3JXBC

Crystal structure of the p22 c2 repressor protein in complex with synthetic operator 9c
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
67
structure length
67
Chain Sequence
NTQLMGERIRARRKKLKIRQAALGKMVGVSNVAISQWERSETEPNGENLLALSKALQCSPDYLLKGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords 5'-D(*CP*AP*TP*TP*TP*AP*AP*GP*AP*CP*GP*TP*CP*TP*TP*AP*AP*AP*
publication title Sequence Recognition of DNA by Protein-Induced Conformational Transitions
pubmed doi rcsb
source organism Enterobacteria phage p22
total genus 23
structure length 67
sequence length 67
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01381 HTH_3 Helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 3jxbC00
3F52A 3CECA 1LCCA 4J1WA 2JCGA 2PE5A 1JFSA 2O38A 2PUEA 4JQDA 3SCHA 2MEZA 1JFTA 3U3WA 3JXCL 2AW6A 3F51A 2KEJA 2AXVA 4X4EA 2ICTA 4Y42A 4JCYA 3FYAA 1QQBA 2D5VA 4NDWA 3S8QA 1OSLA 2BJCA 3O9XA 1WIZA 2O4AA 2HSGA 1Y7YA 2B5AA 2R63A 1ZZBA 2LYLA 1ZZ9A 1RZRD 1RIOA 4PU3C 1LCDA 1PERL 1BDIA 2OR1L 3ZHMA 2AXZA 3CROL 4J1XA 2ICPA 2XCJA 4YARA 4FN3A 4Z59A 3QF3A 2XI8A 2LYKA 1PRUA 2FJRA 4IVZA 2HINA 2LYPA 2BNNA 2PPXA 1R63A 2O49A 4Z58A 2EWTA 2IVBA 1LMB3 3B7HA 1JWLA 1LLIA 2AUWA 1CJGA 3KXAA 2PIJA 3EUSA 4PU8A 2PUAA 1R69A 4YBAA 1ZZ6A 2AWIA 1JH9A 1LQCA 1ZZ8A 1SQ8A 3SCGA 2LCVA 3KZ3A 3SCFA 1PRAA 1ZZCA 1ZAYA 4YG7B 1X57A 2H8RA 2EF8A 2IUOA 3H5TA 3ZHIA 3GBFA 4GQMA 3QWGA 4Z5DA 3OQMA 3JXDL 2WIUB 3OMTA 3BDNA 3HZIB 4OB4A 2PUBA 1IC8A 3PXPA 3G7DA 1XWRA 1POUA 2GRMA 1OCTC 1QP7A 4X4CA 4I6RA 4FBIA 2LYRA 4PU7A 3GN5A 3IVPA 4Z5HA 1AU7A 4I6TA 1PNRA 2JVLA 2LYSA 1PRVA 1QQAA 2CROA 2IVQA 2LYJA 1ZVVA 1YSEA 1NERA 3OQNA 3R1FA 4IWRA 2EBYA 2XJ3A 1WETA 2KEKA 2IV1A 3VK0A 1WH8A 3LISA 4MCXA 4O8BA 2GRLA 3KJXA 1BDHA 2IU7A 4Z5CA 3BD1A 2PUDA 1E3OC 3G5GA 5K98B 2PUCA 1B0NA 3QQ6A 4PU4C 1O4XA 2MQKA 1X2LA 1ZPQA 4I8TA 4X4IA 3RZZA 1UTXA 4X4FA 3D1NI 4MCTA 2A6CA 2GZUA 3F6WA 5A7LA 1QPZA 1UXCA 3JXBC 1DWKA 2IVGA 4X4BA 1HF0A 2WUSR 1QP0A 4JCXA 3QYXA 3LFPA 3ZKCA 4I6UA 1ZZ7A 2KPJA 4GHJA 1Y9QA 1ZUGA 1ZS4A 1CQTA 2PUFA 3MLFA 2KZ8A 2OFYA 2PUGA 1UXDA 3CLCA 2L49A 1RZRA 2XSDC 2R1JL 2LYQA 3OQOA 2AXUA 4YG1A 2BNOA 1RZSA 1WH6A 4X4GA 4YG4A 4X4DA 2KEIA 3DNVB 3UFDA 1GT0C 3FYMA 3GN5B 2XIUA 4IA8A 1DW9A 1EFAA 4F8DA 2L8NA 3FMYA 3TRBA 3BS3A 3OP9A 1QP4A 1NEQA 2BNMA 1ADRA 2CSFA 3L1PA 1RPEL 1S7EA 1VPWA 4X4HA 1L1MA
