3O9XA

Structure of the e. coli antitoxin mqsa (ygit/b3021) in complex with its gene promoter
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
132
structure length
132
Chain Sequence
HMKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKKLSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized HTH-type transcriptional regulator ygiT
publication title Structure of the Escherichia coli Antitoxin MqsA (YgiT/b3021) Bound to Its Gene Promoter Reveals Extensive Domain Rearrangements and the Specificity of Transcriptional Regulation.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription regulator/dna
total genus 40
structure length 132
sequence length 132
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF15731 MqsA_antitoxin Antitoxin component of bacterial toxin-antitoxin system, MqsA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 3o9xA02
1.20.58.720 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3o9xA01
2XCJA 2HSGA 2L8NA 3IVPA 4Y42A 3FYAA 2BJCA 2KZ8A 3SCHA 2XSDC 4OB4A 4YARA 4X4IA 4YG7B 2LYRA 1AU7A 2PUDA 2EBYA 2LYKA 3PXPA 3KZ3A 1QP4A 2MEZA 1E3OC 3KJXA 3QQ6A 1DW9A 2AXZA 2AXUA 2PPXA 2PUAA 1CJGA 4JQDA 5K98B 3CLCA 1ZVVA 1PNRA 1LMB3 3B7HA 3GA8A 3OMTA 4MCXA 1YSEA 2R1JL 4J1XA 2XJ3A 1IC8A 4IA8A 1L1MA 2IVQA 1R63A 2LYLA 4J1WA 1OCTC 3CROL 4I6UA 1LQCA 2LYQA 2IVBA 3LISA 4PU8A 2PIJA 1PERL 3ZKCA 1WETA 4X4EA 1RZRD 2A6CA 1NEQA 4Z5CA 1SQ8A 1GT0C 2PE5A 1ZS4A 2WUSR 3LFPA 1S7EA 2FJRA 1BDHA 4FBIA 2AUWA 5A7LA 2XI8A 3VK0A 3QF3A 4YBAA 1QQBA 3U3WA 1WH8A 2IUOA 1RZSA 4X4DA 1VPWA 3D1NI 3F6WA 4YG1A 1ADRA 1ZZCA 2JCGA 2PUEA 4JCXA 1ZZBA 2XIUA 3F51A 1JFTA 1HF0A 1XWRA 3GBFA 2GRLA 1UXDA 4Z5HA 3OP9A 2JVLA 2AWIA 4Z59A 3DNVB 2GZUA 1RIOA 3GN5B 1CQTA 1QP7A 4X4GA 3QWGA 3O9XA 1RPEL 2D5VA 3CECA 3BDNA 3FMYA 3BS3A 2IVGA 1ZAYA 1JFSA 2B5AA 1QQAA 1X57A 4MCTA 2PUBA 4X4FA 3FYMA 1ZZ9A 3BD1A 2ICTA 1PRAA 1UXCA 2LYJA 1QPZA 2OFYA 1EFAA 1QP0A 2IU7A 3JXBC 3R1FA 2BNNA 1ZUGA 2MQKA 3GN5A 3F52A 1X2LA 3JXDL 4PU4C 2KPJA 4Z5DA 4JCYA 1BDIA 2BNMA 2R63A 1Y7YA 4I8TA 2WIUB 2PUGA 2KEKA 1ZZ7A 3H5TA 2OR1L 1LCCA 2CSFA 4IWRA 4PU3C 4FN3A 2CROA 2AW6A 2HINA 3EUSA 3ZHIA 3JXCL 2IV1A 3L1PA 3TRBA 1ZZ8A 4X4HA 1LLIA 1ZPQA 4Z58A 1POUA 2O49A 1JH9A 1WH6A 2EF8A 1NERA 2PUCA 2O4AA 1PRUA 2LYSA 4YG4A 3HZIB 2ICPA 1JWLA 4GQMA 3SCFA 4O8BA 2AXVA 4I6TA 4X4BA 1ZZ6A 3OQNA 3ZHMA 4IVZA 3UFDA 3OQOA 2L49A 3HI2A 1O4XA 1PRVA 1RZRA 2O38A 3QYXA 4F8DA 3RZZA 2EWTA 1Y9QA 4PU7A 4X4CA 2LYPA 3S8QA 3KXAA 4NDWA 2KEJA 3OQMA 1B0NA 1R69A 2PUFA 4GHJA 1OSLA 2H8RA 3G5GA 4I6RA 2BNOA 1UTXA 1LCDA 3G7DA 2GRMA 3SCGA 2LCVA 3MLFA 1WIZA 2KEIA 1DWKA
chains in the Genus database with same CATH superfamily
3C64A 4K0KT 5HXSA 4I50E 3ZYKA 4JI3T 3UU4A 4CXYA 2V3CC 3FB2A 2X68A 1M62A 2XJ3A 2VKHA 3MZKB 2WZIA 3ZKCA 2CWYA 3G0TA 3JCFA 2JPFA 5FNVE 1GQEA 4N78D 1I94T 1L0VA 3AXJB 5LBQB 1N36T 4XZCA 2I0MA 3KFWX 2K5BB 4DE9A 2NW8A 1CHUA 4OYKA 4NXMT 4JI8T 4QHOA 5LGUB 4LMKA 2PUBA 4C90A 2DWKA 3RH3A 1YD8G 1QP0A 1T98A 3MA9A 1S94A 1OEDC 2HN1A 2CSFA 4IHJE 2BZBA 1HS7A 2MPKA 3TLTA 5DJQC 3F31A 4LF5T 4B3TT 4WBNE 2XQ5A 2H7OA 4QH1A 1U2ZA 3ZHMA 4U31A 4DMWA 4EZIA 5LA6E 4ANJA 2X66A 4ZI7E 2BNOA 1XZYA 1LCDA 3K3OA 3G7DA 3SCGA 3A8YC 5EZYE 4QH4A 2BG9E 1KEYA 2XQ3A 5LCYA 2RP4A 3OPCA 4H9SE 1OEDB 2MTQA 4XBFB 1ZEEA 2XQ9A 4IIJE 4TN7B 2Q9QD 2IVQA 3RQUA 4LF8T 4A97A 3OKZA 2V6YA 2PIJA 2BS4A 2CM0A 4X4EA 3BK9A 2CHNA 2WMNA 3A5XA 4FI5A 2D0UA 2YN6A 2WUSR 4H63V 3AEFA 1H7CA 2KWHA 3WAKA 4TNWA 1G8XA 4YG1A 4JUYA 5LJMA 2UU9T 1R8IA 3RQWA 2VB6A 3DNVB 1FMWA 3X1DA 3UT5E 4TUYE 3R09A 5IHYA 2LOPA 2HCNA 4DR7T 1PRAA 4ILAA 5LP6E 1X2LA 2LKHA 3PUAA 4O4LE 1HNZT 4UELA 2LNMA 5AQOB 5LNKA 5DQWA 4TV9E 5HWXA 3ZT5A 2HPJA 4JEUB 3L1PA 2W4XA 5LMUT 2CEAA 4C91A 2ODUA 1J5WA 1WH6A 2X0LB 2JQKA 5HAXA 4ZZBA 1ZZ6A 2NP9A 1O4XA 4PFPA 4CXXA 5AQRB 5JDMA 2LEHA 3LK2B 1OSLA 5JQGE 3OBVE 4TNVA 2DI4A 4QXBB 4PK4A 2VK9A 2W62A 4IE7A 3N2KE 2XHEB 5FYMA 4Y42A 3RKGA 3U3IA 2LE8A 3IHRA 1KNRA 2V7JA 3MJXA 5GAHi 2D2SA 3AB3B 4U3CA 2KXPB 1Y01A 2LHRA 4J1WA 1ZP0A 4HGAA 4K0UA 5AQLB 2A6CA 4Z5CA 3PDYA 1BDHA 4B3MT 4DR5T 3QC9A 3SOLA 2C0SA 1KK7A 3LK3B 2IAKA 2PUEA 2BBHA 4WNKA 5CA0E 4IDPA 4ZOLE 1V9DA 2D5VA 3CX8B 4LFCT 3ZC0A 4M1PA 3QB5A 3V5SA 3UQ7A 1W9RA 4IT4A 2E9XB 2FUPA 3OWQA 3C4WA 4HWFA 2HFZA 3ZT6A 3HKCE 3ANWA 4EK9A 4GKKT 2JQQA 2RPAA 1I6ZA 3DM5A 2V26A 3CX6B 3N9PA 4AKLA 3T1HT 5LG4A 4L9IA 3JC6D 3IF8B 1NEKA 3I9WA 4KUMB 2IC9A 2LYPA 4NDWA 2KEJA 3ZYMA 2CBIA 2HHHT 2XUEA 5JVDE 2IC6A 2MOZA 2DHRA 2E8IA 1Z8UA 3P4PA 2LLYA 5JDFA 2L8NA 3FYAA 2YOEA 4PK5A 3ZT7A 3UWPA 4ZS2A 2C5KT 2LYKA 3TLWA 2MEZA 3J9X1 2XAGB 3N9NA 4CQIA 2VURA 1IC8A 2LYLA 4NUVA 2LYQA 2LSKA 5LBMA 3PUSA 2AXDS 5F3JA 4I43B 5AQQB 5HEOA 4HFVA 3ME5A 5FXVA 4WVLA 2DNXA 2K24A 3VRAA 4WW0A 3QF3A 1WH8A 4UVCB 2JIWA 1XDPA 1WLXA 1T72A 2VKOA 3OP9A 3GN5B 3AXJA 1IZNB 3BS3A 4I4TE 5TAOA 4LMLA 3UFGA 3NRYA 2UXDT 1EFAA 5AQMB 3GUUA 5AQNB 3ONJA 5F8PA 2I59A 3P50A 2BNMA 1Y7YA 4I8TA 2YDQA 4DBRA 4TZ4C 2OR1L 3UQ4A 4YLHA 2X9HA 3B13A 2XXPA 2XAJB 2WAUA 3ABVA 1ZPQA 1FEWA 1D1CA 2JRKA 3L8RA 2BVLA 4TV8E 2VKJA 1BR1A 3AE3A 1OXZA 2YINA 2EWTA 4JI7T 3U78A 5FVKA 3RKOA 2B1EA 2PXBA 1OWAA 2PUFA 3LQXA 3NXHA 4I6RA 5JDGA 2KZ7B 2BG9B 1WIZA 5HXRA 3ZKRA 2HSGA 2BJCA 1E2AA 2A9UA 2W61A 4OB4A 4YARA 4U2ZA 2QVAA 4KI0F 4AIUA 3AA6B 3QQ6A 4JQDA 1MMNA 2CLYC 1KNZA 5K98B 3AE1A 1BR2A 3B7HA 4FJOA 3K3NA 3HKEE 5AQUB 4I6UA 2LRKA 3NRXA 1LQCA 5AQIB 4X64T 1PERL 5EK3A 4H63H 5HEUA 3RYIE 3AEDA 3H37A 4QH5A 3LFPA 3UUMA 4G2AA 2VASA 4ZI3C 2CWOA 5LMNT 4YHJA 2BS2A 4B3RT 2FJEA 3ZN0B 1RZSA 2XAFB 1Z0PA 2N2NA 1CQTA 2NOXA 3ZN1B 2FJBA 2IVGA 4GYSA 2NWBA 4JYAT 3KV9A 4PFOA 1IJ5A 2I6HA 1E1HB 3UU5A 4AQFA 4ASKA 1QUUA 5JTGA 2A72A 5JR9B 2Q9QB 2WQYA 4MBQA 4FN3A 2V5DA 2DLRA 1M7KA 4EYYR 3JAFA 1POUA 3HZIB 4AI6A 2ODVA 1JNRA 4DV0T 4J2CA 4O8BA 4QXHB 2DWGA 2XJ7A 2OA5A 3H3MA 2M4HA 4ZI2C 2KLQA 3C51A 4KP3C 1HNWT 2BKNA 3MEJA 5CFBA 2A3DA 2CHOA 4IREA 5KDMC 1D0XA 4HTEA 2LJLA 1D0YA 2C5IT 5LHIB 3NDBB 4NXNT 3FHNA 4X4IA 3ZPOA 3KVAA 3R6NA 2P9BA 3FZMB 4DR1T 3VKGA 5LXTE 3QFIA 2PXVA 2NTYA 1UUSA 