZC 4ZS3A 5HCMA 5F5WA 4Z58A 3E0ZA 3C51A 3M9LA 4KX6A 4WVLA 1IAPA 1MFQC 4COFA 2CXFA 5DTMA 2KEKA 2Y6XA 1U2ZA 2H3RA 4DV3T 3CQCB 2G0UA 2JMHA 1QQBA 3ZMSB 3ZT7A 4ZHQE 2LSIA 3UUBA 4OYJA 4H9OC 4FI5A 4H9PC 3HI2A 3R84B 4MBQA 3H3AA 4X1YE 4TNWA 3PUSA 3OVUA 3FXDB 4F8DA 2HPLA 4DBQA 4OHFA 1E1HB 2C5JA 3ZMTB 1IBKT 2PE5A 1LCCA 1MMAA 3SS1A 3UT5E 4X66T 5H6RB 3F2EA 4X20E 2D2SA 3KFWX 2XXQA 3EUHA 4L5GA 2LSYA 3O4XE 4IL4A 3VR9A 4EYYR 3FXEB 5AQJB 3ZLIA 2KNDA 3A9YA 4AKIA 3P4PA 2WDRA 2B1EA 3UU8A 3O9XA 4HFCA 1KNRA 4GQMA 2E9XB 3P7IA 1N33T 4DV4T 4X65T 1QZXA 3FBLA 2X0LB 1DU2A 4X4HA 3R09A 3X1DA 1KK7A 3QOXA 5CJ5A 2UUCT 3TLSA 4A5XA 1MIWA 2V7KA 2AXUA 4JI5T 5DTRA 1HG5A 4PU3C 3PUAA 1FMWA 3MA9A 3SCHA 5BMVE 5JDQA 2VKDA 3ZYMA 4U33A 5LGNB 3O1IA 5LHHB 2PUGA 4E7ZA 4KUMB 4I4TE 3C4XA 1WH6A 1RZRA 1FIOA 4YG1A 3GN5B 4LF8T 2V6YB 4EYUA 2VKJA 2XQ9A 3A9XA 4HTEA 3RI5A 2O49A 5HEGA 4DMVA 2A3DA 1XZYA 1UXDA 2XHEB 4ZS2A 1MMDA 5CB4E 4LF6T 3EDVA 3EHZA 3NZPA 3NDBB 3QC9A 3Q5XA 3BQIA 2WM9A 3HKEE 2YU2A 3EI0A 1AU7A 3UUNA 2L8KA 3AA7B 3AE6A 2KEIA 4MCXA 2ODRD 3ESLA 3DNVB 2B76A 3PUWF 3ANWA 5AQKB 2V7JA 5LA6E 4AISA 3F31A 3K3QC 2J47A 3NRXA 4PU8A 4I6UA 1BDIA 3ZJ1A 3HKBE 4UF0B 4ZI2C 1ZKEA 2Q9QD 1NEQA 3FZHB 3N9LA 1RPEL 2QA7A 4H9RC 5F8PA 2V7IA 1DULA 4GHJA 3OBVE 5HEHA 1WCRA 4YTNA 3B7HA 2HCNA 1PRAA 4CQIA 5AQHB 5HCJA 4PK6A 1E7PA 2CA5A 3KBUA 1M62A 4MALA 2J1DG 4BJNA 3ME5A 3OQMA 1ZV4X 5JR9C 4DR7T 5J2UE 2WMNA 3OQOA 3I1AA 2W00A 4U72A 4IDOA 5LB7B 2LYQA 3RYFE 1V9DA 3F52A 1US7B 4HRAA 5KDMC 2KWHA 2JQHA 2A6CA 3MK7C 1QB2A 1ZZ7A 2E2AA 3Q2MA 2Y8DA 5ADXL 3LK3B 2PBIA 3RQWA 3IA3A 5HWXA 2V6XA 3TELA 1ZZ6A 4IDZA 2H8RA 4LF4T 4MHCA 3RRCA 3PJAJ 2RP4A 3OTOT 4O8SA 4UXNB 4O4HE 2AUWA 1BDHA 2HFZA 3P4RA 5FNVE 3RKGA 4LFAT 1UURA 3UU3A 5FXZA 4HWIB 2CHNA 4H9SE 4AQFA 3L09A 3QB5K 4EKGA 4DUYT 5J1GA 3AECA 1RZRD 2VWAA 3TLTA 2A9UA 5M4YA 4EV6A 3LISA 2KMFA 1E2AA 4EQZA 5BR8T 3SCGA 4XBFB 3RIFA 2MBGA 4ER3A 3JADA 1BR1A 2XSAA 1L0VA 3BD1A 1YKEB 4P0BA 1X79A 5FXWA 3WAKA 3AE2A 2O38A 3CROL 2LCVA 2X0HA 3LBXA 5JRCB
chains in the Genus database with same CATH topology
1RZSA 2OA5A 4MFRA 1PERL 3FB2A 5LBQB 2BZBA 4HEAA 2BVLA 5L3BB 3AA1B 3HL6A 4KBMB 2P9BA 3C50A 4JUYA 4PJMA 1IC8A 5FYMA 2ACXA 2ZM8A 2E9XD 5FXXA 3RYCE 3S4UA 1EFAA 3ETUA 3ZYLA 5L3GB 3N9QA 3J7Yq 1LQCA 3FYAA 2CWOA 2ZMAA 5HXRA 2YU1A 2XSDC 2ZM0A 1BR2A 1OXZA 4IE5A 3HKDE 5LNKA 4J1XA 1QUUA 3GBFA 4Z5DA 2X9WA 3OKQA 3B57A 4CI1B 4PW8A 5LXTE 3VKHA 3ZC0A 2DHRA 3RX6A 3VK0A 2CEAA 3RKOA 1S35A 4UIGA 3OQNA 2EHOD 2PJQA 2X9XA 1UTXA 1U4QA 4ASKA 4DO0A 1LRZA 1T98A 1G8XA 2N1GA 3G7DA 3PU3A 4Z8XA 2JVLA 2DCFA 3ZJ2A 2X9HA 3H5TA 2JMKA 2WBLA 3ZPOA 2LEHA 3O1JA 5LGTB 4IGUA 3N2GE 5TAOA 3R6NA 5AFUL 2V26A 4WBOA 3EVYA 3WAJA 4C91A 4TUYE 3CPZA 3N2OA 1ZAYA 2XAQB 3F57A 4ISSA 4JCYA 2CLYB 2ODVA 3ZMVB 1ZZBA 3NBXX 4QKNA 1ZZCA 3ZMZB 3K8PC 2ICPA 4K0UA 1R69A 3GN5A 4TZ4C 2KPJA 4H63H 4IA8A 1ZVVA 2GRMA 3N9NA 3NZQA 2Q9QB 1LVFA 4PJJA 2WAUA 4UEMA 2ODUA 4JCXA 2D0UA 3D0TA 2ICTA 4Z59A 5FP3A 2V7LA 2SPCA 3MKDA 2AWIA 4WNKA 3OYZA 2BVMA 4ERRA 2B5AA 1HF0A 5IYZE 1BR0A 3AA0B 3OJAA 2D0TA 4ILUA 2C5KT 3KBTA 4YBAA 2LHRA 2CM0A 2XIUA 1AJ3A 1B0NA 3QUJA 1VPWA 5L3FB 1HX8A 1G73A 2LSGA 3U78A 2N2NA 2EHOB 1UX4A 3IF8B 4DBRA 4YJ2E 5HXHA 4O2AE 1UCUA 2VKOA 2HINA 2XAJB 4HE8A 1Z0PA 3KINB 2DLRA 4X1KE 3PE0A 5JQGE 2L49A 3R1FA 4TV8E 5L3DB 3W15B 3KDSE 3AAAB 4O4IE 2KXPB 2YK0A 4O4LE 1PRVA 1DWKA 3QK6A 4NUVA 4PU7A 3FMYA 2CXDA 4ZI3C 4GK5E 2C0SA 3VHLA 1WR6A 2M67A 4UVCB 2I59A 5LG4A 1S94A 5A1LA 4PK5A 4IWRA 5JDNA 5LCYA 1O3XA 4UELA 2X68A 4QHOA 4I8TA 2JCGA 2LSJA 4X4DA 4QX8B 4DVDA 5F3JA 4ZOLE 2NWBA 3MACA 3VU7H 1SHZC 2HH7A 4ZS3A 5JRCA 3KV6A 2L8NA 2NOXA 2WMOA 2VB6A 4Z58A 3UULA 3E0ZA 3LFPA 3C51A 3ZEFB 4IE4A 1Y64B 1DW9A 3OMTA 3SCFA 1MNEA 2W61A 1IAPA 4O4JE 3A5XA 3CX7B 4EIWA 2CXFA 1OSLA 3AAEB 2KEKA 4QX7B 4B6XA 3O1HA 5JREA 2Y6XA 2H3RA 1UX5A 3QF3A 3AVSA 2KZ7B 3CQCB 4X4FA 2G0UA 4H9QC 2KINB 5DABA 5LJMA 4X4CA 2UXNB 5GONE 2JMHA 3RRWA 4AKRB 4O2BE 1WRDA 1QQBA 3LFMA 5HAXA 3ZMSB 1U5PA 3MJXA 2LYPA 4ZHQE 3U3WA 2LSIA 2A72A 3IVPA 3CQGB 2IW5B 2JRKA 1WH8A 4KMCA 4OYJA 3UFEA 4CZZB 3K3NA 4L9IA 2X66A 3G5GA 2BDEA 3ZKCA 4H9OC 4GOUA 1D0YA 4IE6A 4FI5A 4H9PC 1L1MA 3HI2A 3R84B 3ZMUB 4PK4A 2WIUB 2AXZA 3L1PA 1LLIA 4MBQA 2UXXB 5HXCA 3H3AA 3H37A 3CX8B 3BQLA 4X1YE 5EK2A 2PPXA 2ZLYA 3PXPA 4JEHB 2K24A 2X9YA 3PUSA 3TKLB 3ZHIA 2PUAA 3FXDB 3F6WA 4F8DA 2HPLA 3Q5WA 4XAXB 1LKXA 5FY1A 2CLYC 3LG7A 4EOZB 4EZ4A 4DBQA 1CQTA 4OHFA 1E1HB 1LVKA 2C5JA 3ZMTB 2PE5A 2NTXA 3LK42 1LCCA 1MMAA 3SS1A 3UT5E 3ZCIA 4TV9E 3C98B 3FHNA 3GA8A 1H7CA 3PUQA 3F2EA 5H6RB 4X20E 2D2SA 3KFWX 1MIYA 1XWRA 2MYSA 3EUHA 4L5GA 4AKLA 1D1CA 5HWYA 2LSYA 4X4BA 3O4XE 