2BJCA

Nmr structure of a protein-dna complex of an altered specificity mutant of the lac repressor headpiece that mimics the gal repressor
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
62
structure length
62
Chain Sequence
MKPVTLYDVAEYAGVSVATVSRVVNQASHVSAKTREKVEAAMAELNYIPNRCAQQLAGKQSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords LACTOSE OPERON REPRESSOR
publication title Altered Specificity in DNA Binding by the Lac Repressor: A Mutant Lac Headpiece that Mimics the Gal Repressor
pubmed doi rcsb
source organism Escherichia coli
total genus 20
structure length 62
sequence length 62
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00356 LacI Bacterial regulatory proteins, lacI family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2bjcA00
4MCTA 4Z58A 2WUSR 1ZZ8A 2LYKA 1UXDA 4Y42A 3D1NI 3OMTA 2OR1L 5A7LA 2D5VA 4IWRA 3OQMA 3CROL 2JCGA 3PXPA 3ZHIA 2PUBA 1R63A 4I8TA 3F6WA 2XCJA 3O9XA 1ZZ9A 2CROA 1GT0C 1WH8A 4FN3A 1BDHA 1ZAYA 1JH9A 1LMB3 4X4GA 1QP7A 3QWGA 2FJRA 1JFSA 1SQ8A 3GN5A 2BNNA 1ZS4A 1B0NA 1OCTC 2O49A 2EWTA 3VK0A 2BJCA 4Z5DA 1O4XA 3OP9A 1QP4A 3G5GA 4X4CA 3H5TA 4O8BA 3FYAA 2KZ8A 3JXCL 2LYJA 4PU3C 3OQOA 2ICPA 4IVZA 2L8NA 3F51A 3BDNA 4IA8A 2KPJA 3SCHA 2MEZA 1UXCA 4X4DA 1DWKA 3U3WA 2LYSA 2HINA 1R69A 4I6TA 4YARA 4X4FA 3JXDL 3BS3A 2MQKA 4OB4A 1X57A 3UFDA 4JCXA 2LYRA 1Y7YA 2B5AA 1VPWA 2HSGA 3F52A 2O4AA 4YG7B 4X4HA 2XIUA 3DNVB 2XSDC 5K98B 1JWLA 3EUSA 3CLCA 1Y9QA 3RZZA 4Z5HA 1IC8A 1ZVVA 4PU8A 2LCVA 4GHJA 2BNOA 3FMYA 1UTXA 3QF3A 3ZKCA 3QYXA 1PRUA 4I6RA 4PU7A 1L1MA 3S8QA 2EBYA 3KZ3A 2IV1A 3KXAA 3QQ6A 4J1XA 1QQAA 1RZSA 3GN5B 3LISA 2OFYA 1WIZA 1ZPQA 1PRAA 3FYMA 2R63A 2GRMA 3B7HA 2AUWA 2LYLA 3GBFA 1DW9A 2A6CA 2IVQA 2R1JL 1JFTA 1LQCA 1EFAA 3JXBC 1LCDA 4JCYA 4F8DA 2PUFA 1X2LA 2AXUA 3KJXA 3BD1A 1CQTA 3MLFA 1LCCA 2PUDA 2AW6A 1HF0A 1ZZCA 2IUOA 3G7DA 1YSEA 4J1WA 1S7EA 4NDWA 1BDIA 1QP0A 2BNMA 2GZUA 2JVLA 4MCXA 1RZRA 4Z5CA 2H8RA 4GQMA 2PUEA 2PE5A 2WIUB 2GRLA 3TRBA 1ZZ6A 1QQBA 2XI8A 4YBAA 3SCGA 4PU4C 4X4EA 2IU7A 3OQNA 2EF8A 1ZZ7A 2LYQA 1WH6A 2CSFA 3R1FA 3SCFA 3L1PA 2PPXA 2IVGA 2ICTA 4YG1A 1LLIA 1PNRA 1WETA 2O38A 1ADRA 2PUGA 1AU7A 1ZUGA 4YG4A 2IVBA 2PIJA 3LFPA 4JQDA 1NEQA 2PUAA 1PRVA 2KEKA 1OSLA 1ZZBA 2PUCA 4I6UA 3CECA 1PERL 4Z59A 1NERA 2AXVA 2AXZA 3IVPA 4X4IA 2KEIA 1E3OC 2AWIA 2XJ3A 1XWRA 2LYPA 4X4BA 1RPEL 2L49A 4FBIA 1QPZA 1CJGA 3ZHMA 3HZIB 1RIOA 1POUA 1RZRD 2KEJA
