3O9XA

Structure of the e. coli antitoxin mqsa (ygit/b3021) in complex with its gene promoter
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
132
structure length
132
Chain Sequence
HMKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKKLSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Escherichia coli Antitoxin MqsA (YgiT/b3021) Bound to Its Gene Promoter Reveals Extensive Domain Rearrangements and the Specificity of Transcriptional Regulation.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription regulator/dna
molecule keywords Uncharacterized HTH-type transcriptional regulator ygiT
total genus 40
structure length 132
sequence length 132
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF15731 MqsA_antitoxin Antitoxin component of bacterial toxin-antitoxin system, MqsA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 3o9xA02
1.20.58.720 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3o9xA01
4PU4C 2KEKA 1RPEL 4MCXA 1ZVVA 2IVQA 1R63A 3HZIB 3KZ3A 1QP4A 2GRLA 3CLCA 2LYLA 2B5AA 1Y7YA 4I6UA 1RIOA 3F52A 3H5TA 2GRMA 2PUEA 3GA8A 2LYPA 2KPJA 1LMB3 2AXUA 4X4IA 1X2LA 1POUA 2IUOA 2JVLA 4NDWA 4IA8A 3BDNA 2AXVA 1ZS4A 2MQKA 3CROL 1RZRA 1GT0C 3LFPA 4YG1A 2IVBA 3F6WA 2PIJA 2WIUB 4O8BA 2L49A 1B0NA 4Z58A 3HI2A 1BDIA 4JCXA 2WUSR 1WH6A 3OP9A 4X4FA 4PU7A 4X4DA 1DW9A 1QPZA 2AW6A 2A6CA 2R1JL 1RZSA 4GHJA 1QQBA 2XJ3A 1JFTA 1WETA 4X4HA 2KEIA 4JQDA 3CECA 4X4GA 4PU3C 3KXAA 1UXDA 2XCJA 1QP0A 2BNNA 1E3OC 3PXPA 3D1NI 3S8QA 2PE5A 3FYMA 3QQ6A 4YG4A 1WH8A 3OQMA 3G5GA 4I6TA 1PRUA 2BNMA 4MCTA 4PU8A 1JFSA 4X4CA 3ZHMA 1NEQA 2ICTA 1YSEA 2EWTA 4Z5DA 3U3WA 1HF0A 1PERL 2PUBA 2H8RA 4IWRA 2AUWA 1OSLA 1DWKA 3ZHIA 1ZZ7A 4Y42A 1QP7A 4YBAA 2KEJA 2CROA 3GN5A 4X4EA 3ZKCA 2JCGA 3GBFA 3IVPA 4Z59A 1CJGA 2O38A 3FYAA 4I8TA 2LYJA 3JXCL 1IC8A 1OCTC 1LQCA 1PRVA 1S7EA 5K98B 1JWLA 2PUAA 4FBIA 3L1PA 2LYQA 3JXDL 3F51A 2AXZA 1O4XA 3TRBA 2IVGA 2LYSA 4FN3A 4J1WA 1ZZBA 1ZAYA 2PUGA 2OR1L 1ZZCA 2ICPA 3FMYA 3DNVB 5A7LA 2R63A 4Z5HA 2LCVA 2O4AA 2PUDA 1LCDA 1AU7A 1EFAA 4JCYA 2XI8A 4J1XA 3EUSA 3SCHA 1CQTA 1LCCA 1PNRA 2O49A 1PRAA 3JXBC 1SQ8A 3MLFA 1BDHA 2EBYA 3BS3A 3KJXA 3LISA 4YARA 1ZZ8A 2AWIA 1UXCA 4OB4A 3RZZA 2CSFA 3OMTA 3O9XA 2PUCA 3R1FA 1WIZA 1UTXA 1ZUGA 2EF8A 2KZ8A 3QF3A 3QWGA 1LLIA 2PPXA 1QQAA 1VPWA 1ZZ9A 3OQOA 4X4BA 3OQNA 4Z5CA 4I6RA 2OFYA 2BJCA 2HSGA 1NERA 2IU7A 2IV1A 3UFDA 2XIUA 2LYRA 4GQMA 3SCFA 1ADRA 1R69A 1X57A 4F8DA 2BNOA 4YG7B 2HINA 4IVZA 3QYXA 2MEZA 2L8NA 1RZRD 1ZPQA 2D5VA 1JH9A 1ZZ6A 3GN5B 3B7HA 2FJRA 3SCGA 1XWRA 3VK0A 1L1MA 2GZUA 1Y9QA 2PUFA 2LYKA 2XSDC 3G7DA 3BD1A
chains in the Genus database with same CATH superfamily
4A97A 2KEKA 2C5JA 1RPEL 3NWIA 3CLCA 5AQGB 2GRMA 1HG5A 5DTMA 2ZM0A 3F6WA 2V6YB 2VVSA 2L8KA 5AQFB 3F31A 4AQGA 4XZCA 2CLYB 5LGUB 3T8OA 3OQMA 5AQJB 4LFCT 1YQ4A 3I9WA 2EWTA 5FY1A 1NENA 3VR9A 3AE7A 4YSXA 5JDMA 5GAGi 4X4EA 4B3MT 3ZKCA 2XQYA 3U78A 4O4IE 3TFLA 4KP3C 4PK5A 3L1PA 2V5DA 5JR9A 5ABHA 3TRBA 5KX5E 3AE3A 2XAHB 4LF5T 2IIUA 3RIAA 2KSRA 4DV6T 2LCVA 5ABEA 2W0GA 2XI8A 5LP6E 4NXMT 3NZQA 3JXBC 3FZHB 2X68A 3KJXA 1ZZ8A 4QHOA 2LM9A 4K0UA 5HEOA 1IZNB 5LOVE 2EF8A 1LLIA 3AA0B 4QX7B 4DR4T 3UWPA 1HF8A 4YY3T 2BJCA 1WRDA 3ZCIA 4GQMA 4ILBA 3EABA 1IBKT 3P4QA 4PFOA 2JPFA 4X1YE 1XDPA 4DR7T 1XWRA 3QOFA 1UGOA 2GZUA 4HN9A 2BG9B 3BD1A 4P0BA 1VOMA 1G73A 2G0UA 1J5ET 2PXDA 5AQIB 5FY7A 2VVNA 1J5WA 2LYLA 2NOXA 5HAXA 4UV9B 2LSGA 2MQKA 3RKGA 4Q2JA 3ABVA 3HI2A 4U33A 3SS1A 4YJ3E 3N2OA 3AAIA 4AKLA 5DT2A 1T98A 4Q25A 5EK3A 2FUPA 3OKQA 4PU3C 3KXAA 2QGSA 1HCIA 2X51A 2D2SA 1PRUA 4EKGA 3R09A 2XSBA 4EGWA 1QP7A 3VKHA 2XAJB 4CI1B 4I8TA 3NRYA 1SE7A 3ANWA 4YXDA 1S94A 2XQ6A 2VKHA 3G0TA 5J2TE 2A3DA 2FFHA 1OEDB 3FZLB 4EKIA 4ZI3D 3W15B 4ILUA 4MHCA 2ODRD 2Z6EA 2BBJA 2PXEA 2UU9T 2WCAA 3ZMUB 4UVCB 4ZHQE 5F5WA 4DV7T 3Q9DA 3NBXX 4YSZA 1MIVA 3KVBA 2X9HA 4JBWF 2HFZA 5J0ZA 3PUXF 5HWYA 2E8IA 4U74A 1WCRA 2IV1A 4H63V 5LNKA 3AXJA 4UVBB 4PK6A 3AVRA 5LHGB 1HS7A 2D5VA 1YXRA 3QB5A 3CX8B 3BQKA 4O2AE 3ZT6A 5HEUA 2WU5A 3EDUA 5ETWA 1SA0E 3R6NA 1POUA 3ONXA 1UK5A 5JRCA 2YBDA 2BDEA 1N36T 4U3CA 2WM9A 4PU7A 1D0XA 2V26A 4ZEYA 4QH4A 4ILCA 4HWDA 4X4GA 4HFIA 3M65A 2JQ9A 4PFPA 4X4CA 2XPKA 3CVRA 3TEPA 3DM5A 1ZZ7A 2IC6A 2XXQA 5F3JA 5HXEA 2HCNA 2IAKA 1IJ6A 2KMFA 3KBTA 4HTEA 3RIUA 5C3JA 1SUMB 2JMHA 3UQ4A 4ZI3C 2IVGA 2LJLA 2V8SV 1DULA 3N9MA 5LCYA 4DBQA 2HN2A 2Q9QB 1ZEEA 3RX6A 4CN4A 4MBQA 3BQIA 4TUYE 2W63A 2PJQA 1CQTA 2D5UA 2N1GA 3AE1A 3AEDA 3RZZA 3LBXB 5ABGA 2Y8DA 2NWBA 5CA0E 2KZ8A 3R84B 3HL6A 3ZSSA 3UULA 3UU3A 5L3GB 2MPKA 2X66A 4PJJA 4X62T 1NW3A 4YG7B 5LG4A 3KV6A 4DR2T 2D0TA 2XQAA 1WYBA 3B7HA 3NZLA 4KHZF 4IL4A 2DLRA 5FMNA 3G7DA 3J9X1 5FYMA 3B5MA 3OTOT 1VCTA 3C4WA 2ES0A 2X0YA 2KPJA 4X4IA 4IIJE 4NPPA 3TELA 2PFVA 2AXVA 4OYKA 4ZS3A 3GWHA 4CXWA 4CZZB 4DV5T 2KWHA 4BAYB 4ER0A 1YW0A 3QK6A 1DW9A 4U7IA 3FZKB 2R6GF 1MNEA 1YKHB 4X4HA 2KEIA 2WAUA 4DR3T 3FYMA 4X65T 3G5GA 4MCTA 5DRYA 5LJMA 4HFBA 3MXZA 4IGUA 1VRBA 2V3CC 2NR4A 4XBFB 3ETVA 5L4HA 4CXYA 3UUBA 4FBIA 3U3IA 1HNXT 2YDSA 1MIYA 3AEBA 5DTQA 4LF7T 4HFCA 2QRXA 5LHIB 4JCYA 2V7IA 3IF8B 2O49A 4GIWA 3VR8A 2BZBA 1PRAA 4YJ2E 3RYFE 2EBYA 2LLYA 5LG3A 4LF9T 3IEEA 4P09A 4O4JE 3C4ZA 3FB2A 4NXNT 2H7VC 3ZMTB 4X20E 2KINB 4EYYR 4JI6T 2IMLA 5KMGP 3TLUA 3RC3A 2LT3A 4L5GA 4LMLA 2HINA 2WU2A 1IBLT 3AE6A 2FJBA 3SX0A 2HPLA 3JAFA 4EAHA 1R63A 4YLHA 1FJGT 1X9BA 4I6UA 4P0AA 5LYJE 4DMVA 2LSYA 3MK7C 1LMB3 2JVLA 3BDNA 2J4GA 1ZS4A 3L8RA 4WVLA 2Q9QA 2WS3A 4TWDA 3ZYKA 3ZPXA 3B57A 4JI7T 2WDVA 1QP0A 3UU8A 1UXDA 5E0OA 4EZ4A 3C50A 2V7KA 1MIWA 2Q9QD 2E5LT 2WQYA 4ANJA 5AQPB 2VEOA 3UT5E 4YTMA 3TLSA 1S7EA 3AE4A 1MMNA 3CIRA 3PUYF 4Z90A 2V7LA 5FXWA 5CJ5A 4O2BE 3ZN0B 3ANWB 2NTYA 4COFA 2PXQA 4UVAB 2R63A 1LVFA 4CI2B 3KFWX 5L3CB 2MOZA 5JDLA 2C0SA 2OV9A 3K1SA 1BDHA 2JMKA 1KNPA 3ZMVB 3C4XA 2KWIB 1B7TA 2BKPA 4OFZA 3RHWA 3R1FA 2XQ4A 3P4PA 1FMVA 2PXLA 3E08A 2PXTA 2E5VA 2RPAA 3MA9A 5JVDE 2L9QA 3QOWA 4EIWA 1ADRA 2XJ7A 5DSXA 4ILAA 4F8DA 1E2AA 1D1AA 4IT4A 4NUUA 1ZPQA 1HR0T 4QH5A 2FJRA 3O1HA 1L1MA 2ZLYA 