chains in the Genus database with same CATH superfamily
1JFSA 4JQDA 4EK9A 1JFTA 4X4EA 2ICTA 1QB2A 4NDWA 3S8QA 2LNMA 3A9ZA 2XXQA 4HRAA 4EZIA 2BNNA 2PPXA 1LMB3 2AUWA 1CJGA 1R69A 4YBAA 2LCVA 3SCFA 1X57A 2H8RA 2IUOA 3R09A 2PXUA 3QWGA 2WIUB 2MXDA 3KL4A 3HZIB 2PUBA 3G7DA 5DT2A 5DRTA 3A9XA 2LLWA 4FBIA 2LYRA 3SR4A 2JVLA 4IWRA 1YSEA 4ER5A 3OKZA 3LISA 2GRLA 2IU7A 4Z5CA 3GZCA 5K98B 1O4XA 4X4IA 3D1NI 3PE5A 2A6CA 2GZUA 1QPZA 2PXVA 4JCXA 2KPJA 4GHJA 3NDBB 2PUFA 2KZ8A 2PUGA 2R1JL 4YG4A 4ER6A 3DNVB 3FYMA 4IA8A 3FMYA 3BS3A 1RPEL 3L1PA 1S7EA 1VPWA 1L1MA 2PUEA 3SCHA 3JXCL 3F51A 2KEJA 3M9LA 2BJCA 2HSGA 2R63A 3QOWA 1RIOA 4DE9A 4EKIA 3GUUA 2AXZA 3CROL 4J1XA 2XCJA 2XI8A 1U2ZA 2HINA 2O49A 4EQZA 2EWTA 2XXAA 3KXAA 4PU8A 1ZZ6A 1JH9A 1LQCA 5DSXA 3SCGA 3KZ3A 1ZAYA 4YG7B 2EF8A 3ZHIA 4GQMA 3G0TA 4Z5DA 4OB4A 4EKGA 1XWRA 2L1PA 4OBMA 4X4CA 4PU7A 2PXBA 2ODRD 1PRVA 2CROA 2J7UA 3OQNA 2EBYA 3GZDA 4MCXA 2PXTA 2HFZA 2PXFA 3BD1A 2PUDA 2PUCA 2MQKA 1X2LA 1ZPQA 4I8TA 3F6WA 2PXQA 3JXBC 4ER0A 5DTMA 2FFHA 3ZKCA 1ZZ7A 1CQTA 1UXDA 2HCSA 2L49A 3OQOA 2AXUA 4YG1A 1HQ1A 4X4DA 3GN5B 4ER3A 3TRBA 3F52A 1LCCA 2JCGA 2AW6A 4JCYA 3TEPA 4Y42A 3UWPA 1OSLA 2PXEA 4Q2JA 1WIZA 2O4AA 2B5AA 1ZZBA 1ZZ9A 1RZRD 4PU3C 1LCDA 2VEOA 3SX0A 4DE8A 2ICPA 4YARA 3QF3A 2LYKA 2FJRA 1R63A 2IVBA 1LLIA 2PIJA 3EUSA 1SQ8A 1PRAA 2PXLA 1ZZCA 3GBFA 3QFIA 3OQMA 3BDNA 1IC8A 1POUA 2GRMA 2XXPA 4I6RA 3IVPA 1AU7A 4I6TA 5DTRA 2LYSA 1QQAA 2IVQA 3R1FA 2JQEA 1WETA 4WVLA 3VK0A 1WH8A 4O8BA 3KJXA 1B0NA 3QQ6A 4PU4C 3ZPXA 3QOXA 3RZZA 4MCTA 2IVGA 4X4BA 2WUSR 3QYXA 3LFPA 4I6UA 1Y9QA 1ZUGA 1ZS4A 3MLFA 2J7WA 3CLCA 1RZRA 3DM5A 2XSDC 2PXDA 5GAHi 2BNOA 1OCTC 1WH6A 4X4GA 3UFDA 1GT0C 2XIUA 1DW9A 1EFAA 4F8DA 3OP9A 3NROA 2CSFA 5DRYA 4X4HA 3CECA 4J1WA 2PE5A 2O38A 2MEZA 2YBDA 3U3WA 2AXVA 3FYAA 1QQBA 2D5VA 3O9XA 1Y7YA 3TFLA 2PXKA 2LYLA 1QZXA 1PERL 