chains in the Genus database with same CATH superfamily
3UWPA 4ER0A 4Z58A 2WUSR 3D1NI 3OMTA 3PXPA 3F6WA 3O9XA 1WH8A 4FN3A 1JH9A 1LMB3 2PXEA 3QWGA 2M4HA 4Z5DA 4O8BA 4IVZA 2L1PA 2MEZA 2LYSA 3SR4A 3BS3A 3UFDA 4Q2JA 5K98B 1Y9QA 1IC8A 2MXDA 1ZVVA 3SX0A 3NROA 3QF3A 2LNMA 1PRUA 4I6RA 2IV1A 3GN5B 1WIZA 2AUWA 1QZXA 2LYLA 2A6CA 1LCDA 2PXBA 2PUFA 1X2LA 3OKZA 3BD1A 1HQ1A 2IUOA 3G7DA 1YSEA 2PXFA 4J1WA 2BNMA 2H8RA 4Z5CA 2GRLA 5JUWA 2XI8A 2IU7A 1ZZ7A 2CSFA 3R1FA 2PPXA 2IVGA 3VWSA 1ADRA 2FFHA 1NEQA 2PUAA 2KEKA 1OSLA 2PUCA 1PERL 2HCNA 4X4IA 2KEIA 2LYPA 4FBIA 1CJGA 3ZHMA 1JFSA 4Y42A 1ZZ8A 1UXDA 2OR1L 5A7LA 3OQMA 1R63A 2XCJA 1QP7A 2J7WA 2BJCA 3M9LA 3OP9A 1QP4A 3LQXA 3OWQA 4DE9A 4X4CA 3H5TA 2LYJA 2ICPA 4IA8A 2LLWA 1UXCA 4X4DA 2ODRD 2HINA 4I6TA 3JXDL 4ER3A 3A9ZA 3MEJA 1X57A 3NZLA 2B5AA 3F52A 4OBMA 5DRYA 3DNVB 2XSDC 3CLCA 2BNOA 1UTXA 1L1MA 2EBYA 3KZ3A 3QQ6A 4WVLA 4EZIA 5DTQA 1PRAA 2R63A 1DULA 2PXPA 4JCYA 1CQTA 1S7EA 4NDWA 1BDIA 2PUEA 2PE5A 2WIUB 1ZZ6A 3SCGA 4PU4C 1MFQC 3TEPA 3QFIA 1WH6A 2PXQA 2ICTA 1LLIA 4JQDA 2PIJA 3LFPA 1PRVA 4I6UA 3CECA 4EQZA 4Z59A 1NERA 3IVPA 2XJ3A 2L49A 1RIOA 3KL4A 4MCTA 4IWRA 3ZHIA 2PXTA 1QB2A 5DRTA 1ZZ9A 2CROA 4X4GA 4ER5A 3GN5A 2BNNA 1ZS4A 1B0NA 4ER7A 2EWTA 1O4XA 3TELA 4HRAA 3G5GA 3JXCL 4PU3C 2XXPA 3GZCA 2L8NA 3F51A 3BDNA 3SCHA 3TFLA 3A9XA 3ME5A 3GUUA 4OB4A 4JCXA 2LYRA 1Y7YA 2O4AA 2HSGA 4YG7B 4X4HA 3EUSA 3RZZA 4Z5HA 2JQEA 4GHJA 3FMYA 3ZPXA 4J1XA 3KXAA 1RZSA 3LISA 1ZPQA 3GBFA 4DE8A 1DW9A 2VEOA 2R1JL 5DTMA 3KJXA 1LCCA 3MLFA 1U2ZA 3GZDC 4MCXA 4GQMA 4EKIA 2PXKA 1QQBA 3PE5A 3OQNA 5GAGi 2LYQA 3SCFA 3L1PA 3A9YA 4YG1A 1PNRA 1WETA 2O38A 3R09A 4EKGA 4YG4A 2IVBA 1ZZBA 2AXVA 1E3OC 2AWIA 4X4BA 1RPEL 3NDBB 3HZIB 1POUA 2KEJA 3GZDA 2LYKA 4EK9A 2HFZA 3CROL 2JCGA 3QOWA 2PUBA 2YBDA 1GT0C 1BDHA 1ZAYA 