2B76A 3FXEB 4PW8A 1EZ3A 1N34T 2UUAT 4KMCA 2GRLA 3ZC1A 1T72A 2WWVA 3F52A 3FBZA 4GYSA 2BG9E 4QWNB 3IHRA 1WYCA 2Y6XA 1GT0C 4YG1A 2CHOA 3HA4A 5LMUT 2L49A 2W2UA 2DHRA 5JDGA 3Q5EA 4TWFA 2R1JL 1UX5A 1OXZA 1JFSA 3O1JA 3RYIE 5ABFA 2BVMA 4A98A 2WMOA 2MXDA 2YU1A 4EEBA 2JCGA 4H63H 2O38A 4JI2T 1LQCA 1JWLA 3PUVF 2ZMAA 3K8PC 4ISTA 5FNVE 2ACZA 3UQ7A 1ZOYA 5F8PA 4FN3A 2X9YA 3N5LA 3B13A 3OKZA 4B3ST 3ZYMA 3I0QA 5JTGA 4ZZCA 3TLWA 4UELA 2V1DB 3PE5A 2XZEA 3BK9A 2W62A 4P1NA 3CQGB 2E9XA 2J7UA 2CSFA 1D1CA 1ZKEA 1W09A 2CWOA 3LFMA 3LQXA 3OQOA 1R8IA 2CRBA 1NERA 2CA5A 3CKDA 1QSDA 2E9XD 3EAMA 3CWZB 4IVZA 2MTQA 2BS3A 2BG9C 3OYXA 5JDFA 5KDMC 4B3RT 3KZ3A 4TZ4C 1RIOA 4A5XA 4J2CA 3RQUA 2AXUA 2PXPA 5AQOB 4H9SE 4JCXA 2PXBA 1L0VA 4EZIA 1S35A 4A56A 3I9YA 4C91A 2WY2A 4NUVA 3O4XE 2PE5A 4NIQA 2WB5A 3ZEFB 4PU8A 5LHHB 4LMJA 4O4LE 2C5IT 2LNMA 2DL1A 5C8YE 1IJ5A 3V5SA 2YK0A 2PUAA 5K98B 3P50A 1LKXA 2OLTA 5AQNB 2BS4A 2CLYC 4HFVA 3PV0F 1ZV4X 3SOLA 3UUMA 5CGMA 1KEYA 1ZAYA 4JI0T 4ZXLA 1WLXA 2O4AA 4FI5A 2D9DA 4HWFA 3CX7B 1DU2A 3EUSA 4CN1A 3VKGA 2YU2A 4PJNA 3O1IA 2K5BB 2ACXA 3LISA 3KV4A 1SHZC 1WFDA 3AEGA 3O9XA 3VHLA 5JRCB 1KFYA 2ZM8A 3KBUA 5AQLB 4EOZB 2XXPA 1HNWT 1BR1A 2YOEA 4ZS2A 3RQWA 4I6RA 2OFYA 2K24A 4CQIA 3UFDA 2H88A 3SCFA 3UU6A 2L8NA 2A72A 3P8CD 2XSDC 2XAFB 2YKSA 3TLTA 2FBWA 5TAOA 4U72A 4G2AA 2V7JA 3HZIB 4JI8T 2KZ7B 1XNRT 2DWKA 4IE0A 4ERRA 1QLBA 3LK3B 1B0NA 1W0BA 2VB6A 4X4DA 3P7IA 3CECA 3A9ZA 3S8QA 2M4HA 1HQ1A 3RIUC 2BKNA 4LMKA 4EV6A 1V9DA 4JI4T 5FKYA 4Y42A 3ONLC 3GBFA 2XAQB 5HEGA 3ONJA 3UUNA 3A8YC 4U7YA 1NEKA 3A7MA 1O4XA 4QXCB 3ZJ2A 5IHYA 3CK6A 2OR1L 4TX5A 3N9QA 2E9XC 2LHRA 1Y01A 3AA1B 1QUUA 1UX4A 4ZI2C 3HKBE 4OHFA 5DQWA 4EK9A 2PTFA 3MLFA 3NROA 4OX9T 4X1KE 2LSJA 1UXCA 2EHOA 2W00A 1NWMX 1GQEA 2HCSA 2QVAA 5FL0A 4AKIA 2PPXA 3LSVA 2SPCA 3RIFA 2IU7A 2K3WA 4DV3T 4LFBT 4ADZA 2E2AA 5FVKA 3QYXA 3FXDB 4E7ZA 1LVKA 1N32T 2P9BA 3E0ZA 2DI4A 2CPTA 5LXTE 3RLFF 4JLEA 1ZVVA 2PUEA 3LJCA 5HEJA 2ODUA 4HEAA 5M4YA 1VCSA 4IA8A 3PUZF 2VL0A 2GK9A 4YSYA 5AQRB 3RRCA 4X64T 3ZJ1A 3BQLA 2V6YA 1RZSA 4YTPA 2XJ3A 1WETA 2XQ3A 4LFAT 4GYRA 3RH3A 2W67A 2BNNA 2LHNA 3VRBA 1Z0PA 4Z5DA 3U3WA 3A9XA 3C51A 3PJAJ 2ZM2A 5AFUL 3PUAA 3JCFA 3IVPA 2MAWA 1OCTC 3A9YA 1PRVA 3N2KE 2PG8A 3EUHA 3FZMB 2LRLA 4ER7A 2X67A 5L2LA 3L39A 5HEHA 5GONE 1WR6A 3DNVB 2XY8B 1D0YA 4DR6T 3ZT7A 2XXAA 5JR9C 3ZSTA 4AKRB 3SFEA 3SCHA 4WW0A 5EK2A 4DVDA 3HKDE 4TV8E 2RA1A 1D0ZA 2YEVC 3I0OA 4AISA 4YT0A 2ZM6T 2L1PA 5J1GA 1HX1B 2CM0A 1UTXA 2I59A 5KXJA 2AE9A 2WMNA 3ZCJA 4AQFA 5C2TA 1HTJF 4Z5CA 4U2YA 3OVUA 2BNOA 5LGNB 4PK4A 4PAGA 3ZKRA 2X9WA 2YINA 4BA9A 2LYKA 1JFTA 4DMWA 1OEDC 3MJXA 4DV4T 4IE5A 2B5AA 1Y64B 2LYPA 2WP9A 2XQ5A 3ESLA 3CROL 4JUYA 2IVBA 5LJNA 1H7CA 2VQFT 3OP9A 1MMDA 4JI5T 5HXRA 4O4HE 4IE7A 5H6RB 2A6CA 4GHJA 3RYCE 4DBRA 2JQHA 2VURA 3QQ6A 3OYZA 2X0LB 4K0KT 3K3NA 1PERL 1U4QA 2AUWA 1OSLA 2NP9A 3HR0A 5L4EA 2W66A 3FYAA 3NZPA 2J47A 2LYQA 2VL8A 5BMVE 5HXSA 3GZDA 4IDPA 3KV5A 2XSAA 4Z5HA 2PUDA 2YDRA 4B6XA 3AA7B 2WBLA 2WDQA 4XAXB 3AE5A 3PE0A 4MLKA 2UXCT 5LA6E 1U5PA 3WAKA 2WDRA 4EEDA 2VKOA 3T1YT 1OWAA 3Q5XA 3CQCB 3HKEE 4DNDA 4ER6A 2CHNA 3AEAA 4IL9A 5CFBA 2LSKA 2HSGA 4DUYT 2C5KT 3IBPA 5BR8T 3GUUA 1HNZT 4F8HA 4BJNA 3I1AA 3DTOA 1OEDE 4IDQA 2PXKA 5LB7B 4HE8A 4IREA 3MKDA 2LKGA 4KUMB 2M6IA 4DV1T 3F2EA 4MCXA 4JYAT 5FL1A 5GAHi 1QP4A 3NRXA 3N2GE 1UCUA 2IHR1 2X9XA 3H3AA 2JIWA 3RGLA 1OEDA 2WUSR 1WH6A 5LMNT 4I43B 5AQMB 3KDSE 2XM1A 4PNIA 5J2UE 3KINB 5FXZA 2XCJA 3UFEA 2XASB 3RKOA 4I6TA 5CA1E 2RP4A 3QB5K 3ZHMA 1YSEA 4IDZA 3S4UA 3CPZA 1XDOA 2XAGB 2LOSA 3ZHIA 3AB3B 2LYJA 1IC8A 3AE8A 3SWHA 3JXDL 2AXZA 1QB2A 2EHOD 2A9UA 1XZYA 3JAEA 5JQGE 2WZIA 4DUZT 3LK42 4UF0B 4I0UA 4H9PC 5JDNA 1PNRA 2F4VT 2ODVA 3AEEA 4HKAA 4EZHA 5JDQA 3BS3A 4KX6A 2AWIA 4OB4A 3OMTA 4AKGA 3CX6B 1ZUGA 3JADA 4HFHA 3QWGA 4EXTA 4AQYT 1BR2A 2MYSA 2LYRA 2LKHA 4G63A 5L3EB 2MEZA 2QYWA 3SRZA 3GN5B 3E22E 2HN1A 2YDQA 2PUFA 4KBMB 4HFEA 1Y9QA 5DTRA 2WZHA 3QC9A 3FZFB 4IDNA 2LOPA 2W61A 3H5TA 1NAFA 3Q5WA 5H6QB 4YHHT 4F6RC 4O8BA 2WIUB 4Z58A 2XUEA 1G8XA 1US7B 3ZC0A 2UUBT 1QQBA 4DIDB 5JUWA 3OBVE 5FP3A 2HPJA 1WH8A 3EHZA 1NEQA 3WAJA 1J1JA 3RYHE 3P4RA 3ZLIA 4C90A 2HHHT 4U2ZA 3JXCL 2BBHA 3PUWF 3F51A 2H3RA 3VU7H 3ME5A 1YD8G 4UF0A 3GMIA 4OYJA 3T1HT 2LYSA 5AQSB 2N9DA 4WZXA 4CN6A 3NXHA 4GOUA 4L9IA 2JJ9A 2CXLA 3UTKA 2HH7A 3N9PA 4U31A 2VWAA 2LEHA 1U2ZA 3AE9A 5HXCA 2Y48B 3ZPOA 3M9LA 2XM2A 3DP7A 4GKJT 2BKOA 2I0MA 5ABFB 3QF3A 3ZYLA 2NW8A 1QQAA 5DABA 4JI3T 1T8BA 4HRAA 2XIUA 1ZP0A 3CQXC 3DJBA 4WNKA 1RZRD 4ER3A 2V7MA 1ZZ6A 3ETUA 3AA6B 3PJAA 3VK0A 3PDYA 1VPWA 2D0UA 4PU4C 2FJEA 3G06A 3AE2A 2Q9QC 2IVQA 2IUBA 1Z8UA 4AI6A 1XMQT 3VRAA 2LLWA 2IUOA 4PJLA 4JEUB 1RZRA 3LFPA 2PIJA 2PXFA 1XNQT 2JQQA 4M1PA 4UV8B 4IE6A 2UXNB 2VQET 4HGAA 4QXHB 4TN7B 2UXBT 2BNMA 1E1HB 3N9LA 5FXVA 2DCFA 2JQKA 1HF0A 4IWRA 3CMLA 2CROA 3V5UA 2YN6A 4ISSA 4Z59A 4IHJE 3MACA 3AAEB 1IAPA 3AAAB 4Z91A 3LDQB 4X5TA 4GKKT 4IE4A 2JRKA 3ZT5A 2JQEA 2PUGA 1ZZCA 2ICPA 5AQVB 1AU7A 4JEHB 3QNUA 2XQ9A 4UXNB 1W0AA 4O8SA 3OJAA 2VASA 3OWQA 1BR0A 5FVLA 3SR4A 1HG2A 1MMAA 1WIZA 4I50E 4I55E 4DV2T 2IDOB 5JH7E 5IUXA 1KNZA 3ZMZB 4TWHA 1FEWA 1X57A 1UURA 4DR5T 3NKZA 4ZI2D 2CE7A 3PUQA 3AXJB 5DJQC 4Z8XA 2AXDS 3JC6D 2LE8A 4H9OC 5L3DB 5AQTB 1X2LA 5HWXA 2W4XA 5AQUB 3RPUA 2PBIA 1M7KA 5DQVA 3QFIA 5HXHA 2MBGA 1E7PA 3H3MA 2AW6A 3ZMSB 2CXDA 2K48A 3D1NI 1KK7A 2ICTA 4KI0F 1YKEB 2PUBA 2N2NA 4H9QC 2NW7A 2QA7A 1DWKA 3PTRB 2V6XA 2KEJA 3C98B 4X66T 4EYUA 2OA5A 5ADXL 3K3QC 2VK9A 4H9NC 2H89A 3N9OA 3HKCE 3KVAA 4ZOLE 3UUXB 4J1WA 3C64A 2WSSV 1KNRA 1M62A 4DR1T 2CBJA 1AJ3A 3IA3A 5LBMA 5DRTA 1LCCA 4YTNA 4DO0A 4AQFC 1SQ8A 3PUGA 4YARA 3M3ZB 3F57A 4ER5A 2NW9A 5EK4A 2PUCA 3WI3A 4B3TT 4JI1T 4KHPT 2DWGA 3NVOA 2V5CA 2BG9A 4QXBB 1R69A 2LM2A 4DV0T 1JNZA 1MMGA 1JH9A 2J62A 4DE9A 4HWCA 3RRWA 3KV9A 4WBNE 1I6ZA 2IW5B 1MNDA 3RC8A 3EDVA 3Q2MA 3GZCA 1FIOA 4OK0A 4YHJA 4EB6E 3UFGA 1HFAA 4NDWA 3AVSA 3P4WA 4HWHA 2B1EA 3ZN1B 5L47A 1KF6A 1O3XA 5HCMA 4ZZBA 5AQHB 1ZHCA 2K9AA 2UXXB 2XHEB 3EVYA 4JQDA 5FY0A 1W9RA 4CI3B 4X1IE 3LK2B 2CEAA 3L09A 