1BDIA 2OR1L 3ZHMA 4Z59A 4FN3A 1PRUA 4IVZA 2LYPA 4Z58A 3MEJA 3B7HA 1JWLA 2PUAA 2V3CC 2AWIA 2M4HA 1ZZ8A 1MFQC 3GZDC 3H5TA 3JXDL 3OMTA 3PXPA 1QP7A 5JUWA 3LQXA 3GN5A 4Z5HA 3VWSA 3A9YA 1PNRA 5DTQA 1ZVVA 2LYJA 1NERA 2XJ3A 3OWQA 2KEKA 2IV1A 3NZLA 1BDHA 1E3OC 3G5GA 2PXPA 1UTXA 4X4FA 5A7LA 1UXCA 1DWKA 1HF0A 1QP0A 4ER7A 2HCNA 2OFYA 3TELA 2LLVA 2LYQA 3ME5A 1DULA 3NXHA 1NW3A 1RZSA 2KEIA 5GAGi 2L8NA 1QP4A 1NEQA 2BNMA 1ADRA
chains in the Genus database with same CATH topology
3F52A 3CECA 1LCCA 4J1WA 2JCGA 2PE5A 1JFSA 2O38A 2PUEA 4JQDA 3SCHA 2MEZA 1JFTA 3U3WA 3JXCL 2AW6A 3F51A 2KEJA 2AXVA 4X4EA 2ICTA 4Y42A 4JCYA 3FYAA 1QQBA 2D5VA 4NDWA 3S8QA 1OSLA 2BJCA 3O9XA 1WIZA 2O4AA 2HSGA 1Y7YA 2B5AA 2R63A 1ZZBA 2LYLA 1ZZ9A 1RZRD 1RIOA 4PU3C 1LCDA 1PERL 1BDIA 2OR1L 3ZHMA 2AXZA 3CROL 4J1XA 2ICPA 2XCJA 4YARA 4FN3A 4Z59A 3QF3A 2XI8A 2LYKA 1PRUA 2FJRA 4IVZA 2HINA 2LYPA 2BNNA 2PPXA 1R63A 2O49A 4Z58A 2EWTA 2IVBA 1LMB3 3B7HA 1JWLA 1LLIA 2AUWA 1CJGA 3KXAA 2PIJA 3EUSA 4PU8A 2PUAA 1R69A 4YBAA 1ZZ6A 2AWIA 1JH9A 1LQCA 1ZZ8A 1SQ8A 3SCGA 2LCVA 3KZ3A 3SCFA 1PRAA 1ZZCA 1ZAYA 4YG7B 1X57A 2H8RA 2EF8A 2IUOA 3H5TA 3ZHIA 3GBFA 4GQMA 3QWGA 4Z5DA 3OQMA 3JXDL 2WIUB 3OMTA 3BDNA 3HZIB 4OB4A 2PUBA 1IC8A 3PXPA 3G7DA 1XWRA 1POUA 2GRMA 1OCTC 1QP7A 4X4CA 4I6RA 4FBIA 2LYRA 4PU7A 3GN5A 3IVPA 4Z5HA 1AU7A 4I6TA 1PNRA 2JVLA 2LYSA 1PRVA 1QQAA 2CROA 2IVQA 2LYJA 1ZVVA 1YSEA 1NERA 3OQNA 3R1FA 4IWRA 2EBYA 2XJ3A 1WETA 2KEKA 2IV1A 3VK0A 1WH8A 3LISA 4MCXA 4O8BA 2GRLA 3KJXA 1BDHA 2IU7A 4Z5CA 3BD1A 2PUDA 1E3OC 3G5GA 5K98B 2PUCA 1B0NA 3QQ6A 4PU4C 1O4XA 2MQKA 1X2LA 1ZPQA 4I8TA 4X4IA 3RZZA 1UTXA 4X4FA 3D1NI 4MCTA 2A6CA 2GZUA 3F6WA 5A7LA 1QPZA 1UXCA 3JXBC 1DWKA 2IVGA 4X4BA 1HF0A 2WUSR 1QP0A 4JCXA 3QYXA 3LFPA 3ZKCA 4I6UA 1ZZ7A 2KPJA 4GHJA 1Y9QA 1ZUGA 1ZS4A 1CQTA 2PUFA 3MLFA 2KZ8A 2OFYA 2PUGA 1UXDA 3CLCA 2L49A 1RZRA 2XSDC 2R1JL 2LYQA 3OQOA 2AXUA 4YG1A 2BNOA 1RZSA 1WH6A 4X4GA 4YG4A 4X4DA 2KEIA 3DNVB 3UFDA 1GT0C 3FYMA 3GN5B 2XIUA 4IA8A 1DW9A 1EFAA 4F8DA 2L8NA 3FMYA 3TRBA 3BS3A 3OP9A 1QP4A 1NEQA 2BNMA 1ADRA 2CSFA 3L1PA 1RPEL 1S7EA 1VPWA 4X4HA 