2FJRA 5DTRA 1SQ8A 2HCSA 1OCTC 2O49A 3VK0A 3FYAA 2KZ8A 3OQOA 4ER6A 2KPJA 1DWKA 3U3WA 4YARA 1R69A 4X4FA 2MQKA 2XXQA 1VPWA 5DT2A 2XIUA 3NXHA 1JWLA 4PU8A 2PXVA 2LCVA 3ZKCA 3QYXA 4PU7A 3S8QA 2V3CC 2PXDA 1QQAA 2OFYA 2LLVA 2PXUA 3FYMA 2GRMA 3B7HA 5DSXA 2IVQA 1JFTA 1EFAA 1LQCA 3JXBC 1NW3A 4F8DA 3DM5A 2AXUA 5GAHi 2PUDA 3QOXA 2AW6A 1HF0A 1ZZCA 2PXLA 1QP0A 2GZUA 2JVLA 1RZRA 3TRBA 4YBAA 4X4EA 2EF8A 2XXAA 3G0TA 2PUGA 1AU7A 1ZUGA 2D5VA 2AXZA 4I8TA 1XWRA 1QPZA 2J7UA 1RZRD
chains in the Genus database with same CATH topology
4MCTA 4Z58A 2WUSR 1ZZ8A 2LYKA 1UXDA 4Y42A 3D1NI 3OMTA 2OR1L 5A7LA 2D5VA 4IWRA 3OQMA 3CROL 2JCGA 3PXPA 3ZHIA 2PUBA 1R63A 4I8TA 3F6WA 2XCJA 3O9XA 1ZZ9A 2CROA 1GT0C 1WH8A 4FN3A 1BDHA 1ZAYA 1JH9A 1LMB3 4X4GA 1QP7A 3QWGA 2FJRA 1JFSA 1SQ8A 3GN5A 2BNNA 1ZS4A 1B0NA 1OCTC 2O49A 2EWTA 3VK0A 2BJCA 4Z5DA 1O4XA 3OP9A 1QP4A 3G5GA 4X4CA 3H5TA 4O8BA 3FYAA 2KZ8A 3JXCL 2LYJA 4PU3C 3OQOA 2ICPA 4IVZA 2L8NA 3F51A 3BDNA 4IA8A 2KPJA 3SCHA 2MEZA 1UXCA 4X4DA 1DWKA 3U3WA 2LYSA 2HINA 1R69A 4I6TA 4YARA 4X4FA 3JXDL 3BS3A 2MQKA 4OB4A 1X57A 3UFDA 4JCXA 2LYRA 1Y7YA 2B5AA 1VPWA 2HSGA 3F52A 2O4AA 4YG7B 4X4HA 2XIUA 3DNVB 2XSDC 5K98B 1JWLA 3EUSA 3CLCA 1Y9QA 3RZZA 4Z5HA 1IC8A 1ZVVA 4PU8A 2LCVA 4GHJA 2BNOA 3FMYA 1UTXA 3QF3A 3ZKCA 3QYXA 1PRUA 4I6RA 4PU7A 1L1MA 3S8QA 2EBYA 3KZ3A 2IV1A 3KXAA 3QQ6A 4J1XA 1QQAA 1RZSA 3GN5B 3LISA 2OFYA 1WIZA 1ZPQA 1PRAA 3FYMA 2R63A 2GRMA 3B7HA 2AUWA 2LYLA 3GBFA 1DW9A 2A6CA 2IVQA 2R1JL 1JFTA 1LQCA 1EFAA 3JXBC 1LCDA 4JCYA 4F8DA 2PUFA 1X2LA 2AXUA 3KJXA 3BD1A 1CQTA 3MLFA 1LCCA 2PUDA 2AW6A 1HF0A 1ZZCA 2IUOA 3G7DA 1YSEA 4J1WA 1S7EA 4NDWA 1BDIA 1QP0A 2BNMA 2GZUA 2JVLA 4MCXA 1RZRA 4Z5CA 2H8RA 4GQMA 2PUEA 2PE5A 2WIUB 2GRLA 3TRBA 1ZZ6A 1QQBA 2XI8A 4YBAA 3SCGA 4PU4C 4X4EA 2IU7A 3OQNA 2EF8A 1ZZ7A 2LYQA 1WH6A 2CSFA 3R1FA 3SCFA 3L1PA 2PPXA 2IVGA 2ICTA 4YG1A 1LLIA 1PNRA 1WETA 2O38A 1ADRA 2PUGA 1AU7A 1ZUGA 4YG4A 2IVBA 2PIJA 3LFPA 4JQDA 1NEQA 2PUAA 1PRVA 2KEKA 1OSLA 1ZZBA 2PUCA 4I6UA 3CECA 1PERL 4Z59A 1NERA 2AXVA 2AXZA 3IVPA 4X4IA 2KEIA 1E3OC 2AWIA 2XJ3A 1XWRA 2LYPA 4X4BA 1RPEL 2L49A 4FBIA 1QPZA 