1IBMT 3P4SA 5JR9B 4YBAA 3GN5A 5HYAA 3LG7A 2KNDA 1FMWA 3GZDC 1CJGA 2CMRA 1I94T 5A1LA 2J7WA 3PURA 2CWYA 3EI0A 1ZZBA 3FMYA 2E9XB 5A7LA 3PU3A 2KLQA 1EFAA 4HWIB 5EZYE 4V1Av 3UU5A 5AQQB 2IC9A 4J1XA 3AEFA 3MZKB 1XMOT 2DNXA 3PUSA 3LBXA 3JC6C 2L3LA 4IDOA 3VWSA 4GK5E 2A2FX 4AXPA 4N78D 4UEMA 3X1DA 2VKJA 3PU8A 5JDHA 5IWAT 2X0HA 2LSIA 2EHOB 4QKNA 4YFSA 5HCJA 4PJMA 4MFRA 2WWUA 4X4BA 4GK0E 3QOXA 2BS2A 5LGTB 1WR0A 3AECA 3UU4A 4DE8A 4OBMA 1MFQC 2PXUA 2CXFA 3J7Yq 4MALA 3D0TA 3FBLA 5L3FB 5L3BB 3OPCA 3TKLB 1CUNA 2VKDA 1YQ3A 4TNWA 1Y7YA 3GA8A 1LRZA 1QZXA 1D1BA 3H37A 3L3PA 4ASKA 4LF6T 1UUSA 2H7OA 4AKHA 1BDIA 4QX8B 4UR9A 4X4FA 3RI5A 5CB4E 5JREA 2PXVA 2XTLA 2UXDT 1QPZA 3KL4A 4HFDA 1CHUA 1E3OC 3RF1A 3PXPA 2KT9A 2FJAA 4YG4A 4QH1A 5AQKB 2KXPB 4WYVA 4ZI7E 2H8RA 4TV9E 1X79A 4WBOA 2CCQA 4EQZA 4FJOA 3QUJA 2BVLA 4L0RA 1T7SA 3Q5DA 5LBQB 4E7SA 2CBIA 3K3OA 3MEJA 3FHNA 4JV5T 1LCDA 2EHOC 4AIUA 3TLVA 4UIGA 2LRKA 5FXXA 5IYZE 1XWMA 2XQ7A 3N9NA 2J1DG 4BJMA 1BR4A 4CXXA 2FJDA 4LF4T 2M6BA 2M67A 4LF8T 1JNRA 2UUCT 1HX8A 4I4TE 3A5XA 2I6HA 1ZZ9A 3OQNA 1N33T 4TNVA 2XQ8A 3NDBB 3SCGA 2NTXA 2LLVA 3SFDA 4H9RC
chains in the Genus database with same CATH topology
4PU4C 2KEKA 2C5JA 4JLEA 1RPEL 1ZVVA 2Q9QC 2IVQA 4EAHA 1R63A 4YLHA 4AI6A 3CLCA 2PUEA 4I6UA 3LJCA 5LYJE 4P0AA 2ODUA 2GRMA 2LSYA 4DMVA 4HEAA 3MK7C 5M4YA 1LMB3 1HG5A 2IUOA 2JVLA 4IA8A 3BDNA 1ZS4A 4JEUB 4PJLA 1RZRA 2ZM0A 3LFPA 2GK9A 2Q9QA 3F6WA 2PIJA 3RRCA 3ZYKA 2JQQA 2L8KA 4M1PA 3ZJ1A 3BQLA 3B57A 3F31A 4AQGA 4UV8B 1RZSA 2XJ3A 1WETA 4IE6A 2UXNB 1QP0A 4GYRA 1UXDA 3RH3A 2BNNA 4XZCA 4HGAA 2CLYB 2LHNA 4QXHB 5E0OA 4TN7B 3T8OA 5LGUB 3OQMA 4EZ4A 2BNMA 1E1HB 3N9LA 5FXVA 3C50A 2DCFA 2V7KA 1Z0PA 3I9WA 1MIWA 2EWTA 4Z5DA 3U3WA 1HF0A 5FY1A 4IWRA 2Q9QD 3C51A 3CMLA 2ZM2A 5JDMA 4ANJA 5AFUL 2CROA 3V5UA 3PUAA 4X4EA 3UT5E 3ZKCA 3IVPA 4ISSA 2XQYA 4Z59A 4IHJE 4O4IE 3U78A 1OCTC 4KP3C 1PRVA 1S7EA 3MACA 3AAEB 1IAPA 3N2KE 4PK5A 1MMNA 3L1PA 2PG8A 3AAAB 2V7LA 5FXWA 3EUHA 5JR9A 3TRBA 4O2BE 2X67A 4IE4A 2JRKA 3ZN0B 5KX5E 5L2LA 5GONE 1WR6A 3ANWB 2NTYA 2XAHB 2PUGA 1ZZCA 2ICPA 3DNVB 1D0YA 4UVAB 2R63A 2LCVA 2W0GA 1LVFA 1AU7A 4CI2B 3KFWX 4JEHB 5JR9C 5L3CB 2XI8A 4AKRB 3SCHA 2MOZA 4UXNB 4WW0A 5JDLA 5LP6E 2C0SA 3NZQA 4O8SA 3JXBC 5EK2A 4DVDA 3HKDE 4TV8E 1BDHA 2JMKA 2RA1A 3KJXA 2VASA 2X68A 3OJAA 1ZZ8A 1BR0A 1D0ZA 2YEVC 3C4XA 3I0OA 4QHOA 3ZMVB 2KWIB 1B7TA 2LM9A 4OFZA 5J1GA 4K0UA 2CM0A 3R1FA 1HG2A 1MMAA 1WIZA 1UTXA 1FMVA 2I59A 2WMNA 3E08A 1IZNB 4I50E 2EF8A 4I55E 5LOVE 1LLIA 3AA0B 3ZCJA 4AQFA 3MA9A 4QX7B 5JH7E 5JVDE 2L9QA 1HF8A 1KNZA 1HTJF 4Z5CA 2BJCA 1WRDA 3ZMZB 3ZCIA 4EIWA 4GQMA 1ADRA 1FEWA 1X57A 4F8DA 2BNOA 5LGNB 4PK4A 4PAGA 4PFOA 1D1AA 4NUUA 1ZPQA 2X9WA 2JPFA 2YINA 4ZI2D 4X1YE 2FJRA 1XWRA 3O1HA 1L1MA 2CE7A 2GZUA 3PUQA 2ZLYA 2LYKA 4HN9A 1JFTA 4BA9A 5DJQC 3BD1A 4Z8XA 3JC6D 4P0BA 3FXEB 1VOMA 4PW8A 1G73A 2LE8A 2G0UA 1EZ3A 3MJXA 4H9OC 4DMWA 4IE5A 5L3DB 5FY7A 4KMCA 2GRLA 2NOXA 2LYLA 2B5AA 3ZC1A 3F52A 5HAXA 3FBZA 4UV9B 1Y64B 2LYPA 4GYSA 4QWNB 3ESLA 1X2LA 3IHRA 5HWXA 2LSGA 3RPUA 2PBIA 1WYCA 3CROL 2MQKA 5DQVA 2Y6XA 1GT0C 4YG1A 4JUYA 2IVBA 3HA4A 2L49A 5LJNA 3HI2A 3SS1A 1H7CA 4YJ3E 3OP9A 3N2OA 5HXHA 2MBGA 2DHRA 1MMDA 5JDGA 4O4HE 5HXRA 3AAIA 2AW6A 4IE7A 2A6CA 2R1JL 5H6RB 4GHJA 1T98A 5EK3A 3ZMSB 3RYCE 4DBRA 3OKQA 4PU3C 2CXDA 3KXAA 1UX5A 2K48A 2QGSA 3D1NI 1HCIA 2X51A 1KK7A 3QQ6A 2D2SA 1OXZA 1JFSA 3O1JA 1PRUA 3RYIE 3OYZA 2X0LB 2ICTA 1YKEB 3K3NA 1PERL 2PUBA 1U4QA 2N2NA 4H9QC 2AUWA 2NW7A 1OSLA 1DWKA 1QP7A 2BVMA 2NP9A 2QA7A 3HR0A 2KEJA 3PTRB 2WMOA 2YU1A 3C98B 3VKHA 2XAJB 2JCGA 4CI1B 4EYUA 4H63H 2OA5A 2O38A 3FYAA 4I8TA 5ADXL 3NZPA 3K3QC 2VK9A 3NRYA 1LQCA 1JWLA 4H9NC 2ZMAA 3K8PC 4ISTA 2LYQA 3ANWA 5FNVE 1S94A 2VL8A 3N9OA 3HKCE 3KVAA 5F8PA 4ZOLE 5BMVE 4FN3A 2X9YA 3N5LA 5HXSA 2VKHA 3UUXB 4J1WA 3C64A 3B13A 5J2TE 2A3DA 3KV5A 2WSSV 3ZYMA 4Z5HA 2PUDA 4ZI3D 4B6XA 3I0QA 3AA7B 2WBLA 4ILUA 3W15B 1AJ3A 4UELA 4MHCA 2V1DB 5LBMA 4XAXB 2Z6EA 1LCCA 3BK9A 2W62A 4DO0A 3CQGB 3PE0A 4AQFC 1SQ8A 2E9XA 3PUGA 4MLKA 5LA6E 4YARA 3F57A 2NW9A 5EK4A 2CSFA 3ZMUB 2PUCA 1U5PA 4UVCB 4ZHQE 3WI3A 3WAKA 3Q9DA 1D1CA 2VKOA 3NBXX 1OWAA 3Q5XA 3CQCB 1MIVA 1ZKEA 3KVBA 3HKEE 2CWOA 4DNDA 2X9HA 3LFMA 2LSKA 2DWGA 3OQOA 2E8IA 4U74A 5HWYA 2HSGA 1NERA 2IV1A 4H63V 5LNKA 2C5KT 4QXBB 4UVBB 1R69A 2CA5A 3CKDA 4PK6A 1QSDA 3IBPA 2E9XD 3AVRA 3CWZB 4IVZA 2MTQA 3I1AA 3DTOA 4BJNA 5LHGB 1HS7A 2D5VA 1MMGA 1JH9A 3CX8B 3BQKA 4HE8A 4O2AE 3RRWA 3KV9A 4WBNE 3MKDA 4KUMB 2IW5B 1MNDA 3OYXA 3RC8A 3EDVA 5JDFA 5KDMC 3Q2MA 3F2EA 3EDUA 4MCXA 1FIOA 4OK0A 4YHJA 3KZ3A 1QP4A 3NRXA 4TZ4C 1RIOA 3N2GE 1SA0E 5ETWA 4J2CA 4EB6E 1UCUA 2AXUA 1HFAA 4NDWA 1POUA 3R6NA 3ONXA 2X9XA 3H3AA 3AVSA 5JRCA 2B1EA 3ZN1B 4H9SE 1O3XA 2BDEA 2WM9A 4JCXA 2WUSR 1WH6A 4PU7A 1ZHCA 1D0XA 2K9AA 1S35A 4I43B 2V26A 2UXXB 4A56A 2XHEB 3I9YA 3KDSE 3EVYA 4PNIA 5J2UE 4JQDA 3KINB 5FY0A 4C91A 4X4GA 4CI3B 3M65A 5FXZA 2XCJA 4X1IE 4NUVA 3O4XE 3UFEA 2XASB 3RKOA 3LK2B 2PE5A 4PFPA 3ZEFB 4I6TA 5CA1E 4PU8A 2RP4A 5LHHB 4X4CA 3ZHMA 2CEAA 3L09A 1YSEA 4IDZA 4O4LE 3S4UA 2C5IT 3CVRA 3CPZA 2XAGB 2LOSA 3ZHIA 1ZZ7A 5C8YE 5JR9B 4YBAA 2IC6A 3AB3B 3GN5A 5F3JA 1IJ5A 5HYAA 3LG7A 5HXEA 2KNDA 1FMWA 2IAKA 1CJGA 1IJ6A 2CMRA 2KMFA 3KBTA 2LYJA 4HTEA 1IC8A 3V5SA 2YK0A 5A1LA 2PUAA 5K98B 1LKXA 3SWHA 2JMHA 3JXDL 4ZI3C 2AXZA 2EHOD 2CLYC 2IVGA 2LJLA 3PURA 4HFVA 1ZV4X 2CWYA 3SOLA 3N9MA 3UUMA 1ZZBA 1ZAYA 5LCYA 4DBQA 3FMYA 5JQGE 2E9XB 2Q9QB 5A7LA 1WLXA 3PU3A 1ZEEA 2O4AA 4FI5A 2KLQA 1EFAA 3RX6A 4MBQA 3BQIA 3LK42 4TUYE 5EZYE 4V1Av 2W63A 3CX7B 4UF0B 2IC9A 4J1XA 2PJQA 3EUSA 1CQTA 4H9PC 5JDNA 3MZKB 3VKGA 1PNRA 2DNXA 3PUSA 2D5UA 2N1GA 3LBXA 2YU2A 2ODVA 4HKAA 3JC6C 4PJNA 3O1IA 2K5BB 2L3LA 4EZHA 5JDQA 3BS3A 2ACXA 3LISA 3KV4A 2AWIA 1SHZC 4GK5E 2A2FX 4OB4A 3RZZA 3O9XA 3OMTA 3VHLA 3LBXB 4AXPA 4N78D 4UEMA 5JRCB 2Y8DA 2ZM8A 3KBUA 2NWBA 2VKJA 3PU8A 5JDHA 4AKGA 3CX6B 5CA0E 1ZUGA 4EOZB 2LSIA 2EHOB 2KZ8A 4QKNA 3QWGA 3R84B 4YFSA 1BR1A 4PJMA 3HL6A 4MFRA 2WWUA 4ZS2A 4EXTA 3UULA 4X4BA 4GK0E 4I6RA 2OFYA 2K24A 5LGTB 5L3GB 1BR2A 2MYSA 