3JXCL

Crystal structure of the p22 c2 repressor protein in complex with synthetic operator 9t in the presence of tl+
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
66
structure length
66
Chain Sequence
TQLMGERIRARRKKLKIRQAALGKMVGVSNVAISQWERSETEPNGENLLALSKALQCSPDYLLKGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords 5'-D(*CP*AP*TP*TP*TP*AP*AP*GP*AP*TP*AP*TP*CP*TP*TP*AP*AP*AP*
publication title Sequence Recognition of DNA by Protein-Induced Conformational Transitions.
pubmed doi rcsb
source organism Enterobacteria phage p22
total genus 21
structure length 66
sequence length 66
chains with identical sequence R
ec nomenclature
pdb deposition date 2009-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF01381 HTH_3 Helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 3jxcL00
2AXVA 2LYJA 3EUSA 4PU8A 4IVZA 1JFTA 1NEQA 1X2LA 2IU7A 1UXCA 2IUOA 2PIJA 3QQ6A 2AXUA 1Y9QA 2L49A 2PE5A 3RZZA 4F8DA 3F6WA 1BDIA 1ZUGA 2EWTA 3IVPA 4X4IA 4PU3C 3L1PA 3SCHA 2XIUA 3FMYA 3HZIB 1QP4A 1WH6A 3LISA 1HF0A 2O4AA 3ZKCA 1R63A 1RZSA 4Z5CA 1S7EA 4YG4A 1ZZ7A 1ZPQA 1ZZBA 2IV1A 3TRBA 3GN5A 3OQOA 2AWIA 4X4GA 2OR1L 2PUBA 2O49A 4JCXA 2IVQA 3BDNA 1RZRA 1ZZ6A 1UXDA 3JXCL 2H8RA 2MQKA 1QPZA 2IVBA 3VK0A 1LCCA 2FJRA 2OFYA 2BNMA 2LYKA 1WIZA 2HINA 3FYMA 4I6RA 2HSGA 2R63A 3OMTA 1B0NA 3D1NI 5A7LA 1QP0A 1PRUA 2BNOA 4YARA 2KEKA 2MEZA 1BDHA 2A6CA 2LYQA 1OSLA 4PU7A 1ZS4A 2D5VA 3CECA 3H5TA 3R1FA 2PUFA 1WH8A 1E3OC 3F52A 1ADRA 2KEJA 4J1WA 4PU4C 2JVLA 2XSDC 1LMB3 2WIUB 3MLFA 1PRVA 2PUAA 3KJXA 4GHJA 3GBFA 1ZZCA 4YG1A 4MCXA 1CJGA 2ICPA 2LYLA 1NERA 4I6TA 2BJCA 3GN5B 3G5GA 4X4BA 1O4XA 3ZHMA 2XCJA 1JFSA 1UTXA 4Z58A 2XI8A 1IC8A 1XWRA 1AU7A 2PUDA 2O38A 4IA8A 3S8QA 3FYAA 1LLIA 3KXAA 4MCTA 1RZRD 1POUA 1R69A 1JH9A 2ICTA 2LCVA 3DNVB 1SQ8A 1X57A 4O8BA 1PNRA 3QF3A 1Y7YA 3O9XA 4X4DA 3U3WA 1WETA 4FBIA 4YG7B 1ZAYA 1ZZ9A 3OQNA 2LYPA 3F51A 1PRAA 2AXZA 4X4EA 2KEIA 4NDWA 1GT0C 4J1XA 4Z5HA 3OQMA 1LCDA 1ZVVA 1EFAA 2AUWA 2L8NA 3SCFA 1OCTC 1RPEL 4YBAA 4X4CA 3ZHIA 3LFPA 4GQMA 2B5AA 2JCGA 2LYSA 1ZZ8A 2EF8A 2GZUA 2PUGA 2XJ3A 3CROL 4X4FA 2KPJA 1RIOA 3BS3A 3PXPA 1LQCA 2WUSR 2GRMA 2BNNA 4I6UA 1L1MA 4JCYA 3G7DA 2GRLA 2R1JL 1QQBA 1VPWA 4Z5DA 1JWLA 4I8TA 4OB4A 1DW9A 4FN3A 2CROA 2PPXA 2LYRA 3OP9A 2CSFA 3SCGA 3BD1A 4X4HA 2IVGA 5K98B 4Y42A 1DWKA 1YSEA 3B7HA 3JXDL 3UFDA 2PUEA 3QWGA 2EBYA 1CQTA 1QP7A 3CLCA 2PUCA 4Z59A 3KZ3A 1QQAA 2KZ8A 1PERL 2AW6A 3QYXA 3JXBC 4JQDA 4IWRA