3RYHE 2UXCT 1YXRA 2HN2A 5DT2A 2A2FX 1HTJF 4BA9A 2XQAA 1WETA 2EHOD 4Z90A 2WY2A 2KINB 5AQSB 3C4ZA 4PJJA 3QOXA 2WDRA 2ACXA 3PJAA 4YY3T 1IAPA 3TELA 3PE0A 2UUAT 3F51A 3ZMTB 3E08A 4NPPA 4IE4A 2NW7A 4IE5A 1EZ3A 4ISSA 1US7B 4MCTA 2LSJA 3MXZA 2XAHB 2WWVA 3SFEA 1KNPA 4IGUA 2IIUA 4MALA 2PXPA 4MHCA 1XNRT 2E9XA 2K9AA 4KHZF 5JDLA 1D1AA 5DTQA 2J1DG 5DTMA 4OBMA 3VR9A 4UF0B 2O4AA 5ADXL 3VWSA 4LFBT 3EDVA 5L3CB 2R6GF 5HEHA 4COFA 5H6RB 4F8DA 1MNEA 3GMIA 2CMRA 1B0NA 1J1JA 4HWHA 2JMHA 4EEBA 3V5UA 5L3BB 3C50A 2V8SV 3HA4A 4AQYT 2XCJA 2XSDC 2HPLA 2WDQA 5HYAA 5JRCB 3SFDA 1HFAA 2Y48B 2WM9A 2PPXA 2BS3A 4YHHT 4KMCA 3T8OA 5ABGA 1ZVVA 4DVDA 2XSAA 1X9BA 1YSEA 3LSVA 1N34T 2IMLA 3LISA 5DQVA 3RX6A 1RZRD 4L0RA 3RIUA 3EHZA 4DV2T 4AQFC 2BVMA 4DMVA 4UV8B 4ER5A 3RPUA 2MXDA 2RA1A 2UXBT 3KDSE 2AWIA 4Z59A 2DL1A 3N9MA 5FVLA 3RGLA 1XMQT 4U74A 4O4IE 3M3ZB 2YDRA 3CQXC 2H89A 2OFYA 2V6XA 3GN5A 3F52A 4JCYA 4YTMA 2XXQA 3AE6A 5FXWA 3H5TA 4UXNB 2F4VT 5LYJE 2HINA 2J62A 3CPZA 3ZHIA 4XAXB 1LLIA 2H3RA 4ILBA 5AQKB 4YG4A 4HWCA 2YKSA 3KV5A 1MIWA 1WR6A 2VL8A 4Z8XA 1QLBA 5BMVE 4X1YE 2JMKA 2PXLA 3CX7B 3ZJ1A 5IYZE 4ER6A 2LSYA 3AA1B 4OX9T 3RIFA 4GK5E 2V5CA 2YBDA 2EBYA 3PXPA 2J7WA 2BG9A 1MIYA 4KHPT 1BR4A 4IDOA 3FXEB 1R63A 1OCTC 2LLWA 3UU8A 4P1NA 1D0ZA 3GZCA 4EXTA 2FJAA 4Z91A 2XI8A 4YBAA 3O1JA 1QQBA 3PTRB 3J7Yq 2E9XC 5C8YE 3KBUA 3UTKA 1ADRA 2JCGA 1BR0A 2OLTA 1HF0A 1LKXA 4DE8A 2QYWA 3I0OA 4UIGA 4DV6T 3O9XA 4GIWA 3NWIA 2B5AA 2OV9A 3GWHA 3FYMA 3HR0A 2LM9A 3QOFA 2IU7A 4Q25A 4HRAA 4CN1A 3SWHA 4DV4T 3CQGB 3N2OA 2JQ9A 2PUGA 3PV0F 3AEGA 1W09A 3DTOA 5CGMA 4EYUA 3RI5A 4AKHA 3TRBA 3QOWA 3F57A 3P4QA 3PJAJ 5JR9A 2Q9QA 2ICPA 2J7UA 1MIVA 4I6TA 3OQNA 3QUJA 3OQOA 1U4QA 4PJMA 2L1PA 5AQFB 3RZZA 1HX8A 2H88A 4CZZB 4UR9A 3O1IA 2N1GA 3ZEFB 3RIUC 3ESLA 1DWKA 2VL0A 2KZ8A 4DO0A 2LYRA 1XNQT 3AA0B 2X9WA 5L3DB 2LT3A 2UUBT 1VOMA 4ZEYA 4EOZB 4E7ZA 3P4WA 4MCXA 4DR2T 3PUVF 4AKIA 5IWAT 3ZSSA 3UFEA 4QWNB 5HXCA 4HFDA 1KF6A 3AAEB 5FY1A 2AUWA 5ABFA 2X67A 3LK42 4V1Av 3QNUA 4KBMB 4QXCB 1ZZCA 2XIUA 1JFTA 3SX0A 4U7IA 3RYFE 4DIDB 5J2TE 2XM1A 2WCAA 1NW3A 3PURA 5ABEA 5HEJA 3PUGA 3TKLB 3BQLA 3ZPXA 4F8HA 1UXCA 5LHGB 3HL6A 3GZDA 3O1HA 2BKPA 1NWMX 4JV5T 2IUBA 4GK0E 4CXWA 4PU3C 2CROA 3A7MA 2AW6A 5HXHA 1MMAA 5LHHB 3M65A 2ZM6T 2V7IA 2G0UA 1IJ6A 1ZZ8A 4Z58A 2XSBA 2PXQA 2PUCA 4CI2B 4B3ST 2K48A 3EI0A 3ZCJA 2BG9C 2WDVA 4X4BA 4IE6A 1OEDE 4BJNA 4UF0A 3QYXA 3IEEA 1Y9QA 3B5MA 3S8QA 2GK9A 2WU5A 2CBJA 3OQMA 3N9QA 3ETUA 1NAFA 3PUYF 2CA5A 2W00A 1UTXA 3HKDE 4IE0A 4DR6T 3AA7B 2KEIA 4P09A 1LVKA 3EAMA 2L3LA 4PW8A 1ZV4X 1VRBA 1E3OC 2B76A 2VQET 2AXUA 5LB7B 3P4SA 3ZJ2A 1NENA 4QKNA 5L3EB 3LG7A 2Z6EA 1YKHB 5AFUL 3OMTA 5JRCA 2R1JL 4ER7A 2WU2A 5HEGA 2LSGA 2QRXA 2VWAA 2XQ6A 4YJ3E 3MK7C 3NZPA 2X0HA 3S4UA 2JQEA 3BQKA 2MBGA 1XWRA 4H9RC 2GRLA 2X9XA 5L3GB 5IUXA 5JR9C 3SR4A 2Q9QC 2D0TA 2CRBA 1HG2A 4PAGA 2XXAA 1ZAYA 1JFSA 5BR8T 2WZHA 4GOUA 5L4EA 3UU6A 1U5PA 3K1SA 3RHWA 3MACA 3FZKB 3QB5K 1ZUGA 2PXKA 3OYZA 4PU4C 4X66T 1BDIA 4PK6A 4HFBA 3CKDA 4QX7B 3EABA 4JI5T 2W66A 5FY0A 4ADZA 3AECA 3EDUA 4WBOA 5GAGi 5HXEA 1PRUA 4P0BA 4OYJA 4TWDA 3UFDA 4ILUA 2ZM2A 4PU7A 3LDQB 4EAHA 2ODRD 2LSIA 5AQJB 4O4HE 4WYVA 2UUCT 5CA1E 3K3QC 4DBQA 3VKHA 2VEOA 3O4XE 2BBJA 5LGTB 4EGWA 1QP4A 1UX4A 4IL4A 3DJBA 3AEBA 3CLCA 3ZMVB 1UURA 1LMB3 1IBLT 1CUNA 3K8PC 3CQCB 2N9DA 5C3JA 2KNDA 2H7VC 3RF1A 4PU8A 3TEPA 2J4GA 3G06A 4EZ4A 2NW9A 3GZDC 4P0AA 3KINB 2XZEA 4I0UA 2IUOA 3RRWA 5GONE 2PXTA 1ZZBA 3TLVA 3UUXB 1UXDA 5HWYA 2JVLA 3FBLA 4BJMA 1RPEL 3Q2MA 5ABFB 4EEDA 2CXFA 3AE4A 1QQAA 4CN6A 1ZZ9A 2LYJA 3NZLA 3CMLA 1HQ1A 3F2EA 3AE9A 2BNNA 2IW5B 4DR3T 3W15B 1WRDA 4HFHA 2PXDA 4DV1T 2CPTA 4JI2T 4HWIB 3EUSA 1AJ3A 5JREA 5FP3A 2XQ7A 4IDQA 3ONLC 3SS1A 2AXVA 2Y8DA 4A56A 3LBXA 4IVZA 2L49A 3HI2A 2VQFT 5AQVB 3AE7A 2XQYA 3AE8A 3ONXA 2VVNA 2LCVA 5JDHA 4MFRA 4H9PC 3RLFF 3OTOT 3RC8A 1MMGA 3ZMZB 1ZOYA 3C4XA 4EQZA 2UXNB 1AU7A 4CI3B 3WI3A 2PXEA 2IDOB 2YDSA 3KJXA 3JC6C 2PUAA 2CE7A 2E5VA 4EKIA 3CIRA 5DTRA 4WZXA 4B6XA 2JJ9A 3L09A 3PUXF 2WS3A 2M67A 5DRYA 1S35A 1ZS4A 2LOSA 4PNIA 3A9XA 1WYCA 2XTLA 3NVOA 3UUNA 4EB6E 1VPWA 3D1NI 4CN4A 2M6BA 4YT0A 4YSZA 5LGNB 3E22E 3N2GE 4AKRB 4X4GA 2W2UA 4ER3A 2WWUA 4HN9A 1J5ET 3AVRA 4YSYA 3ZCIA 1W0AA 4AQGA 2R63A 3UUBA 3DP7A 2MAWA 1ZZ7A 1HNXT 4DUYT 4ZHQE 3PU8A 4X1IE 4IWRA 3Q5EA 2PTFA 5EK2A 3UULA 3VRBA 4ILCA 2IV1A 4X62T 4A98A 1KFYA 2NR4A 4GQMA 2L8KA 3SCFA 1WR0A 5FY7A 2SPCA 4G63A 4GYRA 4DV7T 5AQPB 2EHOA 2IHR1 2LLVA 2MYSA 1R69A 1N33T 2YU1A 3PUZF 5KMGP 1O3XA 2FJDA 1IBKT 2GRMA 2WP9A 4ZI3D 3PE5A 4L5GA 2V7KA 4YFSA 4O2BE 4GKJT 2PUDA 1T7SA 2WB5A 5FKYA 4IDNA 1E7PA 3FZFB 1CJGA 3R84B 4HFCA 5DRTA 4LF4T 1Y64B 2KMFA 5AQHB 2WSSV 4ZS3A 2IVBA 4KX6A 4YTNA 4OFZA 3VR8A 1NEQA 2AE9A 1SQ8A 2PE5A 4JLEA 4EV6A 5CB4E 3N9OA 4FBIA 3CVRA 3I1AA 4Q2JA 3P8CD 3U3WA 3PU3A 1HR0T 2ZM0A 3F6WA 4UEMA 3RYCE 4DR4T 5AQTB 5FXXA 3NBXX 3KL4A 4JI0T 3TFLA 4YSXA 1XWMA 3ZYLA 4AISA 5FL1A 4X4FA 4QX8B 4U72A 5DSXA 1QPZA 5JDQA 5HCJA 4ZI2D 3NKZA 3Q9DA 3VHLA 3KVBA 2FBWA 4YXDA 3ZC1A 4HWDA 2PXFA 2E5LT 2KEKA 4X20E 5J1GA 3FZLB 3OVUA 4HEAA 4X4HA 3IA3A 1NERA 2LYSA 1QZXA 2K3WA 2X9YA 3LJCA 4LF9T 4JBWF 2XY8B 3JADA 2W63A 4U33A 1RZRA 1HCIA 2CCQA 3ZSTA 1MFQC 1IBMT 1VCTA 3LBXB 1W0BA 3KV6A 3A9YA 3SCHA 4PJLA 4YG7B 4YTPA 4LF7T 3T1YT 3RIAA 1ZKEA 2AXZA 4H9QC 1HX1B 1LVFA 2PXUA 3KV4A 5L47A 4O4JE 4UVBB 5C2TA 3JAEA 1L1MA 1YW0A 5H6QB 3Q5XA 3CROL 4LFAT 3M9LA 2D5UA 2W67A 4AXPA 2V7MA 4NUUA 3OYXA 4DUZT 4UV9B 3SRZA 3MKDA 2XAQB 3LFMA 5J2UE 4X4DA 2M6IA 2KWIB 4U2YA 3N9LA 5LG3A 2HH7A 3GBFA 1QP7A 5ABHA 2NTXA 1YKEB 2FFHA 3FMYA 4LMJA 4OK0A 4O8SA 2CXDA 2DCFA 2W0GA 3JXBC 2EHOC 4EIWA 2C5JA 1FMVA 2PG8A 4ISTA 1LCCA 3QK6A 5L4HA 2HCSA 2X51A 3KBTA 5JDNA 3B57A 4HFEA 4UVAB 4DV3T 1JWLA 1HF8A 5M4YA 4U7YA 3I0QA 2PFVA 4A5XA 1G73A 5HCMA 2ACZA 4ER0A 3AE2A 4NIQA 1D1BA 2H8RA 5E0OA 2YEVC 4TX5A 3MLFA 3AEAA 4X4CA 3AE5A 4F6RC 3IVPA 2EHOB 5KXJA 2PJQA 5LJNA 2WBLA 3IBPA 3L39A 3P4RA 5FL0A 1SA0E 2V6YB 5J0ZA 1HG5A 1PNRA 3PUQA 3GA8A 4IL9A 2Y6XA 3VU7H 5JUWA 4IDZA 4IA8A 3H3AA 4DNDA 4MLKA 4PJNA 5JH7E 4ZXLA 5LOVE 