3UFDA 4CQIA 2LYRA 4G63A 3SCFA 2X66A 4PJJA 4YG7B 5L3EB 5LG4A 2MEZA 2L8NA 3KV6A 2D0TA 1WYBA 2CXFA 3SRZA 3GN5B 3B7HA 3E22E 2A72A 3P8CD 3J7Yq 2PUFA 2DLRA 4KBMB 1Y9QA 2XSDC 3G7DA 4MALA 3D0TA 3FBLA 5FMNA 3J9X1 5L3FB 2XAFB 5FYMA 3QC9A 5TAOA 5L3BB 4U72A 4G2AA 2V7JA 3HZIB 3C4WA 2LOPA 3TKLB 1CUNA 2VKDA 2W61A 1Y7YA 3GA8A 2KZ7B 3H5TA 4AKLA 2ES0A 2KPJA 1NAFA 4X4IA 2DWKA 1LRZA 4IIJE 4IE0A 3Q5WA 3UTKA 1D1BA 3H37A 2PFVA 2AXVA 4OYKA 4ZS3A 3L3PA 3GWHA 5H6QB 4ASKA 4CXWA 4ERRA 4CZZB 2H7OA 2KWHA 3LK3B 4O8BA 2WIUB 4BAYB 4Z58A 1B0NA 2XUEA 4F6RC 1G8XA 4AKHA 1BDIA 4QX8B 2VB6A 4X4FA 1US7B 1YW0A 5CB4E 4X4DA 3QK6A 1DW9A 5JREA 3ZC0A 2XTLA 1QPZA 3P7IA 1QQBA 1MNEA 1YKHB 4X4HA 2KEIA 3CECA 3OBVE 2WAUA 5FP3A 1E3OC 3PXPA 3S8QA 2HPJA 2KT9A 3FYMA 4YG4A 1WH8A 3G5GA 4MCTA 1NEQA 3WAJA 5LJMA 2KXPB 1V9DA 4ZI7E 3RYHE 2H8RA 4Y42A 3MXZA 4IGUA 1VRBA 1X79A 4TV9E 2CCQA 4WBOA 3ZLIA 4XBFB 4C90A 3GBFA 2XAQB 3JXCL 3ETVA 4FJOA 3UUNA 3QUJA 2BVLA 4CXYA 4FBIA 4L0RA 3U3IA 3F51A 2H3RA 5LBQB 3VU7H 1O4XA 1MIYA 1YD8G 4UF0A 3GMIA 4E7SA 4QXCB 3ZJ2A 4OYJA 2LYSA 5IHYA 2N9DA 3K3OA 2OR1L 3FHNA 4TX5A 3N9QA 2E9XC 2LHRA 1LCDA 2EHOC 5LHIB 4JCYA 4GOUA 3AA1B 4UIGA 1QUUA 2V7IA 3IF8B 4L9IA 1UX4A 5FXXA 4ZI2C 2JJ9A 2CXLA 3HKBE 5IYZE 3N9NA 2HH7A 3N9PA 4OHFA 2J1DG 2O49A 1BR4A 4GIWA 2BZBA 1PRAA 2LEHA 2VWAA 5DQWA 3RYFE 4BJMA 4CXXA 4YJ2E 3MLFA 2EBYA 4X1KE 5HXCA 2LSJA 1UXCA 2EHOA 2Y48B 3ZPOA 2M67A 3DP7A 2W00A 1NWMX 3IEEA 4P09A 4O4JE 1HX8A 4I4TE 3C4ZA 3FB2A 3QF3A 3ZYLA 2H7VC 2NW8A 3ZMTB 4AKIA 4X20E 3A5XA 2KINB 2PPXA 1QQAA 5DABA 4EYYR 2SPCA 1ZZ9A 3OQNA 5KMGP 2IU7A 2XIUA 3CQXC 3RC3A 2LT3A 4ADZA 3DJBA 4WNKA 4L5GA 2HINA 3QYXA 1RZRD 3FXDB 4E7ZA 1LVKA 2P9BA 3E0ZA 2DI4A 1ZZ6A 2V7MA 3ETUA 3SCGA 2NTXA 3AA6B 5LXTE 4H9RC 3VK0A 3PDYA 1VPWA 2HPLA 2D0UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PU4 C;  2KEK A;  1RPE L;  4MCX A;  1ZVV A;  2IVQ A;  1R63 A;  3HZI B;  3KZ3 A;  1QP4 A;  2GRL A;  3CLC A;  2LYL A;  2B5A A;  1Y7Y A;  4I6U A;  1RIO A;  3F52 A;  3H5T A;  2GRM A;  2PUE A;  3GA8 A;  2LYP A;  2KPJ A;  1LMB 3;  2AXU A;  4X4I A;  1X2L A;  1POU A;  2IUO A;  2JVL A;  4NDW A;  4IA8 A;  3BDN A;  2AXV A;  1ZS4 A;  2MQK A;  3CRO L;  1RZR A;  1GT0 C;  3LFP A;  4YG1 A;  2IVB A;  3F6W A;  2PIJ A;  2WIU B;  4O8B A;  2L49 A;  1B0N A;  4Z58 A;  3HI2 A;  1BDI A;  4JCX A;  2WUS R;  1WH6 A;  3OP9 A;  4X4F A;  4PU7 A;  4X4D A;  1DW9 A;  1QPZ A;  2AW6 A;  2A6C A;  2R1J L;  1RZS A;  4GHJ A;  1QQB A;  2XJ3 A;  1JFT A;  1WET A;  4X4H A;  2KEI A;  4JQD A;  3CEC A;  4X4G A;  4PU3 C;  3KXA A;  1UXD A;  2XCJ A;  1QP0 A;  2BNN A;  1E3O C;  3PXP A;  3D1N I;  3S8Q A;  2PE5 A;  3FYM A;  3QQ6 A;  4YG4 A;  1WH8 A;  3OQM A;  3G5G A;  4I6T A;  1PRU A;  2BNM A;  4MCT A;  4PU8 A;  1JFS A;  4X4C A;  3ZHM A;  1NEQ A;  2ICT A;  1YSE A;  2EWT A;  4Z5D A;  3U3W A;  1HF0 A;  1PER L;  2PUB A;  2H8R A;  4IWR A;  2AUW A;  1OSL A;  1DWK A;  3ZHI A;  1ZZ7 A;  4Y42 A;  1QP7 A;  4YBA A;  2KEJ A;  2CRO A;  3GN5 A;  4X4E A;  3ZKC A;  2JCG A;  3GBF A;  3IVP A;  4Z59 A;  1CJG A;  2O38 A;  3FYA A;  4I8T A;  2LYJ A;  3JXC L;  1IC8 A;  1OCT C;  1LQC A;  1PRV A;  1S7E A;  5K98 B;  1JWL A;  2PUA A;  4FBI A;  3L1P A;  2LYQ A;  3JXD L;  3F51 A;  2AXZ A;  1O4X A;  3TRB A;  2IVG A;  2LYS A;  4FN3 A;  4J1W A;  1ZZB A;  1ZAY A;  2PUG A;  2OR1 L;  1ZZC A;  2ICP A;  3FMY A;  3DNV B;  5A7L A;  2R63 A;  4Z5H A;  2LCV A;  2O4A A;  2PUD A;  1LCD A;  1AU7 A;  1EFA A;  4JCY A;  2XI8 A;  4J1X A;  3EUS A;  3SCH A;  1CQT A;  1LCC A;  1PNR A;  2O49 A;  1PRA A;  3JXB C;  1SQ8 A;  3MLF A;  1BDH A;  2EBY A;  3BS3 A;  3KJX A;  3LIS A;  4YAR A;  1ZZ8 A;  2AWI A;  1UXC A;  4OB4 A;  3RZZ A;  2CSF A;  3OMT A;  3O9X A;  2PUC A;  3R1F A;  1WIZ A;  1UTX A;  1ZUG A;  2EF8 A;  2KZ8 A;  3QF3 A;  3QWG A;  1LLI A;  2PPX A;  1QQA A;  1VPW A;  1ZZ9 A;  3OQO A;  4X4B A;  3OQN A;  4Z5C A;  4I6R A;  2OFY A;  2BJC A;  2HSG A;  1NER A;  2IU7 A;  2IV1 A;  3UFD A;  2XIU A;  2LYR A;  4GQM A;  3SCF A;  1ADR A;  1R69 A;  1X57 A;  4F8D A;  2BNO A;  4YG7 B;  2HIN A;  4IVZ A;  3QYX A;  2MEZ A;  2L8N A;  1RZR D;  1ZPQ A;  2D5V A;  1JH9 A;  1ZZ6 A;  3GN5 B;  3B7H A;  2FJR A;  3SCG A;  1XWR A;  3VK0 A;  1L1M A;  2GZU A;  1Y9Q A;  2PUF A;  2LYK A;  2XSD C;  3G7D A;  3BD1 A; 
#chains in the Genus database with same CATH topology
 4A97 A;  2KEK A;  2C5J A;  1RPE L;  3NWI A;  3CLC A;  5AQG B;  2GRM A;  1HG5 A;  5DTM A;  2ZM0 A;  3F6W A;  2V6Y B;  2VVS A;  2L8K A;  5AQF B;  3F31 A;  4AQG A;  4XZC A;  2CLY B;  5LGU B;  3T8O A;  3OQM A;  5AQJ B;  4LFC T;  1YQ4 A;  3I9W A;  2EWT A;  5FY1 A;  1NEN A;  3VR9 A;  3AE7 A;  4YSX A;  5JDM A;  5GAG i;  4X4E A;  4B3M T;  3ZKC A;  2XQY A;  3U78 A;  4O4I E;  3TFL A;  4KP3 C;  4PK5 A;  3L1P A;  2V5D A;  5JR9 A;  5ABH A;  3TRB A;  5KX5 E;  3AE3 A;  2XAH B;  4LF5 T;  2IIU A;  3RIA A;  2KSR A;  4DV6 T;  2LCV A;  5ABE A;  2W0G A;  2XI8 A;  5LP6 E;  4NXM T;  3NZQ A;  3JXB C;  3FZH B;  2X68 A;  3KJX A;  1ZZ8 A;  4QHO A;  2LM9 A;  4K0U A;  5HEO A;  1IZN B;  5LOV E;  2EF8 A;  1LLI A;  3AA0 B;  4QX7 B;  4DR4 T;  3UWP A;  1HF8 A;  4YY3 T;  2BJC A;  1WRD A;  3ZCI A;  4GQM A;  4ILB A;  3EAB A;  1IBK T;  3P4Q A;  4PFO A;  2JPF A;  4X1Y E;  1XDP A;  4DR7 T;  1XWR A;  3QOF A;  1UGO A;  2GZU A;  4HN9 A;  2BG9 B;  3BD1 A;  4P0B A;  1VOM A;  1G73 A;  2G0U A;  1J5E T;  2PXD A;  5AQI B;  5FY7 A;  2VVN A;  1J5W A;  2LYL A;  2NOX A;  5HAX A;  4UV9 B;  2LSG A;  2MQK A;  3RKG A;  4Q2J A;  3ABV A;  3HI2 A;  4U33 A;  3SS1 A;  4YJ3 E;  3N2O A;  3AAI A;  4AKL A;  5DT2 A;  1T98 A;  4Q25 A;  5EK3 A;  2FUP A;  3OKQ A;  4PU3 C;  3KXA A;  2QGS A;  1HCI A;  2X51 A;  2D2S A;  1PRU A;  4EKG A;  3R09 A;  2XSB A;  4EGW A;  1QP7 A;  3VKH A;  2XAJ B;  4CI1 B;  4I8T A;  3NRY A;  1SE7 A;  3ANW A;  4YXD A;  1S94 A;  2XQ6 A;  2VKH A;  3G0T A;  5J2T E;  2A3D A;  2FFH A;  1OED B;  3FZL B;  4EKI A;  4ZI3 D;  3W15 B;  4ILU A;  4MHC A;  2ODR D;  2Z6E A;  2BBJ A;  2PXE A;  2UU9 T;  2WCA A;  3ZMU B;  4UVC B;  