1L1MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F52 A;  3CEC A;  1LCC A;  4J1W A;  2JCG A;  2PE5 A;  1JFS A;  2O38 A;  2PUE A;  4JQD A;  3SCH A;  2MEZ A;  1JFT A;  3U3W A;  3JXC L;  2AW6 A;  3F51 A;  2KEJ A;  2AXV A;  4X4E A;  2ICT A;  4Y42 A;  4JCY A;  3FYA A;  1QQB A;  2D5V A;  4NDW A;  3S8Q A;  1OSL A;  2BJC A;  3O9X A;  1WIZ A;  2O4A A;  2HSG A;  1Y7Y A;  2B5A A;  2R63 A;  1ZZB A;  2LYL A;  1ZZ9 A;  1RZR D;  1RIO A;  4PU3 C;  1LCD A;  1PER L;  1BDI A;  2OR1 L;  3ZHM A;  2AXZ A;  3CRO L;  4J1X A;  2ICP A;  2XCJ A;  4YAR A;  4FN3 A;  4Z59 A;  3QF3 A;  2XI8 A;  2LYK A;  1PRU A;  2FJR A;  4IVZ A;  2HIN A;  2LYP A;  2BNN A;  2PPX A;  1R63 A;  2O49 A;  4Z58 A;  2EWT A;  2IVB A;  1LMB 3;  3B7H A;  1JWL A;  1LLI A;  2AUW A;  1CJG A;  3KXA A;  2PIJ A;  3EUS A;  4PU8 A;  2PUA A;  1R69 A;  4YBA A;  1ZZ6 A;  2AWI A;  1JH9 A;  1LQC A;  1ZZ8 A;  1SQ8 A;  3SCG A;  2LCV A;  3KZ3 A;  3SCF A;  1PRA A;  1ZZC A;  1ZAY A;  4YG7 B;  1X57 A;  2H8R A;  2EF8 A;  2IUO A;  3H5T A;  3ZHI A;  3GBF A;  4GQM A;  3QWG A;  4Z5D A;  3OQM A;  3JXD L;  2WIU B;  3OMT A;  3BDN A;  3HZI B;  4OB4 A;  2PUB A;  1IC8 A;  3PXP A;  3G7D A;  1XWR A;  1POU A;  2GRM A;  1OCT C;  1QP7 A;  4X4C A;  4I6R A;  4FBI A;  2LYR A;  4PU7 A;  3GN5 A;  3IVP A;  4Z5H A;  1AU7 A;  4I6T A;  1PNR A;  2JVL A;  2LYS A;  1PRV A;  1QQA A;  2CRO A;  2IVQ A;  2LYJ A;  1ZVV A;  1YSE A;  1NER A;  3OQN A;  3R1F A;  4IWR A;  2EBY A;  2XJ3 A;  1WET A;  2KEK A;  2IV1 A;  3VK0 A;  1WH8 A;  3LIS A;  4MCX A;  4O8B A;  2GRL A;  3KJX A;  1BDH A;  2IU7 A;  4Z5C A;  3BD1 A;  2PUD A;  1E3O C;  3G5G A;  5K98 B;  2PUC A;  1B0N A;  3QQ6 A;  4PU4 C;  1O4X A;  2MQK A;  1X2L A;  1ZPQ A;  4I8T A;  4X4I A;  3RZZ A;  1UTX A;  4X4F A;  3D1N I;  4MCT A;  2A6C A;  2GZU A;  3F6W A;  5A7L A;  1QPZ A;  1UXC A;  3JXB C;  1DWK A;  2IVG A;  4X4B A;  1HF0 A;  2WUS R;  1QP0 A;  4JCX A;  3QYX A;  3LFP A;  3ZKC A;  4I6U A;  1ZZ7 A;  2KPJ A;  4GHJ A;  1Y9Q A;  1ZUG A;  1ZS4 A;  1CQT A;  2PUF A;  3MLF A;  2KZ8 A;  2OFY A;  2PUG A;  1UXD A;  3CLC A;  2L49 A;  