2YK0A 4H9OC 5ETWA 3ETVA 1JNZA 1S7EA 2UXXB 5EK4A 1UX5A 4E7SA 3EVYA 5A7LA 3VK0A 3AEEA 3D0TA 4X1KE 5FMNA 2E2AA 2V7LA 1B7TA 2QGSA 3ZMSB 4Z5HA 1RIOA 1MNDA 4OHFA 2GZUA 1XDOA 4TWHA 4EZHA 2WMOA 5F5WA 5KX5E 2D9DA 1X57A 3ZMUB 2ICTA 3WAJA 4JI6T 4YJ2E 3JXDL 2J47A 2XPKA 4HFIA 4HKAA 3AVSA 3RRCA 3NZQA 3OKQA 5A1LA 4ERRA 2VKDA 3JXCL 1T8BA 2XASB 4AKGA 5AQGB 3E0ZA 1SHZC 2PBIA 2QA7A 1DU2A 2O38A 1VCSA 2LM2A 1SE7A 1YQ3A 5CJ5A 2KSRA 1OEDA 2XQ8A 3OJAA 3L3PA 3TLUA 5L2LA 2XQ4A 3C98B 3CWZB 4DV5T 1X79A 2BKOA 2E9XD 2V1DB 3KZ3A 2ZM8A 3AAAB 4H9NC 2LHNA 1DW9A 3PUWF 5DABA 1LRZA 1ZHCA 3RC3A 4X65T 2ES0A 1FIOA 4J1XA 4TWFA 1WYBA 5L3FB 4CI1B 4LF6T 3FBZA 4I55E 3NROA 2CLYB 3N5LA 1GT0C 1DULA 2ZLYA 2FJRA 2BDEA 3UU3A 2JQHA 2LRLA 2XM2A 1QSDA 4JCXA 3BQIA 3I9YA 4HE8A 2X0YA 3QWGA 3CECA 3BDNA 2KT9A 3ANWB 4X5TA 3HKBE 4ZZCA 3CK6A 3BD1A 1UGOA 3R1FA 4EKGA 2MQKA 1UK5A 3FZHB 4Z5DA 2KPJA 2LKGA 1FJGT 1XMOT 2CXLA 2VVSA 4JI4T 2WIUB 1WCRA 1SUMB 2L9QA 3FXDB 3Q5WA 4JI1T 3A9ZA 3Q5DA 2O49A 1JH9A 2EF8A 4O2AE 1UCUA 2ZMAA 1MMDA 3EUHA 3TLSA 2YU2A 4JEHB 3P7IA 1WFDA 4BAYB 1PRVA 3ZLIA 1YQ4A 1N32T 3KXAA 5FXZA 1QB2A 3AAIA 4GHJA 3G5GA
chains in the Genus database with same CATH topology
2HSGA 2BJCA 4ZI3D 2KZ8A 2W61A 4DO0A 4OB4A 4YARA 3C64A 2V7KA 4L5GA 4YFSA 4O2BE 5HXSA 2LYRA 4I50E 2PUDA 3ZYKA 3AA0B 2X9WA 3AA6B 3QQ6A 4JQDA 1MMNA 2CLYC 5L3DB 1KNZA 1CJGA 2LT3A 1VOMA 3R84B 5K98B 4CXYA 3FB2A 2X68A 1BR2A 4EOZB 3B7HA 4E7ZA 4MCXA 1Y64B 2KMFA 4FJOA 2XJ3A 3HKEE 3K3NA 4AKIA 2VKHA 3MZKB 2WSSV 4ZS3A 4I6UA 3UFEA 3NRXA 1LQCA 4QWNB 2IVBA 1PERL 3ZKCA 5HXCA 5EK3A 4H63H 4OFZA 1NEQA 1SQ8A 2CWYA 2PE5A 3RYIE 3AAEB 5FY1A 4JLEA 3H37A 5CB4E 3LFPA 2JPFA 3N9OA 5FNVE 3UUMA 4FBIA 4G2AA 2VASA 4N78D 2AUWA 4ZI3C 3CVRA 2CWOA 4YHJA 3I1AA 3P8CD 3U3WA 2X67A 5LBQB 3ZN0B 1RZSA 3PU3A 3LK42 4V1Av 2XAFB 1Z0PA 2ZM0A 3F6WA 4KBMB 4QXCB 4XZCA 3KFWX 1ZZCA 4UEMA 3RYCE 2XIUA 1JFTA 2K5BB 2N2NA 3RYFE 5FXXA 5J2TE 1CQTA 2NW8A 3NBXX 2NOXA 3PURA 4OYKA 3ZN1B 2IVGA 4QHOA 3ZYLA 3PUGA 4GYSA 5LGUB 2PUBA 2NWBA 4X4FA 4QX8B 3TKLB 3KV9A 4C90A 3BQLA 4U72A 2DWKA 1UXCA 1QPZA 5JDQA 5LHGB 4ZI2D 3Q9DA 1IJ5A 1YD8G 1QP0A 3KVBA 1E1HB 4PFOA 3RH3A 3VHLA 1T98A 3HL6A 3O1HA 3ZC1A 4AQFA 4ASKA 1QUUA 1NWMX 3MA9A 1S94A 2A72A 4GK0E 5JR9B 2KEKA 2Q9QB 4X20E 4MBQA 4CXWA 2CSFA 4PU3C 4FN3A 2CROA 4IHJE 5J1GA 5HXHA 2AW6A 1MMAA 5LHHB 3M65A 4HEAA 2DLRA 2BZBA 2G0UA 2V7IA 4EYYR 1HS7A 5DJQC 1IJ6A 1ZZ8A 4X4HA 3F31A 4Z58A 4WBNE 1POUA 2H7OA 1NERA 2PUCA 4CI2B 2LYSA 3HZIB 4AI6A 2ODVA 2X9YA 3LJCA 2K48A 3ZCJA 4J2CA 4O8BA 4QXHB 4X4BA 2DWGA 3ZHMA 4IE6A 2OA5A 2W63A 4DMWA 5LA6E 1RZRA 4BJNA 4UF0A 3QYXA 3IEEA 1Y9QA 2KLQA 3C51A 4KP3C 1HCIA 2X66A 4ANJA 4ZI2C 3S8QA 2CCQA 2GK9A 2A3DA 3OQMA 4ZI7E 3N9QA 5KDMC 3ETUA 1NAFA 1D0XA 2BNOA 2LJLA 1D0YA 4HTEA 2CA5A 2W00A 1UTXA 2C5IT 1LCDA 3HKDE 4IE0A 3K3OA 5LHIB 3G7DA 3SCGA 3LBXB 3AA7B 2KEIA 3KV6A 5EZYE 4P09A 1LVKA 3FHNA 3SCHA 4PJLA 4X4IA 4YG7B 3KVAA 3ZPOA 2L3LA 4PW8A 5LCYA 3R6NA 1ZV4X 2P9BA 2RP4A 1VRBA 4H9SE 2MTQA 4XBFB 1E3OC 1ZKEA 2AXZA 2AXUA 3VKGA 4H9QC 1ZEEA 5LXTE 1LVFA 2NTYA 3ZJ2A 4QKNA 5L3EB 3LG7A 2Z6EA 3KV4A 1YKHB 2Q9QD 3OMTA 4IIJE 4TN7B 4O4JE 4UVBB 3RYHE 5AFUL 2R1JL 5JRCA 1L1MA 1YW0A 5H6QB 2IVQA 3Q5XA 3CROL 2A2FX 1HTJF 4BA9A 2PIJA 2D5UA 2CM0A 1WETA 4X4EA 2EHOD 4AXPA 3BK9A 2LSGA 2KINB 2WMNA 2V7MA 2VWAA 3A5XA 4NUUA 3C4ZA 4PJJA 4FI5A 2D0UA 3OYXA 2WUSR 4YJ3E 4H63V 4UV9B 1H7CA 2KWHA 3SRZA 3MK7C 3WAKA 3MKDA 2XAQB 3LFMA 2ACXA 5J2UE 4X4DA 1G8XA 2KWIB 4YG1A 3NZPA 1IAPA 4JUYA 3S4UA 3PE0A 3F51A 3BQKA 3N9LA 3ZMTB 2MBGA 5LJMA 1XWRA 2HH7A 4H9RC 3GBFA 2GRLA 3E08A 2X9XA 2VB6A 4IE4A 3DNVB 5JR9C 1QP7A 5L3GB 2NTXA 2NW7A 1FMWA 1YKEB 2Q9QC 3UT5E 4TUYE 2D0TA 5IHYA 3FMYA 1HG2A 4IE5A 1EZ3A 4ISSA 1ZAYA 1JFSA 4PAGA 2LOPA 1US7B 4O8SA 4MCTA 4OK0A 2LSJA 4GOUA 2CXDA 2DCFA 2W0GA 3MXZA 1PRAA 1U5PA 5LP6E 3JXBC 2XAHB 2EHOC 3MACA 1ZUGA 4EIWA 3OYZA 1X2LA 4PU4C 3PUAA 2C5JA 4O4LE 4IGUA 1FMVA 4MALA 1BDIA 4UELA 2PG8A 4PK6A 4MHCA 3CKDA 4ISTA 5LNKA 5DQWA 2E9XA 2K9AA 1LCCA 3QK6A 4QX7B 4TV9E 5HWXA 2HPJA 5JDLA 2X51A 4JEUB 5FY0A 1D1AA 3KBTA 3L1PA 3EDUA 4WBOA 4ADZA 5JDNA 2CEAA 3B57A 2J1DG 4C91A 2ODUA 4UF0B 1WH6A 2O4AA 2X0LB 5ADXL 4UVAB 1PRUA 5HXEA 1JWLA 3EDVA 1HF8A 5M4YA 5HAXA 4P0BA 3I0QA 2PFVA 4OYJA 1ZZ6A 1G73A 3UFDA 4ILUA 5L3CB 2NP9A 2ZM2A 1O4XA 5H6RB 4F8DA 4PU7A 1MNEA 3GMIA 4PFPA 4CXXA 5JDMA 4EAHA 2LEHA 1D1BA 2CMRA 3LK2B 1B0NA 2LSIA 1OSLA 2H8RA 5E0OA 3OBVE 5JQGE 2DI4A 4O4HE 2JMHA 4QXBB 2YEVC 5CA1E 4PK4A 2VK9A 3V5UA 4TX5A 5L3BB 2W62A 3C50A 3K3QC 4IE7A 4DBQA 3MLFA 3N2KE 4X4CA 3VKHA 2XHEB 3HA4A 4F6RC 2XCJA 3IVPA 4Y42A 2EHOB 5FYMA 2XSDC 2HPLA 3U3IA 2LE8A 3O4XE 5HYAA 5JRCB 2PJQA 5LGTB 3IHRA 5LJNA 2WBLA 1QP4A 3IBPA 1UX4A 1HFAA 2Y48B 2V7JA 3MJXA 2WM9A 2PPXA 1SA0E 3DJBA 2D2SA 3AB3B 4KMCA 3CLCA 3T8OA 3ZMVB 2KXPB 1HG5A 1ZVVA 1PNRA 3PUQA 1LMB3 4DVDA 2LHRA 3GA8A 2Y6XA 3VU7H 1YSEA 1CUNA 3K8PC 3CQCB 4IDZA 4IA8A 3H3AA 4DNDA 2N9DA 4J1WA 4HGAA 4K0UA 2KNDA 4MLKA 2H7VC 4PJNA 5JH7E 3LISA 4PU8A 5DQVA 3RX6A 5LOVE 1RZRD 2YK0A 2A6CA 4L0RA 4EZ4A 4Z5CA 3PDYA 4AQFC 2NW9A 2BVMA 4DMVA 4H9OC 5ETWA 3ETVA 1S7EA 1BDHA 2UXXB 5EK4A 4P0AA 1UX5A 4E7SA 3KINB 3EVYA 5A7LA 4UV8B 3VK0A 3QC9A 3SOLA 2IUOA 3D0TA 3RPUA 3RRWA 2C0SA 5GONE 1KK7A 3LK3B 2IAKA 4X1KE 5FMNA 2PUEA 2RA1A 1ZZBA 2V7LA 1B7TA 4WNKA 2QGSA 5CA0E 3UUXB 3ZMSB 1UXDA 3KDSE 5HWYA 4Z5HA 1RIOA 2JVLA 2AWIA 4Z59A 1MNDA 2GZUA 4OHFA 4ZOLE 3FBLA 4BJMA 1V9DA 3N9MA 4EZHA 1RPEL 2D5VA 2WMOA 3Q2MA 3CX8B 5KX5E 2CXFA 1QQAA 1X57A 4M1PA 3V5SA 3ZC0A 3ZMUB 4U74A 1ZZ9A 4O4IE 2ICTA 2E9XB 2LYJA 3CQXC 2OFYA 3C4WA 3CMLA 3WAJA 3F2EA 2BNNA 3GN5A 2IW5B 3F52A 4JCYA 3JXDL 4YJ2E 4HKAA 3W15B 3HKCE 3ANWA 5FXWA 1WRDA 2JQQA 3AVSA 3H5TA 3RRCA 3NZQA 4UXNB 3OKQA 5A1LA 5LYJE 4ERRA 2HINA 3CPZA 3EUSA 2VKDA 3ZHIA 3JXCL 1AJ3A 4XAXB 2V26A 3CX6B 3N9PA 2XASB 4AKLA 1LLIA 5FP3A 5JREA 2H3RA 5LG4A 4YG4A 4AKGA 3E0ZA 4L9IA 3JC6D 3KV5A 3SS1A 1MIWA 2AXVA 1SHZC 3IF8B 2PBIA 1WR6A 2Y8DA 2VL8A 4Z8XA 4A56A 2QA7A 3I9WA 4X1YE 3LBXA 5BMVE 4IVZA 2L49A 2JMKA 3HI2A 2O38A 3CX7B 2XQYA 4KUMB 2IC9A 2LYPA 3ZJ1A 4NDWA 5IYZE 