4ZHQ E;  5F5W A;  4DV7 T;  3Q9D A;  3NBX X;  4YSZ A;  1MIV A;  3KVB A;  2X9H A;  4JBW F;  2HFZ A;  5J0Z A;  3PUX F;  5HWY A;  2E8I A;  4U74 A;  1WCR A;  2IV1 A;  4H63 V;  5LNK A;  3AXJ A;  4UVB B;  4PK6 A;  3AVR A;  5LHG B;  1HS7 A;  2D5V A;  1YXR A;  3QB5 A;  3CX8 B;  3BQK A;  4O2A E;  3ZT6 A;  5HEU A;  2WU5 A;  3EDU A;  5ETW A;  1SA0 E;  3R6N A;  1POU A;  3ONX A;  1UK5 A;  5JRC A;  2YBD A;  2BDE A;  1N36 T;  4U3C A;  2WM9 A;  4PU7 A;  1D0X A;  2V26 A;  4ZEY A;  4QH4 A;  4ILC A;  4HWD A;  4X4G A;  4HFI A;  3M65 A;  2JQ9 A;  4PFP A;  4X4C A;  2XPK A;  3CVR A;  3TEP A;  3DM5 A;  1ZZ7 A;  2IC6 A;  2XXQ A;  5F3J A;  5HXE A;  2HCN A;  2IAK A;  1IJ6 A;  2KMF A;  3KBT A;  4HTE A;  3RIU A;  5C3J A;  1SUM B;  2JMH A;  3UQ4 A;  4ZI3 C;  2IVG A;  2LJL A;  2V8S V;  1DUL A;  3N9M A;  5LCY A;  4DBQ A;  2HN2 A;  2Q9Q B;  1ZEE A;  3RX6 A;  4CN4 A;  4MBQ A;  3BQI A;  4TUY E;  2W63 A;  2PJQ A;  1CQT A;  2D5U A;  2N1G A;  3AE1 A;  3AED A;  3RZZ A;  3LBX B;  5ABG A;  2Y8D A;  2NWB A;  5CA0 E;  2KZ8 A;  3R84 B;  3HL6 A;  3ZSS A;  3UUL A;  3UU3 A;  5L3G B;  2MPK A;  2X66 A;  4PJJ A;  4X62 T;  1NW3 A;  4YG7 B;  5LG4 A;  3KV6 A;  4DR2 T;  2D0T A;  2XQA A;  1WYB A;  3B7H A;  3NZL A;  4KHZ F;  4IL4 A;  2DLR A;  5FMN A;  3G7D A;  3J9X 1;  5FYM A;  3B5M A;  3OTO T;  1VCT A;  3C4W A;  2ES0 A;  2X0Y A;  2KPJ A;  4X4I A;  4IIJ E;  4NPP A;  3TEL A;  2PFV A;  2AXV A;  4OYK A;  4ZS3 A;  3GWH A;  4CXW A;  4CZZ B;  4DV5 T;  2KWH A;  4BAY B;  4ER0 A;  1YW0 A;  3QK6 A;  1DW9 A;  4U7I A;  3FZK B;  2R6G F;  1MNE A;  1YKH B;  4X4H A;  2KEI A;  2WAU A;  4DR3 T;  3FYM A;  4X65 T;  3G5G A;  4MCT A;  5DRY A;  5LJM A;  4HFB A;  3MXZ A;  4IGU A;  1VRB A;  2V3C C;  2NR4 A;  4XBF B;  3ETV A;  5L4H A;  4CXY A;  3UUB A;  4FBI A;  3U3I A;  1HNX T;  2YDS A;  1MIY A;  3AEB A;  5DTQ A;  4LF7 T;  4HFC A;  2QRX A;  5LHI B;  4JCY A;  2V7I A;  3IF8 B;  2O49 A;  4GIW A;  3VR8 A;  2BZB A;  1PRA A;  4YJ2 E;  3RYF E;  2EBY A;  2LLY A;  5LG3 A;  4LF9 T;  3IEE A;  4P09 A;  4O4J E;  3C4Z A;  3FB2 A;  4NXN T;  2H7V C;  3ZMT B;  4X20 E;  2KIN B;  4EYY R;  4JI6 T;  2IML A;  5KMG P;  3TLU A;  3RC3 A;  2LT3 A;  4L5G A;  4LML A;  2HIN A;  2WU2 A;  1IBL T;  3AE6 A;  2FJB A;  3SX0 A;  2HPL A;  3JAF A;  4EAH A;  1R63 A;  4YLH A;  1FJG T;  1X9B A;  4I6U A;  4P0A A;  5LYJ E;  4DMV A;  2LSY A;  3MK7 C;  1LMB 3;  2JVL A;  3BDN A;  2J4G A;  1ZS4 A;  3L8R A;  4WVL A;  2Q9Q A;  2WS3 A;  4TWD A;  3ZYK A;  3ZPX A;  3B57 A;  4JI7 T;  2WDV A;  1QP0 A;  3UU8 A;  1UXD A;  5E0O A;  4EZ4 A;  3C50 A;  2V7K A;  1MIW A;  2Q9Q D;  2E5L T;  2WQY A;  4ANJ A;  5AQP B;  2VEO A;  3UT5 E;  4YTM A;  3TLS A;  1S7E A;  3AE4 A;  1MMN A;  3CIR A;  3PUY F;  4Z90 A;  2V7L A;  5FXW A;  5CJ5 A;  4O2B E;  3ZN0 B;  3ANW B;  2NTY A;  4COF A;  2PXQ A;  4UVA B;  2R63 A;  1LVF A;  4CI2 B;  3KFW X;  5L3C B;  2MOZ A;  5JDL A;  2C0S A;  2OV9 A;  3K1S A;  1BDH A;  2JMK A;  1KNP A;  3ZMV B;  3C4X A;  2KWI B;  1B7T A;  2BKP A;  4OFZ A;  3RHW A;  3R1F A;  2XQ4 A;  3P4P A;  1FMV A;  2PXL A;  3E08 A;  2PXT A;  2E5V A;  2RPA A;  3MA9 A;  5JVD E;  2L9Q A;  3QOW A;  4EIW A;  1ADR A;  2XJ7 A;  5DSX A;  4ILA A;  4F8D A;  1E2A A;  1D1A A;  4IT4 A;  4NUU A;  1ZPQ A;  1HR0 T;  4QH5 A;  2FJR A;  3O1H A;  1L1M A;  2ZLY A;  2B76 A;  3FXE B;  4PW8 A;  1EZ3 A;  1N34 T;  2UUA T;  4KMC A;  2GRL A;  3ZC1 A;  1T72 A;  2WWV A;  3F52 A;  3FBZ A;  4GYS A;  2BG9 E;  4QWN B;  3IHR A;  1WYC A;  2Y6X A;  1GT0 C;  4YG1 A;  2CHO A;  3HA4 A;  5LMU T;  2L49 A;  2W2U A;  2DHR A;  5JDG A;  3Q5E A;  4TWF A;  2R1J L;  1UX5 A;  1OXZ A;  1JFS A;  3O1J A;  3RYI E;  5ABF A;  2BVM A;  4A98 A;  2WMO A;  2MXD A;  2YU1 A;  4EEB A;  2JCG A;  4H63 H;  2O38 A;  4JI2 T;  1LQC A;  1JWL A;  3PUV F;  2ZMA A;  3K8P C;  4IST A;  5FNV E;  2ACZ A;  3UQ7 A;  1ZOY A;  5F8P A;  4FN3 A;  2X9Y A;  3N5L A;  3B13 A;  3OKZ A;  4B3S T;  3ZYM A;  3I0Q A;  5JTG A;  4ZZC A;  3TLW A;  4UEL A;  2V1D B;  3PE5 A;  2XZE A;  3BK9 A;  2W62 A;  4P1N A;  3CQG B;  2E9X A;  2J7U A;  2CSF A;  1D1C A;  1ZKE A;  1W09 A;  2CWO A;  3LFM A;  3LQX A;  3OQO A;  1R8I A;  2CRB A;  1NER A;  2CA5 A;  3CKD A;  1QSD A;  2E9X D;  3EAM A;  3CWZ B;  4IVZ A;  2MTQ A;  2BS3 A;  2BG9 C;  3OYX A;  5JDF A;  5KDM C;  4B3R T;  3KZ3 A;  4TZ4 C;  1RIO A;  4A5X A;  4J2C A;  3RQU A;  2AXU A;  2PXP A;  5AQO B;  4H9S E;  4JCX A;  2PXB A;  1L0V A;  4EZI A;  1S35 A;  4A56 A;  3I9Y A;  4C91 A;  2WY2 A;  4NUV A;  3O4X E;  2PE5 A;  4NIQ A;  2WB5 A;  3ZEF B;  4PU8 A;  5LHH B;  4LMJ A;  4O4L E;  2C5I T;  2LNM A;  2DL1 A;  5C8Y E;  1IJ5 A;  3V5S A;  2YK0 A;  2PUA A;  5K98 B;  3P50 A;  1LKX A;  2OLT A;  5AQN B;  2BS4 A;  2CLY C;  4HFV A;  3PV0 F;  1ZV4 X;  3SOL A;  3UUM A;  5CGM A;  1KEY A;  1ZAY A;  4JI0 T;  4ZXL A;  1WLX A;  2O4A A;  4FI5 A;  2D9D A;  4HWF A;  3CX7 B;  1DU2 A;  3EUS A;  4CN1 A;  3VKG A;  2YU2 A;  4PJN A;  3O1I A;  2K5B B;  2ACX A;  3LIS A;  3KV4 A;  1SHZ C;  1WFD A;  3AEG A;  3O9X A;  3VHL A;  5JRC B;  1KFY A;  2ZM8 A;  3KBU A;  5AQL B;  4EOZ B;  2XXP A;  1HNW T;  1BR1 A;  2YOE A;  4ZS2 A;  3RQW A;  4I6R A;  2OFY A;  2K24 A;  4CQI A;  3UFD A;  2H88 A;  3SCF A;  3UU6 A;  2L8N A;  2A72 A;  3P8C D;  2XSD C;  2XAF B;  2YKS A;  3TLT A;  2FBW A;  5TAO A;  4U72 A;  4G2A A;  2V7J A;  3HZI B;  4JI8 T;  2KZ7 B;  1XNR T;  2DWK A;  4IE0 A;  4ERR A;  1QLB A;  3LK3 B;  1B0N A;  1W0B A;  2VB6 A;  4X4D A;  3P7I A;  3CEC A;  3A9Z A;  3S8Q A;  2M4H A;  1HQ1 A;  3RIU C;  2BKN A;  4LMK A;  4EV6 A;  1V9D A;  4JI4 T;  5FKY A;  4Y42 A;  3ONL C;  3GBF A;  2XAQ B;  5HEG A;  3ONJ A;  3UUN A;  3A8Y C;  4U7Y A;  1NEK A;  3A7M A;  1O4X A;  4QXC B;  3ZJ2 A;  5IHY A;  3CK6 A;  2OR1 L;  4TX5 A;  3N9Q A;  2E9X C;  2LHR A;  1Y01 A;  3AA1 B;  1QUU A;  1UX4 A;  4ZI2 C;  3HKB E;  4OHF A;  5DQW A;  4EK9 A;  2PTF A;  3MLF A;  3NRO A;  4OX9 T;  4X1K E;  2LSJ A;  1UXC A;  2EHO A;  2W00 A;  1NWM X;  1GQE A;  2HCS A;  2QVA A;  5FL0 A;  4AKI A;  2PPX A;  3LSV