3O9XA

Structure of the e. coli antitoxin mqsa (ygit/b3021) in complex with its gene promoter
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
132
structure length
132
Chain Sequence
b'HMKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKKLSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized HTH-type transcriptional regulator ygiT
publication title Structure of the Escherichia coli Antitoxin MqsA (YgiT/b3021) Bound to Its Gene Promoter Reveals Extensive Domain Rearrangements and the Specificity of Transcriptional Regulation.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription regulator/dna
total genus 40
structure length 132
sequence length 132
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF15731 MqsA_antitoxin Antitoxin component of bacterial toxin-antitoxin system, MqsA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 3o9xA02
1.20.58.720 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3o9xA01
2IVBA 4JQDA 2GRLA 4Z58A 2MQKA 2AXVA 3CROL 3LFPA 2AXZA 2LCVA 2LYQA 3ZKCA 2AXUA 1HF0A 1ZVVA 2R63A 2XCJA 3FYMA 4OB4A 2PPXA 4MCXA 1RIOA 2B5AA 4J1XA 4MCTA 3GN5B 4O8BA 3QYXA 2KEKA 2IVGA 1QP0A 1BDHA 3DNVB 4X4BA 4PU7A 2BNNA 1VPWA 3OQNA 2O38A 1L1MA 1E3OC 1AU7A 1PRUA 4JCYA 1LMB3 1UXDA 4Z5CA 2WIUB 2XSDC 1ZZ6A 3QQ6A 1B0NA 2PIJA 3BD1A 2A6CA 4YG1A 4X4CA 4I6RA 3BDNA 1ADRA 3HI2A 2XJ3A 3KZ3A 3LISA 5A7LA 1NEQA 2IVQA 1SQ8A 1ZPQA 1CJGA 1PERL 3B7HA 3JXBC 2KEJA 1JWLA 2PUAA 2PUEA 2LYPA 2GRMA 1CQTA 1WIZA 1ZUGA 3OQOA 2LYLA 3GBFA 3F51A 1EFAA 2FJRA 2EF8A 2LYJA 1R69A 3RZZA 2PUDA 4X4DA 1DWKA 1X2LA 1Y7YA 4PU4C 2HINA 1ZZCA 1ZAYA 3U3WA 1LQCA 2AW6A 2LYSA 4PU3C 2H8RA 4X4FA 3OQMA 3JXDL 4J1WA 4F8DA 4YG4A 2PUFA 1S7EA 1DW9A 4GQMA 3SCGA 1JFSA 2EWTA 4Y42A 4I6UA 2ICPA 2WUSR 1ZZ9A 4X4HA 1WETA 2KPJA 4Z59A 3FMYA 1Y9QA 3MLFA 1XWRA 2BNOA 1OCTC 1PRVA 4X4EA 1O4XA 1YSEA 1RPEL 2PE5A 3O9XA 1UXCA 2AWIA 3ZHIA 1PNRA 3D1NI 1ZZ8A 3S8QA 4IWRA 2IV1A 3PXPA 2XIUA 2BNMA 4FN3A 2HSGA 2JVLA 2BJCA 3QF3A 2PUGA 3ZHMA 3UFDA 1QP4A 3CECA 3EUSA 3FYAA 4IVZA 3GN5A 3SCFA 1LCDA 1ZS4A 2ICTA 2KEIA 2O4AA 1BDIA 1OSLA 1X57A 3TRBA 3SCHA 3OP9A 3GA8A 4FBIA 2OR1L 2LYKA 3G7DA 2PUBA 2OFYA 1QP7A 1R63A 4Z5HA 4GHJA 3KXAA 2KZ8A 1UTXA 4YG7B 4YARA 2PUCA 4PU8A 4X4GA 4JCXA 2EBYA 2GZUA 4I6TA 1GT0C 3IVPA 3F52A 3QWGA 3H5TA 3BS3A 1RZSA 2R1JL 1LCCA 1ZZBA 1PRAA 3R1FA 2O49A 5K98B 1QQAA 1JFTA 1WH8A 2IUOA 2L49A 2CSFA 2LYRA 3HZIB 2IU7A 1RZRA 1WH6A 4YBAA 3JXCL 4I8TA 1QPZA 1POUA 2MEZA 2D5VA 1NERA 1IC8A 3G5GA 2L8NA 2AUWA 3VK0A 1QQBA 2CROA 1RZRD 4IA8A 2JCGA 3CLCA 3OMTA 4Z5DA 2XI8A 4NDWA 3L1PA 3F6WA 1ZZ7A 4X4IA 3KJXA 1LLIA 1JH9A
chains in the Genus database with same CATH superfamily
2DNXA 2LYQA 4HWIB 3SS1A 3RC8A 4MCTA 3I1AA 3QYXA 4ASKA 3E08A 3IF8B 4NIQA 3UUBA 2BNNA 3TLTA 3R09A 2UUCT 1J5ET 3UFEA 3TLUA 3C50A 2XM1A 2ES0A 2V6YA 3KV6A 2C5IT 2K48A 4EZIA 3I9WA 5AQJB 2PG8A 3RYIE 3JAFA 1X79A 3CPZA 5L3CB 3LK42 3ZYMA 3DJBA 4X4FA 5DTRA 1W09A 1XDPA 4YFSA 3EDUA 2LHRA 3OYXA 2WDRA 4OFZA 2LM2A 2V3CC 2BJCA 2ICTA 4B3ST 4YTNA 2V26A 3GA8A 3ONLC 3FZFB 4MBQA 3J7Yq 2PXFA 2GZUA 3SOLA 3H5TA 3RX6A 1RZSA 3FZHB 4MLKA 3AE2A 4OYKA 2LM9A 5LBQB 2L3LA 1Z8UA 3PUXF 3NZQA 1RZRD 4EAHA 3OMTA 3UWPA 1BR2A 4EXTA 4U33A 4GOUA 4WBOA 4H63V 4UEMA 1ZVVA 3SFDA 4QH5A 3HKCE 4QX8B 4J1XA 4H9SE 4LFCT 2FFHA 1H7CA 3J9X1 4ZS3A 2WWVA 4JLEA 2ACZA 1S35A 3ZN1B 4IREA 4GIWA 3T8OA 4AIUA 4ZOLE 3N9OA 4LMLA 1LVFA 4UELA 3PU3A 2ACXA 2J4GA 4XBFB 2IVQA 1ZPQA 2MAWA 5LGUB 3B7HA 2KEJA 2CCQA 2GRMA 2XQ8A 4JEUB 5AQRB 3NWIA 3OJAA 4TWHA 3W15B 1HFAA 4PK6A 5ABFA 4ILCA 3CWZB 2LLYA 1NEKA 3G0TA 3OQMA 3SCGA 2CPTA 2EWTA 2V5CA 5LG4A 4X4EA 1O4XA 3H3AA 3O9XA 1UXCA 3TKLB 3TLSA 4NXMT 1XDOA 4LF8T 3TFLA 3CK6A 4LF5T 2A72A 3P50A 5ABHA 5JQGE 2RP4A 2UUAT 3OP9A 2Y8DA 4DIDB 3N9MA 2XAJB 4K0UA 4PU8A 2BS2A 2N9DA 4ZXLA 1GT0C 3IVPA 2QGSA 3NDBB 2O49A 2ZM0A 1S94A 2WZHA 4F8HA 2KWIB 1N36T 3R84B 3NKZA 5F8PA 5JDGA 4GK5E 2ODRD 3IBPA 2IW5B 2X67A 4JQDA 2MQKA 2AXVA 3CROL 5H6QB 3ZC0A 2R63A 4KHPT 2XQAA 4U74A 3ZC1A 4EB6E 4L9IA 2LSGA 4JI2T 1ZKEA 2O38A 4IDOA 1PRUA 2BBHA 3MACA 1WR0A 1KNRA 5JR9B 2WIUB 2CWOA 5L3FB 1IJ5A 4AXPA 1FIOA 4EK9A 3FHNA 1XNQT 1UX5A 2CRBA 3WAKA 5AFUL 2XSAA 5LGTB 3IEEA 2PUAA 3JXBC 5F5WA 5J2TE 3UUXB 1ZZCA 2WDVA 2K3WA 2VQET 4J1WA 4F8DA 4YG4A 4GQMA 2LSYA 2AXDS 3NBXX 2V7MA 4PNIA 2NWBA 3ESLA 2M67A 3RC3A 4HFEA 3AA1B 3N9NA 1X9BA 1ZZ8A 2HH7A 4OK0A 4DV3T 2JVLA 3UFDA 3X1DA 3JC6D 1XMQT 1LCDA 1HNZT 3PV0F 3SCHA 2C5JA 5LHIB 1QP7A 1J5WA 3O1IA 2HN1A 3OWQA 4JI7T 4ADZA 3N2GE 4X4GA 4B6XA 1YQ3A 3VRAA 3BQIA 1I6ZA 3P4RA 5JH7E 4CXWA 5DTQA 5AQGB 2JQ9A 5JRCA 4N78D 4BAYB 1QQBA 2H7VC 4TNWA 1CUNA 4JI1T 5JDMA 4GKKT 2YDSA 2IVBA 2B1EA 4DUYT 2JMKA 1RIOA 3AE1A 2IVGA 3ZPOA 2BBJA 2WS3A 2OA5A 4A97A 4KX6A 4KBMB 3ZLIA 1VPWA 3A7MA 3OQNA 1L1MA 1QUUA 1LMB3 1E7PA 5HWYA 4QXBB 2KWHA 3S4UA 3I9YA 3ZT7A 2X9XA 3AEGA 3K8PC 2IC6A 2E9XB 4X1YE 5LG3A 3OKQA 2JQQA 4YSXA 4OBMA 1ZUGA 2EHOA 4TV8E 2VQFT 1Y7YA 3VHLA 2LLWA 1WR6A 3UU6A 2H8RA 1SE7A 3LBXA 2ODVA 1DW9A 3CQXC 1IBMT 3ZMZB 2E8IA 2ZM6T 3A8YC 4DE9A 1D1CA 3UU8A 2KMFA 2XIUA 2BNMA 2JQHA 3FZLB 2PUGA 1CHUA 3FYAA 4OHFA 5FL0A 2LSIA 4U3CA 4A56A 2YU1A 5JDHA 3VRBA 2WWUA 2PXDA 5HXHA 3CKDA 4H9NC 3AE9A 3ZSSA 4YSZA 4GYRA 3Q5EA 3AE6A 3KFWX 5HAXA 2D0TA 3F2EA 4BJMA 5HXEA 5LMNT 4ZI2D 2LJLA 3JXCL 4UF0B 4I55E 4JEHB 2MPKA 2Y6XA 2CXDA 4YTMA 2AUWA 3CLCA 2XI8A 4H63H 2UXNB 2NP9A 4YY3T 3MKDA 3RF1A 4LMKA 2WU2A 1BR1A 3P8CD 3PUZF 1WRDA 3GN5B 4YTPA 2PFVA 2X68A 2MTQA 1IBKT 2V7KA 1BDHA 4FI5A 5L2LA 1UXDA 2BG9B 5AQUB 5AQHB 3BD1A 4LFBT 2L8KA 5J2UE 1UGOA 4V1Av 3UFGA 3BDNA 4Z8XA 1SA0E 1IAPA 4DBQA 1VOMA 3SFEA 2VVSA 3AB3B 2UXXB 4DV5T 2LHNA 3KV4A 2BS3A 4HFDA 4I50E 3OQOA 1MMGA 2FJRA 3UULA 3ANWB 2RPAA 3SR4A 4KUMB 2EHOD 2AW6A 4P09A 1S7EA 4U7YA 5FY0A 4Z59A 3FMYA 4U2YA 4HWCA 1W0BA 2H7OA 3NROA 2W66A 3D1NI 2LLVA 5LOVE 2LOSA 1HF8A 5CFBA 4P0BA 2L9QA 2W62A 3OYZA 2WY2A 3JC6C 4KHZF 3EUSA 4EQZA 5JDLA 3PDYA 4KP3C 4MALA 2PUCA 4JBWF 1OXZA 2NTYA 2FJEA 2V6XA 1ZZBA 1PRAA 4ER5A 1QQAA 2NTXA 4QXCB 4HE8A 5HXSA 1T98A 2BDEA 3RIFA 4JI5T 2NOXA 