2KEJA 3ONXA 3ZYMA 2XUEA 5JVDE 2IC6A 2MOZA 3OJAA 3L3PA 2DHRA 2LSYA 3AA1B 5L2LA 2E8IA 2LCVA 5JDHA 4MFRA 4H9PC 2L8NA 5JDFA 3RC8A 3FYAA 1MMGA 4PK5A 3ZMZB 3C98B 3CWZB 3C4XA 4ZS2A 1X79A 2C5KT 4GK5E 2UXNB 1AU7A 2E9XD 4CI3B 3WI3A 2V1DB 2EBYA 2LYKA 3PXPA 3KZ3A 2MEZA 3J9X1 2ZM8A 3AAAB 4H9NC 3KJXA 3JC6C 2LHNA 1DW9A 2PUAA 2CE7A 5DABA 1MIYA 1LRZA 2XAGB 1BR4A 3N9NA 1ZHCA 3RC3A 4CQIA 2ES0A 1FIOA 4J1XA 1IC8A 4B6XA 3FXEB 1R63A 2LYLA 1OCTC 4NUVA 2JJ9A 2LYQA 2LSKA 1WYBA 5LBMA 3L09A 3PUSA 5L3FB 4CI1B 2M67A 3FBZA 5F3JA 4I55E 2CLYB 3N5LA 1GT0C 1D0ZA 4I43B 1S35A 1ZS4A 4HFVA 4EXTA 2ZLYA 2FJRA 2LOSA 4PNIA 5FXVA 2BDEA 2DNXA 2K24A 4WW0A 2XI8A 3QF3A 4YBAA 1WYCA 1QQBA 3O1JA 3PTRB 3J7Yq 2XTLA 1WH8A 2E9XC 4UVCB 3UUNA 4EB6E 1VPWA 5C8YE 3D1NI 3KBUA 3UTKA 1ADRA 1QSDA 1WLXA 2JCGA 4JCXA 1BR0A 3BQIA 3I9YA 4HE8A 5LGNB 1HF0A 1LKXA 2VKOA 3E22E 3N2GE 3OP9A 4AKRB 3I0OA 3GN5B 4UIGA 4X4GA 3QWGA 3O9XA 4GIWA 1IZNB 3CECA 3BDNA 3BS3A 2KT9A 3ANWB 2B5AA 4I4TE 2WWUA 5TAOA 4HN9A 3GWHA 3AVRA 3HKBE 3FYMA 3NRYA 3BD1A 3HR0A 3ZCIA 2LM9A 1EFAA 2IU7A 3R1FA 2MQKA 4Z5DA 2KPJA 4AQGA 3SWHA 5F8PA 2I59A 2CXLA 2BNMA 2R63A 1Y7YA 4I8TA 3CQGB 2WIUB 2PUGA 3DP7A 3N2OA 1ZZ7A 4DBRA 4TZ4C 2OR1L 4ZHQE 3PU8A 4X1IE 4IWRA 2X9HA 4YLHA 5EK2A 3B13A 3UULA 3ESLA 3DTOA 4EYUA 2IV1A 2XAJB 2L9QA 3TRBA 3F57A 2WAUA 3FXDB 3Q5WA 4AKHA 1ZPQA 2O49A 1JH9A 1FEWA 2EF8A 5JR9A 4O2AE 1D1CA 2JRKA 2BVLA 2Q9QA 2ICPA 1UCUA 4GQMA 4TV8E 2L8KA 3SCFA 2ZMAA 1MIVA 5FY7A 2VKJA 1BR1A 2SPCA 4G63A 1MMDA 4I6TA 1OXZA 3OQNA 4GYRA 3EUHA 2YU2A 3QUJA 3OQOA 4JEHB 1U4QA 3P7IA 4BAYB 2YINA 4PJMA 1PRVA 2EHOA 3ZLIA 3RZZA 2EWTA 1HX8A 3U78A 3RKOA 3KXAA 2MYSA 5FXZA 2B1EA 4CZZB 3AAIA 1R69A 2PUFA 4GHJA 1OWAA 3O1IA 3G5GA 4I6RA 5JDGA 2YU1A 2N1GA 3ZEFB 5KMGP 1O3XA 2GRMA 2KZ7B 1WIZA 5HXRA 1DWKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XCJ A;  2HSG A;  2L8N A;  3IVP A;  4Y42 A;  3FYA A;  2BJC A;  2KZ8 A;  3SCH A;  2XSD C;  4OB4 A;  4YAR A;  4X4I A;  4YG7 B;  2LYR A;  1AU7 A;  2PUD A;  2EBY A;  2LYK A;  3PXP A;  3KZ3 A;  1QP4 A;  2MEZ A;  1E3O C;  3KJX A;  3QQ6 A;  1DW9 A;  2AXZ A;  2AXU A;  2PPX A;  2PUA A;  1CJG A;  4JQD A;  5K98 B;  3CLC A;  1ZVV A;  1PNR A;  1LMB 3;  3B7H A;  3GA8 A;  3OMT A;  4MCX A;  1YSE A;  2R1J L;  4J1X A;  2XJ3 A;  1IC8 A;  4IA8 A;  1L1M A;  2IVQ A;  1R63 A;  2LYL A;  4J1W A;  1OCT C;  3CRO L;  4I6U A;  1LQC A;  2LYQ A;  2IVB A;  3LIS A;  4PU8 A;  2PIJ A;  1PER L;  3ZKC A;  1WET A;  4X4E A;  1RZR D;  2A6C A;  1NEQ A;  4Z5C A;  1SQ8 A;  1GT0 C;  2PE5 A;  1ZS4 A;  2WUS R;  3LFP A;  1S7E A;  2FJR A;  1BDH A;  4FBI A;  2AUW A;  5A7L A;  2XI8 A;  3VK0 A;  3QF3 A;  4YBA A;  1QQB A;  3U3W A;  1WH8 A;  2IUO A;  1RZS A;  4X4D A;  1VPW A;  3D1N I;  3F6W A;  4YG1 A;  1ADR A;  1ZZC A;  2JCG A;  2PUE A;  4JCX A;  1ZZB A;  2XIU A;  3F51 A;  1JFT A;  1HF0 A;  1XWR A;  3GBF A;  2GRL A;  1UXD A;  4Z5H A;  3OP9 A;  2JVL A;  2AWI A;  4Z59 A;  3DNV B;  2GZU A;  1RIO A;  3GN5 B;  1CQT A;  1QP7 A;  4X4G A;  3QWG A;  3O9X A;  1RPE L;  2D5V A;  3CEC A;  3BDN A;  3FMY A;  3BS3 A;  2IVG A;  1ZAY A;  1JFS A;  2B5A A;  1QQA A;  1X57 A;  4MCT A;  2PUB A;  4X4F A;  3FYM A;  1ZZ9 A;  3BD1 A;  2ICT A;  1PRA A;  1UXC A;  2LYJ A;  1QPZ A;  2OFY A;  1EFA A;  1QP0 A;  2IU7 A;  3JXB C;  3R1F A;  2BNN A;  1ZUG A;  2MQK A;  3GN5 A;  3F52 A;  1X2L A;  3JXD L;  4PU4 C;  2KPJ A;  4Z5D A;  4JCY A;  1BDI A;  2BNM A;  2R63 A;  1Y7Y A;  4I8T A;  2WIU B;  2PUG A;  2KEK A;  1ZZ7 A;  3H5T A;  2OR1 L;  1LCC A;  2CSF A;  4IWR A;  4PU3 C;  4FN3 A;  2CRO A;  2AW6 A;  2HIN A;  3EUS A;  3ZHI A;  3JXC L;  2IV1 A;  3L1P A;  3TRB A;  1ZZ8 A;  4X4H A;  1LLI A;  1ZPQ A;  4Z58 A;  1POU A;  2O49 A;  1JH9 A;  1WH6 A;  2EF8 A;  1NER A;  2PUC A;  2O4A A;  1PRU A;  2LYS A;  4YG4 A;  3HZI B;  2ICP A;  1JWL A;  4GQM A;  3SCF A;  4O8B A;  2AXV A;  4I6T A;  4X4B A;  1ZZ6 A;  3OQN A;  3ZHM A;  4IVZ A;  3UFD A;  3OQO A;  2L49 A;  3HI2 A;  1O4X A;  1PRV A;  1RZR A;  2O38 A;  3QYX A;  4F8D A;  3RZZ A;  2EWT A;  1Y9Q A;  4PU7 A;  4X4C A;  2LYP A;  3S8Q A;  3KXA A;  4NDW A;  2KEJ A;  3OQM A;  1B0N A;  1R69 A;  2PUF A;  4GHJ A;  1OSL A;  2H8R A;  3G5G A;  4I6R A;  2BNO A;  1UTX A;  1LCD A;  3G7D A;  2GRM A;  3SCG A;  2LCV A;  3MLF A;  1WIZ A;  2KEI A;  1DWK A; 
#chains in the Genus database with same CATH topology
 3C64 A;  4K0K T;  5HXS A;  4I50 E;  3ZYK A;  4JI3 T;  3UU4 A;  4CXY A;  2V3C C;  3FB2 A;  2X68 A;  1M62 A;  2XJ3 A;  2VKH A;  3MZK B;  2WZI A;  3ZKC A;  2CWY A;  3G0T A;  3JCF A;  2JPF A;  5FNV E;  1GQE A;  4N78 D;  1I94 T;  1L0V A;  3AXJ B;  5LBQ B;  1N36 T;  4XZC A;  2I0M A;  3KFW X;  2K5B B;  4DE9 A;  2NW8 A;  1CHU A;  4OYK A;  4NXM T;  4JI8 T;  4QHO A;  5LGU B;  4LMK A;  2PUB A;  4C90 A;  2DWK A;  3RH3 A;  1YD8 G;  1QP0 A;  1T98 A;  3MA9 A;  1S94 A;  1OED C;  2HN1 A;  2CSF A;  4IHJ E;  2BZB A;  1HS7 A;  2MPK A;  3TLT A;  5DJQ C;  3F31 A;  4LF5 T;  4B3T T;  4WBN E;  2XQ5 A;  2H7O A;  4QH1 A;  1U2Z A;  3ZHM A;  4U31 A;  4DMW A;  4EZI A;  5LA6 E;  4ANJ A;  2X66 A;  4ZI7 E;  2BNO A;  1XZY A;  1LCD A;  3K3O A;  3G7D A;  3SCG A;  3A8Y C;  5EZY E;  4QH4 A;  2BG9 E;  1KEY A;  2XQ3 A;  5LCY A;  2RP4 A;  3OPC A;  4H9S E;  1OED B;  2MTQ A;  4XBF B;  1ZEE A;  2XQ9 A;  4IIJ E;  4TN7 B;  2Q9Q D;  2IVQ A;  3RQU A;  4LF8 T;  4A97 A;  3OKZ A;  2V6Y A;  2PIJ A;  2BS4 A;  2CM0 A;  4X4E A;  3BK9 A;  2CHN A;  2WMN A;  3A5X A;  4FI5 A;  2D0U A;  2YN6 A;  2WUS R;  4H63 V;  3AEF A;  1H7C A;  2KWH A;  3WAK A;  4TNW A;  1G8X A;  4YG1 A;  4JUY A;  5LJM A;  2UU9 T;  1R8I A;  3RQW A;  2VB6 A;  3DNV B;  1FMW A;  3X1D A;  3UT5 E;  4TUY E;  3R09 A;  5IHY A;  2LOP A;  2HCN A;  4DR7 T;  1PRA A;  4ILA A;  5LP6 E;  1X2L A;  2LKH A;  3PUA A;  4O4L E;  1HNZ T;  4UEL A;  2LNM A;  5AQO B;  5LNK A;  5DQW A;  4TV9 E;  5HWX A;  3ZT5 A;  2HPJ A;  4JEU B;  3L1P A;  2W4X A;  5LMU T;  2CEA A;  4C91 A;  2ODU A;  1J5W A;  1WH6 A;  2X0L B;  2JQK A;  5HAX A;  4ZZB A;  1ZZ6 A;  2NP9 A;  1O4X A;  4PFP A;  4CXX A;  