chains in the Genus database with same CATH superfamily
2AXVA 4PU8A 3EUSA 3NXHA 1X2LA 2IU7A 2IUOA 3QQ6A 3FMYA 3HZIB 2PXFA 3TFLA 2O4AA 4EQZA 1ZZ7A 2O49A 2H8RA 3VK0A 2OFYA 2LYKA 2HSGA 3OMTA 1B0NA 2V3CC 1PRUA 4WVLA 3UWPA 3ME5A 3QFIA 2LYQA 3H5TA 1E3OC 3KJXA 3GBFA 4YG1A 4MCXA 2ICPA 3GZDA 1O4XA 3ZHMA 1JFSA 1XWRA 2PUDA 3DM5A 2PXBA 2LLVA 3OKZA 3FYAA 1LLIA 2LCVA 4O8BA 3QF3A 5DRYA 3U3WA 3NDBB 4FBIA 4NDWA 4EK9A 5DTQA 1LCDA 3OQMA 1EFAA 1RPEL 4YBAA 4X4CA 2PXUA 2B5AA 3QOWA 2EF8A 2HCNA 5DRTA 1QZXA 2XJ3A 1RIOA 3PXPA 1LQCA 2R1JL 1QQBA 1JWLA 3OP9A 5DTRA 1DWKA 3JXDL 4DE8A 1QP7A 3CLCA 4Z59A 4JQDA 2AW6A 3JXBC 2LYJA 4IVZA 2AXUA 1Y9QA 3F6WA 3TELA 4PU3C 1QP4A 3A9XA 3A9ZA 4Z5CA 2LLWA 4YG4A 3TRBA 4X4GA 2PUBA 2M4HA 3BDNA 1QPZA 4I6RA 3QOXA 2XXPA 5DSXA 2PXVA 2KEKA 3VWSA 2MEZA 1BDHA 2A6CA 1OSLA 4ER6A 1ZS4A 2D5VA 3CECA 2PXQA 2HCSA 1WH8A 4PU4C 2WIUB 2PUAA 1CJGA 3GN5B 2J7WA 2XI8A 1AU7A 2O38A 3LQXA 4IA8A 4ER7A 1RZRD 1R69A 2ICTA 3DNVB 1SQ8A 1X57A 3O9XA 4X4DA 2PXEA 1WETA 2LNMA 3OQNA 1PRAA 2AXZA 4X4EA 1NW3A 1GT0C 3NZLA 3TEPA 1ZVVA 2LYSA 3CROL 2KPJA 4EZIA 2WUSR 2GRMA 2BNNA 4I6UA 2GRLA 1VPWA 3GZDC 1DW9A 3SCGA 2LYRA 4X4HA 3BD1A 4ER5A 5K98B 1DULA 1YSEA 3KZ3A 1QQAA 1PERL 5DT2A 5GAHi 4IWRA 1JFTA 1NEQA 3ZPXA 2PIJA 2L49A 2PE5A 3RZZA 4F8DA 1ZUGA 2EWTA 3IVPA 2XIUA 3ZKCA 1RZSA 1ZPQA 1ZZBA 3OWQA 3GN5A 3SR4A 3OQOA 2OR1L 1QB2A 3M9LA 2IVQA 1RZRA 1UXDA 2FJRA 1HQ1A 3PE5A 5DTMA 3D1NI 1QP0A 4OBMA 3F52A 2KEJA 2XSDC 2JVLA 3MLFA 2JQEA 1ZZCA 2LYLA 2BJCA 4ER3A 2PXPA 4ER0A 2XCJA 1UTXA 4Z58A 2MXDA 3GUUA 1Y7YA 1ZZ9A 3F51A 2FFHA 4Z5HA 3R09A 2AUWA 2L8NA 1OCTC 3ZHIA 3LFPA 2JCGA 2YBDA 2L1PA 1U2ZA 4EKIA 2GZUA 4X4FA 3KL4A 4JCYA 1L1MA 3G7DA 3SX0A 4FN3A 2CROA 2CSFA 4HRAA 2PUEA 3QWGA 3NROA 1MFQC 4DE9A 1UXCA 3A9YA 1BDIA 3S8QA 3L1PA 4X4IA 3SCHA 1WH6A 3LISA 1HF0A 1R63A 5JUWA 1S7EA 2PXTA 2IV1A 2AWIA 4JCXA 4Q2JA 1ZZ6A 3JXCL 2MQKA 2IVBA 1LCCA 2BNMA 1WIZA 