4GQMA

Crystal structure of a helix-turn-helix containing hypothetical protein (ct009) from chlamydia trachomatis in a sub-domain swap conformation
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
105
structure length
105
Chain Sequence
GHMSEHVHKELLHLGEVFRSQREERALSLKDVEAATSIRLSALEAIEAGHLGKLISPVYAQGFMKKYAAFLDMDGDRLLKEHPYVLKIFQEFSDQNMDMLLDLES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a helix-turn-helix containing hypothetical protein (CT009) from Chlamydia trachomatis in a sub-domain swap conformation
rcsb
source organism Chlamydia trachomatis
molecule tags Unknown function
molecule keywords CT009
total genus 43
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2012-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13413 HTH_25 Helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 4gqmA00
2ICPA 3BS3A 2D5VA 4YG7B 4X4BA 4X4EA 4X4IA 4OB4A 3EUSA 3G7DA 2GZUA 3TRBA 1BDHA 2BNOA 2CROA 1Y9QA 2EF8A 2MQKA 4Z5CA 3LFPA 3OQNA 3BDNA 1ZZ7A 3FYMA 3JXBC 1YSEA 1GT0C 1JWLA 1X57A 2L8NA 2BNNA 4GHJA 4O8BA 2LYRA 1RIOA 1LQCA 4IWRA 3ZHIA 3D1NI 1UXCA 4Z5DA 2GRMA 3F6WA 3QF3A 1OSLA 4X4FA 1DW9A 2HINA 2IVGA 2L49A 2O38A 2XIUA 4PU7A 1ZZCA 4JCXA 2O4AA 4YG4A 2AUWA 1E3OC 4PU8A 2BNMA 4IVZA 2PUFA 2AXZA 1B0NA 3ZKCA 2EWTA 3JXDL 1RZRA 1UXDA 3QWGA 2WUSR 4PU3C 1QP7A 2JVLA 3H5TA 4Y42A 1ZAYA 1QPZA 3RZZA 1POUA 2R63A 1ZUGA 3F51A 4F8DA 1LLIA 4IA8A 1RPEL 4JQDA 3FYAA 3CROL 1CJGA 3CECA 2KZ8A 3F52A 2OR1L 2XJ3A 3BD1A 4I8TA 4MCTA 5K98B 2IVQA 4J1XA 1ZS4A 1WIZA 4YBAA 4YG1A 4I6RA 1Y7YA 2AWIA 3QQ6A 1EFAA 2PUGA 3B7HA 3O9XA 2PUEA 5A7LA 2LYJA 3G5GA 2JCGA 1JFSA 3L1PA 2LYPA 1BDIA 2O49A 1LCDA 2GRLA 3GBFA 1WETA 3VK0A 3MLFA 1CQTA 2KEKA 1PERL 1S7EA 2FJRA 1NERA 3GN5B 1QP4A 2IUOA 1NEQA 1JH9A 1R63A 1PRAA 1ZZ8A 3LISA 4X4CA 3GN5A 3R1FA 2BJCA 3KZ3A 2CSFA 3U3WA 2KEIA 2ICTA 2IVBA 1RZRD 4NDWA 2LYQA 1QQBA 2LYLA 2WIUB 1ADRA 1ZPQA 1OCTC 2LYKA 3KJXA 2HSGA 3SCHA 2EBYA 3PXPA 2AW6A 3HZIB 3UFDA 1X2LA 1SQ8A 4MCXA 2XSDC 4Z59A 4JCYA 1PRUA 2XI8A 3IVPA 1ZVVA 1LMB3 1LCCA 2PUAA 2LCVA 3JXCL 3OP9A 1QQAA 1O4XA 1HF0A 2XCJA 4X4HA 1XWRA 1QP0A 4I6UA 4YARA 