1IC8A 2WZIA 3PUVF 4IL9A 4O4LE 5A1LA 5ABGA 1N32T 2IUBA 4HWHA 2VK9A 2XCJA 2X9HA 5L4EA 2Y48B 4P0AA 4B3TT 2HPLA 3MZKB 3R6NA 4X4BA 4JV5T 3A9ZA 5GONE 4JUYA 3G06A 3LK3B 4ZZBA 4O8SA 3V5SA 2A9UA 2WSSV 4DV7T 4TUYE 1I94T 3AA7B 2D9DA 3SX0A 3H3MA 4JI8T 3PE0A 4UXNB 3LISA 4EOZB 1KK7A 2CBIA 2CHNA 1PERL 4ZEYA 4EZHA 3PE5A 4H9RC 4TV9E 2HN2A 3GBFA 1JNRA 2EF8A 4ANJA 1DWKA 4PU4C 4DNDA 2BS4A 2WP9A 2LYSA 4PU3C 5AQKB 3QUJA 1WCRA 2V7LA 4CXYA 5CA1E 4DMWA 4X4HA 4PJMA 4DV6T 1Y9QA 4IDNA 4GKJT 5ETWA 3FBLA 1IBLT 4IT4A 2LKHA 5HXRA 4TWDA 1QP4A 3CECA 2BKPA 2XUEA 2YOEA 4CN4A 2JJ9A 4TZ4C 3PUQA 3AE4A 3PUSA 2B76A 4PFPA 1R63A 2FJAA 2M6BA 2A3DA 4QWNB 2CM0A 5AQNB 3IHRA 2EBYA 4C91A 4QXHB 3WAJA 4O4JE 3RQWA 4ZI2C 1KNZA 3HZIB 3CMLA 4DR6T 3G5GA 2MOZA 4HWDA 4IA8A 4CZZB 1ZEEA 2LT3A 2M4HA 3F6WA 5LYJE 2XJ7A 2UXCT 2IDOB 4TNVA 3UTKA 3MXZA 2LNMA 2H88A 5C8YE 5FL1A 2E5LT 3NRXA 1AU7A 5JVDE 3QFIA 3ZN0B 4IGUA 2XSDC 5EZYE 5JDNA 5HEUA 3RIUC 3AEEA 3FZMB 3P7IA 3AVSA 4DBRA 5FY1A 1NEQA 2DWGA 5C2TA 3CIRA 2CWYA 5M4YA 1D1AA 2VKJA 4IE5A 3K3NA 5HYAA 5L3EB 2EHOC 4DMVA 2J62A 4AI6A 2KPJA 3UU3A 1XWRA 2M6IA 5FMNA 1PRVA 1ZP0A 2Q9QA 5LCYA 3PJAJ 3ZHIA 3N9LA 3S8QA 3PXPA 1UURA 3MK7C 4FN3A 4IVZA 3WI3A 3FZKB 4JI4T 2DHRA 4QH1A 1IZNB 3UT5E 2LYKA 3A9XA 4FJOA 4DR2T 2WB5A 4JCXA 3BS3A 4EEBA 2CXFA 1POUA 2VWAA 2D5VA 3EI0A 2HHHT 3O1HA 2CROA 2XQ7A 4JI3T 2KXPB 4HFHA 1HS7A 4IHJE 1QZXA 3AXJA 2QYWA 1MFQC 4OX9T 4YXDA 2W2UA 3RRCA 1QP0A 5LGNB 4NPPA 4PU7A 3Q2MA 3M9LA 2R6GF 4ZHQE 4IE6A 4GYSA 3TELA 4U31A 3ZEFB 4PW8A 3ABVA 3HI2A 5AQVB 2XJ3A 3RQUA 2XQ3A 2XAHB 2IHR1 2JMHA 2KSRA 3ZT5A 1CQTA 1MIVA 2F4VT 5ADXL 2J47A 3HA4A 3U3WA 2GK9A 5KDMC 4YLHA 3MLFA 1OWAA 3AE5A 1RPEL 2VURA 2W61A 2Q9QD 5J0ZA 2O4AA 2KEIA 3M3ZB 2PXPA 4LF9T 1BDIA 2VL8A 5L3GB 2X0YA 4FBIA 4TX5A 5LXTE 5DSXA 2OFYA 2RA1A 3KXAA 4YG7B 4YARA 1MMDA 3CX7B 3F52A 4I4TE 1U4QA 2Z6EA 2N2NA 4LFAT 4KI0F 3C64A 2MEZA 4EYYR 2JCGA 3BQLA 1UUSA 2C0SA 1KF6A 4NDWA 1L0VA 3ZCJA 1JH9A 4EYUA 5AQOB 1T72A 3ZKCA 4OB4A 1NWMX 4X20E 1W9RA 2WMNA 3GMIA 2HCSA 2CLYB 2JQEA 3B13A 4JCYA 3ETUA 2ZM8A 2WDQA 4IE7A 1FJGT 4Z5CA 3GZDA 1B0NA 4ER6A 3P4WA 1D1BA 4H9PC 4WNKA 5HXCA 3KBTA 4CI1B 1YKEB 2CE7A 4X4CA 4WW0A 5LBMA 3U3IA 4E7SA 5LB7B 4HGAA 3ZJ2A 1KEYA 1JWLA 2VL0A 2LYPA 2VVNA 2DI4A 1R69A 3RZZA 4I0UA 1V9DA 1D0YA 3RIUA 1EZ3A 3EVYA 2XXPA 4DO0A 1U2ZA 2PUFA 3JXDL 3T1YT 1N33T 4QKNA 2LEHA 1WFDA 5JTGA 1NAFA 5IHYA 1WYCA 3K3OA 3LQXA 3HKDE 1G73A 5FY7A 4DR7T 5JR9C 3P4PA 2X9YA 4C90A 3ZHMA 5HWXA 2LRLA 3GWHA 4IE0A 5LJNA 2YKSA 1X57A 2XTLA 2D5UA 2IMLA 4U7IA 4F6RC 3L8RA 3Q5WA 4CN1A 3DTOA 5IUXA 4ISSA 4COFA 1NERA 3QK6A 5AQQB 2L8NA 4Q2JA 2NW8A 4GK0E 5IWAT 2CA5A 4Z5DA 3IA3A 2WQYA 3RKOA 3PURA 3LSVA 5FXXA 4AKIA 4O8BA 3SRZA 3MEJA 2KLQA 3HKEE 2N1GA 1QLBA 2KNDA 1N34T 4DV4T 3NRYA 3E0ZA 5EK4A 1FMWA 1ADRA 4JI0T 1HCIA 3OVUA 2K9AA 2X9WA 3KZ3A 2NR4A 3ONXA 2DLRA 1SQ8A 4HWFA 4Z91A 3NVOA 5DTMA 3TLVA 3AEAA 4HFIA 4ZS2A 3K1SA 5CB4E 3JAEA 1SHZC 5L47A 5H6RB 2WUSR 4ER7A 2BG9E 3ZPXA 2HCNA 2WU5A 4DV0T 2Q9QC 2XZEA 2LSKA 2YBDA 3KL4A 2CEAA 2OLTA 1OEDB 3AAAB 2HSGA 5FXZA 5FVLA 3AAIA 2E9XC 3PU8A 4NUUA 4AISA 2PXEA 4IDZA 5DT2A 4Z5HA 1HTJF 3LFMA 3LK2B 2MBGA 4IL4A 4AQYT 3OTOT 5L4HA 3R1FA 2LRKA 5K98B 1HX1B 1LRZA 2CSFA 4HFVA 3AECA 4DR5T 1Y01A 1MMNA 1NW3A 1ZZ7A 2UUBT 3QB5K 3AE8A 2XHEB 2LCVA 5DABA 3RLFF 4NXNT 2B5AA 4ZZCA 5E0OA 5HEOA 1J1JA 1HR0T 5L3BB 4YHHT 3VR9A 1ZZ6A 3KV5A 4JYAT 2PIJA 4U2ZA 3C4WA 4YSYA 2BKNA 3U78A 3PUWF 5LNKA 3UU5A 3Q5DA 1D0XA 3ZT6A 3HL6A 5BMVE 5JRCB 3OKZA 2DWKA 5LHHB 1DU2A 1KNPA 2V5DA 3RH3A 4YHJA 1BR4A 3Q5XA 5KMGP 5F3JA 1EFAA 2CHOA 5AQIB 3KV9A 4EEDA 4JI6T 5KX5E 4KMCA 4MFRA 4BA9A 4UR9A 3N2OA 3AA0B 2ICPA 1HNXT 4DR1T 5JDQA 3ETVA 4DE8A 2VASA 1HG2A 3K3QC 1PNRA 2BG9C 1LVKA 3FB2A 4YJ3E 5KXJA 3AEBA 5EK2A 4LMJA 5LJMA 4IDQA 3I0QA 1UX4A 1YD8G 1JNZA 2OR1L 3E22E 3RIAA 4CXXA 5JR9A 2W63A 1XMOT 2EHOB 1T8BA 2J7UA 2JRKA 5LP6E 2ODUA 1JFTA 2XSBA 2L49A 3VR8A 4ZI3D 2BZBA 3LBXB 1WH6A 4I8TA 2YU2A 3TEPA 2ZM2A 5DRTA 5HEJA 2XAFB 1KFYA 3KJXA 4XAXB 5FVKA 4LF7T 1WYBA 1O3XA 2AXZA 2XQ9A 3ZSTA 2VKDA 3AAEB 4XZCA 4X1KE 4A5XA 4IDPA 3ZMUB 4ILBA 3QQ6A 3PUGA 5ABEA 1FEWA 3OPCA 1MMAA 5AQTB 3GZDC 2KT9A 2JPFA 5DRYA 3D0TA 4M1PA 1WIZA 4X65T 2LYLA 3F51A 2LYJA 4YT0A 3P4QA 3PUAA 3ZCIA 3T1HT 2WCAA 3RYFE 1Y64B 2XPKA 5HCJA 2W0GA 2A2FX 1OCTC 2PE5A 4A98A 2XAQB 3EUHA 3RYCE 3QF3A 4NUVA 3L39A 4WVLA 4X62T 5FYMA 1OSLA 5FNVE 2XXQA 4YJ2E 4AQGA 1DULA 3NZPA 5LHGB 3HKBE 1MIYA 4X1IE 2HPJA 4OYJA 2QVAA 2FBWA 4HKAA 2UXBT 1WH8A 2XASB 2LYRA 4IE4A 3CVRA 2E9XA 4AKRB 5CGMA 3RRWA 2XQ5A 3PUYF 3QOWA 5AQSB 1G8XA 1HF0A 2AXUA 2LE8A 4P1NA 4DVDA 3RPUA 4H9QC 4EIWA 2UXDT 1MNDA 3LG7A 4K0KT 2JIWA 3V5UA 2VEOA 3TLWA 4Z90A 2PXVA 1WLXA 5DQVA 4EKGA 3AEDA 3AEFA 2I59A 3MA9A 4AQFA 2PUEA 2BKOA 3I0OA 3ZKRA 3VKGA 2PUDA 4ILAA 3ONJA 1Z0PA 4UF0A 2CBJA 4DR4T 1AJ3A 5FKYA 1ZZ9A 2PXQA 1HX8A 3KDSE 5BR8T 3CQGB 3CX8B 3A5XA 3LJCA 3RGLA 2WBLA 3GN5A 1XWMA 2PXLA 2DCFA 2W4XA 4U72A 1W0AA 3FXDB 1VRBA 3H37A 4I43B 2YINA 3SWHA 2W00A 2BG9A 5AQFB 3EDVA 2UU9T 3GZCA 4AKLA 3EHZA 5HEGA 2IUOA 4PK4A 4ZI3C 2KINB 2XAGB 3M65A 4L0RA 1OEDA 2V6YB 1YQ4A 2E9XD 5AQPB 2V7IA 3ANWA 4X66T 4UVCB 1LLIA 2GRLA 4B3RT 3QNUA 4UV8B 5GAHi 1LKXA 2PPXA 3O1JA 3UQ7A 3A9YA 1HNWT 4QHOA 2NW9A 2D2SA 3RYHE 2J7WA 4YG1A 1VCTA 1CJGA 4UVBB 5JUWA 2K5BB 2PXBA 2E5VA 1YW0A 4X4DA 1M7KA 2QRXA 2LOPA 2PBIA 3B57A 2CXLA 4ISTA 2W67A 2VB6A 3Q9DA 4UV9B 3KVBA 1YSEA 4PJJA 2FUPA 1MNEA 2AWIA 4HRAA 1UCUA 3N9QA 3DP7A 2LKGA 3MJXA 3CQCB 2FJBA 3EAMA 5L3DB 1YKHB 3RHWA 1BR0A 3TRBA 2XQYA 3ZMVB 4PFOA 1ZOYA 3G7DA 3AE3A 5TAOA 5GAGi 1UTXA 2KZ8A 2WAUA 2LSJA 3AE7A 5HEHA 4I6TA 2H3RA 2PTFA 3QWGA 3AA6B 4E7ZA 1LCCA 2XQ4A 4EGWA 1QSDA 2J1DG 2BVLA 4PK5A 2CMRA 4CI2B 4YBAA 3QB5A 2MXDA 5HCMA 3RKGA 2SPCA 2Q9QB 1D0ZA 3L09A 2ZMAA 3L1PA 2IAKA 4PAGA 1HG5A 3C51A 3LFPA 2YEVC 3FYMA 2AE9A 4UVAB 4G63A 3AVRA 3GUUA 1FMVA 1M62A 3JADA 2YK0A 5ABFB 4J2CA 5J1GA 2WMOA 4WZXA 2JQKA 2X51A 3B5MA 1U5PA 4HFBA 4LF4T 2A6CA 4L5GA 1NENA 2VKOA 5C3JA 4PJNA 4Q25A 4I6RA 4LF6T 5LMUT 3PJAA 2XY8B 5DQWA 4EZ4A 2PXUA 3UU4A 4O4IE 4AKGA 3FXEB 4CI3B 2I0MA 4O4HE 2VKHA 