2HINA 3FYMA 2PXKA 2R63A 5A7LA 2BNOA 2J7UA 4YARA 4PU7A 3R1FA 2PUFA 2XXAA 2PXDA 1ADRA 4J1WA 1LMB3 1PRVA 2HFZA 4GHJA 2XXQA 3G0TA 1NERA 4I6TA 3G5GA 4X4BA 1IC8A 3MEJA 3KXAA 4MCTA 1POUA 1JH9A 1PNRA 2PXLA 4YG7B 1ZAYA 2ODRD 2LYPA 2KEIA 4J1XA 3SCFA 4GQMA 1ZZ8A 2PUGA 2VEOA 4EKGA 3BS3A 5GAGi 4Z5DA 4I8TA 4OB4A 2PPXA 3GZCA 2IVGA 4Y42A 3B7HA 3UFDA 2EBYA 1CQTA 2PUCA 2KZ8A 3QYXA
chains in the Genus database with same CATH topology
2AXVA 2LYJA 3EUSA 4PU8A 4IVZA 1JFTA 1NEQA 1X2LA 2IU7A 1UXCA 2IUOA 2PIJA 3QQ6A 2AXUA 1Y9QA 2L49A 2PE5A 3RZZA 4F8DA 3F6WA 1BDIA 1ZUGA 2EWTA 3IVPA 4X4IA 4PU3C 3L1PA 3SCHA 2XIUA 3FMYA 3HZIB 1QP4A 1WH6A 3LISA 1HF0A 2O4AA 3ZKCA 1R63A 1RZSA 4Z5CA 1S7EA 4YG4A 1ZZ7A 1ZPQA 1ZZBA 2IV1A 3TRBA 3GN5A 3OQOA 2AWIA 4X4GA 2OR1L 2PUBA 2O49A 4JCXA 2IVQA 3BDNA 1RZRA 1ZZ6A 1UXDA 3JXCL 2H8RA 2MQKA 1QPZA 2IVBA 3VK0A 1LCCA 2FJRA 2OFYA 2BNMA 2LYKA 1WIZA 2HINA 3FYMA 4I6RA 2HSGA 2R63A 3OMTA 1B0NA 3D1NI 5A7LA 1QP0A 1PRUA 2BNOA 4YARA 2KEKA 2MEZA 1BDHA 2A6CA 2LYQA 1OSLA 4PU7A 1ZS4A 2D5VA 3CECA 3H5TA 3R1FA 2PUFA 1WH8A 1E3OC 3F52A 1ADRA 2KEJA 4J1WA 4PU4C 2JVLA 2XSDC 1LMB3 2WIUB 3MLFA 1PRVA 2PUAA 3KJXA 4GHJA 3GBFA 1ZZCA 4YG1A 4MCXA 1CJGA 2ICPA 2LYLA 1NERA 4I6TA 2BJCA 3GN5B 3G5GA 4X4BA 1O4XA 3ZHMA 2XCJA 1JFSA 1UTXA 4Z58A 2XI8A 1IC8A 1XWRA 1AU7A 2PUDA 2O38A 4IA8A 3S8QA 3FYAA 1LLIA 3KXAA 4MCTA 1RZRD 1POUA 1R69A 1JH9A 2ICTA 2LCVA 3DNVB 1SQ8A 1X57A 4O8BA 1PNRA 3QF3A 1Y7YA 3O9XA 4X4DA 3U3WA 1WETA 4FBIA 4YG7B 1ZAYA 1ZZ9A 3OQNA 2LYPA 3F51A 1PRAA 2AXZA 4X4EA 2KEIA 4NDWA 1GT0C 4J1XA 4Z5HA 3OQMA 1LCDA 1ZVVA 1EFAA 2AUWA 2L8NA 3SCFA 1OCTC 1RPEL 4YBAA 4X4CA 3ZHIA 3LFPA 4GQMA 2B5AA 2JCGA 2LYSA 1ZZ8A 2EF8A 2GZUA 2PUGA 2XJ3A 3CROL 4X4FA 2KPJA 1RIOA 3BS3A 3PXPA 1LQCA 2WUSR 2GRMA 2BNNA 4I6UA 1L1MA 4JCYA 3G7DA 2GRLA 2R1JL 1QQBA 1VPWA 4Z5DA 1JWLA 4I8TA 4OB4A 1DW9A 4FN3A 2CROA 2PPXA 2LYRA 3OP9A 2CSFA 3SCGA 3BD1A 4X4HA 2IVGA 5K98B 4Y42A 1DWKA 1YSEA 3B7HA 3JXDL 3UFDA 2PUEA 3QWGA 2EBYA 1CQTA 1QP7A 3CLCA 2PUCA 4Z59A 3KZ3A 1QQAA 2KZ8A 1PERL 2AW6A 3QYXA 3JXBC 4JQDA 4IWRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AXV A;  2LYJ A;  3EUS A;  4PU8 A;  4IVZ A;  1JFT A;  1NEQ A;  1X2L A;  