1CJGA 3ZHMA 3HZIB 1RIOA 1POUA 1RZRD 2KEJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MCT A;  4Z58 A;  2WUS R;  1ZZ8 A;  2LYK A;  1UXD A;  4Y42 A;  3D1N I;  3OMT A;  2OR1 L;  5A7L A;  2D5V A;  4IWR A;  3OQM A;  3CRO L;  2JCG A;  3PXP A;  3ZHI A;  2PUB A;  1R63 A;  4I8T A;  3F6W A;  2XCJ A;  3O9X A;  1ZZ9 A;  2CRO A;  1GT0 C;  1WH8 A;  4FN3 A;  1BDH A;  1ZAY A;  1JH9 A;  1LMB 3;  4X4G A;  1QP7 A;  3QWG A;  2FJR A;  1JFS A;  1SQ8 A;  3GN5 A;  2BNN A;  1ZS4 A;  1B0N A;  1OCT C;  2O49 A;  2EWT A;  3VK0 A;  2BJC A;  4Z5D A;  1O4X A;  3OP9 A;  1QP4 A;  3G5G A;  4X4C A;  3H5T A;  4O8B A;  3FYA A;  2KZ8 A;  3JXC L;  2LYJ A;  4PU3 C;  3OQO A;  2ICP A;  4IVZ A;  2L8N A;  3F51 A;  3BDN A;  4IA8 A;  2KPJ A;  3SCH A;  2MEZ A;  1UXC A;  4X4D A;  1DWK A;  3U3W A;  2LYS A;  2HIN A;  1R69 A;  4I6T A;  4YAR A;  4X4F A;  3JXD L;  3BS3 A;  2MQK A;  4OB4 A;  1X57 A;  3UFD A;  4JCX A;  2LYR A;  1Y7Y A;  2B5A A;  1VPW A;  2HSG A;  3F52 A;  2O4A A;  4YG7 B;  4X4H A;  2XIU A;  3DNV B;  2XSD C;  5K98 B;  1JWL A;  3EUS A;  3CLC A;  1Y9Q A;  3RZZ A;  4Z5H A;  1IC8 A;  1ZVV A;  4PU8 A;  2LCV A;  4GHJ A;  2BNO A;  3FMY A;  1UTX A;  3QF3 A;  3ZKC A;  3QYX A;  1PRU A;  4I6R A;  4PU7 A;  1L1M A;  3S8Q A;  2EBY A;  3KZ3 A;  2IV1 A;  3KXA A;  3QQ6 A;  4J1X A;  1QQA A;  1RZS A;  3GN5 B;  3LIS A;  2OFY A;  1WIZ A;  1ZPQ A;  1PRA A;  3FYM A;  2R63 A;  2GRM A;  3B7H A;  2AUW A;  2LYL A;  3GBF A;  1DW9 A;  2A6C A;  2IVQ A;  2R1J L;  1JFT A;  1LQC A;  1EFA A;  3JXB C;  1LCD A;  4JCY A;  4F8D A;  2PUF A;  1X2L A;  2AXU A;  3KJX A;  3BD1 A;  1CQT A;  3MLF A;  1LCC A;  2PUD A;  2AW6 A;  1HF0 A;  1ZZC A;  2IUO A;  3G7D A;  1YSE A;  4J1W A;  1S7E A;  4NDW A;  1BDI A;  1QP0 A;  2BNM A;  2GZU A;  2JVL A;  4MCX A;  1RZR A;  4Z5C A;  2H8R A;  4GQM A;  2PUE A;  2PE5 A;  2WIU B;  2GRL A;  3TRB A;  1ZZ6 A;  1QQB A;  2XI8 A;  4YBA A;  3SCG A;  4PU4 C;  4X4E A;  2IU7 A;  3OQN A;  2EF8 A;  1ZZ7 A;  2LYQ A;  1WH6 A;  2CSF A;  3R1F A;  3SCF A;  3L1P A;  2PPX A;  2IVG A;  2ICT A;  4YG1 A;  1LLI A;  1PNR A;  1WET A;  2O38 A;  