1MIVA 4BJMA 1S7EA 1HFAA 4EYYR 3S8QA 4ISTA 3FXEB 4BAYB 2LOSA 4Z5HA 3ZLIA 2D5VA 2XI8A 2KNDA 3RC8A 3BS3A 4HKAA 4JLEA 3VKGA 5FXVA 1HG2A 4YG7B 4UV9B 3T8OA 4X4EA 1D1BA 3CLCA 1OWAA 3UTKA 4AKIA 1MMGA 1X2LA 1JFTA 5LYJE 2PUBA 3JC6C 1ZEEA 4QXBB 3RYIE 2B1EA 4JEUB 3O9XA 3ANWB 2CROA 2IVGA 4H9NC 4GQMA 2PG8A 2WUSR 2E9XB 2EWTA 3BDNA 3P7IA 2E8IA 5JDHA 1POUA 3SOLA 4QXCB 5JVDE 3FBLA 1IJ6A 2X0LB 3FBZA 4X4HA 5LHGB 1KK7A 5L3EB 5LOVE 3KV4A 2LE8A 3LJCA 3N2KE 2CCQA 2XASB 3GMIA 5EK3A 4KP3C 5JH7E 1Y7YA 2GRLA 2YINA 4J2CA 1QP0A 1MIWA 1IJ5A 2V7KA 3ZC1A 3QYXA 2AXUA 2CWYA 4EXTA 1ZS4A 1YD8G 2VKHA 1HG5A 3PTRB 4PU3C 2EF8A 3PUAA 1FMWA 4PU4C 3SCHA 3MA9A 2KLQA 5ETWA 2PUCA 3U3IA 4AXPA 3CWZB 2C5IT 4YLHA 5BMVE 5JDQA 2XAFB 4CXYA 2IVQA 2VKDA 3ZYMA 2NW8A 1YSEA 5JR9B 1LCDA 5LGNB 3O1IA 4ZI3D 4AI6A 5LHHB 2AXVA 4CXXA 2LYJA 2XQYA 1QP7A 2PUGA 3M65A 3NRYA 2BNNA 4P0AA 2JQQA 1SA0E 4BA9A 4ZI7E 4NDWA 4E7ZA 3F51A 1JWLA 2CMRA 4I4TE 4KUMB 3KXAA 3C4XA 1WH6A 1RZRA 4WBNE 1FIOA 3CQXC 4YG1A 3GN5B 5LBMA 2IC6A 3KV9A 1NERA 5CA0E 1ZHCA 3SRZA 3DP7A 2VKJA 4EYUA 2PIJA 3CX6B 3DTOA 2LM9A 5L3CB 3HA4A 4PFOA 4HTEA 4EAHA 3I0QA 3AAIA 4YARA 5HYAA 2O49A 3BK9A 4ADZA 4DMVA 2A3DA 3Q9DA 5FY7A 4PJLA 2OFYA 1UXDA 2W63A 1QSDA 2XHEB 4GYRA 3UUMA 3MZKB 4ZS2A 3C64A 1MMDA 5CB4E 2DI4A 2FJRA 2RA1A 3EDVA 4XZCA 3WI3A 2CSFA 1FMVA 3PURA 2EBYA 2IU7A 3NZPA 4TX5A 5JDGA 1OCTC 2JPFA 2LOPA 3DJBA 1B7TA 1WYBA 3E08A 3QC9A 1D0XA 4PJNA 4X1IE 3Q5XA 2CE7A 4N78D 3BQIA 3PUGA 2WM9A 4HGAA 3HKEE 2YU2A 2O4AA 3JXDL 2BNMA 4Y42A 1AU7A 3KZ3A 2H7OA 3AB3B 3UUNA 2A2FX 2MOZA 2L8KA 5KMGP 2MEZA 3TRBA 4I6RA 2PFVA 3AA7B 2AW6A 3ZHMA 2KEIA 4MCXA 1QQAA 3V5UA 3K3OA 5FMNA 3CECA 3HZIB 2XCJA 3ESLA 3DNVB 3I0OA 3N9OA 3ANWA 2V7JA 5LGUB 5LA6E 4IE7A 1ADRA 4E7SA 2Q9QA 3ONXA 2IV1A 2E9XA 3F31A 3IBPA 3K3QC 3NRXA 3QWGA 1D0ZA 4PU8A 2L3LA 4EZHA 5JDMA 5KX5E 1HF8A 1EZ3A 4I6UA 3I9YA 1BDIA 3MLFA 2GK9A 3RYHE 2LJLA 3ZJ1A 3HKBE 4NUUA 4UF0B 3JXBC 2Q9QC 1E3OC 2E9XC 3P8CD 4IHJE 4AKHA 4ZI2C 2VL8A 1ZZ8A 3OP9A 1VOMA 1ZKEA 2Q9QD 2R1JL 3GWHA 1NEQA 2PUDA 3N9LA 4HN9A 4V1Av 1RPEL 2LYKA 1RIOA 1ZPQA 2QA7A 4QWNB 4ANJA 4ZI2D 1ZZ9A 2LSKA 4H9RC 1PNRA 1WYCA 2EHOA 3KV5A 5F8PA 2KWIB 2LT3A 4YG4A 2HPJA 3C4WA 4UV8B 2V7IA 4GHJA 4IE0A 1ZUGA 4CI3B 3OBVE 4OK0A 2EHOC 1MNDA 2NW9A 4A56A 4GK0E 4WW0A 3B7HA 1PRAA 3CVRA 4CQIA 2IUOA 5LJNA 2L9QA 2LHNA 3JC6D 2XAHB 3N9PA 3ZN0B 4F6RC 4J1WA 3LBXB 4MCTA 3KVAA 4CI2B 1BR4A 3C4ZA 4AQGA 5CA1E 4PK6A 1HS7A 2N9DA 2CA5A 2NTYA 5DQVA 5JR9A 3ZCJA 3KBUA 3J9X1 5C8YE 3MXZA 2QGSA 4MALA 1Y9QA 3PU8A 1YKHB 2J1DG 4U74A 4YFSA 4BJNA 3OQMA 1ZV4X 5JR9C 1NWMX 5EK4A 2OR1L 5J2UE 2YEVC 2V1DB 3OQOA 2WMNA 3HR0A 3RZZA 2W00A 3I1AA 4U72A 3OYXA 2X67A 2LYQA 4G63A 5E0OA 1V9DA 3ETVA 3F52A 1US7B 3RYFE 5KDMC 4DMWA 3EDUA 4TN7B 2KWHA 3IEEA 3HKCE 4YHJA 2A6CA 3MK7C 2MQKA 1D1AA 1MMNA 1SQ8A 1ZZ7A 2D5UA 2ES0A 2K9AA 2Y8DA 3Q2MA 4QXHB 3CKDA 3LK3B 5EZYE 1HTJF 3UUXB 4OYKA 5ADXL 2PBIA 4UVBB 2DNXA 5A7LA 5HWXA 1YW0A 4IDZA 1ZZ6A 4GYSA 3QQ6A 2H8RA 4X4GA 1NAFA 4CXWA 2XJ3A 3N9MA 4AKGA 4O8BA 3ZYKA 4C90A 1WLXA 4H63V 4MHCA 3RRCA 5IHYA 3KJXA 2GZUA 1IZNB 2RP4A 4O8SA 4MLKA 4JQDA 4O4HE 4UXNB 3I9WA 2KEJA 2AUWA 1BDHA 1CUNA 3UFDA 4I50E 2KT9A 3B13A 5FNVE 2ZM2A 4I6TA 3E22E 1KNZA 2KZ8A 2PUFA 4IVZA 5FXZA 2XUEA 4H9SE 1CJGA 2CXLA 2H7VC 4HFVA 2NP9A 4OFZA 4AQFA 5FY0A 3AA6B 4YJ3E 3L09A 2DWGA 5LP6E 5JDFA 1VRBA 4I55E 3BQKA 5K98B 1JH9A 2HSGA 4Z5CA 5DQWA 5J1GA 1JFSA 1HCIA 2IC9A 4AQFC 1RZRD 2VWAA 2WWUA 3RC3A 4P09A 1LMB3 3RPUA 2PUEA 5M4YA 4GIWA 3LISA 2KMFA 2IVBA 4EB6E 5J2TE 1FEWA 2K5BB 2MTQA 2X51A 3AVRA 4FBIA 2LYLA 4PAGA 3SCGA 2IAKA 2XAGB 2DWKA 3EUSA 5HXEA 1X57A 4UF0A 4XBFB 3KVBA 4I43B 1R63A 2MBGA 2LYRA 3LK2B 5DJQC 5HXSA 2XTLA 3V5SA 3SWHA 3IHRA 2VASA 5L2LA 2NW7A 2W0GA 3RH3A 1BR1A 4M1PA 4G2AA 4UVAB 1WETA 2Z6EA 3BD1A 1YKEB 1PRUA 4OB4A 2WSSV 4DNDA 2V7MA 4FJOA 4PNIA 2BNOA 2Y48B 1GT0C 2LYSA 4PFPA 4P0BA 1QP4A 5LHIB 1UXCA 1WIZA 1X79A 4FN3A 2VK9A 3JXCL 5FXWA 3WAKA 2BJCA 5H6QB 1O4XA 3D1NI 3N5LA 3ZN1B 3FYMA 4IIJE 4L0RA 1QPZA 2O38A 2JJ9A 3CROL 2LCVA 2K48A 2W62A 3L3PA 3CMLA 3PDYA 3LBXA 2R63A 4X4IA 5JRCB 5JDLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IUO A;  1RZS A;  3QYX A;  2AXU A;  1DW9 A;  3OMT A;  3SCF A;  1PER L;  4J1W A;  1ZS4 A;  4MCT A;  4PU3 C;  2EF8 A;  4PU4 C;  3SCH A;  1OSL A;  2KEK A;  2PUC A;  1IC8 A;  4X4I A;  2IVQ A;  3QF3 A;  1Y9Q A;  1YSE A;  3LFP A;  4X4F A;  1EFA A;  3OQM A;  1LCD A;  1QP0 A;  4X4C A;  1LQC A;  2AXV A;  3FYA A;  2OR1 L;  2LYJ A;  2XSD C;  3OQO A;  1QP7 A;  1QQB A;  3RZZ A;  2PUG A;  2BNN A;  2LYQ A;  3F52 A;  4J1X A;  3GBF A;  2LYP A;  4Z5D A;  4NDW A;  3U3W A;  3F51 A;  1JWL A;  3IVP A;  