2PXKA 5AQMB 4IIJE 1LQCA 3AXJB 3NZLA 3UUMA 5IYZE 4Y42A 4I6UA 3DM5A 5DJQC 2CLYC 2X0HA 3BQKA 4ER0A 2IIUA 1XNRT 2K24A 3C98B 4WBNE 1E2AA 3SCFA 2D0UA 3C4XA 2X66A 3C4ZA 3ZYLA 5JREA 5CA0E 4EKIA 4GHJA 1GQEA 1MIWA 5LA6E 4HFCA 1T7SA 4MHCA 2ZLYA 2FJDA 3P4SA 5AQLB 2R1JL 5FP3A 5EK3A 4TN7B 3ZYKA 4ERRA 3OBVE 1HQ1A 2X0LB 1QB2A 4BJNA 4WYVA 3ZMTB 3VK0A 2XM2A 4X64T 3FBZA 1OEDE 2MYSA 4X4IA 2XQ6A 4O2AE 1ZV4X 2H89A 2KZ7B 4Z58A 2P9BA 2DL1A 4MCXA 3N9PA 3RI5A 3QC9A 3VU7H 3ZMSB 2KEKA 2E2AA 3QOFA 4HN9A 3KBUA 4DR3T 4CN6A 2PXTA 3DNVB 2NW7A 2QA7A 3CX6B 1E3OC 2L1PA 5FXVA 1B7TA 2IC9A 3N2KE 2HFZA 2YDRA 3ME5A 4ILUA 2V7JA 3PTRB 4TWFA 4H9OC 2I6HA 4AKHA 5A7LA 1VCSA 3F31A 4UIGA 3BK9A 2OV9A 5CJ5A 1UK5A 4HEAA 1XZYA 4DUZT 4AQFC 3O4XE 2XXAA 1X2LA 2HINA 2WM9A 4HTEA 4PJLA 4DV2T 1JFSA 4QX7B 1WETA 4O2BE 2BVMA 2BNOA 2G0UA 2C5KT 3VWSA 1US7B 3ZJ1A 2V1DB 4IWRA 2IV1A 1YXRA 3NXHA 4ER3A 4EV6A 4B3MT 3JCFA 1ZS4A 2V8SV 2YDQA 4CQIA 2PJQA 2PUBA 3N5LA 3F57A 4DV1T 3HR0A 5JDFA 3EABA 3L3PA 4ZI7E 3QOXA 5FXWA 3VKHA 3KVAA 4X5TA 1R8IA 3UUNA 1RZRA 2IU7A 1QPZA 3KINB 1ZHCA 4QH4A 4G2AA 3LDQB 1E1HB 1IJ6A 2YN6A 1SUMB 3UQ4A 1ZAYA 1OEDC
chains in the Genus database with same CATH topology
4EYUA 1HF0A 2LYQA 3ZKCA 2AXUA 1BR1A 2DNXA 4OB4A 3P8CD 3SS1A 2LE8A 3RC8A 1NWMX 1WRDA 4X20E 4MCTA 3GN5B 3I1AA 2PFVA 3QYXA 2X68A 4DVDA 2MTQA 2WMNA 4ASKA 3GMIA 3E08A 3IF8B 4H9QC 3RPUA 1MNDA 4EIWA 2V7KA 3LG7A 1BDHA 3V5UA 2BNNA 2CLYB 4FI5A 3B13A 4JCYA 3ETUA 2ZM8A 4IE7A 5L2LA 1UXDA 4Z5CA 3UFEA 1B0NA 3BD1A 1D1BA 4H9PC 4WNKA 1WLXA 2L8KA 5DQVA 3KBTA 5HXCA 4CI1B 5J2UE 3C50A 1YKEB 2CE7A 4X4CA 2ES0A 3BDNA 4V1Av 4WW0A 4Z8XA 1SA0E 1IAPA 5LBMA 4DBQA 1VOMA 3KV6A 3AB3B 3U3IA 2UXXB 2I59A 3MA9A 4E7SA 5LXTE 2C5IT 4HGAA 3ZJ2A 4AQFA 2K48A 2LHNA 2PUEA 3KV4A 1JWLA 3I9WA 2LYPA 4I50E 3OQOA 3I0OA 1MMGA 2PG8A 3VKGA 2FJRA 2DI4A 1R69A 3RZZA 2PUDA 1V9DA 3ANWB 3UULA 3RYIE 1D0YA 1X79A 3CPZA 5L3CB 4KUMB 1EZ3A 3LK42 3EVYA 2EHOD 3ZYMA 1Z0PA 2AW6A 4P09A 3DJBA 4DO0A 4X4FA 2PUFA 3JXDL 4UF0A 4YFSA 1S7EA 4QKNA 1AJ3A 2LEHA 3EDUA 1ZZ9A 5FY0A 2LHRA 1HX8A 4Z59A 3FMYA 1NAFA 3KDSE 3OYXA 5IHYA 1WYCA 3K3OA 3HKDE 2H7OA 1G73A 5FY7A 5JR9C 3CQGB 3CX8B 4OFZA 3D1NI 2X9YA 5LOVE 2LOSA 3A5XA 1HF8A 3ZHMA 3LJCA 2BJCA 2L9QA 2W62A 3OYZA 3JC6C 4P0BA 3EUSA 5HWXA 2WBLA 5JDLA 3GN5A 3PDYA 2ICTA 2DCFA 3GWHA 4IE0A 4KP3C 4MALA 5LJNA 2V26A 1X57A 2XTLA 3GA8A 4U72A 3FXDB 2D5UA 4MBQA 3J7Yq 1VRBA 3H37A 4I43B 2PUCA 2YINA 1OXZA 3SWHA 4F6RC 2W00A 2GZUA 3SOLA 2NTYA 3EDVA 3H5TA 4AKLA 3RX6A 1RZSA 1ZZBA 1PRAA 3Q5WA 1QQAA 2NTXA 2IUOA 4HE8A 4MLKA 4QXCB 4PK4A 4ZI3C 5HXSA 1T98A 2BDEA 4OYKA 2KINB 3DTOA 2LM9A 4ISSA 5LBQB 2L3LA 2NOXA 1NERA 1IC8A 2XAGB 3QK6A 2L8NA 2NW8A 3M65A 4GK0E 4L0RA 4O4LE 5A1LA 3NZQA 1RZRD 4EAHA 3OMTA 4Z5DA 2CA5A 2E9XD 2V7IA 3ANWA 1BR2A 4EXTA 2VK9A 4UVCB 3RKOA 3PURA 1LLIA 2GRLA 4GOUA 4WBOA 4H63V 4UEMA 4UV8B 1ZVVA 1LKXA 2XCJA 2X9HA 2PPXA 5FXXA 3HKCE 3O1JA 4J1XA 4H9SE 4QX8B 2Y48B 4AKIA 4O8BA 1H7CA 3J9X1 3SRZA 4ZS3A 2KLQA 4P0AA 4JLEA 3HKEE 2HPLA 2N1GA 3MZKB 3R6NA 4X4BA 1S35A 3ZN1B 5GONE 4JUYA 3LK3B 4GIWA 3T8OA 2KNDA 4QHOA 2NW9A 4O8SA 3V5SA 3NRYA 3E0ZA 4ZOLE 2WSSV 3N9OA 5EK4A 1LVFA 2D2SA 1FMWA 3RYHE 4TUYE 3AA7B 4UELA 3PU3A 4YG1A 1ADRA 2ACXA 1HCIA 2K9AA 2X9WA 3KZ3A 3ONXA 3PE0A 4UXNB 3LISA 4EOZB 4XBFB 1KK7A 2DLRA 2IVQA 1SQ8A 1ZPQA 1CJGA 1PERL 3B7HA 2KEJA 4UVBB 2K5BB 5LGUB 4EZHA 2CCQA 2GRMA 4JEUB 4H9RC 4TV9E 3GBFA 3OJAA 2EF8A 1YW0A 4ZS2A 4ANJA 5CB4E 3W15B 4X4DA 1DWKA 4PU4C 1HFAA 4PK6A 4DNDA 3CWZB 2LOPA 2PBIA 3B57A 2LYSA 4PU3C 3QUJA 3OQMA 1SHZC 2V7LA 4CXYA 3SCGA 2CXLA 2EWTA 5CA1E 4ISTA 5H6RB 2WUSR 4DMWA 4X4HA 4PJMA 5LG4A 1Y9QA 2VB6A 3Q9DA 4UV9B 3KVBA 4X4EA 1O4XA 1YSEA 4PJJA 3H3AA 5ETWA 3O9XA 1UXCA 3FBLA 1MNEA 2AWIA 1UCUA 3TKLB 3N9QA 2Q9QC 2LSKA 2CEAA 3AAAB 3DP7A 2HSGA 5HXRA 3MJXA 2A72A 1QP4A 3CECA 5FXZA 3CQCB 2XUEA 5L3DB 5JQGE 3AAIA 1YKHB 2E9XC 2JJ9A 2RP4A 3TRBA 3PU8A 2XQYA 3PUQA 3OP9A 4NUUA 4PFOA 2Y8DA 4TZ4C 3ZMVB 3PUSA 3G7DA 4IDZA 4PFPA 1R63A 4Z5HA 1HTJF 3N9MA 2KZ8A 1UTXA 5TAOA 2XAJB 2WAUA 2A3DA 3LFMA 3LK2B 4QWNB 4K0UA 4PU8A 2CM0A 2LSJA 2EBYA 3IHRA 2N9DA 4I6TA 1GT0C 3IVPA 2H3RA 3QWGA 3AA6B 4C91A 4E7ZA 1LCCA 3R1FA 2QGSA 4QXHB 2O49A 2ZM0A 5K98B 1QSDA 1S94A 3WAJA 4O4JE 1LRZA 2J1DG 2BVLA 2CSFA 2CMRA 2KWIB 4PK5A 4ZI2C 1KNZA 4HFVA 3HZIB 3R84B 4CI2B 4YBAA 3CMLA 3G5GA 5F8PA 2MOZA 5JDGA 4GK5E 2SPCA 4IA8A 1MMNA 2Q9QB 1D0ZA 4CZZB 3L09A 1ZEEA 2ZMAA 3IBPA 2LT3A 3L1PA 3F6WA 2IW5B 1ZZ7A 2IAKA 2X67A 4PAGA 5LYJE 4JQDA 2XHEB 2MQKA 2AXVA 3CROL 3LFPA 1HG5A 3C51A 5H6QB 2LCVA 2YEVC 3ZC0A 2R63A 3FYMA 4UVAB 5DABA 2B5AA 4G63A 3AVRA 1FMVA 4U74A 2YK0A 3UTKA 3MXZA 4J2CA 5J1GA 3ZC1A 4L9IA 4EB6E 2WMOA 5C8YE 5E0OA 2LSGA 1ZKEA 3NRXA 2O38A 1AU7A 1PRUA 5L3BB 2X51A 3MACA 5JVDE 1U5PA 3ZN0B 4IGUA 5JR9B 2XSDC 2WIUB 1ZZ6A 2CWOA 3KV5A 2PIJA 1IJ5A 5L3FB 3C4WA 5EZYE 2A6CA 5JDNA 4AXPA 1FIOA 2VKOA 3FHNA 4L5GA 1UX5A 4PJNA 3P7IA 4I6RA 3U78A 3AVSA 5LNKA 3WAKA 5AFUL 4DBRA 5DQWA 5FY1A 5LGTB 4EZ4A 3IEEA 1NEQA 1D0XA 3HL6A 5BMVE 5JRCB 2PUAA 2DWGA 3JXBC 2DWKA 5LHHB 2CWYA 5M4YA 4O4IE 4AKGA 4C90A 1D1AA 3FXEB 3RH3A 4YHJA 1BR4A 3Q5XA 5J2TE 4CI3B 5KMGP 2VKJA 4IE5A 1EFAA 4O4HE 2VKHA 3UUXB 5F3JA 3K3NA 5HYAA 3KV9A 1ZZCA 5L3EB 2EHOC 4IIJE 5KX5E 4KMCA 1LQCA 4MFRA 4BA9A 3N2OA 3AA0B 4J1WA 4F8DA 4YG4A 4DMVA 4GQMA 2LSYA 3UUMA 5IYZE 4Y42A 4I6UA 2ICPA 3NBXX 4AI6A 2KPJA 2V7MA 4PNIA 5DJQC 2CLYC 5JDQA 2NWBA 1XWRA 3BQKA 3ESLA 5FMNA 1PRVA 2Q9QA 3ETVA 2VASA 2M67A 2MBGA 5LCYA 3RC3A 1HG2A 3K3QC 3AA1B 3N9NA 3ZHIA 1PNRA 1LVKA 2K24A 1ZZ8A 3S8QA 2HH7A 3C98B 3FB2A 3N9LA 4OK0A 4YJ3E 3PXPA 3MK7C 4FN3A 2JVLA 4WBNE 3UFDA 4IVZA 3JC6D 3WI3A 3SCFA 1LCDA 2D0UA 3C4XA 2X66A 2DHRA 3C4ZA 5EK2A 3ZYLA 1IZNB 5LJMA 5CA0E 3UT5E 5JREA 3I0QA 1UX4A 3SCHA 2C5JA 1YD8G 5LHIB 2OR1L 2LYKA 4FJOA 1QP7A 3O1IA 4GHJA 3E22E 1MIWA 4CXXA 4ADZA 3N2GE 4X4GA 5LA6E 4JCXA 4MHCA 5JR9A 2W63A 4B6XA 2EHOB 2ZLYA 3BS3A 2JRKA 2R1JL 5FP3A 5LP6E 2ODUA 1JFTA 4TN7B 5EK3A 2L49A 3ZYKA 3BQIA 4ERRA 4ZI3D 2CXFA 3OBVE 5JH7E 1BR0A 2BZBA 3LBXB 1WH6A 4I8TA 4CXWA 2YU2A 1POUA 2VWAA 2X0LB 5JRCA 4BJNA 