1ADR A;  2PUG A;  1AU7 A;  1ZUG A;  4YG4 A;  2IVB A;  2PIJ A;  3LFP A;  4JQD A;  1NEQ A;  2PUA A;  1PRV A;  2KEK A;  1OSL A;  1ZZB A;  2PUC A;  4I6U A;  3CEC A;  1PER L;  4Z59 A;  1NER A;  2AXV A;  2AXZ A;  3IVP A;  4X4I A;  2KEI A;  1E3O C;  2AWI A;  2XJ3 A;  1XWR A;  2LYP A;  4X4B A;  1RPE L;  2L49 A;  4FBI A;  1QPZ A;  1CJG A;  3ZHM A;  3HZI B;  1RIO A;  1POU A;  1RZR D;  2KEJ A; 
#chains in the Genus database with same CATH topology
 3UWP A;  4ER0 A;  4Z58 A;  2WUS R;  3D1N I;  3OMT A;  3PXP A;  3F6W A;  3O9X A;  1WH8 A;  4FN3 A;  1JH9 A;  1LMB 3;  2PXE A;  3QWG A;  2M4H A;  4Z5D A;  4O8B A;  4IVZ A;  2L1P A;  2MEZ A;  2LYS A;  3SR4 A;  3BS3 A;  3UFD A;  4Q2J A;  5K98 B;  1Y9Q A;  1IC8 A;  2MXD A;  1ZVV A;  3SX0 A;  3NRO A;  3QF3 A;  2LNM A;  1PRU A;  4I6R A;  2IV1 A;  3GN5 B;  1WIZ A;  2AUW A;  1QZX A;  2LYL A;  2A6C A;  1LCD A;  2PXB A;  2PUF A;  1X2L A;  3OKZ A;  3BD1 A;  1HQ1 A;  2IUO A;  3G7D A;  1YSE A;  2PXF A;  4J1W A;  2BNM A;  2H8R A;  4Z5C A;  2GRL A;  5JUW A;  2XI8 A;  2IU7 A;  1ZZ7 A;  2CSF A;  3R1F A;  2PPX A;  2IVG A;  3VWS A;  1ADR A;  2FFH A;  1NEQ A;  2PUA A;  2KEK A;  1OSL A;  2PUC A;  1PER L;  2HCN A;  4X4I A;  2KEI A;  2LYP A;  4FBI A;  1CJG A;  3ZHM A;  1JFS A;  4Y42 A;  1ZZ8 A;  1UXD A;  2OR1 L;  5A7L A;  3OQM A;  1R63 A;  2XCJ A;  1QP7 A;  2J7W A;  2BJC A;  3M9L A;  3OP9 A;  1QP4 A;  3LQX A;  3OWQ A;  4DE9 A;  4X4C A;  3H5T A;  2LYJ A;  2ICP A;  4IA8 A;  2LLW A;  1UXC A;  4X4D A;  2ODR D;  2HIN A;  4I6T A;  3JXD L;  4ER3 A;  3A9Z A;  3MEJ A;  1X57 A;  3NZL A;  2B5A A;  3F52 A;  4OBM A;  5DRY A;  3DNV B;  2XSD C;  3CLC A;  2BNO A;  1UTX A;  1L1M A;  2EBY A;  3KZ3 A;  3QQ6 A;  4WVL A;  4EZI A;  5DTQ A;  1PRA A;  2R63 A;  1DUL A;  2PXP A;  4JCY A;  1CQT A;  1S7E A;  4NDW A;  1BDI A;  2PUE A;  2PE5 A;  2WIU B;  1ZZ6 A;  3SCG A;  4PU4 C;  1MFQ C;  3TEP A;  3QFI A;  1WH6 A;  2PXQ A;  2ICT A;  1LLI A;  4JQD A;  2PIJ A;  3LFP A;  1PRV A;  4I6U A;  3CEC A;  4EQZ A;  4Z59 A;  1NER A;  3IVP A;  2XJ3 A;  2L49 A;  1RIO A;  3KL4 A;  4MCT A;  4IWR A;  3ZHI A;  