2IU7A 2IV1A 1DWKA 3OQMA 2R1JL 1L1MA 1JFTA 1PNRA 4Z5HA 1ZZ9A 3OQOA 1WH8A 4PU4C 1UTXA 2PIJA 4I6TA 3FMYA 1ZZBA 2OFYA 1VPWA 4X4GA 2PUDA 3DNVB 1IC8A 4GQMA 2PE5A 1RZSA 3S8QA 2AXVA 3CLCA 4X4DA 4FN3A 1WH6A 4FBIA 2KPJA 2PPXA 1PRVA 2MEZA 4J1WA 2B5AA 3SCGA 4Z58A 1ZZ6A 2PUBA 2PUCA 3ZHMA 2AXUA 3SCFA 1R69A 2A6CA 3KXAA 2KEJA 2LYSA 1AU7A 2H8RA 3OMTA 3QYXA
chains in the Genus database with same CATH superfamily
2ICPA 3UWPA 2D5VA 4YG7B 2GZUA 3PE5A 3M9LA 1RIOA 5DTQA 3D1NI 4Z5DA 4ER5A 4PU7A 1ZZCA 4IVZA 2AXZA 3ZKCA 2EWTA 1ZAYA 1QPZA 1ZUGA 3F51A 2JQEA 4JQDA 3FYAA 3F52A 2LLVA 5JUWA 5K98B 2IVQA 1WIZA 4YBAA 4YG1A 2AWIA 3QQ6A 2JCGA 1JFSA 3L1PA 2LYPA 2O49A 1WETA 3VK0A 2KEKA 1PERL 4WVLA 1S7EA 2FJRA 1QP4A 1NEQA 1R63A 3KZ3A 2CSFA 3U3WA 2IVBA 4NDWA 2LYQA 4ER6A 2LYKA 2AW6A 4MCXA 3GZDC 1LCCA 2PUAA 3R09A 3A9ZA 4X4HA 4I6UA 2VEOA 2IV1A 4Z5HA 2PIJA 1ZZBA 2LNMA 4X4GA 1IC8A 3S8QA 2PXEA 2PPXA 4Z58A 1U2ZA 2PUBA 2PUCA 2H8RA 4X4EA 4OB4A 3G7DA 5GAHi 4EK9A 2BNOA 2MQKA 3OQNA 1ZZ7A 3FYMA 5DTMA 3JXBC 1X57A 2LYRA 1LQCA 3QOWA 4X4FA 2L49A 2IVGA 2O4AA 3GUUA 4PU8A 2BNMA 2PXUA 1RZRA 3JXDL 1UXDA 2L1PA 5GAGi 2PXDA 1POUA 2R63A 1LLIA 3TFLA 4HRAA 2KZ8A 3OKZA 4I8TA 1DULA 1HQ1A 1ZS4A 1Y7YA 3DM5A 2PUGA 3A9YA 1BDIA 1LCDA 2GRLA 3A9XA 5DRTA 3GN5B 2IUOA 4X4CA 1ZZ8A 2BJCA 2ICTA 2LYLA 3QFIA 2HCNA 3NROA 2HSGA 2PXVA 1X2LA 1ZVVA 3IVPA 2PXQA 1LMB3 4ER7A 1QQAA 1XWRA 1NW3A 1DWKA 3OQMA 1L1MA 1ZZ9A 3OQOA 1WH8A 3GZCA 4I6TA 1VPWA 3DNVB 3KL4A 5DSXA 3CLCA 4X4DA 4FN3A 1WH6A 1ZZ6A 2AXUA 3SCFA 4EKIA 3KXAA 4X4IA 3ME5A 2EF8A 3LFPA 3BDNA 1GT0C 1YSEA 3TELA 1JWLA 4GHJA 4O8BA 4IWRA 3ZHIA 3NZLA 3QF3A 1DW9A 1MFQC 2O38A 2XIUA 4JCXA 4Q2JA 2AUWA 1E3OC 5DTRA 2PUFA 3VWSA 2HFZA 3ZPXA 2JVLA 4OBMA 2PXPA 3CECA 2OR1L 4MCTA 2XXQA 4EZIA 4J1XA 2XXAA 4ER3A 5A7LA 3G5GA 3LQXA 5DT2A 3SX0A 1CQTA 1NERA 3G0TA 1JH9A 1QZXA 3GN5A 1QQBA 1ADRA 3NDBB 1OCTC 3SCHA 2EBYA 3HZIB 3UFDA 1SQ8A 4Z59A 4ER0A 3OP9A 2HCSA 3OWQA 2XCJA 1QP0A 2R1JL 1PNRA 4DE9A 4DE8A 2LLWA 2PUDA 4GQMA 2PE5A 2PXLA 4FBIA 2ODRD 2KPJA 3TEPA 4J1WA 3SCGA 2B5AA 1R69A 2KEJA 4Y42A 2LYSA 3QYXA 3BS3A 4X4BA 3EUSA 3TRBA 1BDHA 2CROA 2MXDA 1Y9QA 