4N78D 2D5VA 4BAYB 3ZMTB 3O1HA 3VK0A 1QQBA 2H7VC 2ZM2A 2CROA 1CUNA 3FBZA 5JDMA 2KXPB 2XAFB 2MYSA 1HS7A 4IHJE 4X4IA 3KJXA 4XAXB 4O2AE 1ZV4X 1WYBA 2IVBA 2KZ7B 4Z58A 2B1EA 2P9BA 1O3XA 2AXZA 2JMKA 4MCXA 1RIOA 3N9PA 2VKDA 3QC9A 3VU7H 3ZMSB 3RRCA 2KEKA 2IVGA 1QP0A 5LGNB 3ZPOA 2OA5A 3AAEB 4HN9A 3KBUA 4X1KE 4KBMB 4XZCA 3DNVB 2NW7A 4PU7A 2QA7A 1VPWA 3Q2MA 3CX6B 3ZLIA 3OQNA 1L1MA 1E3OC 3ZMUB 1QUUA 5FXVA 1LMB3 1B7TA 2IC9A 4ZHQE 4IE6A 3N2KE 4GYSA 4QXBB 5HWYA 3QQ6A 3PUGA 2KWHA 1FEWA 3ZEFB 3S4UA 3I9YA 4ILUA 4PW8A 2V7JA 3PTRB 1MMAA 2X9XA 3HI2A 4H9OC 2XJ3A 4AKHA 2KT9A 2JPFA 3K8PC 5A7LA 2IC6A 3F31A 2XAHB 2E9XB 4X1YE 3OKQA 2JMHA 4UIGA 3BK9A 2JQQA 3D0TA 1CQTA 4HEAA 4M1PA 1WIZA 1ZUGA 1MIVA 2EHOA 2LYLA 4TV8E 4AQFC 3F51A 3O4XE 5ADXL 2LYJA 1X2LA 1Y7YA 3VHLA 3PUAA 2HINA 1WR6A 3ZCIA 2WM9A 3HA4A 3U3WA 4HTEA 2H8RA 4PJLA 3LBXA 2GK9A 2ODVA 3RYFE 1Y64B 5KDMC 1DW9A 1JFSA 3CQXC 2W0GA 4QX7B 2A2FX 1WETA 4O2BE 4YLHA 3MLFA 3ZMZB 2BVMA 2BNOA 1OCTC 2C5KT 2G0UA 1US7B 2E8IA 1OWAA 1RPEL 2PE5A 2W61A 3ZJ1A 2V1DB 4IWRA 2IV1A 1D1CA 2XAQB 2KMFA 3EUHA 2XIUA 2Q9QD 3RYCE 2BNMA 2PUGA 3QF3A 4NUVA 3FYAA 4OHFA 2O4AA 1ZS4A 2KEIA 5FYMA 1BDIA 2VL8A 1OSLA 2LSIA 5L3GB 4A56A 2YU1A 5JDHA 5FNVE 4FBIA 2PJQA 4TX5A 4CQIA 2PUBA 2OFYA 2WWUA 3N5LA 5HXHA 2RA1A 3F57A 4YJ2E 3KXAA 3CKDA 4AQGA 5LHGB 4YG7B 4YARA 3HKBE 3NZPA 3HR0A 4H9NC 1MIYA 4X1IE 5JDFA 2HPJA 4OYJA 3L3PA 1MMDA 3CX7B 4ZI7E 3F52A 4GYRA 4I4TE 5FXWA 1U4QA 3VKHA 2Z6EA 4HKAA 3KVAA 3KFWX 1WH8A 5HAXA 2N2NA 2D0TA 3F2EA 2XASB 4BJMA 5HXEA 2LYRA 4IE4A 3UUNA 1RZRA 2IU7A 3CVRA 2LJLA 3JXCL 4UF0B 2E9XA 4ZI2D 1QPZA 3C64A 2MEZA 4I55E 3KINB 1ZHCA 4JEHB 2Y6XA 4AKRB 4G2AA 2CXDA 2AUWA 4EYYR 1E1HB 3RRWA 1IJ6A 2JCGA 3CLCA 3BQLA 2XI8A 2C0SA 4NDWA 1G8XA 4H63H 2UXNB 2NP9A 3MKDA 1ZAYA 3ZCJA 1JH9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IVB A;  4JQD A;  2GRL A;  4Z58 A;  2MQK A;  2AXV A;  3CRO L;  3LFP A;  2AXZ A;  2LCV A;  2LYQ A;  3ZKC A;  2AXU A;  1HF0 A;  1ZVV A;  2R63 A;  2XCJ A;  3FYM A;  4OB4 A;  2PPX A;  4MCX A;  1RIO A;  2B5A A;  4J1X A;  4MCT A;  3GN5 B;  4O8B A;  3QYX A;  2KEK A;  2IVG A;  1QP0 A;  1BDH A;  3DNV B;  4X4B A;  4PU7 A;  2BNN A;  1VPW A;  3OQN A;  2O38 A;  1L1M A;  1E3O C;  1AU7 A;  1PRU A;  4JCY A;  1LMB 3;  1UXD A;  4Z5C A;  2WIU B;  2XSD C;  1ZZ6 A;  3QQ6 A;  1B0N A;  2PIJ A;  3BD1 A;  2A6C A;  4YG1 A;  4X4C A;  4I6R A;  3BDN A;  1ADR A;  3HI2 A;  2XJ3 A;  3KZ3 A;  3LIS A;  5A7L A;  1NEQ A;  2IVQ A;  1SQ8 A;  1ZPQ A;  1CJG A;  1PER L;  3B7H A;  3JXB C;  2KEJ A;  1JWL A;  2PUA A;  2PUE A;  2LYP A;  2GRM A;  1CQT A;  1WIZ A;  1ZUG A;  3OQO A;  2LYL A;  3GBF A;  3F51 A;  1EFA A;  2FJR A;  2EF8 A;  2LYJ A;  1R69 A;  3RZZ A;  2PUD A;  4X4D A;  1DWK A;  1X2L A;  1Y7Y A;  4PU4 C;  2HIN A;  1ZZC A;  1ZAY A;  3U3W A;  1LQC A;  2AW6 A;  2LYS A;  4PU3 C;  2H8R A;  4X4F A;  3OQM A;  3JXD L;  4J1W A;  4F8D A;  4YG4 A;  2PUF A;  1S7E A;  1DW9 A;  4GQM A;  3SCG A;  1JFS A;  2EWT A;  4Y42 A;  4I6U A;  2ICP A;  2WUS R;  1ZZ9 A;  4X4H A;  1WET A;  2KPJ A;  4Z59 A;  3FMY A;  1Y9Q A;  3MLF A;  1XWR A;  2BNO A;  1OCT C;  1PRV A;  4X4E A;  1O4X A;  1YSE A;  1RPE L;  2PE5 A;  3O9X A;  1UXC A;  2AWI A;  3ZHI A;  1PNR A;  3D1N I;  1ZZ8 A;  3S8Q A;  4IWR A;  2IV1 A;  3PXP A;  2XIU A;  2BNM A;  4FN3 A;  2HSG A;  2JVL A;  2BJC A;  3QF3 A;  2PUG A;  3ZHM A;  3UFD A;  1QP4 A;  3CEC A;  3EUS A;  3FYA A;  4IVZ A;  3GN5 A;  3SCF A;  1LCD A;  1ZS4 A;  2ICT A;  2KEI A;  2O4A A;  1BDI A;  1OSL A;  1X57 A;  3TRB A;  3SCH A;  3OP9 A;  3GA8 A;  4FBI A;  2OR1 L;  2LYK A;  3G7D A;  2PUB A;  2OFY A;  1QP7 A;  1R63 A;  4Z5H A;  4GHJ A;  3KXA A;  2KZ8 A;  1UTX A;  4YG7 B;  4YAR A;  2PUC A;  4PU8 A;  4X4G A;  4JCX A;  2EBY A;  2GZU A;  4I6T A;  1GT0 C;  3IVP A;  3F52 A;  3QWG A;  3H5T A;  3BS3 A;  1RZS A;  2R1J L;  1LCC A;  1ZZB A;  1PRA A;  3R1F A;  2O49 A;  5K98 B;  1QQA A;  1JFT A;  1WH8 A;  2IUO A;  2L49 A;  2CSF A;  2LYR A;  3HZI B;  2IU7 A;  1RZR A;  1WH6 A;  4YBA A;  3JXC L;  4I8T A;  1QPZ A;  1POU A;  2MEZ A;  2D5V A;  1NER A;  1IC8 A;  3G5G A;  2L8N A;  2AUW A;  3VK0 A;  1QQB A;  2CRO A;  1RZR D;  4IA8 A;  2JCG A;  3CLC A;  3OMT A;  4Z5D A;  2XI8 A;  4NDW A;  3L1P A;  3F6W A;  1ZZ7 A;  4X4I A;  3KJX A;  1LLI A;  1JH9 A; 
#chains in the Genus database with same CATH topology
 2DNX A;  2LYQ A;  4HWI B;  3SS1 A;  3RC8 A;  4MCT A;  3I1A A;  3QYX A;  4ASK A;  3E08 A;  3IF8 B;  4NIQ A;  3UUB A;  2BNN A;  3TLT A;  3R09 A;  2UUC T;  1J5E T;  3UFE A;  3TLU A;  3C50 A;  2XM1 A;  2ES0 A;  2V6Y A;  3KV6 A;  2C5I T;  2K48 A;  4EZI A;  3I9W A;  5AQJ B;  2PG8 A;  3RYI E;  3JAF A;  1X79 A;  3CPZ A;  5L3C B;  3LK4 2;  3ZYM A;  3DJB A;  4X4F A;  5DTR A;  1W09 A;  1XDP A;  4YFS A;  3EDU A;  2LHR A;  3OYX A;  2WDR A;  4OFZ A;  2LM2 A;  2V3C C;  2BJC A;  2ICT A;  4B3S T;  4YTN A;  2V26 A;  3GA8 A;  3ONL C;  3FZF B;  4MBQ A;  3J7Y q;  2PXF A;  2GZU A;  3SOL A;  3H5T A;  3RX6 A;  1RZS A;  3FZH B;  4MLK A;  3AE2 A;  4OYK A;  2LM9 A;  5LBQ B;  2L3L A;  1Z8U A;  3PUX F;  3NZQ A;  1RZR D;  4EAH A;  3OMT A;  3UWP A;  1BR2 A;  4EXT A;  4U33 A;  4GOU A;  4WBO A;  4H63 V;  4UEM A;  1ZVV A;  3SFD A;  4QH5 A;  3HKC E;  4QX8 B;  4J1X A;  4H9S E;  4LFC T;  2FFH A;  1H7C A;  3J9X 1;  4ZS3 A;  2WWV A;  4JLE A;  2ACZ A;  1S35 A;  3ZN1 B;  4IRE A;  4GIW A;  3T8O A;  4AIU A;  4ZOL E;  3N9O A;  4LML A;  1LVF A;  4UEL A;  3PU3 A;  2ACX A;  2J4G A;  4XBF B;  2IVQ A;  1ZPQ A;  2MAW A;  5LGU B;  3B7H A;  2KEJ A;  2CCQ A;  2GRM A;  2XQ8 A;  4JEU B;  5AQR B;  3NWI A;  3OJA A;  4TWH A;  3W15 B;  1HFA A;  4PK6 A;  5ABF A;  4ILC A;  3CWZ B;  2LLY A;  1NEK A;  3G0T A;  3OQM A;  3SCG A;  2CPT A;  2EWT A;  2V5C A;  5LG4 A;  4X4E A;  1O4X A;  3H3A A;  3O9X A;  1UXC A;  3TKL B;  3TLS A;  4NXM T;  1XDO A;  4LF8 T;  3TFL A;  3CK6 A;  4LF5 T;  2A72 A;  3P50 A;  5ABH A;  5JQG E;  2RP4 A;  2UUA T;  3OP9 A;  2Y8D A;  4DID B;  3N9M A;  2XAJ B;  4K0U A;  4PU8 A;  2BS2 A;  2N9D A;  4ZXL A;  1GT0 