3KXA A;  2A6C A;  1WH8 A;  1WH6 A;  2MQK A;  3VK0 A;  1RZR A;  1SQ8 A;  1ZZ7 A;  3OQN A;  4YG1 A;  3G5G A;  1UTX A;  3GN5 B;  3ZKC A;  1NER A;  1L1M A;  3HI2 A;  3G7D A;  5A7L A;  2JVL A;  2WIU B;  2PIJ A;  1ZZ6 A;  2AXZ A;  3H5T A;  3L1P A;  1LLI A;  3QQ6 A;  2H8R A;  4X4G A;  2XJ3 A;  2PPX A;  4O8B A;  3PXP A;  4YAR A;  1ZAY A;  2O49 A;  4JCY A;  3KJX A;  2GZU A;  3ZHI A;  2PUA A;  3F6W A;  4F8D A;  2OFY A;  1UXD A;  4JQD A;  1ZZB A;  2KEJ A;  2AUW A;  1BDH A;  3UFD A;  1CQT A;  2FJR A;  1ZZC A;  2PE5 A;  2CSF A;  2ICP A;  4I6T A;  1LCC A;  2KZ8 A;  1R69 A;  2EBY A;  2IU7 A;  3GN5 A;  2PUF A;  4IVZ A;  1OCT C;  2KPJ A;  3GA8 A;  4IA8 A;  1ZVV A;  2GRM A;  1CJG A;  1XWR A;  4JCX A;  2ICT A;  4Z59 A;  2AWI A;  2B5A A;  4X4B A;  1HF0 A;  3JXD L;  2BNM A;  2O4A A;  5K98 B;  4Y42 A;  2HSG A;  4Z5C A;  3KZ3 A;  1S7E A;  1JH9 A;  1AU7 A;  3S8Q A;  1JFS A;  1RZR D;  4YBA A;  2MEZ A;  2XIU A;  4Z5H A;  3TRB A;  2XI8 A;  4I6R A;  1LMB 3;  3BS3 A;  1B0N A;  2D5V A;  2AW6 A;  1VPW A;  2KEI A;  2PUE A;  4MCX A;  4YG7 B;  1QQA A;  3ZHM A;  3LIS A;  4X4E A;  2IVB A;  3CLC A;  3CEC A;  3HZI B;  2XCJ A;  3DNV B;  1X2L A;  4FBI A;  2LYL A;  1JFT A;  2PUB A;  2HIN A;  1ADR A;  3SCG A;  2L49 A;  3R1F A;  2IV1 A;  3EUS A;  1X57 A;  3O9X A;  3QWG A;  4PU8 A;  2CRO A;  1R63 A;  2IVG A;  2LYR A;  4I6U A;  1BDI A;  3MLF A;  4GQM A;  1PRV A;  2WUS R;  1DWK A;  2EWT A;  3JXB C;  3BDN A;  1E3O C;  1POU A;  4PU7 A;  1WET A;  3FMY A;  3BD1 A;  1PRU A;  1ZZ8 A;  3OP9 A;  4OB4 A;  2R1J L;  1NEQ A;  2PUD A;  4IWR A;  2BNO A;  2LYK A;  1RIO A;  1ZPQ A;  2LYS A;  1GT0 C;  1RPE L;  1QP4 A;  4X4H A;  1UXC A;  1WIZ A;  1ZZ9 A;  4FN3 A;  1PNR A;  3JXC L;  4YG4 A;  4I8T A;  2JCG A;  4X4D A;  2BJC A;  1O4X A;  3D1N I;  3FYM A;  4GHJ A;  1ZUG A;  1QPZ A;  2O38 A;  2L8N A;  3CRO L;  2LCV A;  1Y7Y A;  2GRL A;  2R63 A;  4Z58 A;  3B7H A;  1PRA A; 
#chains in the Genus database with same CATH topology
 1RZS A;  4U2Z A;  1PER L;  1HR0 T;  3AA1 B;  2P9B A;  3C50 A;  4JUY A;  2ACX A;  3ZYL A;  3AE7 A;  5HEO A;  3FYA A;  2ZMA A;  2YU1 A;  2XSD C;  2ZM0 A;  1OXZ A;  3HKD E;  5LNK A;  4J1X A;  1QUU A;  3GBF A;  5JTG A;  2CEA A;  2PJQ A;  2PXK A;  1UTX A;  1LRZ A;  4AQY T;  3AE1 A;  3PU3 A;  2DCF A;  2X9H A;  3ZPO A;  4IGU A;  5TAO A;  1W9R A;  4TUY E;  5DTQ A;  3CPZ A;  3N2O A;  2XAQ B;  3AEE A;  2ODV A;  3ZMV B;  3ZMZ B;  4K0U A;  1R69 A;  3GUU A;  4DR6 T;  1J1J A;  4ER6 A;  3NZQ A;  4DR2 T;  3D0T A;  4U31 A;  2SPC A;  4WNK A;  4Z90 A;  2ACZ A;  2BVM A;  3CK6 A;  1BR0 A;  4YT0 A;  5J0Z A;  1HX8 A;  5AQF B;  1UX4 A;  3IF8 B;  4DBR A;  4O2A E;  1Z0P A;  3KIN B;  5KXJ A;  4TV8 E;  3FZL B;  1W0B A;  3PJA A;  2BBJ A;  3AAA B;  4O4I E;  1VCS A;  1PRV A;  1DWK A;  4NUV A;  4IDN A;  2XQ3 A;  2M67 A;  1S94 A;  4PK5 A;  4K0K T;  4JBW F;  4DVD A;  4QX8 B;  2XXA A;  2L8N A;  2NOX A;  2WMO A;  3AXJ B;  2R6G F;  3UUL A;  3ZEF B;  1NEK A;  3SFD A;  1XMO T;  3CX7 B;  1OSL A;  3AAE B;  5JRE A;  4JI7 T;  1UX5 A;  4YSZ A;  3ZT5 A;  3QF3 A;  4X4F A;  2KIN B;  5LJM A;  5GON E;  4QH1 A;  3RLF F;  3LFM A;  5HEU A;  4ZEY A;  3IVP A;  2X66 A;  3ZKC A;  4GOU A;  1D0Y A;  2JQK A;  4PK4 A;  2J62 A;  3L1P A;  1LLI A;  3BQL A;  2PPX A;  3PXP A;  2X9Y A;  2WP9 A;  1XNR T;  5FY1 A;  3LG7 A;  5FL0 A;  1CQT A;  1XMQ T;  4U3C A;  3LK4 2;  3ZCI A;  5AQQ B;  2BG9 C;  4TV9 E;  3C98 B;  3PUQ A;  1H7C A;  1XWR A;  4JV5 T;  3UFG A;  5HWY A;  3NXH A;  4X4B A;  4WYV A;  1S7E A;  1HFA A;  3S8Q A;  3DM5 A;  4IST A;  2CBJ A;  2LOS A;  2D5V A;  5FXV A;  4UV9 B;  2M6I A;  4X4E A;  1X9B A;  1MMG A;  1JFT A;  1ZEE A;  4QXB B;  2XQ6 A;  2FJE A;  3BDN A;  2E8I A;  1POU A;  1HNX T;  4QXC B;  2UXD T;  2IML A;  1IJ6 A;  3VWS A;  4IDP A;  3LQX A;  1WR0 A;  2YN6 A;  2VEO A;  2WQY A;  2XAS B;  4KP3 C;  2YIN A;  2WU5 A;  1IJ5 A;  4HFE A;  1JNZ A;  3QYX A;  1ZS4 A;  2CPT A;  4AKG A;  4PU4 C;  2KLQ A;  3U3I A;  4AXP A;  2C5I T;  2XAF B;  4YHH T;  3P4S A;  2E5V A;  2NW8 A;  5L47 A;  1YSE A;  5JR9 B;  4ZI3 D;  2LYJ A;  3M65 A;  3UQ4 A;  5ABE A;  2BNN A;  2JQQ A;  1SA0 E;  4NDW A;  2I6H A;  4CN6 A;  1JNR A;  5C2T A;  3ZST A;  4B3S T;  1ZP0 A;  3DP7 A;  2PIJ A;  5L3C B;  3AAI A;  5HYA A;  4ADZ A;  3UUM A;  2W63 A;  3C64 A;  2DI4 A;  3WI3 A;  3B5M A;  2CSF A;  1FMV A;  2JPF A;  4A98 A;  1D0X A;  4X1I E;  3AE4 A;  4HGA A;  2BNM A;  2H7O A;  2MOZ A;  2YDQ A;  4WZX A;  4EGW A;  4I6R A;  2PFV A;  2AW6 A;  3ZHM A;  1J5E T;  3CEC A;  2XCJ A;  2I0M A;  2Q9Q A;  3ONX A;  2E9X A;  3IBP A;  1D0Z A;  5KX5 E;  3RYH E;  3MLF A;  1CHU