4Z5CA 2L8NA 2BNNA 2J7UA 1UXCA 2GRMA 3F6WA 1OSLA 2HINA 2XXPA 4YG4A 3MEJA 1B0NA 3QWGA 2WUSR 4PU3C 1QP7A 5DRYA 3H5TA 3RZZA 2J7WA 4F8DA 3SR4A 2M4HA 4IA8A 1RPEL 2PXTA 3CROL 1CJGA 2XJ3A 3BD1A 2PXKA 3NXHA 4I6RA 1EFAA 3B7HA 3O9XA 2V3CC 2PUEA 2FFHA 2LYJA 3QOXA 3GBFA 3MLFA 2PXFA 1PRAA 3LISA 3R1FA 2KEIA 1RZRD 2WIUB 1ZPQA 4EKGA 3KJXA 3PXPA 2XSDC 4EQZA 4JCYA 1PRUA 2XI8A 2LCVA 3JXCL 1O4XA 1HF0A 2YBDA 4YARA 2IU7A 1JFTA 1QB2A 4PU4C 1UTXA 3FMYA 2OFYA 2PXBA 1RZSA 2AXVA 1PRVA 2MEZA 3ZHMA 2A6CA 3GZDA 1AU7A 3OMTA
chains in the Genus database with same CATH topology
2ICPA 3BS3A 2D5VA 4YG7B 4X4BA 4X4EA 4X4IA 4OB4A 3EUSA 3G7DA 2GZUA 3TRBA 1BDHA 2BNOA 2CROA 1Y9QA 2EF8A 2MQKA 4Z5CA 3LFPA 3OQNA 3BDNA 1ZZ7A 3FYMA 3JXBC 1YSEA 1GT0C 1JWLA 1X57A 2L8NA 2BNNA 4GHJA 4O8BA 2LYRA 1RIOA 1LQCA 4IWRA 3ZHIA 3D1NI 1UXCA 4Z5DA 2GRMA 3F6WA 3QF3A 1OSLA 4X4FA 1DW9A 2HINA 2IVGA 2L49A 2O38A 2XIUA 4PU7A 1ZZCA 4JCXA 2O4AA 4YG4A 2AUWA 1E3OC 4PU8A 2BNMA 4IVZA 2PUFA 2AXZA 1B0NA 3ZKCA 2EWTA 3JXDL 1RZRA 1UXDA 3QWGA 2WUSR 4PU3C 1QP7A 2JVLA 3H5TA 4Y42A 1ZAYA 1QPZA 3RZZA 1POUA 2R63A 1ZUGA 3F51A 4F8DA 1LLIA 4IA8A 1RPEL 4JQDA 3FYAA 3CROL 1CJGA 3CECA 2KZ8A 3F52A 2OR1L 2XJ3A 3BD1A 4I8TA 4MCTA 5K98B 2IVQA 4J1XA 1ZS4A 1WIZA 4YBAA 4YG1A 4I6RA 1Y7YA 2AWIA 3QQ6A 1EFAA 2PUGA 3B7HA 3O9XA 2PUEA 5A7LA 2LYJA 3G5GA 2JCGA 1JFSA 3L1PA 2LYPA 1BDIA 2O49A 1LCDA 2GRLA 3GBFA 1WETA 3VK0A 3MLFA 1CQTA 2KEKA 1PERL 1S7EA 2FJRA 1NERA 3GN5B 1QP4A 2IUOA 1NEQA 1JH9A 1R63A 1PRAA 1ZZ8A 3LISA 4X4CA 3GN5A 3R1FA 2BJCA 3KZ3A 2CSFA 3U3WA 2KEIA 2ICTA 2IVBA 1RZRD 4NDWA 2LYQA 1QQBA 2LYLA 2WIUB 1ADRA 1ZPQA 1OCTC 2LYKA 3KJXA 2HSGA 3SCHA 2EBYA 3PXPA 2AW6A 3HZIB 3UFDA 1X2LA 1SQ8A 4MCXA 2XSDC 4Z59A 4JCYA 1PRUA 2XI8A 3IVPA 1ZVVA 1LMB3 1LCCA 2PUAA 2LCVA 3JXCL 3OP9A 1QQAA 1O4XA 1HF0A 2XCJA 4X4HA 1XWRA 1QP0A 4I6UA 4YARA 2IU7A 2IV1A 1DWKA 3OQMA 2R1JL 1L1MA 1JFTA 1PNRA 4Z5HA 1ZZ9A 3OQOA 1WH8A 4PU4C 1UTXA 2PIJA 4I6TA 3FMYA 1ZZBA 2OFYA 1VPWA 4X4GA 2PUDA 3DNVB 1IC8A 4GQMA 2PE5A 1RZSA 3S8QA 2AXVA 3CLCA 4X4DA 4FN3A 1WH6A 4FBIA 2KPJA 2PPXA 1PRVA 2MEZA 4J1WA 2B5AA 3SCGA 4Z58A 1ZZ6A 2PUBA 2PUCA 