C;  3IVP A;  2QGS A;  3NDB B;  2O49 A;  2ZM0 A;  1S94 A;  2WZH A;  4F8H A;  2KWI B;  1N36 T;  3R84 B;  3NKZ A;  5F8P A;  5JDG A;  4GK5 E;  2ODR D;  3IBP A;  2IW5 B;  2X67 A;  4JQD A;  2MQK A;  2AXV A;  3CRO L;  5H6Q B;  3ZC0 A;  2R63 A;  4KHP T;  2XQA A;  4U74 A;  3ZC1 A;  4EB6 E;  4L9I A;  2LSG A;  4JI2 T;  1ZKE A;  2O38 A;  4IDO A;  1PRU A;  2BBH A;  3MAC A;  1WR0 A;  1KNR A;  5JR9 B;  2WIU B;  2CWO A;  5L3F B;  1IJ5 A;  4AXP A;  1FIO A;  4EK9 A;  3FHN A;  1XNQ T;  1UX5 A;  2CRB A;  3WAK A;  5AFU L;  2XSA A;  5LGT B;  3IEE A;  2PUA A;  3JXB C;  5F5W A;  5J2T E;  3UUX B;  1ZZC A;  2WDV A;  2K3W A;  2VQE T;  4J1W A;  4F8D A;  4YG4 A;  4GQM A;  2LSY A;  2AXD S;  3NBX X;  2V7M A;  4PNI A;  2NWB A;  3ESL A;  2M67 A;  3RC3 A;  4HFE A;  3AA1 B;  3N9N A;  1X9B A;  1ZZ8 A;  2HH7 A;  4OK0 A;  4DV3 T;  2JVL A;  3UFD A;  3X1D A;  3JC6 D;  1XMQ T;  1LCD A;  1HNZ T;  3PV0 F;  3SCH A;  2C5J A;  5LHI B;  1QP7 A;  1J5W A;  3O1I A;  2HN1 A;  3OWQ A;  4JI7 T;  4ADZ A;  3N2G E;  4X4G A;  4B6X A;  1YQ3 A;  3VRA A;  3BQI A;  1I6Z A;  3P4R A;  5JH7 E;  4CXW A;  5DTQ A;  5AQG B;  2JQ9 A;  5JRC A;  4N78 D;  4BAY B;  1QQB A;  2H7V C;  4TNW A;  1CUN A;  4JI1 T;  5JDM A;  4GKK T;  2YDS A;  2IVB A;  2B1E A;  4DUY T;  2JMK A;  1RIO A;  3AE1 A;  2IVG A;  3ZPO A;  2BBJ A;  2WS3 A;  2OA5 A;  4A97 A;  4KX6 A;  4KBM B;  3ZLI A;  1VPW A;  3A7M A;  3OQN A;  1L1M A;  1QUU A;  1LMB 3;  1E7P A;  5HWY A;  4QXB B;  2KWH A;  3S4U A;  3I9Y A;  3ZT7 A;  2X9X A;  3AEG A;  3K8P C;  2IC6 A;  2E9X B;  4X1Y E;  5LG3 A;  3OKQ A;  2JQQ A;  4YSX A;  4OBM A;  1ZUG A;  2EHO A;  4TV8 E;  2VQF T;  1Y7Y A;  3VHL A;  2LLW A;  1WR6 A;  3UU6 A;  2H8R A;  1SE7 A;  3LBX A;  2ODV A;  1DW9 A;  3CQX C;  1IBM T;  3ZMZ B;  2E8I A;  2ZM6 T;  3A8Y C;  4DE9 A;  1D1C A;  3UU8 A;  2KMF A;  2XIU A;  2BNM A;  2JQH A;  3FZL B;  2PUG A;  1CHU A;  3FYA A;  4OHF A;  5FL0 A;  2LSI A;  4U3C A;  4A56 A;  2YU1 A;  5JDH A;  3VRB A;  2WWU A;  2PXD A;  5HXH A;  3CKD A;  4H9N C;  3AE9 A;  3ZSS A;  4YSZ A;  4GYR A;  3Q5E A;  3AE6 A;  3KFW X;  5HAX A;  2D0T A;  3F2E A;  4BJM A;  5HXE A;  5LMN T;  4ZI2 D;  2LJL A;  3JXC L;  4UF0 B;  4I55 E;  4JEH B;  2MPK A;  2Y6X A;  2CXD A;  4YTM A;  2AUW A;  3CLC A;  2XI8 A;  4H63 H;  2UXN B;  2NP9 A;  4YY3 T;  3MKD A;  3RF1 A;  4LMK A;  2WU2 A;  1BR1 A;  3P8C D;  3PUZ F;  1WRD A;  3GN5 B;  4YTP A;  2PFV A;  2X68 A;  2MTQ A;  1IBK T;  2V7K A;  1BDH A;  4FI5 A;  5L2L A;  1UXD A;  2BG9 B;  5AQU B;  5AQH B;  3BD1 A;  4LFB T;  2L8K A;  5J2U E;  1UGO A;  4V1A v;  3UFG A;  3BDN A;  4Z8X A;  1SA0 E;  1IAP A;  4DBQ A;  1VOM A;  3SFE A;  2VVS A;  3AB3 B;  2UXX B;  4DV5 T;  2LHN A;  3KV4 A;  2BS3 A;  4HFD A;  4I50 E;  3OQO A;  1MMG A;  2FJR A;  3UUL A;  3ANW B;  2RPA A;  3SR4 A;  4KUM B;  2EHO D;  2AW6 A;  4P09 A;  1S7E A;  4U7Y A;  5FY0 A;  4Z59 A;  3FMY A;  4U2Y A;  4HWC A;  1W0B A;  2H7O A;  3NRO A;  2W66 A;  3D1N I;  2LLV A;  5LOV E;  2LOS A;  1HF8 A;  5CFB A;  4P0B A;  2L9Q A;  2W62 A;  3OYZ A;  2WY2 A;  3JC6 C;  4KHZ F;  3EUS A;  4EQZ A;  5JDL A;  3PDY A;  4KP3 C;  4MAL A;  2PUC A;  4JBW F;  1OXZ A;  2NTY A;  2FJE A;  2V6X A;  1ZZB A;  1PRA A;  4ER5 A;  1QQA A;  2NTX A;  4QXC B;  4HE8 A;  5HXS A;  1T98 A;  2BDE A;  3RIF A;  4JI5 T;  2NOX A;  1IC8 A;  2WZI A;  3PUV F;  4IL9 A;  4O4L E;  5A1L A;  5ABG A;  1N32 T;  2IUB A;  4HWH A;  2VK9 A;  2XCJ A;  2X9H A;  5L4E A;  2Y48 B;  4P0A A;  4B3T T;  2HPL A;  3MZK B;  3R6N A;  4X4B A;  4JV5 T;  3A9Z A;  5GON E;  4JUY A;  3G06 A;  3LK3 B;  4ZZB A;  4O8S A;  3V5S A;  2A9U A;  2WSS V;  4DV7 T;  4TUY E;  1I94 T;  3AA7 B;  2D9D A;  3SX0 A;  3H3M A;  4JI8 T;  3PE0 A;  4UXN B;  3LIS A;  4EOZ B;  1KK7 A;  2CBI A;  2CHN A;  1PER L;  4ZEY A;  4EZH A;  3PE5 A;  4H9R C;  4TV9 E;  2HN2 A;  3GBF A;  1JNR A;  2EF8 A;  4ANJ A;  1DWK A;  4PU4 C;  4DND A;  2BS4 A;  2WP9 A;  2LYS A;  4PU3 C;  5AQK B;  3QUJ A;  1WCR A;  2V7L A;  4CXY A;  5CA1 E;  4DMW A;  4X4H A;  4PJM A;  4DV6 T;  1Y9Q A;  4IDN A;  4GKJ T;  5ETW A;  3FBL A;  1IBL T;  4IT4 A;  2LKH A;  5HXR A;  4TWD A;  1QP4 A;  3CEC A;  2BKP A;  2XUE A;  2YOE A;  4CN4 A;  2JJ9 A;  4TZ4 C;  3PUQ A;  3AE4 A;  3PUS A;  2B76 A;  4PFP A;  1R63 A;  2FJA A;  2M6B A;  2A3D A;  4QWN B;  2CM0 A;  5AQN B;  3IHR A;  2EBY A;  4C91 A;  4QXH B;  3WAJ A;  4O4J E;  3RQW A;  4ZI2 C;  1KNZ A;  3HZI B;  3CML A;  4DR6 T;  3G5G A;  2MOZ A;  4HWD A;  4IA8 A;  4CZZ B;  1ZEE A;  2LT3 A;  2M4H A;  3F6W A;  5LYJ E;  2XJ7 A;  2UXC T;  2IDO B;  4TNV A;  3UTK A;  3MXZ A;  2LNM A;  2H88 A;  5C8Y E;  5FL1 A;  2E5L T;  3NRX A;  1AU7 A;  5JVD E;  3QFI A;  3ZN0 B;  4IGU A;  2XSD C;  5EZY E;  5JDN A;  5HEU A;  3RIU C;  3AEE A;  3FZM B;  3P7I A;  3AVS A;  4DBR A;  5FY1 A;  1NEQ A;  2DWG A;  5C2T A;  3CIR A;  2CWY A;  5M4Y A;  1D1A A;  2VKJ A;  4IE5 A;  3K3N A;  5HYA A;  5L3E B;  2EHO C;  4DMV A;  2J62 A;  4AI6 A;  2KPJ A;  3UU3 A;  1XWR A;  2M6I A;  5FMN A;  1PRV A;  1ZP0 A;  2Q9Q A;  5LCY A;  3PJA J;  3ZHI A;  3N9L A;  3S8Q A;  3PXP A;  1UUR A;  3MK7 C;  4FN3 A;  4IVZ A;  3WI3 A;  3FZK B;  4JI4 T;  2DHR A;  4QH1 A;  1IZN B;  3UT5 E;  2LYK A;  3A9X A;  4FJO A;  4DR2 T;  2WB5 A;  4JCX A;  3BS3 A;  4EEB A;  2CXF A;  1POU A;  2VWA A;  2D5V A;  3EI0 A;  2HHH T;  3O1H A;  2CRO A;  2XQ7 A;  4JI3 T;  2KXP B;  4HFH A;  1HS7 A;  4IHJ E;  1QZX A;  3AXJ A;  2QYW A;  1MFQ C;  4OX9 T;  4YXD A;  2W2U A;  3RRC A;  1QP0 A;  5LGN B;  4NPP A;  4PU7 A;  3Q2M A;  3M9L A;  2R6G F;  4ZHQ E;  4IE6 A;  4GYS A;  3TEL A;  4U31 A;  3ZEF B;  4PW8 A;  3ABV A;  3HI2 A;  5AQV B;  2XJ3 A;  3RQU A;  2XQ3 A;  2XAH B;  2IHR 1;  2JMH A;  2KSR A;  3ZT5 A;  1CQT A;  1MIV A;  2F4V T;  5ADX L;  2J47 A;  3HA4 A;  3U3W A;  2GK9 A;  5KDM C;  4YLH A;  3MLF A;  1OWA A;  3AE5 A;  1RPE L;  2VUR A;  2W61 A;  2Q9Q D;  5J0Z A;  2O4A A;  2KEI A;  3M3Z B;  2PXP A;  4LF9 T;  1BDI A;  2VL8 A;  5L3G B;  2X0Y A;  4FBI A;  4TX5 A;  5LXT E;  5DSX A;  2OFY A;  2RA1 A;  3KXA A;  