2PXT A;  1QB2 A;  5DRT A;  1ZZ9 A;  2CRO A;  4X4G A;  4ER5 A;  3GN5 A;  2BNN A;  1ZS4 A;  1B0N A;  4ER7 A;  2EWT A;  1O4X A;  3TEL A;  4HRA A;  3G5G A;  3JXC L;  4PU3 C;  2XXP A;  3GZC A;  2L8N A;  3F51 A;  3BDN A;  3SCH A;  3TFL A;  3A9X A;  3ME5 A;  3GUU A;  4OB4 A;  4JCX A;  2LYR A;  1Y7Y A;  2O4A A;  2HSG A;  4YG7 B;  4X4H A;  3EUS A;  3RZZ A;  4Z5H A;  2JQE A;  4GHJ A;  3FMY A;  3ZPX A;  4J1X A;  3KXA A;  1RZS A;  3LIS A;  1ZPQ A;  3GBF A;  4DE8 A;  1DW9 A;  2VEO A;  2R1J L;  5DTM A;  3KJX A;  1LCC A;  3MLF A;  1U2Z A;  3GZD C;  4MCX A;  4GQM A;  4EKI A;  2PXK A;  1QQB A;  3PE5 A;  3OQN A;  5GAG i;  2LYQ A;  3SCF A;  3L1P A;  3A9Y A;  4YG1 A;  1PNR A;  1WET A;  2O38 A;  3R09 A;  4EKG A;  4YG4 A;  2IVB A;  1ZZB A;  2AXV A;  1E3O C;  2AWI A;  4X4B A;  1RPE L;  3NDB B;  3HZI B;  1POU A;  2KEJ A;  3GZD A;  2LYK A;  4EK9 A;  2HFZ A;  3CRO L;  2JCG A;  3QOW A;  2PUB A;  2YBD A;  1GT0 C;  1BDH A;  1ZAY A;  2FJR A;  5DTR A;  1SQ8 A;  2HCS A;  1OCT C;  2O49 A;  3VK0 A;  3FYA A;  2KZ8 A;  3OQO A;  4ER6 A;  2KPJ A;  1DWK A;  3U3W A;  4YAR A;  1R69 A;  4X4F A;  2MQK A;  2XXQ A;  1VPW A;  5DT2 A;  2XIU A;  3NXH A;  1JWL A;  4PU8 A;  2PXV A;  2LCV A;  3ZKC A;  3QYX A;  4PU7 A;  3S8Q A;  2V3C C;  2PXD A;  1QQA A;  2OFY A;  2LLV A;  2PXU A;  3FYM A;  2GRM A;  3B7H A;  5DSX A;  2IVQ A;  1JFT A;  1EFA A;  1LQC A;  3JXB C;  1NW3 A;  4F8D A;  3DM5 A;  2AXU A;  5GAH i;  2PUD A;  3QOX A;  2AW6 A;  1HF0 A;  1ZZC A;  2PXL A;  1QP0 A;  2GZU A;  2JVL A;  1RZR A;  3TRB A;  4YBA A;  4X4E A;  2EF8 A;  2XXA A;  3G0T A;  2PUG A;  1AU7 A;  1ZUG A;  2D5V A;  2AXZ A;  4I8T A;  1XWR A;  1QPZ A;  2J7U A;  1RZR D; 
#chains in the Genus database with same CATH homology
 4MCT A;  4Z58 A;  2WUS R;  1ZZ8 A;  2LYK A;  1UXD A;  4Y42 A;  3D1N I;  3OMT A;  2OR1 L;  5A7L A;  2D5V A;  4IWR A;  3OQM A;  3CRO L;  2JCG A;  3PXP A;  3ZHI A;  2PUB A;  1R63 A;  4I8T A;  3F6W A;  2XCJ A;  3O9X A;  1ZZ9 A;  2CRO A;  1GT0 C;  1WH8 A;  4FN3 A;  1BDH A;  1ZAY A;  1JH9 A;  1LMB 3;  4X4G A;  1QP7 A;  3QWG A;  2FJR A;  1JFS A;  1SQ8 