2IU7 A;  1UXC A;  2IUO A;  2PIJ A;  3QQ6 A;  2AXU A;  1Y9Q A;  2L49 A;  2PE5 A;  3RZZ A;  4F8D A;  3F6W A;  1BDI A;  1ZUG A;  2EWT A;  3IVP A;  4X4I A;  4PU3 C;  3L1P A;  3SCH A;  2XIU A;  3FMY A;  3HZI B;  1QP4 A;  1WH6 A;  3LIS A;  1HF0 A;  2O4A A;  3ZKC A;  1R63 A;  1RZS A;  4Z5C A;  1S7E A;  4YG4 A;  1ZZ7 A;  1ZPQ A;  1ZZB A;  2IV1 A;  3TRB A;  3GN5 A;  3OQO A;  2AWI A;  4X4G A;  2OR1 L;  2PUB A;  2O49 A;  4JCX A;  2IVQ A;  3BDN A;  1RZR A;  1ZZ6 A;  1UXD A;  3JXC L;  2H8R A;  2MQK A;  1QPZ A;  2IVB A;  3VK0 A;  1LCC A;  2FJR A;  2OFY A;  2BNM A;  2LYK A;  1WIZ A;  2HIN A;  3FYM A;  4I6R A;  2HSG A;  2R63 A;  3OMT A;  1B0N A;  3D1N I;  5A7L A;  1QP0 A;  1PRU A;  2BNO A;  4YAR A;  2KEK A;  2MEZ A;  1BDH A;  2A6C A;  2LYQ A;  1OSL A;  4PU7 A;  1ZS4 A;  2D5V A;  3CEC A;  3H5T A;  3R1F A;  2PUF A;  1WH8 A;  1E3O C;  3F52 A;  1ADR A;  2KEJ A;  4J1W A;  4PU4 C;  2JVL A;  2XSD C;  1LMB 3;  2WIU B;  3MLF A;  1PRV A;  2PUA A;  3KJX A;  4GHJ A;  3GBF A;  1ZZC A;  4YG1 A;  4MCX A;  1CJG A;  2ICP A;  2LYL A;  1NER A;  4I6T A;  2BJC A;  3GN5 B;  3G5G A;  4X4B A;  1O4X A;  3ZHM A;  2XCJ A;  1JFS A;  1UTX A;  4Z58 A;  2XI8 A;  1IC8 A;  1XWR A;  1AU7 A;  2PUD A;  2O38 A;  4IA8 A;  3S8Q A;  3FYA A;  1LLI A;  3KXA A;  4MCT A;  1RZR D;  1POU A;  1R69 A;  1JH9 A;  2ICT A;  2LCV A;  3DNV B;  1SQ8 A;  1X57 A;  4O8B A;  1PNR A;  3QF3 A;  1Y7Y A;  3O9X A;  4X4D A;  3U3W A;  1WET A;  4FBI A;  4YG7 B;  1ZAY A;  1ZZ9 A;  3OQN A;  2LYP A;  3F51 A;  1PRA A;  2AXZ A;  4X4E A;  2KEI A;  4NDW A;  1GT0 C;  4J1X A;  4Z5H A;  3OQM A;  1LCD A;  1ZVV A;  1EFA A;  2AUW A;  2L8N A;  3SCF A;  1OCT C;  1RPE L;  4YBA A;  4X4C A;  3ZHI A;  3LFP A;  4GQM A;  2B5A A;  2JCG A;  2LYS A;  1ZZ8 A;  2EF8 A;  2GZU A;  2PUG A;  2XJ3 A;  3CRO L;  4X4F A;  2KPJ A;  1RIO A;  3BS3 A;  3PXP A;  1LQC A;  2WUS R;  2GRM A;  2BNN A;  4I6U A;  1L1M A;  4JCY A;  3G7D A;  2GRL A;  2R1J L;  1QQB A;  1VPW A;  4Z5D A;  1JWL A;  4I8T A;  4OB4 A;  1DW9 A;  4FN3 A;  2CRO A;  2PPX A;  2LYR A;  3OP9 A;  2CSF A;  3SCG A;  3BD1 A;  4X4H A;  2IVG A;  5K98 B;  4Y42 A;  1DWK A;  1YSE A;  3B7H A;  3JXD L;  3UFD A;  2PUE A;  3QWG A;  2EBY A;  1CQT A;  1QP7 A;  3CLC A;  2PUC A;  4Z59 A;  3KZ3 A;  1QQA A;  2KZ8 A;  1PER L;  2AW6 A;  3QYX A;  3JXB C;  4JQD A;  4IWR A; 