A;  4TWF A;  3NZL A;  1W0A A;  4HN9 A;  2LYK A;  4ZI2 D;  1ZZ9 A;  2LSK A;  4YXD A;  2EHO A;  2KWI B;  2HPJ A;  3C4W A;  4UV8 B;  4IE0 A;  4OK0 A;  2NW9 A;  2IUO A;  2L9Q A;  3JC6 D;  3ZN0 B;  4F6R C;  4MCT A;  3KVA A;  4CI2 B;  4LFC T;  5CA1 E;  2PXV A;  5DQV A;  3J9X 1;  3TLV A;  1Y9Q A;  3PU8 A;  1YKH B;  4YFS A;  5EK4 A;  3VRA A;  2OR1 L;  2FBW A;  3OYX A;  2X67 A;  2LLW A;  3ETV A;  2JQ9 A;  4YHJ A;  2V6Y A;  2MQK A;  1D1A A;  1SQ8 A;  2K9A A;  4QXH B;  3CKD A;  4OYK A;  2DNX A;  5A7L A;  3P4W A;  5FVK A;  3AEA A;  1YW0 A;  3QQ6 A;  2IUB A;  5AQS B;  2XJ3 A;  4CXW A;  4IL9 A;  3ZYK A;  1WLX A;  4H63 V;  1OED C;  1YQ4 A;  1IZN B;  2GZU A;  4JQD A;  3ABV A;  3UFD A;  3B13 A;  2ZM2 A;  3FZM B;  1KNZ A;  2KZ8 A;  5CGM A;  1CJG A;  2H7V C;  3OPC A;  3GZD C;  2PTF A;  3AA6 B;  5LP6 E;  2DWG A;  2LLV A;  1VRB A;  3BQK A;  1JH9 A;  2HSG A;  5DQW A;  1JFS A;  2WWU A;  3RC3 A;  4P09 A;  2PUE A;  4QH5 A;  2YDS A;  1FEW A;  2MTQ A;  2X51 A;  3AVR A;  2LYL A;  4ER0 A;  2XAG B;  3EUS A;  4UF0 A;  4I43 B;  2VAS A;  5L2L A;  4M1P A;  4G2A A;  1WET A;  2JIW A;  4OB4 A;  2V7M A;  4FJO A;  4PNI A;  2BNO A;  2XY8 B;  3SFE A;  3TEP A;  4FN3 A;  4A97 A;  2BJC A;  5H6Q B;  5LMU T;  3ZN1 B;  4IIJ E;  4L0R A;  3ONL C;  2W62 A;  3PDY A;  2DL1 A;  4X4I A;  4MFR A;  2BVL A;  2W67 A;  3A9Z A;  1KEY A;  3QB5 A;  2E9X D;  5FXX A;  2X0Y A;  1LQC A;  2PXQ A;  3A7M A;  4DID B;  4IE5 A;  4Z5D A;  2X9W A;  3OKQ A;  2IDO B;  2EHO D;  4ASK A;  4DO0 A;  1T98 A;  2VQF T;  2JVL A;  3AE9 A;  3AEG A;  3ZJ2 A;  4DV0 T;  2WBL A;  3N2G E;  3R6N A;  4IRE A;  2V8S V;  5AFU L;  4WBO A;  3AED A;  4LF9 T;  1ZAY A;  3F57 A;  4ISS A;  4JCY A;  5FL1 A;  3ZPX A;  4Q25 A;  2BG9 B;  1KF6 A;  4H63 H;  3N9N A;  2GRM A;  4DE9 A;  4U2Y A;  2XQ7 A;  4Z59 A;  2B5A A;  2W4X A;  1HF0 A;  2BBH A;  4NXM T;  4ILU A;  4YBA A;  1B0N A;  2QRX A;  5L3F B;  3G06 A;  5HXH A;  2WS3 A;  2NR4 A;  2VKO A;  2J4G A;  2XAJ B;  4X1K E;  5JQG E;  2WZI A;  3W15 B;  3FZF B;  3KDS E;  5AQP B;  3UU4 A;  4X62 T;  1HNZ T;  2L1P A;  3RIU C;  4PU7 A;  4GK5 E;  2IHR 1;  2LKH A;  4UVC B;  5JDN A;  4IWR A;  1O3X A;  2RPA A;  4UEL A;  2X68 A;  4QHO A;  1HNW T;  4X4D A;  2YOE A;  5JRC A;  3KV6 A;  4ER5 A;  2VB6 A;  4YTP A;  3LFP A;  3NVO A;  4IE4 A;  3OMT A;  4LF7 T;  2BG9 E;  2VVN A;  4HFB A;  4EIW A;  4QX7 B;  2KZ7 B;  5DAB A;  2UXN B;  2J7W A;  3KL4 A;  2ZM6 T;  1WRD A;  5HAX A;  1U5P A;  3U3W A;  4KMC A;  4HWC A;  4DE8 A;  3K3N A;  4L9I A;  2BDE A;  4IE6 A;  2HN2 A;  2WIU B;  2LRK A;  2AXZ A;  2UXX B;  5HXC A;  3H37 A;  5EK2 A;  2ZLY A;  2K24 A;  4DV7 T;  2PUA A;  3Q5W A;  3F6W A;  4EOZ B;  3T1Y T;  4EZ4 A;  1QLB A;  3TLW A;  3FHN A;  3GA8 A;  4JI0 T;  1MIY A;  4AKL A;  4B3M T;  3TFL A;  4EEB A;  4DR4 T;  2M6B A;  2XQ5 A;  1FJG T;  4LFB T;  2XI8 A;  4JLE A;  3VKG A;  1T8B A;  4YG7 B;  4HWH A;  3UTK A;  1X2L A;  3SX0 A;  2MXD A;  4JEU B;  5AQR B;  2CRO A;  2IVG A;  2LKG A;  2WUS R;  2EWT A;  2CBI A;  5JDH A;  4QH4 A;  5JVD E;  2LLY A;  5LHG B;  2WWV A;  4HFI A;  3AXJ A;  5LOV E;  3KV4 A;  2LE8 A;  1UK5 A;  3N2K E;  2CCQ A;  3GMI A;  5EK3 A;  1Y7Y A;  4J2C A;  1N34 T;  1QP0 A;  4U7I A;  3ZC1 A;  2CWY A;  2VKH A;  2XQA A;  2PUC A;  4ZZC A;  3CWZ B;  4IDQ A;  4YLH A;  1J5W A;  4JI1 T;  4NPP A;  4AI6 A;  2AXV A;  2IIU A;  4CXX A;  4BA9 A;  4ZI7 E;  1JWL A;  2CMR A;  4GKJ T;  4EK9 A;  3CQX C;  5LBM A;  3UU6 A;  1ZHC A;  3SRZ A;  2F4V T;  2LNM A;  3CX6 B;  3DTO A;  2CRB A;  3OWQ A;  2FUP A;  3Q5E A;  4EAH A;  1OED B;  3I0Q A;  1ZOY A;  2AXD S;  3Q9D A;  4PJL A;  5AQU B;  4LMK A;  2V3C C;  4XZC A;  2FJR A;  3SR4 A;  2EBY A;  4TX5 A;  4PJN A;  1B7T A;  2CE7 A;  3PUG A;  3NRO A;  5DRT A;  5AQO B;  1GQE A;  4Z91 A;  3JXD L;  3T1H T;  3AB3 B;  2A2F X;  2J7U A;  3AE5 A;  3V5U A;  2UXC T;  2PXT A;  3HZI B;  1NW3 A;  2FJA A;  2XPK A;  5LGU B;  4IE7 A;  1ADR A;  2IV1 A;  3QWG A;  2L3L A;  5JDM A;  2E5L T;  1HF8 A;  1EZ3 A;  2LJL A;  3JXB C;  4AIU A;  4IHJ E;  4AKH A;  2PXF A;  2VL8 A;  2XXP A;  3GWH A;  4JYA T;  3CIR A;  1RIO A;  4ANJ A;  1WYC A;  2V5C A;  2LT3 A;  4YG4 A;  1OED E;  5ABG A;  1ZUG A;  4CI3 B;  1MND A;  1W09 A;  3CVR A;  3N9P A;  2XAH B;  4J1W A;  1BR4 A;  3C4Z A;  1HS7 A;  5ABH A;  4YY3 T;  5JR9 A;  3ZCJ A;  2QGS A;  4U74 A;  1NWM X;  2UU9 T;  2V1D B;  2YBD A;  2WDV A;  4TN7 B;  3IEE A;  2VUR A;  1MMN A;  2D5U A;  5EZY E;  1HTJ F;  4ILA A;  3AEB A;  4ILB A;  2PXU A;  3PV0 F;  4GYS A;  3ZSS A;  4LML A;  4X4G A;  3N9M A;  2WCA A;  4U7Y A;  4C90 A;  3KJX A;  3UWP A;  4HWF A;  1VCT A;  4MLK