4YG7 B;  4YAR A;  1MMD A;  3CX7 B;  3F52 A;  4I4T E;  1U4Q A;  2Z6E A;  2N2N A;  4LFA T;  4KI0 F;  3C64 A;  2MEZ A;  4EYY R;  2JCG A;  3BQL A;  1UUS A;  2C0S A;  1KF6 A;  4NDW A;  1L0V A;  3ZCJ A;  1JH9 A;  4EYU A;  5AQO B;  1T72 A;  3ZKC A;  4OB4 A;  1NWM X;  4X20 E;  1W9R A;  2WMN A;  3GMI A;  2HCS A;  2CLY B;  2JQE A;  3B13 A;  4JCY A;  3ETU A;  2ZM8 A;  2WDQ A;  4IE7 A;  1FJG T;  4Z5C A;  3GZD A;  1B0N A;  4ER6 A;  3P4W A;  1D1B A;  4H9P C;  4WNK A;  5HXC A;  3KBT A;  4CI1 B;  1YKE B;  2CE7 A;  4X4C A;  4WW0 A;  5LBM A;  3U3I A;  4E7S A;  5LB7 B;  4HGA A;  3ZJ2 A;  1KEY A;  1JWL A;  2VL0 A;  2LYP A;  2VVN A;  2DI4 A;  1R69 A;  3RZZ A;  4I0U A;  1V9D A;  1D0Y A;  3RIU A;  1EZ3 A;  3EVY A;  2XXP A;  4DO0 A;  1U2Z A;  2PUF A;  3JXD L;  3T1Y T;  1N33 T;  4QKN A;  2LEH A;  1WFD A;  5JTG A;  1NAF A;  5IHY A;  1WYC A;  3K3O A;  3LQX A;  3HKD E;  1G73 A;  5FY7 A;  4DR7 T;  5JR9 C;  3P4P A;  2X9Y A;  4C90 A;  3ZHM A;  5HWX A;  2LRL A;  3GWH A;  4IE0 A;  5LJN A;  2YKS A;  1X57 A;  2XTL A;  2D5U A;  2IML A;  4U7I A;  4F6R C;  3L8R A;  3Q5W A;  4CN1 A;  3DTO A;  5IUX A;  4ISS A;  4COF A;  1NER A;  3QK6 A;  5AQQ B;  2L8N A;  4Q2J A;  2NW8 A;  4GK0 E;  5IWA T;  2CA5 A;  4Z5D A;  3IA3 A;  2WQY A;  3RKO A;  3PUR A;  3LSV A;  5FXX A;  4AKI A;  4O8B A;  3SRZ A;  3MEJ A;  2KLQ A;  3HKE E;  2N1G A;  1QLB A;  2KND A;  1N34 T;  4DV4 T;  3NRY A;  3E0Z A;  5EK4 A;  1FMW A;  1ADR A;  4JI0 T;  1HCI A;  3OVU A;  2K9A A;  2X9W A;  3KZ3 A;  2NR4 A;  3ONX A;  2DLR A;  1SQ8 A;  4HWF A;  4Z91 A;  3NVO A;  5DTM A;  3TLV A;  3AEA A;  4HFI A;  4ZS2 A;  3K1S A;  5CB4 E;  3JAE A;  1SHZ C;  5L47 A;  5H6R B;  2WUS R;  4ER7 A;  2BG9 E;  3ZPX A;  2HCN A;  2WU5 A;  4DV0 T;  2Q9Q C;  2XZE A;  2LSK A;  2YBD A;  3KL4 A;  2CEA A;  2OLT A;  1OED B;  3AAA B;  2HSG A;  5FXZ A;  5FVL A;  3AAI A;  2E9X C;  3PU8 A;  4NUU A;  4AIS A;  2PXE A;  4IDZ A;  5DT2 A;  4Z5H A;  1HTJ F;  3LFM A;  3LK2 B;  2MBG A;  4IL4 A;  4AQY T;  3OTO T;  5L4H A;  3R1F A;  2LRK A;  5K98 B;  1HX1 B;  1LRZ A;  2CSF A;  4HFV A;  3AEC A;  4DR5 T;  1Y01 A;  1MMN A;  1NW3 A;  1ZZ7 A;  2UUB T;  3QB5 K;  3AE8 A;  2XHE B;  2LCV A;  5DAB A;  3RLF F;  4NXN T;  2B5A A;  4ZZC A;  5E0O A;  5HEO A;  1J1J A;  1HR0 T;  5L3B B;  4YHH T;  3VR9 A;  1ZZ6 A;  3KV5 A;  4JYA T;  2PIJ A;  4U2Z A;  3C4W A;  4YSY A;  2BKN A;  3U78 A;  3PUW F;  5LNK A;  3UU5 A;  3Q5D A;  1D0X A;  3ZT6 A;  3HL6 A;  5BMV E;  5JRC B;  3OKZ A;  2DWK A;  5LHH B;  1DU2 A;  1KNP A;  2V5D A;  3RH3 A;  4YHJ A;  1BR4 A;  3Q5X A;  5KMG P;  5F3J A;  1EFA A;  2CHO A;  5AQI B;  3KV9 A;  4EED A;  4JI6 T;  5KX5 E;  4KMC A;  4MFR A;  4BA9 A;  4UR9 A;  3N2O A;  3AA0 B;  2ICP A;  1HNX T;  4DR1 T;  5JDQ A;  3ETV A;  4DE8 A;  2VAS A;  1HG2 A;  3K3Q C;  1PNR A;  2BG9 C;  1LVK A;  3FB2 A;  4YJ3 E;  5KXJ A;  3AEB A;  5EK2 A;  4LMJ A;  5LJM A;  4IDQ A;  3I0Q A;  1UX4 A;  1YD8 G;  1JNZ A;  2OR1 L;  3E22 E;  3RIA A;  4CXX A;  5JR9 A;  2W63 A;  1XMO T;  2EHO B;  1T8B A;  2J7U A;  2JRK A;  5LP6 E;  2ODU A;  1JFT A;  2XSB A;  2L49 A;  3VR8 A;  4ZI3 D;  2BZB A;  3LBX B;  1WH6 A;  4I8T A;  2YU2 A;  3TEP A;  2ZM2 A;  5DRT A;  5HEJ A;  2XAF B;  1KFY A;  3KJX A;  4XAX B;  5FVK A;  4LF7 T;  1WYB A;  1O3X A;  2AXZ A;  2XQ9 A;  3ZST A;  2VKD A;  3AAE B;  4XZC A;  4X1K E;  4A5X A;  4IDP A;  3ZMU B;  4ILB A;  3QQ6 A;  3PUG A;  5ABE A;  1FEW A;  3OPC A;  1MMA A;  5AQT B;  3GZD C;  2KT9 A;  2JPF A;  5DRY A;  3D0T A;  4M1P A;  1WIZ A;  4X65 T;  2LYL A;  3F51 A;  2LYJ A;  4YT0 A;  3P4Q A;  3PUA A;  3ZCI A;  3T1H T;  2WCA A;  3RYF E;  1Y64 B;  2XPK A;  5HCJ A;  2W0G A;  2A2F X;  1OCT C;  2PE5 A;  4A98 A;  2XAQ B;  3EUH A;  3RYC E;  3QF3 A;  4NUV A;  3L39 A;  4WVL A;  4X62 T;  5FYM A;  1OSL A;  5FNV E;  2XXQ A;  4YJ2 E;  4AQG A;  1DUL A;  3NZP A;  5LHG B;  3HKB E;  1MIY A;  4X1I E;  2HPJ A;  4OYJ A;  2QVA A;  2FBW A;  4HKA A;  2UXB T;  1WH8 A;  2XAS B;  2LYR A;  4IE4 A;  3CVR A;  2E9X A;  4AKR B;  5CGM A;  3RRW A;  2XQ5 A;  3PUY F;  3QOW A;  5AQS B;  1G8X A;  1HF0 A;  2AXU A;  2LE8 A;  4P1N A;  4DVD A;  3RPU A;  4H9Q C;  4EIW A;  2UXD T;  1MND A;  3LG7 A;  4K0K T;  2JIW A;  3V5U A;  2VEO A;  3TLW A;  4Z90 A;  2PXV A;  1WLX A;  5DQV A;  4EKG A;  3AED A;  3AEF A;  2I59 A;  3MA9 A;  4AQF A;  2PUE A;  2BKO A;  3I0O A;  3ZKR A;  3VKG A;  2PUD A;  4ILA A;  3ONJ A;  1Z0P A;  4UF0 A;  2CBJ A;  4DR4 T;  1AJ3 A;  5FKY A;  1ZZ9 A;  2PXQ A;  1HX8 A;  3KDS E;  5BR8 T;  3CQG B;  3CX8 B;  3A5X A;  3LJC A;  3RGL A;  2WBL A;  3GN5 A;  1XWM A;  2PXL A;  2DCF A;  2W4X A;  4U72 A;  1W0A A;  3FXD B;  1VRB A;  3H37 A;  4I43 B;  2YIN A;  3SWH A;  2W00 A;  2BG9 A;  5AQF B;  3EDV A;  2UU9 T;  3GZC A;  4AKL A;  3EHZ A;  5HEG A;  2IUO A;  4PK4 A;  4ZI3 C;  2KIN B;  2XAG B;  3M65 A;  4L0R A;  1OED A;  2V6Y B;  1YQ4 A;  2E9X D;  5AQP B;  2V7I A;  3ANW A;  4X66 T;  4UVC B;  1LLI A;  2GRL A;  4B3R T;  3QNU A;  4UV8 B;  5GAH i;  1LKX A;  2PPX A;  3O1J A;  3UQ7 A;  3A9Y A;  1HNW T;  4QHO A;  2NW9 A;  2D2S A;  3RYH E;  2J7W A;  4YG1 A;  1VCT A;  1CJG A;  4UVB B;  5JUW A;  2K5B B;  2PXB A;  2E5V A;  1YW0 A;  4X4D A;  1M7K A;  2QRX A;  2LOP A;  2PBI A;  3B57 A;  2CXL A;  4IST A;  2W67 A;  2VB6 A;  3Q9D A;  4UV9 B;  3KVB A;  1YSE A;  4PJJ A;  2FUP A;  1MNE A;  2AWI A;  4HRA A;  1UCU A;  3N9Q A;  3DP7 A;  2LKG A;  3MJX A;  3CQC B;  2FJB A;  3EAM A;  5L3D B;  1YKH B;  3RHW A;  1BR0 A;  3TRB A;  2XQY A;  3ZMV B;  4PFO A;  1ZOY A;  3G7D A;  3AE3 A;  5TAO A;  5GAG i;  1UTX A;  2KZ8 A;  2WAU A;  2LSJ A;  3AE7 A;  5HEH A;  4I6T A;  2H3R A;  2PTF A;  3QWG A;  3AA6 B;  4E7Z A;  1LCC A;  2XQ4 A;  4EGW A;  1QSD A;  2J1D G;  2BVL A;  4PK5 A;  2CMR A;  4CI2 B;  4YBA A;  3QB5 A;  2MXD A;  5HCM A;  3RKG A;  2SPC A;  2Q9Q B;  1D0Z A;  3L09 A;  2ZMA A;  3L1P A;  2IAK A;  4PAG A;  1HG5 A;  3C51 A;  3LFP A;  2YEV C;  3FYM A;  2AE9 A;  4UVA B;  4G63 A;  3AVR A;  3GUU A;  1FMV A;  1M62 A;  3JAD A;  2YK0 A;  5ABF B;  