1RZR A;  2XSD C;  2R1J L;  2LYQ A;  3OQO A;  2AXU A;  4YG1 A;  2BNO A;  1RZS A;  1WH6 A;  4X4G A;  4YG4 A;  4X4D A;  2KEI A;  3DNV B;  3UFD A;  1GT0 C;  3FYM A;  3GN5 B;  2XIU A;  4IA8 A;  1DW9 A;  1EFA A;  4F8D A;  2L8N A;  3FMY A;  3TRB A;  3BS3 A;  3OP9 A;  1QP4 A;  1NEQ A;  2BNM A;  1ADR A;  2CSF A;  3L1P A;  1RPE L;  1S7E A;  1VPW A;  4X4H A;  1L1M A; 
#chains in the Genus database with same CATH topology
 1JFS A;  4JQD A;  4EK9 A;  1JFT A;  4X4E A;  2ICT A;  1QB2 A;  4NDW A;  3S8Q A;  2LNM A;  3A9Z A;  2XXQ A;  4HRA A;  4EZI A;  2BNN A;  2PPX A;  1LMB 3;  2AUW A;  1CJG A;  1R69 A;  4YBA A;  2LCV A;  3SCF A;  1X57 A;  2H8R A;  2IUO A;  3R09 A;  2PXU A;  3QWG A;  2WIU B;  2MXD A;  3KL4 A;  3HZI B;  2PUB A;  3G7D A;  5DT2 A;  5DRT A;  3A9X A;  2LLW A;  4FBI A;  2LYR A;  3SR4 A;  2JVL A;  4IWR A;  1YSE A;  4ER5 A;  3OKZ A;  3LIS A;  2GRL A;  2IU7 A;  4Z5C A;  3GZC A;  5K98 B;  1O4X A;  4X4I A;  3D1N I;  3PE5 A;  2A6C A;  2GZU A;  1QPZ A;  2PXV A;  4JCX A;  2KPJ A;  4GHJ A;  3NDB B;  2PUF A;  2KZ8 A;  2PUG A;  2R1J L;  4YG4 A;  4ER6 A;  3DNV B;  3FYM A;  4IA8 A;  3FMY A;  3BS3 A;  1RPE L;  3L1P A;  1S7E A;  1VPW A;  1L1M A;  2PUE A;  3SCH A;  3JXC L;  3F51 A;  2KEJ A;  3M9L A;  2BJC A;  2HSG A;  2R63 A;  3QOW A;  1RIO A;  4DE9 A;  4EKI A;  3GUU A;  2AXZ A;  3CRO L;  4J1X A;  2XCJ A;  2XI8 A;  1U2Z A;  2HIN A;  2O49 A;  4EQZ A;  2EWT A;  2XXA A;  3KXA A;  4PU8 A;  1ZZ6 A;  1JH9 A;  1LQC A;  5DSX A;  3SCG A;  3KZ3 A;  1ZAY A;  4YG7 B;  2EF8 A;  3ZHI A;  4GQM A;  3G0T A;  4Z5D A;  4OB4 A;  4EKG A;  1XWR A;  2L1P A;  4OBM A;  4X4C A;  4PU7 A;  2PXB A;  2ODR D;  1PRV A;  2CRO A;  2J7U A;  3OQN A;  2EBY A;  3GZD A;  4MCX A;  2PXT A;  2HFZ A;  2PXF A;  3BD1 A;  2PUD A;  2PUC A;  2MQK A;  1X2L A;  1ZPQ A;  4I8T A;  3F6W A;  2PXQ A;  3JXB C;  4ER0 A;  5DTM A;  2FFH A;  3ZKC A;  1ZZ7 A;  1CQT A;  1UXD A;  2HCS A;  2L49 A;  3OQO A;  2AXU A;  4YG1 A;  1HQ1 A;  4X4D A;  3GN5 B;  4ER3 A;  3TRB A;  3F52 A;  1LCC A;  2JCG A;  2AW6 A;  4JCY A;  3TEP A;  4Y42 A;  3UWP A;  1OSL A;  2PXE