5AQR B;  5JDM A;  2LEH A;  3LK2 B;  1OSL A;  5JQG E;  3OBV E;  4TNV A;  2DI4 A;  4QXB B;  4PK4 A;  2VK9 A;  2W62 A;  4IE7 A;  3N2K E;  2XHE B;  5FYM A;  4Y42 A;  3RKG A;  3U3I A;  2LE8 A;  3IHR A;  1KNR A;  2V7J A;  3MJX A;  5GAH i;  2D2S A;  3AB3 B;  4U3C A;  2KXP B;  1Y01 A;  2LHR A;  4J1W A;  1ZP0 A;  4HGA A;  4K0U A;  5AQL B;  2A6C A;  4Z5C A;  3PDY A;  1BDH A;  4B3M T;  4DR5 T;  3QC9 A;  3SOL A;  2C0S A;  1KK7 A;  3LK3 B;  2IAK A;  2PUE A;  2BBH A;  4WNK A;  5CA0 E;  4IDP A;  4ZOL E;  1V9D A;  2D5V A;  3CX8 B;  4LFC T;  3ZC0 A;  4M1P A;  3QB5 A;  3V5S A;  3UQ7 A;  1W9R A;  4IT4 A;  2E9X B;  2FUP A;  3OWQ A;  3C4W A;  4HWF A;  2HFZ A;  3ZT6 A;  3HKC E;  3ANW A;  4EK9 A;  4GKK T;  2JQQ A;  2RPA A;  1I6Z A;  3DM5 A;  2V26 A;  3CX6 B;  3N9P A;  4AKL A;  3T1H T;  5LG4 A;  4L9I A;  3JC6 D;  3IF8 B;  1NEK A;  3I9W A;  4KUM B;  2IC9 A;  2LYP A;  4NDW A;  2KEJ A;  3ZYM A;  2CBI A;  2HHH T;  2XUE A;  5JVD E;  2IC6 A;  2MOZ A;  2DHR A;  2E8I A;  1Z8U A;  3P4P A;  2LLY A;  5JDF A;  2L8N A;  3FYA A;  2YOE A;  4PK5 A;  3ZT7 A;  3UWP A;  4ZS2 A;  2C5K T;  2LYK A;  3TLW A;  2MEZ A;  3J9X 1;  2XAG B;  3N9N A;  4CQI A;  2VUR A;  1IC8 A;  2LYL A;  4NUV A;  2LYQ A;  2LSK A;  5LBM A;  3PUS A;  2AXD S;  5F3J A;  4I43 B;  5AQQ B;  5HEO A;  4HFV A;  3ME5 A;  5FXV A;  4WVL A;  2DNX A;  2K24 A;  3VRA A;  4WW0 A;  3QF3 A;  1WH8 A;  4UVC B;  2JIW A;  1XDP A;  1WLX A;  1T72 A;  2VKO A;  3OP9 A;  3GN5 B;  3AXJ A;  1IZN B;  3BS3 A;  4I4T E;  5TAO A;  4LML A;  3UFG A;  3NRY A;  2UXD T;  1EFA A;  5AQM B;  3GUU A;  5AQN B;  3ONJ A;  5F8P A;  2I59 A;  3P50 A;  2BNM A;  1Y7Y A;  4I8T A;  2YDQ A;  4DBR A;  4TZ4 C;  2OR1 L;  3UQ4 A;  4YLH A;  2X9H A;  3B13 A;  2XXP A;  2XAJ B;  2WAU A;  3ABV A;  1ZPQ A;  1FEW A;  1D1C A;  2JRK A;  3L8R A;  2BVL A;  4TV8 E;  2VKJ A;  1BR1 A;  3AE3 A;  1OXZ A;  2YIN A;  2EWT A;  4JI7 T;  3U78 A;  5FVK A;  3RKO A;  2B1E A;  2PXB A;  1OWA A;  2PUF A;  3LQX A;  3NXH A;  4I6R A;  5JDG A;  2KZ7 B;  2BG9 B;  1WIZ A;  5HXR A;  3ZKR A;  2HSG A;  2BJC A;  1E2A A;  2A9U A;  2W61 A;  4OB4 A;  4YAR A;  4U2Z A;  2QVA A;  4KI0 F;  4AIU A;  3AA6 B;  3QQ6 A;  4JQD A;  1MMN A;  2CLY C;  1KNZ A;  5K98 B;  3AE1 A;  1BR2 A;  3B7H A;  4FJO A;  3K3N A;  3HKE E;  5AQU B;  4I6U A;  2LRK A;  3NRX A;  1LQC A;  5AQI B;  4X64 T;  1PER L;  5EK3 A;  4H63 H;  5HEU A;  3RYI E;  3AED A;  3H37 A;  4QH5 A;  3LFP A;  3UUM A;  4G2A A;  2VAS A;  4ZI3 C;  2CWO A;  5LMN T;  4YHJ A;  2BS2 A;  4B3R T;  2FJE A;  3ZN0 B;  1RZS A;  2XAF B;  1Z0P A;  2N2N A;  1CQT A;  2NOX A;  3ZN1 B;  2FJB A;  2IVG A;  4GYS A;  2NWB A;  4JYA T;  3KV9 A;  4PFO A;  1IJ5 A;  2I6H A;  1E1H B;  3UU5 A;  4AQF A;  4ASK A;  1QUU A;  5JTG A;  2A72 A;  5JR9 B;  2Q9Q B;  2WQY A;  4MBQ A;  4FN3 A;  2V5D A;  2DLR A;  1M7K A;  4EYY R;  3JAF A;  1POU A;  3HZI B;  4AI6 A;  2ODV A;  1JNR A;  4DV0 T;  4J2C A;  4O8B A;  4QXH B;  2DWG A;  2XJ7 A;  2OA5 A;  3H3M A;  2M4H A;  4ZI2 C;  2KLQ A;  3C51 A;  4KP3 C;  1HNW T;  2BKN A;  3MEJ A;  5CFB A;  2A3D A;  2CHO A;  4IRE A;  5KDM C;  1D0X A;  4HTE A;  2LJL A;  1D0Y A;  2C5I T;  5LHI B;  3NDB B;  4NXN T;  3FHN A;  4X4I A;  3ZPO A;  3KVA A;  3R6N A;  2P9B A;  3FZM B;  4DR1 T;  3VKG A;  5LXT E;  3QFI A;  2PXV A;  2NTY A;  1UUS A;  3RYH E;  2UXC T;  1YXR A;  2HN2 A;  5DT2 A;  2A2F X;  1HTJ F;  4BA9 A;  2XQA A;  1WET A;  2EHO D;  4Z90 A;  2WY2 A;  2KIN B;  5AQS B;  3C4Z A;  4PJJ A;  3QOX A;  2WDR A;  2ACX A;  3PJA A;  4YY3 T;  1IAP A;  3TEL A;  3PE0 A;  2UUA T;  3F51 A;  3ZMT B;  3E08 A;  4NPP A;  4IE4 A;  2NW7 A;  4IE5 A;  1EZ3 A;  4ISS A;  1US7 B;  4MCT A;  2LSJ A;  3MXZ A;  2XAH B;  2WWV A;  3SFE A;  1KNP A;  4IGU A;  2IIU A;  4MAL A;  2PXP A;  4MHC A;  1XNR T;  2E9X A;  2K9A A;  4KHZ F;  5JDL A;  1D1A A;  5DTQ A;  2J1D G;  5DTM A;  4OBM A;  3VR9 A;  4UF0 B;  2O4A A;  5ADX L;  3VWS A;  4LFB T;  3EDV A;  5L3C B;  2R6G F;  5HEH A;  4COF A;  5H6R B;  4F8D A;  1MNE A;  3GMI A;  2CMR A;  1B0N A;  1J1J A;  4HWH A;  2JMH A;  4EEB A;  3V5U A;  5L3B B;  3C50 A;  2V8S V;  3HA4 A;  4AQY T;  2XCJ A;  2XSD C;  2HPL A;  2WDQ A;  5HYA A;  5JRC B;  3SFD A;  1HFA A;  2Y48 B;  2WM9 A;  2PPX A;  2BS3 A;  4YHH T;  4KMC A;  3T8O A;  5ABG A;  1ZVV A;  4DVD A;  2XSA A;  1X9B A;  1YSE A;  3LSV A;  1N34 T;  2IML A;  3LIS A;  5DQV A;  3RX6 A;  1RZR D;  4L0R A;  3RIU A;  3EHZ A;  4DV2 T;  4AQF C;  2BVM A;  4DMV A;  4UV8 B;  4ER5 A;  3RPU A;  2MXD A;  2RA1 A;  2UXB T;  3KDS E;  2AWI A;  4Z59 A;  2DL1 A;  3N9M A;  5FVL A;  3RGL A;  1XMQ T;  4U74 A;  4O4I E;  3M3Z B;  2YDR A;  3CQX C;  2H89 A;  2OFY A;  2V6X A;  3GN5 A;  3F52 A;  4JCY A;  4YTM A;  2XXQ A;  3AE6 A;  5FXW A;  3H5T A;  4UXN B;  2F4V T;  5LYJ E;  2HIN A;  2J62 A;  3CPZ A;  3ZHI A;  4XAX B;  1LLI A;  2H3R A;  4ILB A;  5AQK B;  4YG4 A;  4HWC A;  2YKS A;  3KV5 A;  1MIW A;  1WR6 A;  2VL8 A;  4Z8X A;  1QLB A;  5BMV E;  4X1Y E;  2JMK A;  2PXL A;  3CX7 B;  3ZJ1 A;  5IYZ E;  4ER6 A;  2LSY A;  3AA1 B;  4OX9 T;  3RIF A;  4GK5 E;  2V5C A;  2YBD A;  2EBY A;  3PXP A;  2J7W A;  2BG9 A;  1MIY A;  4KHP T;  1BR4 A;  4IDO A;  3FXE B;  1R63 A;  1OCT C;  2LLW A;  3UU8 A;  4P1N A;  1D0Z A;  3GZC A;  4EXT A;  2FJA A;  4Z91 A;  2XI8 A;  4YBA A;  3O1J A;  1QQB A;  3PTR B;  3J7Y q;  2E9X C;  5C8Y E;  3KBU A;  3UTK A;  1ADR A;  2JCG A;  1BR0 A;  2OLT A;  1HF0 A;  1LKX A;  4DE8 A;  2QYW A;  3I0O A;  4UIG A;  4DV6 T;  3O9X A;  4GIW A;  3NWI A;  2B5A A;  2OV9 A;  3GWH A;  3FYM A;  3HR0 A;  2LM9 A;  3QOF A;  2IU7 A;  4Q25 A;  4HRA A;  4CN1 A;  3SWH A;  4DV4 T;  3CQG B;  3N2O A;  2JQ9 A;  2PUG A;  3PV0 F;  3AEG A;  1W09 A;  3DTO A;  5CGM A;  4EYU A;  3RI5 A;  4AKH A;  3TRB A;  3QOW A;  3F57 A;  3P4Q A;  3PJA J;  5JR9 A;  2Q9Q A;  2ICP A;  2J7U A;  1MIV A;  4I6T A;  3OQN A;  3QUJ A;  3OQO A;  1U4Q A;  4PJM A;  2L1P A;  5AQF B;  3RZZ A;  1HX8 A;  2H88 A;  4CZZ B;  4UR9 A;  3O1I A;  2N1G A;  3ZEF B;  3RIU C;  3ESL A;  1DWK A;  2VL0 A;  