3ZHMA 2AXUA 3SCFA 1R69A 2A6CA 3KXAA 2KEJA 2LYSA 1AU7A 2H8RA 3OMTA 3QYXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ICP A;  3BS3 A;  2D5V A;  4YG7 B;  4X4B A;  4X4E A;  4X4I A;  4OB4 A;  3EUS A;  3G7D A;  2GZU A;  3TRB A;  1BDH A;  2BNO A;  2CRO A;  1Y9Q A;  2EF8 A;  2MQK A;  4Z5C A;  3LFP A;  3OQN A;  3BDN A;  1ZZ7 A;  3FYM A;  3JXB C;  1YSE A;  1GT0 C;  1JWL A;  1X57 A;  2L8N A;  2BNN A;  4GHJ A;  4O8B A;  2LYR A;  1RIO A;  1LQC A;  4IWR A;  3ZHI A;  3D1N I;  1UXC A;  4Z5D A;  2GRM A;  3F6W A;  3QF3 A;  1OSL A;  4X4F A;  1DW9 A;  2HIN A;  2IVG A;  2L49 A;  2O38 A;  2XIU A;  4PU7 A;  1ZZC A;  4JCX A;  2O4A A;  4YG4 A;  2AUW A;  1E3O C;  4PU8 A;  2BNM A;  4IVZ A;  2PUF A;  2AXZ A;  1B0N A;  3ZKC A;  2EWT A;  3JXD L;  1RZR A;  1UXD A;  3QWG A;  2WUS R;  4PU3 C;  1QP7 A;  2JVL A;  3H5T A;  4Y42 A;  1ZAY A;  1QPZ A;  3RZZ A;  1POU A;  2R63 A;  1ZUG A;  3F51 A;  4F8D A;  1LLI A;  4IA8 A;  1RPE L;  4JQD A;  3FYA A;  3CRO L;  1CJG A;  3CEC A;  2KZ8 A;  3F52 A;  2OR1 L;  2XJ3 A;  3BD1 A;  4I8T A;  4MCT A;  5K98 B;  2IVQ A;  4J1X A;  1ZS4 A;  1WIZ A;  4YBA A;  4YG1 A;  4I6R A;  1Y7Y A;  2AWI A;  3QQ6 A;  1EFA A;  2PUG A;  3B7H A;  3O9X A;  2PUE A;  5A7L A;  2LYJ A;  3G5G A;  2JCG A;  1JFS A;  3L1P A;  2LYP A;  1BDI A;  2O49 A;  1LCD A;  2GRL A;  3GBF A;  1WET A;  3VK0 A;  3MLF A;  1CQT A;  2KEK A;  1PER L;  1S7E A;  2FJR A;  1NER A;  3GN5 B;  1QP4 A;  2IUO A;  1NEQ A;  1JH9 A;  1R63 A;  1PRA A;  1ZZ8 A;  3LIS A;  4X4C A;  3GN5 A;  3R1F A;  2BJC A;  3KZ3 A;  2CSF A;  3U3W A;  2KEI A;  2ICT A;  2IVB A;  1RZR D;  4NDW A;  2LYQ A;  1QQB A;  2LYL A;  2WIU B;  1ADR A;  1ZPQ A;  1OCT C;  2LYK A;  3KJX A;  2HSG A;  3SCH A;  2EBY A;  3PXP A;  2AW6 A;  3HZI B;  3UFD A;  1X2L A;  1SQ8 A;  4MCX A;  2XSD C;  4Z59 A;  4JCY A;  1PRU A;  2XI8 A;  3IVP A;  1ZVV A;  1LMB 3;  1LCC A;  2PUA A;  2LCV A;  3JXC L;  3OP9 A;  1QQA A;  1O4X A;  1HF0 A;  2XCJ A;  4X4H A;  1XWR A;  1QP0 A;  4I6U A;  4YAR A;  2IU7 A;  2IV1 A;  1DWK A;  3OQM A;  2R1J L;  1L1M A;  1JFT A;  1PNR A;  4Z5H A;  1ZZ9 A;  3OQO A;  1WH8 