4J2C A;  5J1G A;  2WMO A;  4WZX A;  2JQK A;  2X51 A;  3B5M A;  1U5P A;  4HFB A;  4LF4 T;  2A6C A;  4L5G A;  1NEN A;  2VKO A;  5C3J A;  4PJN A;  4Q25 A;  4I6R A;  4LF6 T;  5LMU T;  3PJA A;  2XY8 B;  5DQW A;  4EZ4 A;  2PXU A;  3UU4 A;  4O4I E;  4AKG A;  3FXE B;  4CI3 B;  2I0M A;  4O4H E;  2VKH A;  2PXK A;  5AQM B;  4IIJ E;  1LQC A;  3AXJ B;  3NZL A;  3UUM A;  5IYZ E;  4Y42 A;  4I6U A;  3DM5 A;  5DJQ C;  2CLY C;  2X0H A;  3BQK A;  4ER0 A;  2IIU A;  1XNR T;  2K24 A;  3C98 B;  4WBN E;  1E2A A;  3SCF A;  2D0U A;  3C4X A;  2X66 A;  3C4Z A;  3ZYL A;  5JRE A;  5CA0 E;  4EKI A;  4GHJ A;  1GQE A;  1MIW A;  5LA6 E;  4HFC A;  1T7S A;  4MHC A;  2ZLY A;  2FJD A;  3P4S A;  5AQL B;  2R1J L;  5FP3 A;  5EK3 A;  4TN7 B;  3ZYK A;  4ERR A;  3OBV E;  1HQ1 A;  2X0L B;  1QB2 A;  4BJN A;  4WYV A;  3ZMT B;  3VK0 A;  2XM2 A;  4X64 T;  3FBZ A;  1OED E;  2MYS A;  4X4I A;  2XQ6 A;  4O2A E;  1ZV4 X;  2H89 A;  2KZ7 B;  4Z58 A;  2P9B A;  2DL1 A;  4MCX A;  3N9P A;  3RI5 A;  3QC9 A;  3VU7 H;  3ZMS B;  2KEK A;  2E2A A;  3QOF A;  4HN9 A;  3KBU A;  4DR3 T;  4CN6 A;  2PXT A;  3DNV B;  2NW7 A;  2QA7 A;  3CX6 B;  1E3O C;  2L1P A;  5FXV A;  1B7T A;  2IC9 A;  3N2K E;  2HFZ A;  2YDR A;  3ME5 A;  4ILU A;  2V7J A;  3PTR B;  4TWF A;  4H9O C;  2I6H A;  4AKH A;  5A7L A;  1VCS A;  3F31 A;  4UIG A;  3BK9 A;  2OV9 A;  5CJ5 A;  1UK5 A;  4HEA A;  1XZY A;  4DUZ T;  4AQF C;  3O4X E;  2XXA A;  1X2L A;  2HIN A;  2WM9 A;  4HTE A;  4PJL A;  4DV2 T;  1JFS A;  4QX7 B;  1WET A;  4O2B E;  2BVM A;  2BNO A;  2G0U A;  2C5K T;  3VWS A;  1US7 B;  3ZJ1 A;  2V1D B;  4IWR A;  2IV1 A;  1YXR A;  3NXH A;  4ER3 A;  4EV6 A;  4B3M T;  3JCF A;  1ZS4 A;  2V8S V;  2YDQ A;  4CQI A;  2PJQ A;  2PUB A;  3N5L A;  3F57 A;  4DV1 T;  3HR0 A;  5JDF A;  3EAB A;  3L3P A;  4ZI7 E;  3QOX A;  5FXW A;  3VKH A;  3KVA A;  4X5T A;  1R8I A;  3UUN A;  1RZR A;  2IU7 A;  1QPZ A;  3KIN B;  1ZHC A;  4QH4 A;  4G2A A;  3LDQ B;  1E1H B;  1IJ6 A;  2YN6 A;  1SUM B;  3UQ4 A;  1ZAY A;  1OED C; 
#chains in the Genus database with same CATH homology
 4EYU A;  1HF0 A;  2LYQ A;  3ZKC A;  2AXU A;  1BR1 A;  2DNX A;  4OB4 A;  3P8C D;  3SS1 A;  2LE8 A;  3RC8 A;  1NWM X;  1WRD A;  4X20 E;  4MCT A;  3GN5 B;  3I1A A;  2PFV A;  3QYX A;  2X68 A;  4DVD A;  2MTQ A;  2WMN A;  4ASK A;  3GMI A;  3E08 A;  3IF8 B;  4H9Q C;  3RPU A;  1MND A;  4EIW A;  2V7K A;  3LG7 A;  1BDH A;  3V5U A;  2BNN A;  2CLY B;  4FI5 A;  3B13 A;  4JCY A;  3ETU A;  2ZM8 A;  4IE7 A;  5L2L A;  1UXD A;  4Z5C A;  3UFE A;  1B0N A;  3BD1 A;  1D1B A;  4H9P C;  4WNK A;  1WLX A;  2L8K A;  5DQV A;  3KBT A;  5HXC A;  4CI1 B;  5J2U E;  3C50 A;  1YKE B;  2CE7 A;  4X4C A;  2ES0 A;  3BDN A;  4V1A v;  4WW0 A;  4Z8X A;  1SA0 E;  1IAP A;  5LBM A;  4DBQ A;  1VOM A;  3KV6 A;  3AB3 B;  3U3I A;  2UXX B;  2I59 A;  3MA9 A;  4E7S A;  5LXT E;  2C5I T;  4HGA A;  3ZJ2 A;  4AQF A;  2K48 A;  2LHN A;  2PUE A;  3KV4 A;  1JWL A;  3I9W A;  2LYP A;  4I50 E;  3OQO A;  3I0O A;  1MMG A;  2PG8 A;  3VKG A;  2FJR A;  2DI4 A;  1R69 A;  3RZZ A;  2PUD A;  1V9D A;  3ANW B;  3UUL A;  3RYI E;  1D0Y A;  1X79 A;  3CPZ A;  5L3C B;  4KUM B;  1EZ3 A;  3LK4 2;  3EVY A;  2EHO D;  3ZYM A;  1Z0P A;  2AW6 A;  4P09 A;  3DJB A;  4DO0 A;  4X4F A;  2PUF A;  3JXD L;  4UF0 A;  4YFS A;  1S7E A;  4QKN A;  1AJ3 A;  2LEH A;  3EDU A;  1ZZ9 A;  5FY0 A;  2LHR A;  1HX8 A;  4Z59 A;  3FMY A;  1NAF A;  3KDS E;  3OYX A;  5IHY A;  1WYC A;  3K3O A;  3HKD E;  2H7O A;  1G73 A;  5FY7 A;  5JR9 C;  3CQG B;  3CX8 B;  4OFZ A;  3D1N I;  2X9Y A;  5LOV E;  2LOS A;  3A5X A;  1HF8 A;  3ZHM A;  3LJC A;  2BJC A;  2L9Q A;  2W62 A;  3OYZ A;  3JC6 C;  4P0B A;  3EUS A;  5HWX A;  2WBL A;  5JDL A;  3GN5 A;  3PDY A;  2ICT A;  2DCF A;  3GWH A;  4IE0 A;  4KP3 C;  4MAL A;  5LJN A;  2V26 A;  1X57 A;  2XTL A;  3GA8 A;  4U72 A;  3FXD B;  2D5U A;  4MBQ A;  3J7Y q;  1VRB A;  3H37 A;  4I43 B;  2PUC A;  2YIN A;  1OXZ A;  3SWH A;  4F6R C;  2W00 A;  2GZU A;  3SOL A;  2NTY A;  3EDV A;  3H5T A;  4AKL A;  3RX6 A;  1RZS A;  1ZZB A;  1PRA A;  3Q5W A;  1QQA A;  2NTX A;  2IUO A;  4HE8 A;  4MLK A;  4QXC B;  4PK4 A;  4ZI3 C;  5HXS A;  1T98 A;  2BDE A;  4OYK A;  2KIN B;  3DTO A;  2LM9 A;  4ISS A;  5LBQ B;  2L3L A;  2NOX A;  1NER A;  1IC8 A;  2XAG B;  3QK6 A;  2L8N A;  2NW8 A;  3M65 A;  4GK0 E;  4L0R A;  4O4L E;  5A1L A;  3NZQ A;  1RZR D;  4EAH A;  3OMT A;  4Z5D A;  2CA5 A;  2E9X D;  2V7I A;  3ANW A;  1BR2 A;  4EXT A;  2VK9 A;  4UVC B;  3RKO A;  3PUR A;  1LLI A;  2GRL A;  4GOU A;  4WBO A;  4H63 V;  4UEM A;  4UV8 B;  1ZVV A;  1LKX A;  2XCJ A;  2X9H A;  2PPX A;  5FXX A;  3HKC E;  3O1J A;  4J1X A;  4H9S E;  4QX8 B;  2Y48 B;  4AKI A;  4O8B A;  1H7C A;  3J9X 1;  3SRZ A;  4ZS3 A;  2KLQ A;  4P0A A;  4JLE A;  3HKE E;  2HPL A;  2N1G A;  3MZK B;  3R6N A;  4X4B A;  1S35 A;  3ZN1 B;  5GON E;  4JUY A;  3LK3 B;  4GIW A;  3T8O A;  2KND A;  4QHO A;  2NW9 A;  4O8S A;  3V5S A;  3NRY A;  3E0Z A;  4ZOL E;  2WSS V;  3N9O A;  5EK4 A;  1LVF A;  2D2S A;  1FMW A;  3RYH E;  4TUY E;  3AA7 B;  4UEL A;  3PU3 A;  4YG1 A;  1ADR A;  2ACX A;  1HCI A;  2K9A A;  2X9W A;  3KZ3 A;  3ONX A;  3PE0 A;  4UXN B;  3LIS A;  4EOZ B;  4XBF B;  1KK7 A;  2DLR A;  2IVQ A;  1SQ8 A;  1ZPQ A;  1CJG A;  1PER L;  3B7H A;  2KEJ A;  4UVB B;  2K5B B;  5LGU B;  4EZH A;  2CCQ A;  2GRM A;  4JEU B;  4H9R C;  4TV9 E;  3GBF A;  3OJA A;  2EF8 A;  1YW0 A;  4ZS2 A;  4ANJ A;  5CB4 E;  3W15 B;  4X4D A;  1DWK A;  4PU4 C;  1HFA A;  4PK6 A;  4DND A;  3CWZ B;  2LOP A;  2PBI A;  3B57 A;  2LYS A;  4PU3 C;  3QUJ A;  3OQM A;  1SHZ C;  2V7L A;  4CXY A;  3SCG A;  2CXL A;  2EWT A;  5CA1 E;  4IST A;  5H6R B;  2WUS R;  4DMW A;  4X4H A;  4PJM A;  5LG4 A;  1Y9Q A;  2VB6 A;  3Q9D A;  4UV9 B;  3KVB A;  4X4E A;  1O4X A;  1YSE A;  4PJJ A;  3H3A A;  5ETW A;  3O9X A;  1UXC A;  3FBL A;  1MNE A;  2AWI A;  1UCU A;  3TKL B;  3N9Q A;  2Q9Q C;  2LSK A;  2CEA A;  3AAA B;  3DP7 A;  2HSG A;  5HXR A;  3MJX A;  2A72 A;  1QP4 A;  3CEC A;  5FXZ A;  3CQC B;  2XUE A;  5L3D B;  5JQG