2KZ8 A;  4DO0 A;  2LYR A;  1XNQ T;  3AA0 B;  2X9W A;  5L3D B;  2LT3 A;  2UUB T;  1VOM A;  4ZEY A;  4EOZ B;  4E7Z A;  3P4W A;  4MCX A;  4DR2 T;  3PUV F;  4AKI A;  5IWA T;  3ZSS A;  3UFE A;  4QWN B;  5HXC A;  4HFD A;  1KF6 A;  3AAE B;  5FY1 A;  2AUW A;  5ABF A;  2X67 A;  3LK4 2;  4V1A v;  3QNU A;  4KBM B;  4QXC B;  1ZZC A;  2XIU A;  1JFT A;  3SX0 A;  4U7I A;  3RYF E;  4DID B;  5J2T E;  2XM1 A;  2WCA A;  1NW3 A;  3PUR A;  5ABE A;  5HEJ A;  3PUG A;  3TKL B;  3BQL A;  3ZPX A;  4F8H A;  1UXC A;  5LHG B;  3HL6 A;  3GZD A;  3O1H A;  2BKP A;  1NWM X;  4JV5 T;  2IUB A;  4GK0 E;  4CXW A;  4PU3 C;  2CRO A;  3A7M A;  2AW6 A;  5HXH A;  1MMA A;  5LHH B;  3M65 A;  2ZM6 T;  2V7I A;  2G0U A;  1IJ6 A;  1ZZ8 A;  4Z58 A;  2XSB A;  2PXQ A;  2PUC A;  4CI2 B;  4B3S T;  2K48 A;  3EI0 A;  3ZCJ A;  2BG9 C;  2WDV A;  4X4B A;  4IE6 A;  1OED E;  4BJN A;  4UF0 A;  3QYX A;  3IEE A;  1Y9Q A;  3B5M A;  3S8Q A;  2GK9 A;  2WU5 A;  2CBJ A;  3OQM A;  3N9Q A;  3ETU A;  1NAF A;  3PUY F;  2CA5 A;  2W00 A;  1UTX A;  3HKD E;  4IE0 A;  4DR6 T;  3AA7 B;  2KEI A;  4P09 A;  1LVK A;  3EAM A;  2L3L A;  4PW8 A;  1ZV4 X;  1VRB A;  1E3O C;  2B76 A;  2VQE T;  2AXU A;  5LB7 B;  3P4S A;  3ZJ2 A;  1NEN A;  4QKN A;  5L3E B;  3LG7 A;  2Z6E A;  1YKH B;  5AFU L;  3OMT A;  5JRC A;  2R1J L;  4ER7 A;  2WU2 A;  5HEG A;  2LSG A;  2QRX A;  2VWA A;  2XQ6 A;  4YJ3 E;  3MK7 C;  3NZP A;  2X0H A;  3S4U A;  2JQE A;  3BQK A;  2MBG A;  1XWR A;  4H9R C;  2GRL A;  2X9X A;  5L3G B;  5IUX A;  5JR9 C;  3SR4 A;  2Q9Q C;  2D0T A;  2CRB A;  1HG2 A;  4PAG A;  2XXA A;  1ZAY A;  1JFS A;  5BR8 T;  2WZH A;  4GOU A;  5L4E A;  3UU6 A;  1U5P A;  3K1S A;  3RHW A;  3MAC A;  3FZK B;  3QB5 K;  1ZUG A;  2PXK A;  3OYZ A;  4PU4 C;  4X66 T;  1BDI A;  4PK6 A;  4HFB A;  3CKD A;  4QX7 B;  3EAB A;  4JI5 T;  2W66 A;  5FY0 A;  4ADZ A;  3AEC A;  3EDU A;  4WBO A;  5GAG i;  5HXE A;  1PRU A;  4P0B A;  4OYJ A;  4TWD A;  3UFD A;  4ILU A;  2ZM2 A;  4PU7 A;  3LDQ B;  4EAH A;  2ODR D;  2LSI A;  5AQJ B;  4O4H E;  4WYV A;  2UUC T;  5CA1 E;  3K3Q C;  4DBQ A;  3VKH A;  2VEO A;  3O4X E;  2BBJ A;  5LGT B;  4EGW A;  1QP4 A;  1UX4 A;  4IL4 A;  3DJB A;  3AEB A;  3CLC A;  3ZMV B;  1UUR A;  1LMB 3;  1IBL T;  1CUN A;  3K8P C;  3CQC B;  2N9D A;  5C3J A;  2KND A;  2H7V C;  3RF1 A;  4PU8 A;  3TEP A;  2J4G A;  3G06 A;  4EZ4 A;  2NW9 A;  3GZD C;  4P0A A;  3KIN B;  2XZE A;  4I0U A;  2IUO A;  3RRW A;  5GON E;  2PXT A;  1ZZB A;  3TLV A;  3UUX B;  1UXD A;  5HWY A;  2JVL A;  3FBL A;  4BJM A;  1RPE L;  3Q2M A;  5ABF B;  4EED A;  2CXF A;  3AE4 A;  1QQA A;  4CN6 A;  1ZZ9 A;  2LYJ A;  3NZL A;  3CML A;  1HQ1 A;  3F2E A;  3AE9 A;  2BNN A;  2IW5 B;  4DR3 T;  3W15 B;  1WRD A;  4HFH A;  2PXD A;  4DV1 T;  2CPT A;  4JI2 T;  4HWI B;  3EUS A;  1AJ3 A;  5JRE A;  5FP3 A;  2XQ7 A;  4IDQ A;  3ONL C;  3SS1 A;  2AXV A;  2Y8D A;  4A56 A;  3LBX A;  4IVZ A;  2L49 A;  3HI2 A;  2VQF T;  5AQV B;  3AE7 A;  2XQY A;  3AE8 A;  3ONX A;  2VVN A;  2LCV A;  5JDH A;  4MFR A;  4H9P C;  3RLF F;  3OTO T;  3RC8 A;  1MMG A;  3ZMZ B;  1ZOY A;  3C4X A;  4EQZ A;  2UXN B;  1AU7 A;  4CI3 B;  3WI3 A;  2PXE A;  2IDO B;  2YDS A;  3KJX A;  3JC6 C;  2PUA A;  2CE7 A;  2E5V A;  4EKI A;  3CIR A;  5DTR A;  4WZX A;  4B6X A;  2JJ9 A;  3L09 A;  3PUX F;  2WS3 A;  2M67 A;  5DRY A;  1S35 A;  1ZS4 A;  2LOS A;  4PNI A;  3A9X A;  1WYC A;  2XTL A;  3NVO A;  3UUN A;  4EB6 E;  1VPW A;  3D1N I;  4CN4 A;  2M6B A;  4YT0 A;  4YSZ A;  5LGN B;  3E22 E;  3N2G E;  4AKR B;  4X4G A;  2W2U A;  4ER3 A;  2WWU A;  4HN9 A;  1J5E T;  3AVR A;  4YSY A;  3ZCI A;  1W0A A;  4AQG A;  2R63 A;  3UUB A;  3DP7 A;  2MAW A;  1ZZ7 A;  1HNX T;  4DUY T;  4ZHQ E;  3PU8 A;  4X1I E;  4IWR A;  3Q5E A;  2PTF A;  5EK2 A;  3UUL A;  3VRB A;  4ILC A;  2IV1 A;  4X62 T;  4A98 A;  1KFY A;  2NR4 A;  4GQM A;  2L8K A;  3SCF A;  1WR0 A;  5FY7 A;  2SPC A;  4G63 A;  4GYR A;  4DV7 T;  5AQP B;  2EHO A;  2IHR 1;  2LLV A;  2MYS A;  1R69 A;  1N33 T;  2YU1 A;  3PUZ F;  5KMG P;  1O3X A;  2FJD A;  1IBK T;  2GRM A;  2WP9 A;  4ZI3 D;  3PE5 A;  4L5G A;  2V7K A;  4YFS A;  4O2B E;  4GKJ T;  2PUD A;  1T7S A;  2WB5 A;  5FKY A;  4IDN A;  1E7P A;  3FZF B;  1CJG A;  3R84 B;  4HFC A;  5DRT A;  4LF4 T;  1Y64 B;  2KMF A;  5AQH B;  2WSS V;  4ZS3 A;  2IVB A;  4KX6 A;  4YTN A;  4OFZ A;  3VR8 A;  1NEQ A;  2AE9 A;  1SQ8 A;  2PE5 A;  4JLE A;  4EV6 A;  5CB4 E;  3N9O A;  4FBI A;  3CVR A;  3I1A A;  4Q2J A;  3P8C D;  3U3W A;  3PU3 A;  1HR0 T;  2ZM0 A;  3F6W A;  4UEM A;  3RYC E;  4DR4 T;  5AQT B;  5FXX A;  3NBX X;  3KL4 A;  4JI0 T;  3TFL A;  4YSX A;  1XWM A;  3ZYL A;  4AIS A;  5FL1 A;  4X4F A;  4QX8 B;  4U72 A;  5DSX A;  1QPZ A;  5JDQ A;  5HCJ A;  4ZI2 D;  3NKZ A;  3Q9D A;  3VHL A;  3KVB A;  2FBW A;  4YXD A;  3ZC1 A;  4HWD A;  2PXF A;  2E5L T;  2KEK A;  4X20 E;  5J1G A;  3FZL B;  3OVU A;  4HEA A;  4X4H A;  3IA3 A;  1NER A;  2LYS A;  1QZX A;  2K3W A;  2X9Y A;  3LJC A;  4LF9 T;  4JBW F;  2XY8 B;  3JAD A;  2W63 A;  4U33 A;  1RZR A;  1HCI A;  2CCQ A;  3ZST A;  1MFQ C;  1IBM T;  1VCT A;  3LBX B;  1W0B A;  3KV6 A;  3A9Y A;  3SCH A;  4PJL A;  4YG7 B;  4YTP A;  4LF7 T;  3T1Y T;  3RIA A;  1ZKE A;  2AXZ A;  4H9Q C;  1HX1 B;  1LVF A;  2PXU A;  3KV4 A;  5L47 A;  4O4J E;  4UVB B;  5C2T A;  3JAE A;  1L1M A;  1YW0 A;  5H6Q B;  3Q5X A;  3CRO L;  4LFA T;  3M9L A;  2D5U A;  2W67 A;  4AXP A;  2V7M A;  4NUU A;  3OYX A;  4DUZ T;  4UV9 B;  3SRZ A;  3MKD A;  2XAQ B;  3LFM A;  5J2U E;  4X4D A;  2M6I A;  2KWI B;  4U2Y A;  3N9L A;  5LG3 A;  2HH7 A;  3GBF A;  1QP7 A;  5ABH A;  2NTX A;  1YKE B;  2FFH A;  3FMY A;  4LMJ A;  4OK0 A;  4O8S A;  2CXD A;  2DCF A;  2W0G A;  3JXB C;  2EHO C;  4EIW A;  2C5J A;  1FMV A;  2PG8 A;  4IST A;  1LCC A;  3QK6 A;  5L4H A;  2HCS A;  2X51 A;  3KBT A;  5JDN A;  3B57 A;  4HFE A;  4UVA B;  4DV3 T;  1JWL A;  1HF8 A;  5M4Y A;  4U7Y A;  3I0Q A;  2PFV A;  4A5X A;  1G73 A;  5HCM A;  2ACZ A;  4ER0 A;  3AE2 A;  4NIQ A;  1D1B A;  2H8R A;  5E0O A;  2YEV C;  4TX5 A;  3MLF A;  3AEA A;  4X4C