A;  4PU4 C;  1UTX A;  2PIJ A;  4I6T A;  3FMY A;  1ZZB A;  2OFY A;  1VPW A;  4X4G A;  2PUD A;  3DNV B;  1IC8 A;  4GQM A;  2PE5 A;  1RZS A;  3S8Q A;  2AXV A;  3CLC A;  4X4D A;  4FN3 A;  1WH6 A;  4FBI A;  2KPJ A;  2PPX A;  1PRV A;  2MEZ A;  4J1W A;  2B5A A;  3SCG A;  4Z58 A;  1ZZ6 A;  2PUB A;  2PUC A;  3ZHM A;  2AXU A;  3SCF A;  1R69 A;  2A6C A;  3KXA A;  2KEJ A;  2LYS A;  1AU7 A;  2H8R A;  3OMT A;  3QYX A; 
#chains in the Genus database with same CATH topology
 2ICP A;  3UWP A;  2D5V A;  4YG7 B;  2GZU A;  3PE5 A;  3M9L A;  1RIO A;  5DTQ A;  3D1N I;  4Z5D A;  4ER5 A;  4PU7 A;  1ZZC A;  4IVZ A;  2AXZ A;  3ZKC A;  2EWT A;  1ZAY A;  1QPZ A;  1ZUG A;  3F51 A;  2JQE A;  4JQD A;  3FYA A;  3F52 A;  2LLV A;  5JUW A;  5K98 B;  2IVQ A;  1WIZ A;  4YBA A;  4YG1 A;  2AWI A;  3QQ6 A;  2JCG A;  1JFS A;  3L1P A;  2LYP A;  2O49 A;  1WET A;  3VK0 A;  2KEK A;  1PER L;  4WVL A;  1S7E A;  2FJR A;  1QP4 A;  1NEQ A;  1R63 A;  3KZ3 A;  2CSF A;  3U3W A;  2IVB A;  4NDW A;  2LYQ A;  4ER6 A;  2LYK A;  2AW6 A;  4MCX A;  3GZD C;  1LCC A;  2PUA A;  3R09 A;  3A9Z A;  4X4H A;  4I6U A;  2VEO A;  2IV1 A;  4Z5H A;  2PIJ A;  1ZZB A;  2LNM A;  4X4G A;  1IC8 A;  3S8Q A;  2PXE A;  2PPX A;  4Z58 A;  1U2Z A;  2PUB A;  2PUC A;  2H8R A;  4X4E A;  4OB4 A;  3G7D A;  5GAH i;  4EK9 A;  2BNO A;  2MQK A;  3OQN A;  1ZZ7 A;  3FYM A;  5DTM A;  3JXB C;  1X57 A;  2LYR A;  1LQC A;  3QOW A;  4X4F A;  2L49 A;  2IVG A;  2O4A A;  3GUU A;  4PU8 A;  2BNM A;  2PXU A;  1RZR A;  3JXD L;  1UXD A;  2L1P A;  5GAG i;  2PXD A;  1POU A;  2R63 A;  1LLI A;  3TFL A;  4HRA A;  2KZ8 A;  3OKZ A;  4I8T A;  1DUL A;  1HQ1 A;  1ZS4 A;  1Y7Y A;  3DM5 A;  2PUG A;  3A9Y A;  1BDI A;  1LCD A;  2GRL A;  3A9X A;  5DRT A;  3GN5 B;  2IUO A;  4X4C A;  1ZZ8 A;  2BJC A;  2ICT A;  2LYL A;  3QFI A;  2HCN A;  3NRO A;  2HSG A;  2PXV A;  1X2L A;  1ZVV A;  3IVP A;  2PXQ A;  1LMB 3;  4ER7 A;  1QQA A;  1XWR A;  1NW3 A;  1DWK A;  3OQM A;  1L1M A;  1ZZ9 A;  3OQO A;  1WH8 A;  3GZC A;  4I6T A;  1VPW A;  3DNV B;  3KL4 A;  5DSX A;  3CLC A;  4X4D A;  4FN3 A;  1WH6 A;  1ZZ6 A;  2AXU A;  3SCF