E;  3AAI A;  1YKH B;  2E9X C;  2JJ9 A;  2RP4 A;  3TRB A;  3PU8 A;  2XQY A;  3PUQ A;  3OP9 A;  4NUU A;  4PFO A;  2Y8D A;  4TZ4 C;  3ZMV B;  3PUS A;  3G7D A;  4IDZ A;  4PFP A;  1R63 A;  4Z5H A;  1HTJ F;  3N9M A;  2KZ8 A;  1UTX A;  5TAO A;  2XAJ B;  2WAU A;  2A3D A;  3LFM A;  3LK2 B;  4QWN B;  4K0U A;  4PU8 A;  2CM0 A;  2LSJ A;  2EBY A;  3IHR A;  2N9D A;  4I6T A;  1GT0 C;  3IVP A;  2H3R A;  3QWG A;  3AA6 B;  4C91 A;  4E7Z A;  1LCC A;  3R1F A;  2QGS A;  4QXH B;  2O49 A;  2ZM0 A;  5K98 B;  1QSD A;  1S94 A;  3WAJ A;  4O4J E;  1LRZ A;  2J1D G;  2BVL A;  2CSF A;  2CMR A;  2KWI B;  4PK5 A;  4ZI2 C;  1KNZ A;  4HFV A;  3HZI B;  3R84 B;  4CI2 B;  4YBA A;  3CML A;  3G5G A;  5F8P A;  2MOZ A;  5JDG A;  4GK5 E;  2SPC A;  4IA8 A;  1MMN A;  2Q9Q B;  1D0Z A;  4CZZ B;  3L09 A;  1ZEE A;  2ZMA A;  3IBP A;  2LT3 A;  3L1P A;  3F6W A;  2IW5 B;  1ZZ7 A;  2IAK A;  2X67 A;  4PAG A;  5LYJ E;  4JQD A;  2XHE B;  2MQK A;  2AXV A;  3CRO L;  3LFP A;  1HG5 A;  3C51 A;  5H6Q B;  2LCV A;  2YEV C;  3ZC0 A;  2R63 A;  3FYM A;  4UVA B;  5DAB A;  2B5A A;  4G63 A;  3AVR A;  1FMV A;  4U74 A;  2YK0 A;  3UTK A;  3MXZ A;  4J2C A;  5J1G A;  3ZC1 A;  4L9I A;  4EB6 E;  2WMO A;  5C8Y E;  5E0O A;  2LSG A;  1ZKE A;  3NRX A;  2O38 A;  1AU7 A;  1PRU A;  5L3B B;  2X51 A;  3MAC A;  5JVD E;  1U5P A;  3ZN0 B;  4IGU A;  5JR9 B;  2XSD C;  2WIU B;  1ZZ6 A;  2CWO A;  3KV5 A;  2PIJ A;  1IJ5 A;  5L3F B;  3C4W A;  5EZY E;  2A6C A;  5JDN A;  4AXP A;  1FIO A;  2VKO A;  3FHN A;  4L5G A;  1UX5 A;  4PJN A;  3P7I A;  4I6R A;  3U78 A;  3AVS A;  5LNK A;  3WAK A;  5AFU L;  4DBR A;  5DQW A;  5FY1 A;  5LGT B;  4EZ4 A;  3IEE A;  1NEQ A;  1D0X A;  3HL6 A;  5BMV E;  5JRC B;  2PUA A;  2DWG A;  3JXB C;  2DWK A;  5LHH B;  2CWY A;  5M4Y A;  4O4I E;  4AKG A;  4C90 A;  1D1A A;  3FXE B;  3RH3 A;  4YHJ A;  1BR4 A;  3Q5X A;  5J2T E;  4CI3 B;  5KMG P;  2VKJ A;  4IE5 A;  1EFA A;  4O4H E;  2VKH A;  3UUX B;  5F3J A;  3K3N A;  5HYA A;  3KV9 A;  1ZZC A;  5L3E B;  2EHO C;  4IIJ E;  5KX5 E;  4KMC A;  1LQC A;  4MFR A;  4BA9 A;  3N2O A;  3AA0 B;  4J1W A;  4F8D A;  4YG4 A;  4DMV A;  4GQM A;  2LSY A;  3UUM A;  5IYZ E;  4Y42 A;  4I6U A;  2ICP A;  3NBX X;  4AI6 A;  2KPJ A;  2V7M A;  4PNI A;  5DJQ C;  2CLY C;  5JDQ A;  2NWB A;  1XWR A;  3BQK A;  3ESL A;  5FMN A;  1PRV A;  2Q9Q A;  3ETV A;  2VAS A;  2M67 A;  2MBG A;  5LCY A;  3RC3 A;  1HG2 A;  3K3Q C;  3AA1 B;  3N9N A;  3ZHI A;  1PNR A;  1LVK A;  2K24 A;  1ZZ8 A;  3S8Q A;  2HH7 A;  3C98 B;  3FB2 A;  3N9L A;  4OK0 A;  4YJ3 E;  3PXP A;  3MK7 C;  4FN3 A;  2JVL A;  4WBN E;  3UFD A;  4IVZ A;  3JC6 D;  3WI3 A;  3SCF A;  1LCD A;  2D0U A;  3C4X A;  2X66 A;  2DHR A;  3C4Z A;  5EK2 A;  3ZYL A;  1IZN B;  5LJM A;  5CA0 E;  3UT5 E;  5JRE A;  3I0Q A;  1UX4 A;  3SCH A;  2C5J A;  1YD8 G;  5LHI B;  2OR1 L;  2LYK A;  4FJO A;  1QP7 A;  3O1I A;  4GHJ A;  3E22 E;  1MIW A;  4CXX A;  4ADZ A;  3N2G E;  4X4G A;  5LA6 E;  4JCX A;  4MHC A;  5JR9 A;  2W63 A;  4B6X A;  2EHO B;  2ZLY A;  3BS3 A;  2JRK A;  2R1J L;  5FP3 A;  5LP6 E;  2ODU A;  1JFT A;  4TN7 B;  5EK3 A;  2L49 A;  3ZYK A;  3BQI A;  4ERR A;  4ZI3 D;  2CXF A;  3OBV E;  5JH7 E;  1BR0 A;  2BZB A;  3LBX B;  1WH6 A;  4I8T A;  4CXW A;  2YU2 A;  1POU A;  2VWA A;  2X0L B;  5JRC A;  4BJN A;  4N78 D;  2D5V A;  4BAY B;  3ZMT B;  3O1H A;  3VK0 A;  1QQB A;  2H7V C;  2ZM2 A;  2CRO A;  1CUN A;  3FBZ A;  5JDM A;  2KXP B;  2XAF B;  2MYS A;  1HS7 A;  4IHJ E;  4X4I A;  3KJX A;  4XAX B;  4O2A E;  1ZV4 X;  1WYB A;  2IVB A;  2KZ7 B;  4Z58 A;  2B1E A;  2P9B A;  1O3X A;  2AXZ A;  2JMK A;  4MCX A;  1RIO A;  3N9P A;  2VKD A;  3QC9 A;  3VU7 H;  3ZMS B;  3RRC A;  2KEK A;  2IVG A;  1QP0 A;  5LGN B;  3ZPO A;  2OA5 A;  3AAE B;  4HN9 A;  3KBU A;  4X1K E;  4KBM B;  4XZC A;  3DNV B;  2NW7 A;  4PU7 A;  2QA7 A;  1VPW A;  3Q2M A;  3CX6 B;  3ZLI A;  3OQN A;  1L1M A;  1E3O C;  3ZMU B;  1QUU A;  5FXV A;  1LMB 3;  1B7T A;  2IC9 A;  4ZHQ E;  4IE6 A;  3N2K E;  4GYS A;  4QXB B;  5HWY A;  3QQ6 A;  3PUG A;  2KWH A;  1FEW A;  3ZEF B;  3S4U A;  3I9Y A;  4ILU A;  4PW8 A;  2V7J A;  3PTR B;  1MMA A;  2X9X A;  3HI2 A;  4H9O C;  2XJ3 A;  4AKH A;  2KT9 A;  2JPF A;  3K8P C;  5A7L A;  2IC6 A;  3F31 A;  2XAH B;  2E9X B;  4X1Y E;  3OKQ A;  2JMH A;  4UIG A;  3BK9 A;  2JQQ A;  3D0T A;  1CQT A;  4HEA A;  4M1P A;  1WIZ A;  1ZUG A;  1MIV A;  2EHO A;  2LYL A;  4TV8 E;  4AQF C;  3F51 A;  3O4X E;  5ADX L;  2LYJ A;  1X2L A;  1Y7Y A;  3VHL A;  3PUA A;  2HIN A;  1WR6 A;  3ZCI A;  2WM9 A;  3HA4 A;  3U3W A;  4HTE A;  2H8R A;  4PJL A;  3LBX A;  2GK9 A;  2ODV A;  3RYF E;  1Y64 B;  5KDM C;  1DW9 A;  1JFS A;  3CQX C;  2W0G A;  4QX7 B;  2A2F X;  1WET A;  4O2B E;  4YLH A;  3MLF A;  3ZMZ B;  2BVM A;  2BNO A;  1OCT C;  2C5K T;  2G0U A;  1US7 B;  2E8I A;  1OWA A;  1RPE L;  2PE5 A;  2W61 A;  3ZJ1 A;  2V1D B;  4IWR A;  2IV1 A;  1D1C A;  2XAQ B;  2KMF A;  3EUH A;  2XIU A;  2Q9Q D;  3RYC E;  2BNM A;  2PUG A;  3QF3 A;  4NUV A;  3FYA A;  4OHF A;  2O4A A;  1ZS4 A;  2KEI A;  5FYM A;  1BDI A;  2VL8 A;  1OSL A;  2LSI A;  5L3G B;  4A56 A;  2YU1 A;  5JDH A;  5FNV E;  4FBI A;  2PJQ A;  4TX5 A;  4CQI A;  2PUB A;  2OFY A;  2WWU A;  3N5L A;  5HXH A;  2RA1 A;  3F57 A;  4YJ2 E;  3KXA A;  3CKD A;  4AQG A;  5LHG B;  4YG7 B;  4YAR A;  3HKB E;  3NZP A;  3HR0 A;  4H9N C;  1MIY A;  4X1I E;  5JDF A;  2HPJ A;  4OYJ A;  3L3P A;  1MMD A;  3CX7 B;  4ZI7 E;  3F52 A;  4GYR A;  4I4T E;  5FXW A;  1U4Q A;  3VKH A;  2Z6E A;  4HKA A;  3KVA A;  3KFW X;  1WH8 A;  5HAX A;  2N2N A;  2D0T A;  3F2E A;  2XAS B;  4BJM A;  5HXE A;  2LYR A;  4IE4 A;  3UUN A;  1RZR A;  2IU7 A;  3CVR A;  2LJL A;  3JXC L;  4UF0 B;  2E9X A;  4ZI2 D;  1QPZ A;  3C64 A;  2MEZ A;  4I55 E;  3KIN B;  1ZHC A;  4JEH B;  2Y6X A;  4AKR B;  4G2A A;  2CXD A;  2AUW A;  4EYY R;  1E1H B;  3RRW A;  1IJ6 A;  2JCG A;  3CLC A;  3BQL A;  2XI8 A;  2C0S A;  4NDW A;  1G8X A;  4H63 H;  2UXN B;  2NP9 A;  3MKD A;  1ZAY A;  3ZCJ A;  1JH9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...