A;  3AE5 A;  4F6R C;  3IVP A;  2EHO B;  5KXJ A;  2PJQ A;  5LJN A;  2WBL A;  3IBP A;  3L39 A;  3P4R A;  5FL0 A;  1SA0 E;  2V6Y B;  5J0Z A;  1HG5 A;  1PNR A;  3PUQ A;  3GA8 A;  4IL9 A;  2Y6X A;  3VU7 H;  5JUW A;  4IDZ A;  4IA8 A;  3H3A A;  4DND A;  4MLK A;  4PJN A;  5JH7 E;  4ZXL A;  5LOV E;  2YK0 A;  4H9O C;  5ETW A;  3ETV A;  1JNZ A;  1S7E A;  2UXX B;  5EK4 A;  1UX5 A;  4E7S A;  3EVY A;  5A7L A;  3VK0 A;  3AEE A;  3D0T A;  4X1K E;  5FMN A;  2E2A A;  2V7L A;  1B7T A;  2QGS A;  3ZMS B;  4Z5H A;  1RIO A;  1MND A;  4OHF A;  2GZU A;  1XDO A;  4TWH A;  4EZH A;  2WMO A;  5F5W A;  5KX5 E;  2D9D A;  1X57 A;  3ZMU B;  2ICT A;  3WAJ A;  4JI6 T;  4YJ2 E;  3JXD L;  2J47 A;  2XPK A;  4HFI A;  4HKA A;  3AVS A;  3RRC A;  3NZQ A;  3OKQ A;  5A1L A;  4ERR A;  2VKD A;  3JXC L;  1T8B A;  2XAS B;  4AKG A;  5AQG B;  3E0Z A;  1SHZ C;  2PBI A;  2QA7 A;  1DU2 A;  2O38 A;  1VCS A;  2LM2 A;  1SE7 A;  1YQ3 A;  5CJ5 A;  2KSR A;  1OED A;  2XQ8 A;  3OJA A;  3L3P A;  3TLU A;  5L2L A;  2XQ4 A;  3C98 B;  3CWZ B;  4DV5 T;  1X79 A;  2BKO A;  2E9X D;  2V1D B;  3KZ3 A;  2ZM8 A;  3AAA B;  4H9N C;  2LHN A;  1DW9 A;  3PUW F;  5DAB A;  1LRZ A;  1ZHC A;  3RC3 A;  4X65 T;  2ES0 A;  1FIO A;  4J1X A;  4TWF A;  1WYB A;  5L3F B;  4CI1 B;  4LF6 T;  3FBZ A;  4I55 E;  3NRO A;  2CLY B;  3N5L A;  1GT0 C;  1DUL A;  2ZLY A;  2FJR A;  2BDE A;  3UU3 A;  2JQH A;  2LRL A;  2XM2 A;  1QSD A;  4JCX A;  3BQI A;  3I9Y A;  4HE8 A;  2X0Y A;  3QWG A;  3CEC A;  3BDN A;  2KT9 A;  3ANW B;  4X5T A;  3HKB E;  4ZZC A;  3CK6 A;  3BD1 A;  1UGO A;  3R1F A;  4EKG A;  2MQK A;  1UK5 A;  3FZH B;  4Z5D A;  2KPJ A;  2LKG A;  1FJG T;  1XMO T;  2CXL A;  2VVS A;  4JI4 T;  2WIU B;  1WCR A;  1SUM B;  2L9Q A;  3FXD B;  3Q5W A;  4JI1 T;  3A9Z A;  3Q5D A;  2O49 A;  1JH9 A;  2EF8 A;  4O2A E;  1UCU A;  2ZMA A;  1MMD A;  3EUH A;  3TLS A;  2YU2 A;  4JEH B;  3P7I A;  1WFD A;  4BAY B;  1PRV A;  3ZLI A;  1YQ4 A;  1N32 T;  3KXA A;  5FXZ A;  1QB2 A;  3AAI A;  4GHJ A;  3G5G A; 
#chains in the Genus database with same CATH homology
 2HSG A;  2BJC A;  4ZI3 D;  2KZ8 A;  2W61 A;  4DO0 A;  4OB4 A;  4YAR A;  3C64 A;  2V7K A;  4L5G A;  4YFS A;  4O2B E;  5HXS A;  2LYR A;  4I50 E;  2PUD A;  3ZYK A;  3AA0 B;  2X9W A;  3AA6 B;  3QQ6 A;  4JQD A;  1MMN A;  2CLY C;  5L3D B;  1KNZ A;  1CJG A;  2LT3 A;  1VOM A;  3R84 B;  5K98 B;  4CXY A;  3FB2 A;  2X68 A;  1BR2 A;  4EOZ B;  3B7H A;  4E7Z A;  4MCX A;  1Y64 B;  2KMF A;  4FJO A;  2XJ3 A;  3HKE E;  3K3N A;  4AKI A;  2VKH A;  3MZK B;  2WSS V;  4ZS3 A;  4I6U A;  3UFE A;  3NRX A;  1LQC A;  4QWN B;  2IVB A;  1PER L;  3ZKC A;  5HXC A;  5EK3 A;  4H63 H;  4OFZ A;  1NEQ A;  1SQ8 A;  2CWY A;  2PE5 A;  3RYI E;  3AAE B;  5FY1 A;  4JLE A;  3H37 A;  5CB4 E;  3LFP A;  2JPF A;  3N9O A;  5FNV E;  3UUM A;  4FBI A;  4G2A A;  2VAS A;  4N78 D;  2AUW A;  4ZI3 C;  3CVR A;  2CWO A;  4YHJ A;  3I1A A;  3P8C D;  3U3W A;  2X67 A;  5LBQ B;  3ZN0 B;  1RZS A;  3PU3 A;  3LK4 2;  4V1A v;  2XAF B;  1Z0P A;  2ZM0 A;  3F6W A;  4KBM B;  4QXC B;  4XZC A;  3KFW X;  1ZZC A;  4UEM A;  3RYC E;  2XIU A;  1JFT A;  2K5B B;  2N2N A;  3RYF E;  5FXX A;  5J2T E;  1CQT A;  2NW8 A;  3NBX X;  2NOX A;  3PUR A;  4OYK A;  3ZN1 B;  2IVG A;  4QHO A;  3ZYL A;  3PUG A;  4GYS A;  5LGU B;  2PUB A;  2NWB A;  4X4F A;  4QX8 B;  3TKL B;  3KV9 A;  4C90 A;  3BQL A;  4U72 A;  2DWK A;  1UXC A;  1QPZ A;  5JDQ A;  5LHG B;  4ZI2 D;  3Q9D A;  1IJ5 A;  1YD8 G;  1QP0 A;  3KVB A;  1E1H B;  4PFO A;  3RH3 A;  3VHL A;  1T98 A;  3HL6 A;  3O1H A;  3ZC1 A;  4AQF A;  4ASK A;  1QUU A;  1NWM X;  3MA9 A;  1S94 A;  2A72 A;  4GK0 E;  5JR9 B;  2KEK A;  2Q9Q B;  4X20 E;  4MBQ A;  4CXW A;  2CSF A;  4PU3 C;  4FN3 A;  2CRO A;  4IHJ E;  5J1G A;  5HXH A;  2AW6 A;  1MMA A;  5LHH B;  3M65 A;  4HEA A;  2DLR A;  2BZB A;  2G0U A;  2V7I A;  4EYY R;  1HS7 A;  5DJQ C;  1IJ6 A;  1ZZ8 A;  4X4H A;  3F31 A;  4Z58 A;  4WBN E;  1POU A;  2H7O A;  1NER A;  2PUC A;  4CI2 B;  2LYS A;  3HZI B;  4AI6 A;  2ODV A;  2X9Y A;  3LJC A;  2K48 A;  3ZCJ A;  4J2C A;  4O8B A;  4QXH B;  4X4B A;  2DWG A;  3ZHM A;  4IE6 A;  2OA5 A;  2W63 A;  4DMW A;  5LA6 E;  1RZR A;  4BJN A;  4UF0 A;  3QYX A;  3IEE A;  1Y9Q A;  2KLQ A;  3C51 A;  4KP3 C;  1HCI A;  2X66 A;  4ANJ A;  4ZI2 C;  3S8Q A;  2CCQ A;  2GK9 A;  2A3D A;  3OQM A;  4ZI7 E;  3N9Q A;  5KDM C;  3ETU A;  1NAF A;  1D0X A;  2BNO A;  2LJL A;  1D0Y A;  4HTE A;  2CA5 A;  2W00 A;  1UTX A;  2C5I T;  1LCD A;  3HKD E;  4IE0 A;  3K3O A;  5LHI B;  3G7D A;  3SCG A;  3LBX B;  3AA7 B;  2KEI A;  3KV6 A;  5EZY E;  4P09 A;  1LVK A;  3FHN A;  3SCH A;  4PJL A;  4X4I A;  4YG7 B;  3KVA A;  3ZPO A;  2L3L A;  4PW8 A;  5LCY A;  3R6N A;  1ZV4 X;  2P9B A;  2RP4 A;  1VRB A;  4H9S E;  2MTQ A;  4XBF B;  1E3O C;  1ZKE A;  2AXZ A;  2AXU A;  3VKG A;  4H9Q C;  1ZEE A;  5LXT E;  1LVF A;  2NTY A;  3ZJ2 A;  4QKN A;  5L3E B;  3LG7 A;  2Z6E A;  3KV4 A;  1YKH B;  2Q9Q D;  3OMT A;  4IIJ E;  4TN7 B;  4O4J E;  4UVB B;  3RYH E;  5AFU L;  2R1J L;  5JRC A;  1L1M A;  1YW0 A;  5H6Q B;  2IVQ A;  3Q5X A;  3CRO L;  2A2F X;  1HTJ F;  4BA9 A;  2PIJ A;  2D5U A;  2CM0 A;  1WET A;  4X4E A;  2EHO D;  4AXP A;  3BK9 A;  2LSG A;  2KIN B;  2WMN A;  2V7M A;  2VWA A;  3A5X A;  4NUU A;  3C4Z A;  4PJJ A;  4FI5 A;  2D0U A;  3OYX A;  2WUS R;  4YJ3 E;  4H63 V;  4UV9 B;  1H7C A;  2KWH A;  3SRZ A;  3MK7 C;  3WAK A;  3MKD A;  2XAQ B;  3LFM A;  2ACX A;  5J2U E;  4X4D A;  1G8X A;  2KWI B;  4YG1 A;  3NZP A;  1IAP A;  4JUY A;  3S4U A;  3PE0 A;  3F51 A;  3BQK A;  3N9L A;  3ZMT B;  2MBG A;  5LJM A;  1XWR A;  2HH7 A;  4H9R C;  3GBF A;  2GRL A;  3E08 A;  2X9X A;  2VB6 A;  4IE4 A;  3DNV B;  5JR9 C;  1QP7 A;  5L3G B;  2NTX A;  2NW7 A;  1FMW A;  1YKE B;  2Q9Q C;  3UT5 E;  4TUY E;  2D0T A;  5IHY A;  3FMY A;  1HG2 A;  4IE5 A;  1EZ3 A;  4ISS A;  1ZAY A;  1JFS A;  4PAG A;  2LOP A;  1US7 B;  4O8S A;  4MCT A;  4OK0 A;  2LSJ A;  4GOU A;  2CXD A;  2DCF A;  2W0G A;  3MXZ A;  1PRA A;  1U5P A;  5LP6 E;  3JXB C;  2XAH B;  2EHO C;  3MAC