A;  2SPC A;  3RIF A;  2IU7 A;  2K3W A;  4DV3 T;  4LFB T;  4ADZ A;  2E2A A;  5FVK A;  3QYX A;  3FXD B;  4E7Z A;  1LVK A;  1N32 T;  2P9B A;  3E0Z A;  2DI4 A;  2CPT A;  5LXT E;  3RLF F;  4JLE A;  1ZVV A;  2PUE A;  3LJC A;  5HEJ A;  2ODU A;  4HEA A;  5M4Y A;  1VCS A;  4IA8 A;  3PUZ F;  2VL0 A;  2GK9 A;  4YSY A;  5AQR B;  3RRC A;  4X64 T;  3ZJ1 A;  3BQL A;  2V6Y A;  1RZS A;  4YTP A;  2XJ3 A;  1WET A;  2XQ3 A;  4LFA T;  4GYR A;  3RH3 A;  2W67 A;  2BNN A;  2LHN A;  3VRB A;  1Z0P A;  4Z5D A;  3U3W A;  3A9X A;  3C51 A;  3PJA J;  2ZM2 A;  5AFU L;  3PUA A;  3JCF A;  3IVP A;  2MAW A;  1OCT C;  3A9Y A;  1PRV A;  3N2K E;  2PG8 A;  3EUH A;  3FZM B;  2LRL A;  4ER7 A;  2X67 A;  5L2L A;  3L39 A;  5HEH A;  5GON E;  1WR6 A;  3DNV B;  2XY8 B;  1D0Y A;  4DR6 T;  3ZT7 A;  2XXA A;  5JR9 C;  3ZST A;  4AKR B;  3SFE A;  3SCH A;  4WW0 A;  5EK2 A;  4DVD A;  3HKD E;  4TV8 E;  2RA1 A;  1D0Z A;  2YEV C;  3I0O A;  4AIS A;  4YT0 A;  2ZM6 T;  2L1P A;  5J1G A;  1HX1 B;  2CM0 A;  1UTX A;  2I59 A;  5KXJ A;  2AE9 A;  2WMN A;  3ZCJ A;  4AQF A;  5C2T A;  1HTJ F;  4Z5C A;  4U2Y A;  3OVU A;  2BNO A;  5LGN B;  4PK4 A;  4PAG A;  3ZKR A;  2X9W A;  2YIN A;  4BA9 A;  2LYK A;  1JFT A;  4DMW A;  1OED C;  3MJX A;  4DV4 T;  4IE5 A;  2B5A A;  1Y64 B;  2LYP A;  2WP9 A;  2XQ5 A;  3ESL A;  3CRO L;  4JUY A;  2IVB A;  5LJN A;  1H7C A;  2VQF T;  3OP9 A;  1MMD A;  4JI5 T;  5HXR A;  4O4H E;  4IE7 A;  5H6R B;  2A6C A;  4GHJ A;  3RYC E;  4DBR A;  2JQH A;  2VUR A;  3QQ6 A;  3OYZ A;  2X0L B;  4K0K T;  3K3N A;  1PER L;  1U4Q A;  2AUW A;  1OSL A;  2NP9 A;  3HR0 A;  5L4E A;  2W66 A;  3FYA A;  3NZP A;  2J47 A;  2LYQ A;  2VL8 A;  5BMV E;  5HXS A;  3GZD A;  4IDP A;  3KV5 A;  2XSA A;  4Z5H A;  2PUD A;  2YDR A;  4B6X A;  3AA7 B;  2WBL A;  2WDQ A;  4XAX B;  3AE5 A;  3PE0 A;  4MLK A;  2UXC T;  5LA6 E;  1U5P A;  3WAK A;  2WDR A;  4EED A;  2VKO A;  3T1Y T;  1OWA A;  3Q5X A;  3CQC B;  3HKE E;  4DND A;  4ER6 A;  2CHN A;  3AEA A;  4IL9 A;  5CFB A;  2LSK A;  2HSG A;  4DUY T;  2C5K T;  3IBP A;  5BR8 T;  3GUU A;  1HNZ T;  4F8H A;  4BJN A;  3I1A A;  3DTO A;  1OED E;  4IDQ A;  2PXK A;  5LB7 B;  4HE8 A;  4IRE A;  3MKD A;  2LKG A;  4KUM B;  2M6I A;  4DV1 T;  3F2E A;  4MCX A;  4JYA T;  5FL1 A;  5GAH i;  1QP4 A;  3NRX A;  3N2G E;  1UCU A;  2IHR 1;  2X9X A;  3H3A A;  2JIW A;  3RGL A;  1OED A;  2WUS R;  1WH6 A;  5LMN T;  4I43 B;  5AQM B;  3KDS E;  2XM1 A;  4PNI A;  5J2U E;  3KIN B;  5FXZ A;  2XCJ A;  3UFE A;  2XAS B;  3RKO A;  4I6T A;  5CA1 E;  2RP4 A;  3QB5 K;  3ZHM A;  1YSE A;  4IDZ A;  3S4U A;  3CPZ A;  1XDO A;  2XAG B;  2LOS A;  3ZHI A;  3AB3 B;  2LYJ A;  1IC8 A;  3AE8 A;  3SWH A;  3JXD L;  2AXZ A;  1QB2 A;  2EHO D;  2A9U A;  1XZY A;  3JAE A;  5JQG E;  2WZI A;  4DUZ T;  3LK4 2;  4UF0 B;  4I0U A;  4H9P C;  5JDN A;  1PNR A;  2F4V T;  2ODV A;  3AEE A;  4HKA A;  4EZH A;  5JDQ A;  3BS3 A;  4KX6 A;  2AWI A;  4OB4 A;  3OMT A;  4AKG A;  3CX6 B;  1ZUG A;  3JAD A;  4HFH A;  3QWG A;  4EXT A;  4AQY T;  1BR2 A;  2MYS A;  2LYR A;  2LKH A;  4G63 A;  5L3E B;  2MEZ A;  2QYW A;  3SRZ A;  3GN5 B;  3E22 E;  2HN1 A;  2YDQ A;  2PUF A;  4KBM B;  4HFE A;  1Y9Q A;  5DTR A;  2WZH A;  3QC9 A;  3FZF B;  4IDN A;  2LOP A;  2W61 A;  3H5T A;  1NAF A;  3Q5W A;  5H6Q B;  4YHH T;  4F6R C;  4O8B A;  2WIU B;  4Z58 A;  2XUE A;  1G8X A;  1US7 B;  3ZC0 A;  2UUB T;  1QQB A;  4DID B;  5JUW A;  3OBV E;  5FP3 A;  2HPJ A;  1WH8 A;  3EHZ A;  1NEQ A;  3WAJ A;  1J1J A;  3RYH E;  3P4R A;  3ZLI A;  4C90 A;  2HHH T;  4U2Z A;  3JXC L;  2BBH A;  3PUW F;  3F51 A;  2H3R A;  3VU7 H;  3ME5 A;  1YD8 G;  4UF0 A;  3GMI A;  4OYJ A;  3T1H T;  2LYS A;  5AQS B;  2N9D A;  4WZX A;  4CN6 A;  3NXH A;  4GOU A;  4L9I A;  2JJ9 A;  2CXL A;  3UTK A;  2HH7 A;  3N9P A;  4U31 A;  2VWA A;  2LEH A;  1U2Z A;  3AE9 A;  5HXC A;  2Y48 B;  3ZPO A;  3M9L A;  2XM2 A;  3DP7 A;  4GKJ T;  2BKO A;  2I0M A;  5ABF B;  3QF3 A;  3ZYL A;  2NW8 A;  1QQA A;  5DAB A;  4JI3 T;  1T8B A;  4HRA A;  2XIU A;  1ZP0 A;  3CQX C;  3DJB A;  4WNK A;  1RZR D;  4ER3 A;  2V7M A;  1ZZ6 A;  3ETU A;  3AA6 B;  3PJA A;  3VK0 A;  3PDY A;  1VPW A;  2D0U A;  4PU4 C;  2FJE A;  3G06 A;  3AE2 A;  2Q9Q C;  2IVQ A;  2IUB A;  1Z8U A;  4AI6 A;  1XMQ T;  3VRA A;  2LLW A;  2IUO A;  4PJL A;  4JEU B;  1RZR A;  3LFP A;  2PIJ A;  2PXF A;  1XNQ T;  2JQQ A;  4M1P A;  4UV8 B;  4IE6 A;  2UXN B;  2VQE T;  4HGA A;  4QXH B;  4TN7 B;  2UXB T;  2BNM A;  1E1H B;  3N9L A;  5FXV A;  2DCF A;  2JQK A;  1HF0 A;  4IWR A;  3CML A;  2CRO A;  3V5U A;  2YN6 A;  4ISS A;  4Z59 A;  4IHJ E;  3MAC A;  3AAE B;  1IAP A;  3AAA B;  4Z91 A;  3LDQ B;  4X5T A;  4GKK T;  4IE4 A;  2JRK A;  3ZT5 A;  2JQE A;  2PUG A;  1ZZC A;  2ICP A;  5AQV B;  1AU7 A;  4JEH B;  3QNU A;  2XQ9 A;  4UXN B;  1W0A A;  4O8S A;  3OJA A;  2VAS A;  3OWQ A;  1BR0 A;  5FVL A;  3SR4 A;  1HG2 A;  1MMA A;  1WIZ A;  4I50 E;  4I55 E;  4DV2 T;  2IDO B;  5JH7 E;  5IUX A;  1KNZ A;  3ZMZ B;  4TWH A;  1FEW A;  1X57 A;  1UUR A;  4DR5 T;  3NKZ A;  4ZI2 D;  2CE7 A;  3PUQ A;  3AXJ B;  5DJQ C;  4Z8X A;  2AXD S;  3JC6 D;  2LE8 A;  4H9O C;  5L3D B;  5AQT B;  1X2L A;  5HWX A;  2W4X A;  5AQU B;  3RPU A;  2PBI A;  1M7K A;  5DQV A;  3QFI A;  5HXH A;  2MBG A;  1E7P A;  3H3M A;  2AW6 A;  3ZMS B;  2CXD A;  2K48 A;  3D1N I;  1KK7 A;  2ICT A;  4KI0 F;  1YKE B;  2PUB A;  2N2N A;  4H9Q C;  2NW7 A;  2QA7 A;  1DWK A;  3PTR B;  2V6X A;  2KEJ A;  3C98 B;  4X66 T;  4EYU A;  2OA5 A;  5ADX L;  3K3Q C;  2VK9 A;  4H9N C;  2H89 A;  3N9O A;  3HKC E;  3KVA A;  4ZOL E;  3UUX B;  4J1W A;  3C64 A;  2WSS V;  1KNR A;  1M62 A;  4DR1 T;  2CBJ A;  1AJ3 A;  3IA3 A;  5LBM A;  5DRT A;  1LCC A;  4YTN A;  4DO0 A;  4AQF C;  1SQ8 A;  3PUG A;  4YAR A;  3M3Z B;  3F57 A;  4ER5 A;  2NW9 A;  5EK4 A;  2PUC A;  3WI3 A;  4B3T T;  4JI1 T;  4KHP T;  2DWG A;  3NVO A;  2V5C A;  2BG9 A;  4QXB B;  1R69 A;  2LM2 A;  4DV0 T;  1JNZ A;  1MMG A;  1JH9 A;  2J62 A;  4DE9 A;  4HWC A;  3RRW A;  3KV9 A;  4WBN E;  1I6Z A;  2IW5 B;  1MND A;  3RC8 A;  3EDV