A;  1CUN A;  4I50 E;  2KT9 A;  1XWM A;  2UUB T;  4I6T A;  2PUF A;  2XZE A;  2XM1 A;  3QNU A;  2PXP A;  5FY0 A;  5AQL B;  5JDF A;  4I55 E;  4NXN T;  4Z5C A;  2IC9 A;  4AQF C;  4DV2 T;  2W2U A;  1Z8U A;  3RPU A;  4UR9 A;  2IVB A;  4EB6 E;  5DRY A;  5ABF B;  2DWK A;  5HXE A;  1X57 A;  5DJQ C;  3LK2 B;  2XTL A;  3V5S A;  3SWH A;  3IHR A;  2NW7 A;  2W0G A;  4UVA B;  2Z6E A;  1PRU A;  4DND A;  2Y48 B;  1GT0 C;  2LYS A;  4PFP A;  5LHI B;  1QP4 A;  1UXC A;  2VK9 A;  1WFD A;  3JXC L;  2BS2 A;  3N5L A;  3CML A;  2R63 A;  4CN4 A;  5FKY A;  3JAE A;  2OA5 A;  3FB2 A;  2BZB A;  5L3B B;  3HL6 A;  4KBM B;  1IC8 A;  4DV1 T;  3RYC E;  3H3M A;  2M4H A;  5L3G B;  4GKK T;  5HXR A;  2BKN A;  3B57 A;  4PW8 A;  5LXT E;  3VKH A;  2DHR A;  3RX6 A;  4B3R T;  4UIG A;  3OQN A;  3NWI A;  3OKZ A;  4ZXL A;  4Z8X A;  2JMK A;  3O1J A;  5DSX A;  3EVY A;  4C91 A;  3RQU A;  3NBX X;  4DR1 T;  4QKN A;  3K8P C;  3GN5 A;  4KHP T;  4TZ4 C;  2KPJ A;  5GAG i;  4IA8 A;  2Q9Q B;  1LVF A;  4PJJ A;  4UEM A;  2D0U A;  2XM2 A;  5IUX A;  5FP3 A;  3MKD A;  4ERR A;  4TWH A;  4OX9 T;  1M7K A;  3KBT A;  2LHR A;  1AJ3 A;  2CM0 A;  2XIU A;  1G73 A;  2BS3 A;  2N2N A;  2EHO B;  4YJ2 E;  4EZI A;  2HIN A;  3RHW A;  3PE0 A;  5L3D B;  1UUS A;  2KXP B;  2YK0 A;  4O4L E;  3VR8 A;  3QK6 A;  1SUM B;  3FMY A;  2CXD A;  2WU2 A;  4ZI3 C;  3VHL A;  5LG4 A;  2I59 A;  2HN1 A;  3L8R A;  2VVS A;  4I8T A;  2JCG A;  2LSJ A;  2BKP A;  5F3J A;  3VU7 H;  2NWB A;  2HH7 A;  3TLU A;  4CN1 A;  2HCS A;  4DV5 T;  5AQM B;  4HFH A;  4JI8 T;  1Y64 B;  1DW9 A;  3SCF A;  1MNE A;  2W61 A;  4O4J E;  3A5X A;  2WY2 A;  3LSV A;  4B6X A;  2XQ4 A;  3O1H A;  3RF1 A;  3AVS A;  4H9Q C;  4X4C A;  4HWD A;  2BS4 A;  3RRW A;  4AKR B;  4O2B E;  3ZKR A;  4JI6 T;  3MJX A;  2LYP A;  2A72 A;  2IW5 B;  3CQG B;  5AQI B;  2JRK A;  1WH8 A;  2VL0 A;  3UFE A;  4CZZ B;  4KHZ F;  3G5G A;  1L1M A;  2FJB A;  3ZMU B;  2FJD A;  5DT2 A;  2WB5 A;  3CX8 B;  1XDO A;  5AQN B;  4JEH B;  3G0T A;  3TKL B;  3ZHI A;  4XAX B;  1LKX A;  2BG9 A;  2CLY C;  2FFH A;  3MEJ A;  1HX1 B;  1LVK A;  2NTX A;  4DR5 T;  2MYS A;  1D1C A;  5AQT B;  1MIV A;  4BJM A;  4BAY B;  2VQE T;  4Z5H A;  3RC8 A;  2PXB A;  3BS3 A;  4HKA A;  3PUV F;  1HG2 A;  3T8O A;  1D1B A;  3CLC A;  1OWA A;  3AE3 A;  5LYJ E;  2PUB A;  3JC6 C;  4TWD A;  3RYI E;  2H89 A;  2UUA T;  3ANW B;  1R8I A;  4H9N C;  2PG8 A;  2LRL A;  4IT4 A;  3SOL A;  2JQE A;  3PUZ F;  3FBZ A;  1Y01 A;  5L3E B;  3UU5 A;  4X5T A;  3GZC A;  3LJC A;  2MPK A;  5JH7 E;  2GRL A;  4EXT A;  1NEN A;  1YD8 G;  3PTR B;  2EF8 A;  1N36 T;  5ETW A;  4HFD A;  4CXY A;  2IVQ A;  1XNQ T;  3P4Q A;  1XDP A;  3EAM A;  1LCD A;  5AQV B;  2XQY A;  1QP7 A;  3NRY A;  3P50 A;  1T7S A;  4P0A A;  3F51 A;  3KXA A;  3K1S A;  4WBN E;  2IC6 A;  3KV9 A;  1NER A;  5CA0 E;  4JI3 T;  2LM9 A;  3HA4 A;  4PFO A;  2D9D A;  4YAR A;  1I94 T;  3BK9 A;  3NKZ A;  5FY7 A;  2OFY A;  4GYR A;  1QSD A;  3MZK B;  1IBM T;  2RA1 A;  3PUR A;  2IU7 A;  5JDG A;  3UQ7 A;  1OCT C;  2LOP A;  3DJB A;  3E08 A;  1WYB A;  2QVA A;  3VRB A;  2MAW A;  5AQG B;  5GAH i;  2O4A A;  4DV6 T;  4Y42 A;  3KZ3 A;  2HHH T;  5KMG P;  2MEZ A;  3TRB A;  1YQ3 A;  3QOF A;  1QQA A;  3K3O A;  5FMN A;  3N9O A;  3I0O A;  3RIA A;  4E7S A;  2V5D A;  4EZH A;  2PXD A;  3I9Y A;  3JAF A;  2GK9 A;  4NUU A;  2Q9Q C;  1E3O C;  2E9X C;  3P8C D;  4EED A;  2YKS A;  4N78 D;  1ZZ8 A;  3OP9 A;  1VOM A;  2R1J L;  2PUD A;  4V1A v;  1ZPQ A;  4QWN B;  1PNR A;  3KV5 A;  3JCF A;  1KNP A;  2H88 A;  2EHO C;  4A56 A;  4GK0 E;  4WW0 A;  5LJN A;  4OBM A;  2LHN A;  3LBX B;  4AQG A;  3PUY F;  2N9D A;  5C8Y E;  2NTY A;  3MXZ A;  3AEF A;  2YEV C;  3HR0 A;  3RZZ A;  1HQ1 A;  5C3J A;  4G63 A;  5E0O A;  3QFI A;  4DMW A;  3EDU A;  1YXR A;  3HKC E;  1IBL T;  2ES0 A;  3L39 A;  3AE8 A;  3UUX B;  4UVB B;  1OED A;  1NAF A;  4O8B A;  4LMJ A;  2AE9 A;  3FZK B;  4P1N A;  5IHY A;  3I9W A;  2KEJ A;  5JUW A;  3GZD A;  3E22 E;  4IVZ A;  2XUE A;  2CXL A;  4HFV A;  3PUX F;  2NP9 A;  4OFZ A;  4YJ3 E;  3RGL A;  2YDR A;  5K98 B;  1HCI A;  2XSB A;  2QYW A;  3ONJ A;  1LMB 3;  4GIW A;  5LMN T;  5J2T E;  2K5B B;  2PXL A;  4FBI A;  4ER7 A;  4PAG A;  3PE5 A;  2IAK A;  3KVB A;  1R63 A;  5HEJ A;  2LYR A;  5HXS A;  1T72 A;  3RH3 A;  4YSX A;  2WSS V;  5IWA T;  3EAB A;  1WIZ A;  1SE7 A;  4YSY A;  3ZT6 A;  5L4H A;  1O4X A;  3D1N I;  2W66 A;  3FYM A;  4Q2J A;  1QPZ A;  2JJ9 A;  2K48 A;  3L3P A;  1I6Z A;  5JDL A;  5LBQ B;  4HEA A;  4B3T T;  4PJM A;  2BKO A;  5FYM A;  2ZM8 A;  3S4U A;  1EFA A;  3ETU A;  3Q5D A;  2OLT A;  3N9Q A;  3J7Y q;  1N32 T;  2CWO A;  