A;  1ZUG A;  4EIW A;  3OYZ A;  1X2L A;  4PU4 C;  3PUA A;  2C5J A;  4O4L E;  4IGU A;  1FMV A;  4MAL A;  1BDI A;  4UEL A;  2PG8 A;  4PK6 A;  4MHC A;  3CKD A;  4IST A;  5LNK A;  5DQW A;  2E9X A;  2K9A A;  1LCC A;  3QK6 A;  4QX7 B;  4TV9 E;  5HWX A;  2HPJ A;  5JDL A;  2X51 A;  4JEU B;  5FY0 A;  1D1A A;  3KBT A;  3L1P A;  3EDU A;  4WBO A;  4ADZ A;  5JDN A;  2CEA A;  3B57 A;  2J1D G;  4C91 A;  2ODU A;  4UF0 B;  1WH6 A;  2O4A A;  2X0L B;  5ADX L;  4UVA B;  1PRU A;  5HXE A;  1JWL A;  3EDV A;  1HF8 A;  5M4Y A;  5HAX A;  4P0B A;  3I0Q A;  2PFV A;  4OYJ A;  1ZZ6 A;  1G73 A;  3UFD A;  4ILU A;  5L3C B;  2NP9 A;  2ZM2 A;  1O4X A;  5H6R B;  4F8D A;  4PU7 A;  1MNE A;  3GMI A;  4PFP A;  4CXX A;  5JDM A;  4EAH A;  2LEH A;  1D1B A;  2CMR A;  3LK2 B;  1B0N A;  2LSI A;  1OSL A;  2H8R A;  5E0O A;  3OBV E;  5JQG E;  2DI4 A;  4O4H E;  2JMH A;  4QXB B;  2YEV C;  5CA1 E;  4PK4 A;  2VK9 A;  3V5U A;  4TX5 A;  5L3B B;  2W62 A;  3C50 A;  3K3Q C;  4IE7 A;  4DBQ A;  3MLF A;  3N2K E;  4X4C A;  3VKH A;  2XHE B;  3HA4 A;  4F6R C;  2XCJ A;  3IVP A;  4Y42 A;  2EHO B;  5FYM A;  2XSD C;  2HPL A;  3U3I A;  2LE8 A;  3O4X E;  5HYA A;  5JRC B;  2PJQ A;  5LGT B;  3IHR A;  5LJN A;  2WBL A;  1QP4 A;  3IBP A;  1UX4 A;  1HFA A;  2Y48 B;  2V7J A;  3MJX A;  2WM9 A;  2PPX A;  1SA0 E;  3DJB A;  2D2S A;  3AB3 B;  4KMC A;  3CLC A;  3T8O A;  3ZMV B;  2KXP B;  1HG5 A;  1ZVV A;  1PNR A;  3PUQ A;  1LMB 3;  4DVD A;  2LHR A;  3GA8 A;  2Y6X A;  3VU7 H;  1YSE A;  1CUN A;  3K8P C;  3CQC B;  4IDZ A;  4IA8 A;  3H3A A;  4DND A;  2N9D A;  4J1W A;  4HGA A;  4K0U A;  2KND A;  4MLK A;  2H7V C;  4PJN A;  5JH7 E;  3LIS A;  4PU8 A;  5DQV A;  3RX6 A;  5LOV E;  1RZR D;  2YK0 A;  2A6C A;  4L0R A;  4EZ4 A;  4Z5C A;  3PDY A;  4AQF C;  2NW9 A;  2BVM A;  4DMV A;  4H9O C;  5ETW A;  3ETV A;  1S7E A;  1BDH A;  2UXX B;  5EK4 A;  4P0A A;  1UX5 A;  4E7S A;  3KIN B;  3EVY A;  5A7L A;  4UV8 B;  3VK0 A;  3QC9 A;  3SOL A;  2IUO A;  3D0T A;  3RPU A;  3RRW A;  2C0S A;  5GON E;  1KK7 A;  3LK3 B;  2IAK A;  4X1K E;  5FMN A;  2PUE A;  2RA1 A;  1ZZB A;  2V7L A;  1B7T A;  4WNK A;  2QGS A;  5CA0 E;  3UUX B;  3ZMS B;  1UXD A;  3KDS E;  5HWY A;  4Z5H A;  1RIO A;  2JVL A;  2AWI A;  4Z59 A;  1MND A;  2GZU A;  4OHF A;  4ZOL E;  3FBL A;  4BJM A;  1V9D A;  3N9M A;  4EZH A;  1RPE L;  2D5V A;  2WMO A;  3Q2M A;  3CX8 B;  5KX5 E;  2CXF A;  1QQA A;  1X57 A;  4M1P A;  3V5S A;  3ZC0 A;  3ZMU B;  4U74 A;  1ZZ9 A;  4O4I E;  2ICT A;  2E9X B;  2LYJ A;  3CQX C;  2OFY A;  3C4W A;  3CML A;  3WAJ A;  3F2E A;  2BNN A;  3GN5 A;  2IW5 B;  3F52 A;  4JCY A;  3JXD L;  4YJ2 E;  4HKA A;  3W15 B;  3HKC E;  3ANW A;  5FXW A;  1WRD A;  2JQQ A;  3AVS A;  3H5T A;  3RRC A;  3NZQ A;  4UXN B;  3OKQ A;  5A1L A;  5LYJ E;  4ERR A;  2HIN A;  3CPZ A;  3EUS A;  2VKD A;  3ZHI A;  3JXC L;  1AJ3 A;  4XAX B;  2V26 A;  3CX6 B;  3N9P A;  2XAS B;  4AKL A;  1LLI A;  5FP3 A;  5JRE A;  2H3R A;  5LG4 A;  4YG4 A;  4AKG A;  3E0Z A;  4L9I A;  3JC6 D;  3KV5 A;  3SS1 A;  1MIW A;  2AXV A;  1SHZ C;  3IF8 B;  2PBI A;  1WR6 A;  2Y8D A;  2VL8 A;  4Z8X A;  4A56 A;  2QA7 A;  3I9W A;  4X1Y E;  3LBX A;  5BMV E;  4IVZ A;  2L49 A;  2JMK A;  3HI2 A;  2O38 A;  3CX7 B;  2XQY A;  4KUM B;  2IC9 A;  2LYP A;  3ZJ1 A;  4NDW A;  5IYZ E;  2KEJ A;  3ONX A;  3ZYM A;  2XUE A;  5JVD E;  2IC6 A;  2MOZ A;  3OJA A;  3L3P A;  2DHR A;  2LSY A;  3AA1 B;  5L2L A;  2E8I A;  2LCV A;  5JDH A;  4MFR A;  4H9P C;  2L8N A;  5JDF A;  3RC8 A;  3FYA A;  1MMG A;  4PK5 A;  3ZMZ B;  3C98 B;  3CWZ B;  3C4X A;  4ZS2 A;  1X79 A;  2C5K T;  4GK5 E;  2UXN B;  1AU7 A;  2E9X D;  4CI3 B;  3WI3 A;  2V1D B;  2EBY A;  2LYK A;  3PXP A;  3KZ3 A;  2MEZ A;  3J9X 1;  2ZM8 A;  3AAA B;  4H9N C;  3KJX A;  3JC6 C;  2LHN A;  1DW9 A;  2PUA A;  2CE7 A;  5DAB A;  1MIY A;  1LRZ A;  2XAG B;  1BR4 A;  3N9N A;  1ZHC A;  3RC3 A;  4CQI A;  2ES0 A;  1FIO A;  4J1X A;  1IC8 A;  4B6X A;  3FXE B;  1R63 A;  2LYL A;  1OCT C;  4NUV A;  2JJ9 A;  2LYQ A;  2LSK A;  1WYB A;  5LBM A;  3L09 A;  3PUS A;  5L3F B;  4CI1 B;  2M67 A;  3FBZ A;  5F3J A;  4I55 E;  2CLY B;  3N5L A;  1GT0 C;  1D0Z A;  4I43 B;  1S35 A;  1ZS4 A;  4HFV A;  4EXT A;  2ZLY A;  2FJR A;  2LOS A;  4PNI A;  5FXV A;  2BDE A;  2DNX A;  2K24 A;  4WW0 A;  2XI8 A;  3QF3 A;  4YBA A;  1WYC A;  1QQB A;  3O1J A;  3PTR B;  3J7Y q;  2XTL A;  1WH8 A;  2E9X C;  4UVC B;  3UUN A;  4EB6 E;  1VPW A;  5C8Y E;  3D1N I;  3KBU A;  3UTK A;  1ADR A;  1QSD A;  1WLX A;  2JCG A;  4JCX A;  1BR0 A;  3BQI A;  3I9Y A;  4HE8 A;  5LGN B;  1HF0 A;  1LKX A;  2VKO A;  3E22 E;  3N2G E;  3OP9 A;  4AKR B;  3I0O A;  3GN5 B;  4UIG A;  4X4G A;  3QWG A;  3O9X A;  4GIW A;  1IZN B;  3CEC A;  3BDN A;  3BS3 A;  2KT9 A;  3ANW B;  2B5A A;  4I4T E;  2WWU A;  5TAO A;  4HN9 A;  3GWH A;  3AVR A;  3HKB E;  3FYM A;  3NRY A;  3BD1 A;  3HR0 A;  3ZCI A;  2LM9 A;  1EFA A;  2IU7 A;  3R1F A;  2MQK A;  4Z5D A;  2KPJ A;  4AQG A;  3SWH A;  5F8P A;  2I59 A;  2CXL A;  2BNM A;  2R63 A;  1Y7Y A;  4I8T A;  3CQG B;  2WIU B;  2PUG A;  3DP7 A;  3N2O A;  1ZZ7 A;  4DBR A;  4TZ4 C;  2OR1 L;  4ZHQ E;  3PU8 A;  4X1I E;  4IWR A;  2X9H A;  4YLH A;  5EK2 A;  3B13 A;  3UUL A;  3ESL A;  3DTO A;  4EYU A;  2IV1 A;  2XAJ B;  2L9Q A;  3TRB A;  3F57 A;  2WAU A;  3FXD B;  3Q5W A;  4AKH A;  1ZPQ A;  2O49 A;  1JH9 A;  1FEW A;  2EF8 A;  5JR9 A;  4O2A E;  1D1C A;  2JRK A;  2BVL A;  2Q9Q A;  2ICP A;  1UCU A;  4GQM A;  4TV8 E;  2L8K A;  3SCF A;  2ZMA A;  1MIV A;  5FY7 A;  2VKJ A;  1BR1 A;  2SPC A;  4G63 A;  1MMD A;  4I6T A;  1OXZ A;  3OQN A;  4GYR A;  3EUH A;  2YU2 A;  3QUJ A;  3OQO A;  4JEH B;  1U4Q A;  3P7I A;  4BAY B;  2YIN A;  4PJM A;  1PRV A;  2EHO A;  3ZLI A;  3RZZ A;  2EWT A;  1HX8 A;  3U78 A;  3RKO A;  3KXA A;  2MYS A;  5FXZ A;  2B1E A;  4CZZ B;  3AAI A;  1R69 A;  2PUF A;  4GHJ A;  1OWA A;  3O1I A;  3G5G A;  4I6R A;  5JDG A;  2YU1 A;  2N1G A;  3ZEF B;  5KMG P;  1O3X A;  2GRM A;  2KZ7 B;  1WIZ A;  5HXR A;  1DWK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...