A;  4Q2J A;  1WIZ A;  2O4A A;  2B5A A;  1ZZB A;  1ZZ9 A;  1RZR D;  4PU3 C;  1LCD A;  2VEO A;  3SX0 A;  4DE8 A;  2ICP A;  4YAR A;  3QF3 A;  2LYK A;  2FJR A;  1R63 A;  2IVB A;  1LLI A;  2PIJ A;  3EUS A;  1SQ8 A;  1PRA A;  2PXL A;  1ZZC A;  3GBF A;  3QFI A;  3OQM A;  3BDN A;  1IC8 A;  1POU A;  2GRM A;  2XXP A;  4I6R A;  3IVP A;  1AU7 A;  4I6T A;  5DTR A;  2LYS A;  1QQA A;  2IVQ A;  3R1F A;  2JQE A;  1WET A;  4WVL A;  3VK0 A;  1WH8 A;  4O8B A;  3KJX A;  1B0N A;  3QQ6 A;  4PU4 C;  3ZPX A;  3QOX A;  3RZZ A;  4MCT A;  2IVG A;  4X4B A;  2WUS R;  3QYX A;  3LFP A;  4I6U A;  1Y9Q A;  1ZUG A;  1ZS4 A;  3MLF A;  2J7W A;  3CLC A;  1RZR A;  3DM5 A;  2XSD C;  2PXD A;  5GAH i;  2BNO A;  1OCT C;  1WH6 A;  4X4G A;  3UFD A;  1GT0 C;  2XIU A;  1DW9 A;  1EFA A;  4F8D A;  3OP9 A;  3NRO A;  2CSF A;  5DRY A;  4X4H A;  3CEC A;  4J1W A;  2PE5 A;  2O38 A;  2MEZ A;  2YBD A;  3U3W A;  2AXV A;  3FYA A;  1QQB A;  2D5V A;  3O9X A;  1Y7Y A;  3TFL A;  2PXK A;  2LYL A;  1QZX A;  1PER L;  1BDI A;  2OR1 L;  3ZHM A;  4Z59 A;  4FN3 A;  1PRU A;  4IVZ A;  2LYP A;  4Z58 A;  3MEJ A;  3B7H A;  1JWL A;  2PUA A;  2V3C C;  2AWI A;  2M4H A;  1ZZ8 A;  1MFQ C;  3GZD C;  3H5T A;  3JXD L;  3OMT A;  3PXP A;  1QP7 A;  5JUW A;  3LQX A;  3GN5 A;  4Z5H A;  3VWS A;  3A9Y A;  1PNR A;  5DTQ A;  1ZVV A;  2LYJ A;  1NER A;  2XJ3 A;  3OWQ A;  2KEK A;  2IV1 A;  3NZL A;  1BDH A;  1E3O C;  3G5G A;  2PXP A;  1UTX A;  4X4F A;  5A7L A;  1UXC A;  1DWK A;  1HF0 A;  1QP0 A;  4ER7 A;  2HCN A;  2OFY A;  3TEL A;  2LLV A;  2LYQ A;  3ME5 A;  1DUL A;  3NXH A;  1NW3 A;  1RZS A;  2KEI A;  5GAG i;  2L8N A;  1QP4 A;  1NEQ A;  2BNM A;  1ADR A; 
#chains in the Genus database with same CATH homology
 3F52 A;  3CEC A;  1LCC A;  4J1W A;  2JCG A;  2PE5 A;  1JFS A;  2O38 A;  2PUE A;  4JQD A;  3SCH A;  2MEZ A;  1JFT A;  3U3W A;  3JXC L;  2AW6 A;  3F51 A;  2KEJ A;  2AXV A;  4X4E A;  2ICT A;  4Y42 A;  4JCY A;  3FYA A;  1QQB A;  2D5V A;  4NDW A;  3S8Q A;  1OSL A;  2BJC A;  3O9X A;  1WIZ A;  2O4A A;  2HSG A;  1Y7Y A;  2B5A A;  2R63 A;  1ZZB A;  2LYL A;  1ZZ9 