2WDQ A;  4LF5 T;  1KFY A;  3M3Z B;  1BR2 A;  4F8H A;  4CI1 B;  3ZC0 A;  3VK0 A;  3RKO A;  4JI2 T;  1S35 A;  2X9X A;  1U4Q A;  2K3W A;  1G8X A;  4X64 T;  2N1G A;  3G7D A;  3LDQ B;  3H5T A;  5LGT B;  3A8Y C;  2LEH A;  2V26 A;  3WAJ A;  5CFB A;  5LG3 A;  4DUZ T;  2CLY B;  1ZZB A;  2PXE A;  5FVL A;  4JI4 T;  1ZZC A;  2ICP A;  3QOW A;  2XQ8 A;  1ZVV A;  2KSR A;  1UGO A;  2WAU A;  2ODU A;  4JCX A;  2ICT A;  2V7L A;  4KI0 F;  2AWI A;  3OYZ A;  5IYZ E;  4EKI A;  3AA0 B;  3OJA A;  2D0T A;  2C5K T;  5L4E A;  4TNV A;  3QUJ A;  4ILC A;  1VPW A;  2LSG A;  3U78 A;  4ZZB A;  5ABF A;  4YTM A;  4NIQ A;  1UCU A;  4HE8 A;  2DLR A;  2LM2 A;  2CHO A;  2L49 A;  3R1F A;  3RIU A;  4I0U A;  2XJ7 A;  2OV9 A;  2WZH A;  4DR3 T;  2C0S A;  2UXB T;  1WR6 A;  5A1L A;  5LCY A;  4ZOL E;  3MAC A;  1SHZ C;  4ZS3 A;  5HCM A;  5F5W A;  4Z58 A;  3E0Z A;  3C51 A;  3M9L A;  4KX6 A;  4WVL A;  1IAP A;  1MFQ C;  4COF A;  2CXF A;  5DTM A;  2KEK A;  2Y6X A;  1U2Z A;  2H3R A;  4DV3 T;  3CQC B;  2G0U A;  2JMH A;  1QQB A;  3ZMS B;  3ZT7 A;  4ZHQ E;  2LSI A;  3UUB A;  4OYJ A;  4H9O C;  4FI5 A;  4H9P C;  3HI2 A;  3R84 B;  4MBQ A;  3H3A A;  4X1Y E;  4TNW A;  3PUS A;  3OVU A;  3FXD B;  4F8D A;  2HPL A;  4DBQ A;  4OHF A;  1E1H B;  2C5J A;  3ZMT B;  1IBK T;  2PE5 A;  1LCC A;  1MMA A;  3SS1 A;  3UT5 E;  4X66 T;  5H6R B;  3F2E A;  4X20 E;  2D2S A;  3KFW X;  2XXQ A;  3EUH A;  4L5G A;  2LSY A;  3O4X E;  4IL4 A;  3VR9 A;  4EYY R;  3FXE B;  5AQJ B;  3ZLI A;  2KND A;  3A9Y A;  4AKI A;  3P4P A;  2WDR A;  2B1E A;  3UU8 A;  3O9X A;  4HFC A;  1KNR A;  4GQM A;  2E9X B;  3P7I A;  1N33 T;  4DV4 T;  4X65 T;  1QZX A;  3FBL A;  2X0L B;  1DU2 A;  4X4H A;  3R09 A;  3X1D A;  1KK7 A;  3QOX A;  5CJ5 A;  2UUC T;  3TLS A;  4A5X A;  1MIW A;  2V7K A;  2AXU A;  4JI5 T;  5DTR A;  1HG5 A;  4PU3 C;  3PUA A;  1FMW A;  3MA9 A;  3SCH A;  5BMV E;  5JDQ A;  2VKD A;  3ZYM A;  4U33 A;  5LGN B;  3O1I A;  5LHH B;  2PUG A;  4E7Z A;  4KUM B;  4I4T E;  3C4X A;  1WH6 A;  1RZR A;  1FIO A;  4YG1 A;  3GN5 B;  4LF8 T;  2V6Y B;  4EYU A;  2VKJ A;  2XQ9 A;  3A9X A;  4HTE A;  3RI5 A;  2O49 A;  5HEG A;  4DMV A;  2A3D A;  1XZY A;  1UXD A;  2XHE B;  4ZS2 A;  1MMD A;  5CB4 E;  4LF6 T;  3EDV A;  3EHZ A;  3NZP A;  3NDB B;  3QC9 A;  3Q5X A;  3BQI A;  2WM9 A;  3HKE E;  2YU2 A;  3EI0 A;  1AU7 A;  3UUN A;  2L8K A;  3AA7 B;  3AE6 A;  2KEI A;  4MCX A;  2ODR D;  3ESL A;  3DNV B;  2B76 A;  3PUW F;  3ANW A;  5AQK B;  2V7J A;  5LA6 E;  4AIS A;  3F31 A;  3K3Q C;  2J47 A;  3NRX A;  4PU8 A;  4I6U A;  1BDI A;  3ZJ1 A;  3HKB E;  4UF0 B;  4ZI2 C;  1ZKE A;  2Q9Q D;  1NEQ A;  3FZH B;  3N9L A;  1RPE L;  2QA7 A;  4H9R C;  5F8P A;  2V7I A;  1DUL A;  4GHJ A;  3OBV E;  5HEH A;  1WCR A;  4YTN A;  3B7H A;  2HCN A;  1PRA A;  4CQI A;  5AQH B;  5HCJ A;  4PK6 A;  1E7P A;  2CA5 A;  3KBU A;  1M62 A;  4MAL A;  2J1D G;  4BJN A;  3ME5 A;  3OQM A;  1ZV4 X;  5JR9 C;  4DR7 T;  5J2U E;  2WMN A;  3OQO A;  3I1A A;  2W00 A;  4U72 A;  4IDO A;  5LB7 B;  2LYQ A;  3RYF E;  1V9D A;  3F52 A;  1US7 B;  4HRA A;  5KDM C;  2KWH A;  2JQH A;  2A6C A;  3MK7 C;  1QB2 A;  1ZZ7 A;  2E2A A;  3Q2M A;  2Y8D A;  5ADX L;  3LK3 B;  2PBI A;  3RQW A;  3IA3 A;  5HWX A;  2V6X A;  3TEL A;  1ZZ6 A;  4IDZ A;  2H8R A;  4LF4 T;  4MHC A;  3RRC A;  3PJA J;  2RP4 A;  3OTO T;  4O8S A;  4UXN B;  4O4H E;  2AUW A;  1BDH A;  2HFZ A;  3P4R A;  5FNV E;  3RKG A;  4LFA T;  1UUR A;  3UU3 A;  5FXZ A;  4HWI B;  2CHN A;  4H9S E;  4AQF A;  3L09 A;  3QB5 K;  4EKG A;  4DUY T;  5J1G A;  3AEC A;  1RZR D;  2VWA A;  3TLT A;  2A9U A;  5M4Y A;  4EV6 A;  3LIS A;  2KMF A;  1E2A A;  4EQZ A;  5BR8 T;  3SCG A;  4XBF B;  3RIF A;  2MBG A;  4ER3 A;  3JAD A;  1BR1 A;  2XSA A;  1L0V A;  3BD1 A;  1YKE B;  4P0B A;  1X79 A;  5FXW A;  3WAK A;  3AE2 A;  2O38 A;  3CRO L;  2LCV A;  2X0H A;  3LBX A;  5JRC B; 
#chains in the Genus database with same CATH homology
 1RZS A;  2OA5 A;  4MFR A;  1PER L;  3FB2 A;  5LBQ B;  2BZB A;  4HEA A;  2BVL A;  5L3B B;  3AA1 B;  3HL6 A;  4KBM B;  2P9B A;  3C50 A;  4JUY A;  4PJM A;  1IC8 A;  5FYM A;  2ACX A;  2ZM8 A;  2E9X D;  5FXX A;  3RYC E;  3S4U A;  1EFA A;  3ETU A;  3ZYL A;  5L3G B;  3N9Q A;  3J7Y q;  1LQC A;  3FYA A;  2CWO A;  2ZMA A;  5HXR A;  2YU1 A;  2XSD C;  2ZM0 A;  1BR2 A;  1OXZ A;  4IE5 A;  3HKD E;  5LNK A;  4J1X A;  1QUU A;  3GBF A;  4Z5D A;  2X9W A;  3OKQ A;  3B57 A;  4CI1 B;  4PW8 A;  5LXT E;  3VKH A;  3ZC0 A;  2DHR A;  3RX6 A;  3VK0 A;  2CEA A;  3RKO A;  1S35 A;  4UIG A;  3OQN A;  2EHO D;  2PJQ A;  2X9X A;  1UTX A;  1U4Q A;  4ASK A;  4DO0 A;  1LRZ A;  1T98 A;  1G8X A;  2N1G A;  