A;  4EKI A;  3KXA A;  4X4I A;  3ME5 A;  2EF8 A;  3LFP A;  3BDN A;  1GT0 C;  1YSE A;  3TEL A;  1JWL A;  4GHJ A;  4O8B A;  4IWR A;  3ZHI A;  3NZL A;  3QF3 A;  1DW9 A;  1MFQ C;  2O38 A;  2XIU A;  4JCX A;  4Q2J A;  2AUW A;  1E3O C;  5DTR A;  2PUF A;  3VWS A;  2HFZ A;  3ZPX A;  2JVL A;  4OBM A;  2PXP A;  3CEC A;  2OR1 L;  4MCT A;  2XXQ A;  4EZI A;  4J1X A;  2XXA A;  4ER3 A;  5A7L A;  3G5G A;  3LQX A;  5DT2 A;  3SX0 A;  1CQT A;  1NER A;  3G0T A;  1JH9 A;  1QZX A;  3GN5 A;  1QQB A;  1ADR A;  3NDB B;  1OCT C;  3SCH A;  2EBY A;  3HZI B;  3UFD A;  1SQ8 A;  4Z59 A;  4ER0 A;  3OP9 A;  2HCS A;  3OWQ A;  2XCJ A;  1QP0 A;  2R1J L;  1PNR A;  4DE9 A;  4DE8 A;  2LLW A;  2PUD A;  4GQM A;  2PE5 A;  2PXL A;  4FBI A;  2ODR D;  2KPJ A;  3TEP A;  4J1W A;  3SCG A;  2B5A A;  1R69 A;  2KEJ A;  4Y42 A;  2LYS A;  3QYX A;  3BS3 A;  4X4B A;  3EUS A;  3TRB A;  1BDH A;  2CRO A;  2MXD A;  1Y9Q A;  4Z5C A;  2L8N A;  2BNN A;  2J7U A;  1UXC A;  2GRM A;  3F6W A;  1OSL A;  2HIN A;  2XXP A;  4YG4 A;  3MEJ A;  1B0N A;  3QWG A;  2WUS R;  4PU3 C;  1QP7 A;  5DRY A;  3H5T A;  3RZZ A;  2J7W A;  4F8D A;  3SR4 A;  2M4H A;  4IA8 A;  1RPE L;  2PXT A;  3CRO L;  1CJG A;  2XJ3 A;  3BD1 A;  2PXK A;  3NXH A;  4I6R A;  1EFA A;  3B7H A;  3O9X A;  2V3C C;  2PUE A;  2FFH A;  2LYJ A;  3QOX A;  3GBF A;  3MLF A;  2PXF A;  1PRA A;  3LIS A;  3R1F A;  2KEI A;  1RZR D;  2WIU B;  1ZPQ A;  4EKG A;  3KJX A;  3PXP A;  2XSD C;  4EQZ A;  4JCY A;  1PRU A;  2XI8 A;  2LCV A;  3JXC L;  1O4X A;  1HF0 A;  2YBD A;  4YAR A;  2IU7 A;  1JFT A;  1QB2 A;  4PU4 C;  1UTX A;  3FMY A;  2OFY A;  2PXB A;  1RZS A;  2AXV A;  1PRV A;  2MEZ A;  3ZHM A;  2A6C A;  3GZD A;  1AU7 A;  3OMT A; 
#chains in the Genus database with same CATH homology
 2ICP A;  3BS3 A;  2D5V A;  4YG7 B;  4X4B A;  4X4E A;  4X4I A;  4OB4 A;  3EUS A;  3G7D A;  2GZU A;  3TRB A;  1BDH A;  2BNO A;  2CRO A;  1Y9Q A;  2EF8 A;  2MQK A;  4Z5C A;  3LFP A;  3OQN A;  3BDN A;  1ZZ7 A;  3FYM A;  3JXB C;  1YSE A;  1GT0 C;  1JWL A;  1X57 A;  2L8N A;  2BNN A;  4GHJ A;  4O8B A;  2LYR A;  1RIO A;  1LQC A;  4IWR A;  3ZHI