A;  3GN5 A;  2BNN A;  1ZS4 A;  1B0N A;  1OCT C;  2O49 A;  2EWT A;  3VK0 A;  2BJC A;  4Z5D A;  1O4X A;  3OP9 A;  1QP4 A;  3G5G A;  4X4C A;  3H5T A;  4O8B A;  3FYA A;  2KZ8 A;  3JXC L;  2LYJ A;  4PU3 C;  3OQO A;  2ICP A;  4IVZ A;  2L8N A;  3F51 A;  3BDN A;  4IA8 A;  2KPJ A;  3SCH A;  2MEZ A;  1UXC A;  4X4D A;  1DWK A;  3U3W A;  2LYS A;  2HIN A;  1R69 A;  4I6T A;  4YAR A;  4X4F A;  3JXD L;  3BS3 A;  2MQK A;  4OB4 A;  1X57 A;  3UFD A;  4JCX A;  2LYR A;  1Y7Y A;  2B5A A;  1VPW A;  2HSG A;  3F52 A;  2O4A A;  4YG7 B;  4X4H A;  2XIU A;  3DNV B;  2XSD C;  5K98 B;  1JWL A;  3EUS A;  3CLC A;  1Y9Q A;  3RZZ A;  4Z5H A;  1IC8 A;  1ZVV A;  4PU8 A;  2LCV A;  4GHJ A;  2BNO A;  3FMY A;  1UTX A;  3QF3 A;  3ZKC A;  3QYX A;  1PRU A;  4I6R A;  4PU7 A;  1L1M A;  3S8Q A;  2EBY A;  3KZ3 A;  2IV1 A;  3KXA A;  3QQ6 A;  4J1X A;  1QQA A;  1RZS A;  3GN5 B;  3LIS A;  2OFY A;  1WIZ A;  1ZPQ A;  1PRA A;  3FYM A;  2R63 A;  2GRM A;  3B7H A;  2AUW A;  2LYL A;  3GBF A;  1DW9 A;  2A6C A;  2IVQ A;  2R1J L;  1JFT A;  1LQC A;  1EFA A;  3JXB C;  1LCD A;  4JCY A;  4F8D A;  2PUF A;  1X2L A;  2AXU A;  3KJX A;  3BD1 A;  1CQT A;  3MLF A;  1LCC A;  2PUD A;  2AW6 A;  1HF0 A;  1ZZC A;  2IUO A;  3G7D A;  1YSE A;  4J1W A;  1S7E A;  4NDW A;  1BDI A;  1QP0 A;  2BNM A;  2GZU A;  2JVL A;  4MCX A;  1RZR A;  4Z5C A;  2H8R A;  4GQM A;  2PUE A;  2PE5 A;  2WIU B;  2GRL A;  3TRB A;  1ZZ6 A;  1QQB A;  2XI8 A;  4YBA A;  3SCG A;  4PU4 C;  4X4E A;  2IU7 A;  3OQN A;  2EF8 A;  1ZZ7 A;  2LYQ A;  1WH6 A;  2CSF A;  3R1F A;  3SCF A;  3L1P A;  2PPX A;  2IVG A;  2ICT A;  4YG1 A;  1LLI A;  1PNR A;  1WET A;  2O38 A;  1ADR A;  2PUG A;  1AU7 A;  1ZUG A;  4YG4 A;  2IVB A;  2PIJ A;  3LFP A;  4JQD A;  1NEQ A;  2PUA A;  1PRV A;  2KEK A;  1OSL A;  1ZZB A;  2PUC A;  4I6U A;  3CEC A;  1PER L;  4Z59 A;  1NER A;  2AXV A;  2AXZ A;  3IVP A;  4X4I A;  2KEI A;  1E3O C;  2AWI A;  2XJ3 A;  1XWR A;  2LYP A;  4X4B A;  1RPE L;  2L49 A;  4FBI A;  1QPZ A;  1CJG A;  3ZHM A;  3HZI B;  1RIO A;  1POU A;  1RZR D;  2KEJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...