3G7D A;  3PU3 A;  4Z8X A;  2JVL A;  2DCF A;  3ZJ2 A;  2X9H A;  3H5T A;  2JMK A;  2WBL A;  3ZPO A;  2LEH A;  3O1J A;  5LGT B;  4IGU A;  3N2G E;  5TAO A;  3R6N A;  5AFU L;  2V26 A;  4WBO A;  3EVY A;  3WAJ A;  4C91 A;  4TUY E;  3CPZ A;  3N2O A;  1ZAY A;  2XAQ B;  3F57 A;  4ISS A;  4JCY A;  2CLY B;  2ODV A;  3ZMV B;  1ZZB A;  3NBX X;  4QKN A;  1ZZC A;  3ZMZ B;  3K8P C;  2ICP A;  4K0U A;  1R69 A;  3GN5 A;  4TZ4 C;  2KPJ A;  4H63 H;  4IA8 A;  1ZVV A;  2GRM A;  3N9N A;  3NZQ A;  2Q9Q B;  1LVF A;  4PJJ A;  2WAU A;  4UEM A;  2ODU A;  4JCX A;  2D0U A;  3D0T A;  2ICT A;  4Z59 A;  5FP3 A;  2V7L A;  2SPC A;  3MKD A;  2AWI A;  4WNK A;  3OYZ A;  2BVM A;  4ERR A;  2B5A A;  1HF0 A;  5IYZ E;  1BR0 A;  3AA0 B;  3OJA A;  2D0T A;  4ILU A;  2C5K T;  3KBT A;  4YBA A;  2LHR A;  2CM0 A;  2XIU A;  1AJ3 A;  1B0N A;  3QUJ A;  1VPW A;  5L3F B;  1HX8 A;  1G73 A;  2LSG A;  3U78 A;  2N2N A;  2EHO B;  1UX4 A;  3IF8 B;  4DBR A;  4YJ2 E;  5HXH A;  4O2A E;  1UCU A;  2VKO A;  2HIN A;  2XAJ B;  4HE8 A;  1Z0P A;  3KIN B;  2DLR A;  4X1K E;  3PE0 A;  5JQG E;  2L49 A;  3R1F A;  4TV8 E;  5L3D B;  3W15 B;  3KDS E;  3AAA B;  4O4I E;  2KXP B;  2YK0 A;  4O4L E;  1PRV A;  1DWK A;  3QK6 A;  4NUV A;  4PU7 A;  3FMY A;  2CXD A;  4ZI3 C;  4GK5 E;  2C0S A;  3VHL A;  1WR6 A;  2M67 A;  4UVC B;  2I59 A;  5LG4 A;  1S94 A;  5A1L A;  4PK5 A;  4IWR A;  5JDN A;  5LCY A;  1O3X A;  4UEL A;  2X68 A;  4QHO A;  4I8T A;  2JCG A;  2LSJ A;  4X4D A;  4QX8 B;  4DVD A;  5F3J A;  4ZOL E;  2NWB A;  3MAC A;  3VU7 H;  1SHZ C;  2HH7 A;  4ZS3 A;  5JRC A;  3KV6 A;  2L8N A;  2NOX A;  2WMO A;  2VB6 A;  4Z58 A;  3UUL A;  3E0Z A;  3LFP A;  3C51 A;  3ZEF B;  4IE4 A;  1Y64 B;  1DW9 A;  3OMT A;  3SCF A;  1MNE A;  2W61 A;  1IAP A;  4O4J E;  3A5X A;  3CX7 B;  4EIW A;  2CXF A;  1OSL A;  3AAE B;  2KEK A;  4QX7 B;  4B6X A;  3O1H A;  5JRE A;  2Y6X A;  2H3R A;  1UX5 A;  3QF3 A;  3AVS A;  2KZ7 B;  3CQC B;  4X4F A;  2G0U A;  4H9Q C;  2KIN B;  5DAB A;  5LJM A;  4X4C A;  2UXN B;  5GON E;  2JMH A;  3RRW A;  4AKR B;  4O2B E;  1WRD A;  1QQB A;  3LFM A;  5HAX A;  3ZMS B;  1U5P A;  3MJX A;  2LYP A;  4ZHQ E;  3U3W A;  2LSI A;  2A72 A;  3IVP A;  3CQG B;  2IW5 B;  2JRK A;  1WH8 A;  4KMC A;  4OYJ A;  3UFE A;  4CZZ B;  3K3N A;  4L9I A;  2X66 A;  3G5G A;  2BDE A;  3ZKC A;  4H9O C;  4GOU A;  1D0Y A;  4IE6 A;  4FI5 A;  4H9P C;  1L1M A;  3HI2 A;  3R84 B;  3ZMU B;  4PK4 A;  2WIU B;  2AXZ A;  3L1P A;  1LLI A;  4MBQ A;  2UXX B;  5HXC A;  3H3A A;  3H37 A;  3CX8 B;  3BQL A;  4X1Y E;  5EK2 A;  2PPX A;  2ZLY A;  3PXP A;  4JEH B;  2K24 A;  2X9Y A;  3PUS A;  3TKL B;  3ZHI A;  2PUA A;  3FXD B;  3F6W A;  4F8D A;  2HPL A;  3Q5W A;  4XAX B;  1LKX A;  5FY1 A;  2CLY C;  3LG7 A;  4EOZ B;  4EZ4 A;  4DBQ A;  1CQT A;  4OHF A;  1E1H B;  1LVK A;  2C5J A;  3ZMT B;  2PE5 A;  2NTX A;  3LK4 2;  1LCC A;  1MMA A;  3SS1 A;  3UT5 E;  3ZCI A;  4TV9 E;  3C98 B;  3FHN A;  3GA8 A;  1H7C A;  3PUQ A;  3F2E A;  5H6R B;  4X20 E;  2D2S A;  3KFW X;  1MIY A;  1XWR A;  2MYS A;  3EUH A;  4L5G A;  4AKL A;  1D1C A;  5HWY A;  2LSY A;  4X4B A;  3O4X E;  1MIV A;  4BJM A;  1S7E A;  1HFA A;  4EYY R;  3S8Q A;  4IST A;  3FXE B;  4BAY B;  2LOS A;  4Z5H A;  3ZLI A;  2D5V A;  2XI8 A;  2KND A;  3RC8 A;  3BS3 A;  4HKA A;  4JLE A;  3VKG A;  5FXV A;  1HG2 A;  4YG7 B;  4UV9 B;  3T8O A;  4X4E A;  1D1B A;  3CLC A;  1OWA A;  3UTK A;  4AKI A;  1MMG A;  1X2L A;  1JFT A;  5LYJ E;  2PUB A;  3JC6 C;  1ZEE A;  4QXB B;  3RYI E;  2B1E A;  4JEU B;  3O9X A;  3ANW B;  2CRO A;  2IVG A;  4H9N C;  4GQM A;  2PG8 A;  2WUS R;  2E9X B;  2EWT A;  3BDN A;  3P7I A;  2E8I A;  5JDH A;  1POU A;  3SOL A;  4QXC B;  5JVD E;  3FBL A;  1IJ6 A;  2X0L B;  3FBZ A;  4X4H A;  5LHG B;  1KK7 A;  5L3E B;  5LOV E;  3KV4 A;  2LE8 A;  3LJC A;  3N2K E;  2CCQ A;  2XAS B;  3GMI A;  5EK3 A;  4KP3 C;  5JH7 E;  1Y7Y A;  2GRL A;  2YIN A;  4J2C A;  1QP0 A;  1MIW A;  1IJ5 A;  2V7K A;  3ZC1 A;  3QYX A;  2AXU A;  2CWY A;  4EXT A;  1ZS4 A;  1YD8 G;  2VKH A;  1HG5 A;  3PTR B;  4PU3 C;  2EF8 A;  3PUA A;  1FMW A;  4PU4 C;  3SCH A;  3MA9 A;  2KLQ A;  5ETW A;  2PUC A;  3U3I A;  4AXP A;  3CWZ B;  2C5I T;  4YLH A;  5BMV E;  5JDQ A;  2XAF B;  4CXY A;  2IVQ A;  2VKD A;  3ZYM A;  2NW8 A;  1YSE A;  5JR9 B;  1LCD A;  5LGN B;  3O1I A;  4ZI3 D;  4AI6 A;  5LHH B;  2AXV A;  4CXX A;  2LYJ A;  2XQY A;  1QP7 A;  2PUG A;  3M65 A;  3NRY A;  2BNN A;  4P0A A;  2JQQ A;  1SA0 E;  4BA9 A;  4ZI7 E;  4NDW A;  4E7Z A;  3F51 A;  1JWL A;  2CMR A;  4I4T E;  4KUM B;  3KXA A;  3C4X A;  1WH6 A;  1RZR A;  4WBN E;  1FIO A;  3CQX C;  4YG1 A;  3GN5 B;  5LBM A;  2IC6 