A;  3Q2M A;  3GZC A;  1FIO A;  4OK0 A;  4YHJ A;  4EB6 E;  3UFG A;  1HFA A;  4NDW A;  3AVS A;  3P4W A;  4HWH A;  2B1E A;  3ZN1 B;  5L47 A;  1KF6 A;  1O3X A;  5HCM A;  4ZZB A;  5AQH B;  1ZHC A;  2K9A A;  2UXX B;  2XHE B;  3EVY A;  4JQD A;  5FY0 A;  1W9R A;  4CI3 B;  4X1I E;  3LK2 B;  2CEA A;  3L09 A;  1IBM T;  3P4S A;  5JR9 B;  4YBA A;  3GN5 A;  5HYA A;  3LG7 A;  2KND A;  1FMW A;  3GZD C;  1CJG A;  2CMR A;  1I94 T;  5A1L A;  2J7W A;  3PUR A;  2CWY A;  3EI0 A;  1ZZB A;  3FMY A;  2E9X B;  5A7L A;  3PU3 A;  2KLQ A;  1EFA A;  4HWI B;  5EZY E;  4V1A v;  3UU5 A;  5AQQ B;  2IC9 A;  4J1X A;  3AEF A;  3MZK B;  1XMO T;  2DNX A;  3PUS A;  3LBX A;  3JC6 C;  2L3L A;  4IDO A;  3VWS A;  4GK5 E;  2A2F X;  4AXP A;  4N78 D;  4UEM A;  3X1D A;  2VKJ A;  3PU8 A;  5JDH A;  5IWA T;  2X0H A;  2LSI A;  2EHO B;  4QKN A;  4YFS A;  5HCJ A;  4PJM A;  4MFR A;  2WWU A;  4X4B A;  4GK0 E;  3QOX A;  2BS2 A;  5LGT B;  1WR0 A;  3AEC A;  3UU4 A;  4DE8 A;  4OBM A;  1MFQ C;  2PXU A;  2CXF A;  3J7Y q;  4MAL A;  3D0T A;  3FBL A;  5L3F B;  5L3B B;  3OPC A;  3TKL B;  1CUN A;  2VKD A;  1YQ3 A;  4TNW A;  1Y7Y A;  3GA8 A;  1LRZ A;  1QZX A;  1D1B A;  3H37 A;  3L3P A;  4ASK A;  4LF6 T;  1UUS A;  2H7O A;  4AKH A;  1BDI A;  4QX8 B;  4UR9 A;  4X4F A;  3RI5 A;  5CB4 E;  5JRE A;  2PXV A;  2XTL A;  2UXD T;  1QPZ A;  3KL4 A;  4HFD A;  1CHU A;  1E3O C;  3RF1 A;  3PXP A;  2KT9 A;  2FJA A;  4YG4 A;  4QH1 A;  5AQK B;  2KXP B;  4WYV A;  4ZI7 E;  2H8R A;  4TV9 E;  1X79 A;  4WBO A;  2CCQ A;  4EQZ A;  4FJO A;  3QUJ A;  2BVL A;  4L0R A;  1T7S A;  3Q5D A;  5LBQ B;  4E7S A;  2CBI A;  3K3O A;  3MEJ A;  3FHN A;  4JV5 T;  1LCD A;  2EHO C;  4AIU A;  3TLV A;  4UIG A;  2LRK A;  5FXX A;  5IYZ E;  1XWM A;  2XQ7 A;  3N9N A;  2J1D G;  4BJM A;  1BR4 A;  4CXX A;  2FJD A;  4LF4 T;  2M6B A;  2M67 A;  4LF8 T;  1JNR A;  2UUC T;  1HX8 A;  4I4T E;  3A5X A;  2I6H A;  1ZZ9 A;  3OQN A;  1N33 T;  4TNV A;  2XQ8 A;  3NDB B;  3SCG A;  2NTX A;  2LLV A;  3SFD A;  4H9R C; 
#chains in the Genus database with same CATH homology
 4PU4 C;  2KEK A;  2C5J A;  4JLE A;  1RPE L;  1ZVV A;  2Q9Q C;  2IVQ A;  4EAH A;  1R63 A;  4YLH A;  4AI6 A;  3CLC A;  2PUE A;  4I6U A;  3LJC A;  5LYJ E;  4P0A A;  2ODU A;  2GRM A;  2LSY A;  4DMV A;  4HEA A;  3MK7 C;  5M4Y A;  1LMB 3;  1HG5 A;  2IUO A;  2JVL A;  4IA8 A;  3BDN A;  1ZS4 A;  4JEU B;  4PJL A;  1RZR A;  2ZM0 A;  3LFP A;  2GK9 A;  2Q9Q A;  3F6W A;  2PIJ A;  3RRC A;  3ZYK A;  2JQQ A;  2L8K A;  4M1P A;  3ZJ1 A;  3BQL A;  3B57 A;  3F31 A;  4AQG A;  4UV8 B;  1RZS A;  2XJ3 A;  1WET A;  4IE6 A;  2UXN B;  1QP0 A;  4GYR A;  1UXD A;  3RH3 A;  2BNN A;  4XZC A;  4HGA A;  2CLY B;  2LHN A;  4QXH B;  5E0O A;  4TN7 B;  3T8O A;  5LGU B;  3OQM A;  4EZ4 A;  2BNM A;  1E1H B;  3N9L A;  5FXV A;  3C50 A;  2DCF A;  2V7K A;  1Z0P A;  3I9W A;  1MIW A;  2EWT A;  4Z5D A;  3U3W A;  1HF0 A;  5FY1 A;  4IWR A;  2Q9Q D;  3C51 A;  3CML A;  2ZM2 A;  5JDM A;  4ANJ A;  5AFU L;  2CRO A;  3V5U A;  3PUA A;  4X4E A;  3UT5 E;  3ZKC A;  3IVP A;  4ISS A;  2XQY A;  4Z59 A;  4IHJ E;  4O4I E;  3U78 A;  1OCT C;  4KP3 C;  1PRV A;  1S7E A;  3MAC A;  3AAE B;  1IAP A;  3N2K E;  4PK5 A;  1MMN A;  3L1P A;  2PG8 A;  3AAA B;  2V7L A;  5FXW A;  3EUH A;  5JR9 A;  3TRB A;  4O2B E;  2X67 A;  4IE4 A;  2JRK A;  3ZN0 B;  5KX5 E;  5L2L A;  5GON E;  1WR6 A;  3ANW B;  2NTY A;  2XAH B;  2PUG A;  1ZZC A;  2ICP A;  3DNV B;  1D0Y A;  4UVA B;  2R63 A;  2LCV A;  2W0G A;  1LVF A;  1AU7 A;  4CI2 B;  3KFW X;  4JEH B;  5JR9 C;  5L3C B;  2XI8 A;  4AKR B;  3SCH A;  2MOZ A;  4UXN B;  4WW0 A;  5JDL A;  5LP6 E;  2C0S A;  3NZQ A;  4O8S A;  3JXB C;  5EK2 A;  4DVD A;  3HKD E;  4TV8 E;  1BDH A;  2JMK A;  2RA1 A;  3KJX A;  2VAS A;  2X68 A;  3OJA A;  1ZZ8 A;  1BR0 A;  1D0Z A;  2YEV C;  3C4X A;  3I0O A;  4QHO A;  3ZMV B;  2KWI B;  1B7T A;  2LM9 A;  4OFZ A;  5J1G A;  4K0U A;  2CM0 A;  3R1F A;  1HG2 A;  1MMA A;  1WIZ A;  1UTX A;  1FMV A;  2I59 A;  2WMN A;  3E08 A;  1IZN B;  4I50 E;  2EF8 A;  4I55 E;  5LOV E;  1LLI A;  3AA0 B;  3ZCJ A;  4AQF A;  3MA9 A;  4QX7 B;  5JH7 E;  5JVD E;  2L9Q A;  1HF8 A;  1KNZ A;  1HTJ F;  4Z5C A;  2BJC A;  1WRD A;  3ZMZ B;  3ZCI A;  4EIW A;  4GQM A;  1ADR A;  1FEW A;  1X57 A;  4F8D A;  2BNO A;  5LGN B;  4PK4 A;  4PAG A;  4PFO A;  1D1A A;  4NUU A;  1ZPQ A;  2X9W A;  2JPF A;  2YIN A;  4ZI2 D;  4X1Y E;  2FJR A;  1XWR A;  3O1H A;  1L1M A;  2CE7 A;  2GZU A;  3PUQ A;  2ZLY A;  2LYK A;  4HN9 A;  1JFT A;  4BA9 A;  5DJQ C;  3BD1 A;  4Z8X A;  3JC6 D;  4P0B A;  3FXE B;  1VOM A;  4PW8 A;  1G73 A;  2LE8 A;  2G0U A;  1EZ3 A;  3MJX A;  4H9O C;  4DMW A;  4IE5 A;  5L3D B;  5FY7 A;  4KMC A;  2GRL A;  2NOX A;  2LYL A;  2B5A A;  3ZC1 A;  3F52 A;  5HAX A;  3FBZ A;  4UV9 B;  1Y64 B;  2LYP A;  4GYS A;  4QWN B;  3ESL A;  1X2L A;  3IHR A;  5HWX A;  2LSG A;  3RPU A;  2PBI A;  1WYC A;  3CRO L;  2MQK A;  5DQV A;  2Y6X A;  1GT0 C;  4YG1 A;  4JUY A;  2IVB A;  3HA4 A;  2L49 A;  5LJN A;  3HI2 A;  3SS1 A;  1H7C A;  4YJ3 E;  3OP9 A;  3N2O A;  5HXH A;  2MBG A;  2DHR A;  1MMD A;  5JDG A;  4O4H E;  5HXR A;  3AAI A;  2AW6 A;  4IE7 A;  2A6C A;  2R1J L;  5H6R B;  4GHJ A;  1T98 A;  5EK3 A;  3ZMS B;  3RYC E;  4DBR A;  3OKQ A;  4PU3 C;  2CXD A;  3KXA A;  1UX5 A;  2K48 A;  2QGS A;  3D1N I;  1HCI A;  2X51 A;  1KK7 A;  3QQ6 A;  2D2S A;  1OXZ A;  1JFS A;  3O1J A;  1PRU A;  3RYI E;  3OYZ A;  2X0L B;  2ICT A;  1YKE B;  3K3N A;  1PER L;  2PUB A;  1U4Q A;  2N2N A;  4H9Q C;  2AUW A;  2NW7 A;  1OSL A;  1DWK A;  1QP7 A;  2BVM A;  2NP9 A;  2QA7 A;  3HR0 A;  2KEJ A;  3PTR B;  2WMO A;  2YU1 A;  3C98 B;  3VKH A;  2XAJ B;  2JCG A;  4CI1 B;  4EYU A;  4H63 H;  2OA5 A;  2O38 A;  3FYA A;  4I8T A;  5ADX L;  3NZP A;  3K3Q C;  2VK9 A;  3NRY A;  1LQC A;  1JWL A;  4H9N C;  2ZMA A;  3K8P C;  4IST A;  2LYQ A;  3ANW A;  5FNV E;  1S94 A;  2VL8 A;  3N9O A;  3HKC E;  3KVA A;  5F8P A;  4ZOL E;  5BMV E;  4FN3 A;  2X9Y A;  3N5L A;  5HXS A;  2VKH A;  3UUX B;  4J1W A;  3C64 A;  3B13 A;  5J2T E;  2A3D