A;  1RZR D;  1RIO A;  4PU3 C;  1LCD A;  1PER L;  1BDI A;  2OR1 L;  3ZHM A;  2AXZ A;  3CRO L;  4J1X A;  2ICP A;  2XCJ A;  4YAR A;  4FN3 A;  4Z59 A;  3QF3 A;  2XI8 A;  2LYK A;  1PRU A;  2FJR A;  4IVZ A;  2HIN A;  2LYP A;  2BNN A;  2PPX A;  1R63 A;  2O49 A;  4Z58 A;  2EWT A;  2IVB A;  1LMB 3;  3B7H A;  1JWL A;  1LLI A;  2AUW A;  1CJG A;  3KXA A;  2PIJ A;  3EUS A;  4PU8 A;  2PUA A;  1R69 A;  4YBA A;  1ZZ6 A;  2AWI A;  1JH9 A;  1LQC A;  1ZZ8 A;  1SQ8 A;  3SCG A;  2LCV A;  3KZ3 A;  3SCF A;  1PRA A;  1ZZC A;  1ZAY A;  4YG7 B;  1X57 A;  2H8R A;  2EF8 A;  2IUO A;  3H5T A;  3ZHI A;  3GBF A;  4GQM A;  3QWG A;  4Z5D A;  3OQM A;  3JXD L;  2WIU B;  3OMT A;  3BDN A;  3HZI B;  4OB4 A;  2PUB A;  1IC8 A;  3PXP A;  3G7D A;  1XWR A;  1POU A;  2GRM A;  1OCT C;  1QP7 A;  4X4C A;  4I6R A;  4FBI A;  2LYR A;  4PU7 A;  3GN5 A;  3IVP A;  4Z5H A;  1AU7 A;  4I6T A;  1PNR A;  2JVL A;  2LYS A;  1PRV A;  1QQA A;  2CRO A;  2IVQ A;  2LYJ A;  1ZVV A;  1YSE A;  1NER A;  3OQN A;  3R1F A;  4IWR A;  2EBY A;  2XJ3 A;  1WET A;  2KEK A;  2IV1 A;  3VK0 A;  1WH8 A;  3LIS A;  4MCX A;  4O8B A;  2GRL A;  3KJX A;  1BDH A;  2IU7 A;  4Z5C A;  3BD1 A;  2PUD A;  1E3O C;  3G5G A;  5K98 B;  2PUC A;  1B0N A;  3QQ6 A;  4PU4 C;  1O4X A;  2MQK A;  1X2L A;  1ZPQ A;  4I8T A;  4X4I A;  3RZZ A;  1UTX A;  4X4F A;  3D1N I;  4MCT A;  2A6C A;  2GZU A;  3F6W A;  5A7L A;  1QPZ A;  1UXC A;  3JXB C;  1DWK A;  2IVG A;  4X4B A;  1HF0 A;  2WUS R;  1QP0 A;  4JCX A;  3QYX A;  3LFP A;  3ZKC A;  4I6U A;  1ZZ7 A;  2KPJ A;  4GHJ A;  1Y9Q A;  1ZUG A;  1ZS4 A;  1CQT A;  2PUF A;  3MLF A;  2KZ8 A;  2OFY A;  2PUG A;  1UXD A;  3CLC A;  2L49 A;  1RZR A;  2XSD C;  2R1J L;  2LYQ A;  3OQO A;  2AXU A;  4YG1 A;  2BNO A;  1RZS A;  1WH6 A;  4X4G A;  4YG4 A;  4X4D A;  2KEI A;  3DNV B;  3UFD A;  1GT0 C;  3FYM A;  3GN5 B;  2XIU A;  4IA8 A;  1DW9 A;  1EFA A;  4F8D A;  2L8N A;  3FMY A;  3TRB A;  3BS3 A;  3OP9 A;  1QP4 A;  1NEQ A;  2BNM A;  1ADR A;  2CSF A;  3L1P A;  1RPE L;  1S7E A;  1VPW A;  4X4H A;  1L1M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...