A;  3D1N I;  1UXC A;  4Z5D A;  2GRM A;  3F6W A;  3QF3 A;  1OSL A;  4X4F A;  1DW9 A;  2HIN A;  2IVG A;  2L49 A;  2O38 A;  2XIU A;  4PU7 A;  1ZZC A;  4JCX A;  2O4A A;  4YG4 A;  2AUW A;  1E3O C;  4PU8 A;  2BNM A;  4IVZ A;  2PUF A;  2AXZ A;  1B0N A;  3ZKC A;  2EWT A;  3JXD L;  1RZR A;  1UXD A;  3QWG A;  2WUS R;  4PU3 C;  1QP7 A;  2JVL A;  3H5T A;  4Y42 A;  1ZAY A;  1QPZ A;  3RZZ A;  1POU A;  2R63 A;  1ZUG A;  3F51 A;  4F8D A;  1LLI A;  4IA8 A;  1RPE L;  4JQD A;  3FYA A;  3CRO L;  1CJG A;  3CEC A;  2KZ8 A;  3F52 A;  2OR1 L;  2XJ3 A;  3BD1 A;  4I8T A;  4MCT A;  5K98 B;  2IVQ A;  4J1X A;  1ZS4 A;  1WIZ A;  4YBA A;  4YG1 A;  4I6R A;  1Y7Y A;  2AWI A;  3QQ6 A;  1EFA A;  2PUG A;  3B7H A;  3O9X A;  2PUE A;  5A7L A;  2LYJ A;  3G5G A;  2JCG A;  1JFS A;  3L1P A;  2LYP A;  1BDI A;  2O49 A;  1LCD A;  2GRL A;  3GBF A;  1WET A;  3VK0 A;  3MLF A;  1CQT A;  2KEK A;  1PER L;  1S7E A;  2FJR A;  1NER A;  3GN5 B;  1QP4 A;  2IUO A;  1NEQ A;  1JH9 A;  1R63 A;  1PRA A;  1ZZ8 A;  3LIS A;  4X4C A;  3GN5 A;  3R1F A;  2BJC A;  3KZ3 A;  2CSF A;  3U3W A;  2KEI A;  2ICT A;  2IVB A;  1RZR D;  4NDW A;  2LYQ A;  1QQB A;  2LYL A;  2WIU B;  1ADR A;  1ZPQ A;  1OCT C;  2LYK A;  3KJX A;  2HSG A;  3SCH A;  2EBY A;  3PXP A;  2AW6 A;  3HZI B;  3UFD A;  1X2L A;  1SQ8 A;  4MCX A;  2XSD C;  4Z59 A;  4JCY A;  1PRU A;  2XI8 A;  3IVP A;  1ZVV A;  1LMB 3;  1LCC A;  2PUA A;  2LCV A;  3JXC L;  3OP9 A;  1QQA A;  1O4X A;  1HF0 A;  2XCJ A;  4X4H A;  1XWR A;  1QP0 A;  4I6U A;  4YAR A;  2IU7 A;  2IV1 A;  1DWK A;  3OQM A;  2R1J L;  1L1M A;  1JFT A;  1PNR A;  4Z5H A;  1ZZ9 A;  3OQO A;  1WH8 A;  4PU4 C;  1UTX A;  2PIJ A;  4I6T A;  3FMY A;  1ZZB A;  2OFY A;  1VPW A;  4X4G A;  2PUD A;  3DNV B;  1IC8 A;  4GQM A;  2PE5 A;  1RZS A;  3S8Q A;  2AXV A;  3CLC A;  4X4D A;  4FN3 A;  1WH6 A;  4FBI A;  2KPJ A;  2PPX A;  1PRV A;  2MEZ A;  4J1W A;  2B5A A;  3SCG A;  4Z58 A;  1ZZ6 A;  2PUB A;  2PUC A;  3ZHM A;  2AXU A;  3SCF A;  1R69 A;  2A6C A;  3KXA A;  2KEJ A;  2LYS A;  1AU7 A;  2H8R A;  3OMT A;  3QYX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...