A;  3KV5 A;  2WSS V;  3ZYM A;  4Z5H A;  2PUD A;  4ZI3 D;  4B6X A;  3I0Q A;  3AA7 B;  2WBL A;  4ILU A;  3W15 B;  1AJ3 A;  4UEL A;  4MHC A;  2V1D B;  5LBM A;  4XAX B;  2Z6E A;  1LCC A;  3BK9 A;  2W62 A;  4DO0 A;  3CQG B;  3PE0 A;  4AQF C;  1SQ8 A;  2E9X A;  3PUG A;  4MLK A;  5LA6 E;  4YAR A;  3F57 A;  2NW9 A;  5EK4 A;  2CSF A;  3ZMU B;  2PUC A;  1U5P A;  4UVC B;  4ZHQ E;  3WI3 A;  3WAK A;  3Q9D A;  1D1C A;  2VKO A;  3NBX X;  1OWA A;  3Q5X A;  3CQC B;  1MIV A;  1ZKE A;  3KVB A;  3HKE E;  2CWO A;  4DND A;  2X9H A;  3LFM A;  2LSK A;  2DWG A;  3OQO A;  2E8I A;  4U74 A;  5HWY A;  2HSG A;  1NER A;  2IV1 A;  4H63 V;  5LNK A;  2C5K T;  4QXB B;  4UVB B;  1R69 A;  2CA5 A;  3CKD A;  4PK6 A;  1QSD A;  3IBP A;  2E9X D;  3AVR A;  3CWZ B;  4IVZ A;  2MTQ A;  3I1A A;  3DTO A;  4BJN A;  5LHG B;  1HS7 A;  2D5V A;  1MMG A;  1JH9 A;  3CX8 B;  3BQK A;  4HE8 A;  4O2A E;  3RRW A;  3KV9 A;  4WBN E;  3MKD A;  4KUM B;  2IW5 B;  1MND A;  3OYX A;  3RC8 A;  3EDV A;  5JDF A;  5KDM C;  3Q2M A;  3F2E A;  3EDU A;  4MCX A;  1FIO A;  4OK0 A;  4YHJ A;  3KZ3 A;  1QP4 A;  3NRX A;  4TZ4 C;  1RIO A;  3N2G E;  1SA0 E;  5ETW A;  4J2C A;  4EB6 E;  1UCU A;  2AXU A;  1HFA A;  4NDW A;  1POU A;  3R6N A;  3ONX A;  2X9X A;  3H3A A;  3AVS A;  5JRC A;  2B1E A;  3ZN1 B;  4H9S E;  1O3X A;  2BDE A;  2WM9 A;  4JCX A;  2WUS R;  1WH6 A;  4PU7 A;  1ZHC A;  1D0X A;  2K9A A;  1S35 A;  4I43 B;  2V26 A;  2UXX B;  4A56 A;  2XHE B;  3I9Y A;  3KDS E;  3EVY A;  4PNI A;  5J2U E;  4JQD A;  3KIN B;  5FY0 A;  4C91 A;  4X4G A;  4CI3 B;  3M65 A;  5FXZ A;  2XCJ A;  4X1I E;  4NUV A;  3O4X E;  3UFE A;  2XAS B;  3RKO A;  3LK2 B;  2PE5 A;  4PFP A;  3ZEF B;  4I6T A;  5CA1 E;  4PU8 A;  2RP4 A;  5LHH B;  4X4C A;  3ZHM A;  2CEA A;  3L09 A;  1YSE A;  4IDZ A;  4O4L E;  3S4U A;  2C5I T;  3CVR A;  3CPZ A;  2XAG B;  2LOS A;  3ZHI A;  1ZZ7 A;  5C8Y E;  5JR9 B;  4YBA A;  2IC6 A;  3AB3 B;  3GN5 A;  5F3J A;  1IJ5 A;  5HYA A;  3LG7 A;  5HXE A;  2KND A;  1FMW A;  2IAK A;  1CJG A;  1IJ6 A;  2CMR A;  2KMF A;  3KBT A;  2LYJ A;  4HTE A;  1IC8 A;  3V5S A;  2YK0 A;  5A1L A;  2PUA A;  5K98 B;  1LKX A;  3SWH A;  2JMH A;  3JXD L;  4ZI3 C;  2AXZ A;  2EHO D;  2CLY C;  2IVG A;  2LJL A;  3PUR A;  4HFV A;  1ZV4 X;  2CWY A;  3SOL A;  3N9M A;  3UUM A;  1ZZB A;  1ZAY A;  5LCY A;  4DBQ A;  3FMY A;  5JQG E;  2E9X B;  2Q9Q B;  5A7L A;  1WLX A;  3PU3 A;  1ZEE A;  2O4A A;  4FI5 A;  2KLQ A;  1EFA A;  3RX6 A;  4MBQ A;  3BQI A;  3LK4 2;  4TUY E;  5EZY E;  4V1A v;  2W63 A;  3CX7 B;  4UF0 B;  2IC9 A;  4J1X A;  2PJQ A;  3EUS A;  1CQT A;  4H9P C;  5JDN A;  3MZK B;  3VKG A;  1PNR A;  2DNX A;  3PUS A;  2D5U A;  2N1G A;  3LBX A;  2YU2 A;  2ODV A;  4HKA A;  3JC6 C;  4PJN A;  3O1I A;  2K5B B;  2L3L A;  4EZH A;  5JDQ A;  3BS3 A;  2ACX A;  3LIS A;  3KV4 A;  2AWI A;  1SHZ C;  4GK5 E;  2A2F X;  4OB4 A;  3RZZ A;  3O9X A;  3OMT A;  3VHL A;  3LBX B;  4AXP A;  4N78 D;  4UEM A;  5JRC B;  2Y8D A;  2ZM8 A;  3KBU A;  2NWB A;  2VKJ A;  3PU8 A;  5JDH A;  4AKG A;  3CX6 B;  5CA0 E;  1ZUG A;  4EOZ B;  2LSI A;  2EHO B;  2KZ8 A;  4QKN A;  3QWG A;  3R84 B;  4YFS A;  1BR1 A;  4PJM A;  3HL6 A;  4MFR A;  2WWU A;  4ZS2 A;  4EXT A;  3UUL A;  4X4B A;  4GK0 E;  4I6R A;  2OFY A;  2K24 A;  5LGT B;  5L3G B;  1BR2 A;  2MYS A;  3UFD A;  4CQI A;  2LYR A;  4G63 A;  3SCF A;  2X66 A;  4PJJ A;  4YG7 B;  5L3E B;  5LG4 A;  2MEZ A;  2L8N A;  3KV6 A;  2D0T A;  1WYB A;  2CXF A;  3SRZ A;  3GN5 B;  3B7H A;  3E22 E;  2A72 A;  3P8C D;  3J7Y q;  2PUF A;  2DLR A;  4KBM B;  1Y9Q A;  2XSD C;  3G7D A;  4MAL A;  3D0T A;  3FBL A;  5FMN A;  3J9X 1;  5L3F B;  2XAF B;  5FYM A;  3QC9 A;  5TAO A;  5L3B B;  4U72 A;  4G2A A;  2V7J A;  3HZI B;  3C4W A;  2LOP A;  3TKL B;  1CUN A;  2VKD A;  2W61 A;  1Y7Y A;  3GA8 A;  2KZ7 B;  3H5T A;  4AKL A;  2ES0 A;  2KPJ A;  1NAF A;  4X4I A;  2DWK A;  1LRZ A;  4IIJ E;  4IE0 A;  3Q5W A;  3UTK A;  1D1B A;  3H37 A;  2PFV A;  2AXV A;  4OYK A;  4ZS3 A;  3L3P A;  3GWH A;  5H6Q B;  4ASK A;  4CXW A;  4ERR A;  4CZZ B;  2H7O A;  2KWH A;  3LK3 B;  4O8B A;  2WIU B;  4BAY B;  4Z58 A;  1B0N A;  2XUE A;  4F6R C;  1G8X A;  4AKH A;  1BDI A;  4QX8 B;  2VB6 A;  4X4F A;  1US7 B;  1YW0 A;  5CB4 E;  4X4D A;  3QK6 A;  1DW9 A;  5JRE A;  3ZC0 A;  2XTL A;  1QPZ A;  3P7I A;  1QQB A;  1MNE A;  1YKH B;  4X4H A;  2KEI A;  3CEC A;  3OBV E;  2WAU A;  5FP3 A;  1E3O C;  3PXP A;  3S8Q A;  2HPJ A;  2KT9 A;  3FYM A;  4YG4 A;  1WH8 A;  3G5G A;  4MCT A;  1NEQ A;  3WAJ A;  5LJM A;  2KXP B;  1V9D A;  4ZI7 E;  3RYH E;  2H8R A;  4Y42 A;  3MXZ A;  4IGU A;  1VRB A;  1X79 A;  4TV9 E;  2CCQ A;  4WBO A;  3ZLI A;  4XBF B;  4C90 A;  3GBF A;  2XAQ B;  3JXC L;  3ETV A;  4FJO A;  3UUN A;  3QUJ A;  2BVL A;  4CXY A;  4FBI A;  4L0R A;  3U3I A;  3F51 A;  2H3R A;  5LBQ B;  3VU7 H;  1O4X A;  1MIY A;  1YD8 G;  4UF0 A;  3GMI A;  4E7S A;  4QXC B;  3ZJ2 A;  4OYJ A;  2LYS A;  5IHY A;  2N9D A;  3K3O A;  2OR1 L;  3FHN A;  4TX5 A;  3N9Q A;  2E9X C;  2LHR A;  1LCD A;  2EHO C;  5LHI B;  4JCY A;  4GOU A;  3AA1 B;  4UIG A;  1QUU A;  2V7I A;  3IF8 B;  4L9I A;  1UX4 A;  5FXX A;  4ZI2 C;  2JJ9 A;  2CXL A;  3HKB E;  5IYZ E;  3N9N A;  2HH7 A;  3N9P A;  4OHF A;  2J1D G;  2O49 A;  1BR4 A;  4GIW A;  2BZB A;  1PRA A;  2LEH A;  2VWA A;  5DQW A;  3RYF E;  4BJM A;  4CXX A;  4YJ2 E;  3MLF A;  2EBY A;  4X1K E;  5HXC A;  2LSJ A;  1UXC A;  2EHO A;  2Y48 B;  3ZPO A;  2M67 A;  3DP7 A;  2W00 A;  1NWM X;  3IEE A;  4P09 A;  4O4J E;  1HX8 A;  4I4T E;  3C4Z A;  3FB2 A;  3QF3 A;  3ZYL A;  2H7V C;  2NW8 A;  3ZMT B;  4AKI A;  4X20 E;  3A5X A;  2KIN B;  2PPX A;  1QQA A;  5DAB A;  4EYY R;  2SPC A;  1ZZ9 A;  3OQN A;  5KMG P;  2IU7 A;  2XIU A;  3CQX C;  3RC3 A;  2LT3 A;  4ADZ A;  3DJB A;  4WNK A;  4L5G A;  2HIN A;  3QYX A;  1RZR D;  3FXD B;  4E7Z A;  1LVK A;  2P9B A;  3E0Z A;  2DI4 A;  1ZZ6 A;  2V7M A;  3ETU A;  3SCG A;  2NTX A;  3AA6 B;  5LXT E;  4H9R C;  3VK0 A;  3PDY A;  1VPW A;  2HPL A;  2D0U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...