A;  3KV9 A;  1NER A;  5CA0 E;  1ZHC A;  3SRZ A;  3DP7 A;  2VKJ A;  4EYU A;  2PIJ A;  3CX6 B;  3DTO A;  2LM9 A;  5L3C B;  3HA4 A;  4PFO A;  4HTE A;  4EAH A;  3I0Q A;  3AAI A;  4YAR A;  5HYA A;  2O49 A;  3BK9 A;  4ADZ A;  4DMV A;  2A3D A;  3Q9D A;  5FY7 A;  4PJL A;  2OFY A;  1UXD A;  2W63 A;  1QSD A;  2XHE B;  4GYR A;  3UUM A;  3MZK B;  4ZS2 A;  3C64 A;  1MMD A;  5CB4 E;  2DI4 A;  2FJR A;  2RA1 A;  3EDV A;  4XZC A;  3WI3 A;  2CSF A;  1FMV A;  3PUR A;  2EBY A;  2IU7 A;  3NZP A;  4TX5 A;  5JDG A;  1OCT C;  2JPF A;  2LOP A;  3DJB A;  1B7T A;  1WYB A;  3E08 A;  3QC9 A;  1D0X A;  4PJN A;  4X1I E;  3Q5X A;  2CE7 A;  4N78 D;  3BQI A;  3PUG A;  2WM9 A;  4HGA A;  3HKE E;  2YU2 A;  2O4A A;  3JXD L;  2BNM A;  4Y42 A;  1AU7 A;  3KZ3 A;  2H7O A;  3AB3 B;  3UUN A;  2A2F X;  2MOZ A;  2L8K A;  5KMG P;  2MEZ A;  3TRB A;  4I6R A;  2PFV A;  3AA7 B;  2AW6 A;  3ZHM A;  2KEI A;  4MCX A;  1QQA A;  3V5U A;  3K3O A;  5FMN A;  3CEC A;  3HZI B;  2XCJ A;  3ESL A;  3DNV B;  3I0O A;  3N9O A;  3ANW A;  2V7J A;  5LGU B;  5LA6 E;  4IE7 A;  1ADR A;  4E7S A;  2Q9Q A;  3ONX A;  2IV1 A;  2E9X A;  3F31 A;  3IBP A;  3K3Q C;  3NRX A;  3QWG A;  1D0Z A;  4PU8 A;  2L3L A;  4EZH A;  5JDM A;  5KX5 E;  1HF8 A;  1EZ3 A;  4I6U A;  3I9Y A;  1BDI A;  3MLF A;  2GK9 A;  3RYH E;  2LJL A;  3ZJ1 A;  3HKB E;  4NUU A;  4UF0 B;  3JXB C;  2Q9Q C;  1E3O C;  2E9X C;  3P8C D;  4IHJ E;  4AKH A;  4ZI2 C;  2VL8 A;  1ZZ8 A;  3OP9 A;  1VOM A;  1ZKE A;  2Q9Q D;  2R1J L;  3GWH A;  1NEQ A;  2PUD A;  3N9L A;  4HN9 A;  4V1A v;  1RPE L;  2LYK A;  1RIO A;  1ZPQ A;  2QA7 A;  4QWN B;  4ANJ A;  4ZI2 D;  1ZZ9 A;  2LSK A;  4H9R C;  1PNR A;  1WYC A;  2EHO A;  3KV5 A;  5F8P A;  2KWI B;  2LT3 A;  4YG4 A;  2HPJ A;  3C4W A;  4UV8 B;  2V7I A;  4GHJ A;  4IE0 A;  1ZUG A;  4CI3 B;  3OBV E;  4OK0 A;  2EHO C;  1MND A;  2NW9 A;  4A56 A;  4GK0 E;  4WW0 A;  3B7H A;  1PRA A;  3CVR A;  4CQI A;  2IUO A;  5LJN A;  2L9Q A;  2LHN A;  3JC6 D;  2XAH B;  3N9P A;  3ZN0 B;  4F6R C;  4J1W A;  3LBX B;  4MCT A;  3KVA A;  4CI2 B;  1BR4 A;  3C4Z A;  4AQG A;  5CA1 E;  4PK6 A;  1HS7 A;  2N9D A;  2CA5 A;  2NTY A;  5DQV A;  5JR9 A;  3ZCJ A;  3KBU A;  3J9X 1;  5C8Y E;  3MXZ A;  2QGS A;  4MAL A;  1Y9Q A;  3PU8 A;  1YKH B;  2J1D G;  4U74 A;  4YFS A;  4BJN A;  3OQM A;  1ZV4 X;  5JR9 C;  1NWM X;  5EK4 A;  2OR1 L;  5J2U E;  2YEV C;  2V1D B;  3OQO A;  2WMN A;  3HR0 A;  3RZZ A;  2W00 A;  3I1A A;  4U72 A;  3OYX A;  2X67 A;  2LYQ A;  4G63 A;  5E0O A;  1V9D A;  3ETV A;  3F52 A;  1US7 B;  3RYF E;  5KDM C;  4DMW A;  3EDU A;  4TN7 B;  2KWH A;  3IEE A;  3HKC E;  4YHJ A;  2A6C A;  3MK7 C;  2MQK A;  1D1A A;  1MMN A;  1SQ8 A;  1ZZ7 A;  2D5U A;  2ES0 A;  2K9A A;  2Y8D A;  3Q2M A;  4QXH B;  3CKD A;  3LK3 B;  5EZY E;  1HTJ F;  3UUX B;  4OYK A;  5ADX L;  2PBI A;  4UVB B;  2DNX A;  5A7L A;  5HWX A;  1YW0 A;  4IDZ A;  1ZZ6 A;  4GYS A;  3QQ6 A;  2H8R A;  4X4G A;  1NAF A;  4CXW A;  2XJ3 A;  3N9M A;  4AKG A;  4O8B A;  3ZYK A;  4C90 A;  1WLX A;  4H63 V;  4MHC A;  3RRC A;  5IHY A;  3KJX A;  2GZU A;  1IZN B;  2RP4 A;  4O8S A;  4MLK A;  4JQD A;  4O4H E;  4UXN B;  3I9W A;  2KEJ A;  2AUW A;  1BDH A;  1CUN A;  3UFD A;  4I50 E;  2KT9 A;  3B13 A;  5FNV E;  2ZM2 A;  4I6T A;  3E22 E;  1KNZ A;  2KZ8 A;  2PUF A;  4IVZ A;  5FXZ A;  2XUE A;  4H9S E;  1CJG A;  2CXL A;  2H7V C;  4HFV A;  2NP9 A;  4OFZ A;  4AQF A;  5FY0 A;  3AA6 B;  4YJ3 E;  3L09 A;  2DWG A;  5LP6 E;  5JDF A;  1VRB A;  4I55 E;  3BQK A;  5K98 B;  1JH9 A;  2HSG A;  4Z5C A;  5DQW A;  5J1G A;  1JFS A;  1HCI A;  2IC9 A;  4AQF C;  1RZR D;  2VWA A;  2WWU A;  3RC3 A;  4P09 A;  1LMB 3;  3RPU A;  2PUE A;  5M4Y A;  4GIW A;  3LIS A;  2KMF A;  2IVB A;  4EB6 E;  5J2T E;  1FEW A;  2K5B B;  2MTQ A;  2X51 A;  3AVR A;  4FBI A;  2LYL A;  4PAG A;  3SCG A;  2IAK A;  2XAG B;  2DWK A;  3EUS A;  5HXE A;  1X57 A;  4UF0 A;  4XBF B;  3KVB A;  4I43 B;  1R63 A;  2MBG A;  2LYR A;  3LK2 B;  5DJQ C;  5HXS A;  2XTL A;  3V5S A;  3SWH A;  3IHR A;  2VAS A;  5L2L A;  2NW7 A;  2W0G A;  3RH3 A;  1BR1 A;  4M1P A;  4G2A A;  4UVA B;  1WET A;  2Z6E A;  3BD1 A;  1YKE B;  1PRU A;  4OB4 A;  2WSS V;  4DND A;  2V7M A;  4FJO A;  4PNI A;  2BNO A;  2Y48 B;  1GT0 C;  2LYS A;  4PFP A;  4P0B A;  1QP4 A;  5LHI B;  1UXC A;  1WIZ A;  1X79 A;  4FN3 A;  2VK9 A;  3JXC L;  5FXW A;  3WAK A;  2BJC A;  5H6Q B;  1O4X A;  3D1N I;  3N5L A;  3ZN1 B;  3FYM A;  4IIJ E;  4L0R A;  1QPZ A;  2O38 A;  2JJ9 A;  3CRO L;  2LCV A;  2K48 A;  2W62 A;  3L3P A;  3CML A;  3PDY A;  3LBX A;  2R63 A;  4X4I A;  5JRC B;  5JDL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...