#chains in the Genus database with same CATH topology
 2AXV A;  4PU8 A;  3EUS A;  3NXH A;  1X2L A;  2IU7 A;  2IUO A;  3QQ6 A;  3FMY A;  3HZI B;  2PXF A;  3TFL A;  2O4A A;  4EQZ A;  1ZZ7 A;  2O49 A;  2H8R A;  3VK0 A;  2OFY A;  2LYK A;  2HSG A;  3OMT A;  1B0N A;  2V3C C;  1PRU A;  4WVL A;  3UWP A;  3ME5 A;  3QFI A;  2LYQ A;  3H5T A;  1E3O C;  3KJX A;  3GBF A;  4YG1 A;  4MCX A;  2ICP A;  3GZD A;  1O4X A;  3ZHM A;  1JFS A;  1XWR A;  2PUD A;  3DM5 A;  2PXB A;  2LLV A;  3OKZ A;  3FYA A;  1LLI A;  2LCV A;  4O8B A;  3QF3 A;  5DRY A;  3U3W A;  3NDB B;  4FBI A;  4NDW A;  4EK9 A;  5DTQ A;  1LCD A;  3OQM A;  1EFA A;  1RPE L;  4YBA A;  4X4C A;  2PXU A;  2B5A A;  3QOW A;  2EF8 A;  2HCN A;  5DRT A;  1QZX A;  2XJ3 A;  1RIO A;  3PXP A;  1LQC A;  2R1J L;  1QQB A;  1JWL A;  3OP9 A;  5DTR A;  1DWK A;  3JXD L;  4DE8 A;  1QP7 A;  3CLC A;  4Z59 A;  4JQD A;  2AW6 A;  3JXB C;  2LYJ A;  4IVZ A;  2AXU A;  1Y9Q A;  3F6W A;  3TEL A;  4PU3 C;  1QP4 A;  3A9X A;  3A9Z A;  4Z5C A;  2LLW A;  4YG4 A;  3TRB A;  4X4G A;  2PUB A;  2M4H A;  3BDN A;  1QPZ A;  4I6R A;  3QOX A;  2XXP A;  5DSX A;  2PXV A;  2KEK A;  3VWS A;  2MEZ A;  1BDH A;  2A6C A;  1OSL A;  4ER6 A;  1ZS4 A;  2D5V A;  3CEC A;  2PXQ A;  2HCS A;  1WH8 A;  4PU4 C;  2WIU B;  2PUA A;  1CJG A;  3GN5 B;  2J7W A;  2XI8 A;  1AU7 A;  2O38 A;  3LQX A;  4IA8 A;  4ER7 A;  1RZR D;  1R69 A;  2ICT A;  3DNV B;  1SQ8 A;  1X57 A;  3O9X A;  4X4D A;  2PXE A;  1WET A;  2LNM A;  3OQN A;  1PRA A;  2AXZ A;  4X4E A;  1NW3 A;  1GT0 C;  3NZL A;  3TEP A;  1ZVV A;  2LYS A;  3CRO L;  2KPJ A;  4EZI A;  2WUS R;  2GRM A;  2BNN A;  4I6U A;  2GRL A;  1VPW A;  3GZD C;  1DW9 A;  3SCG A;  2LYR A;  4X4H A;  3BD1 A;  4ER5 A;  5K98 B;  1DUL A;  1YSE A;  3KZ3 A;  1QQA A;  1PER L;  5DT2 A;  5GAH i;  4IWR A;  1JFT A;  1NEQ A;  3ZPX A;  2PIJ A;  2L49 A;  2PE5 A;  3RZZ A;  4F8D A;  1ZUG A;  2EWT A;  3IVP A;  2XIU A;  3ZKC A;  1RZS A;  1ZPQ A;  1ZZB A;  3OWQ A;  3GN5 A;  3SR4 A;  3OQO A;  2OR1 L;  1QB2 A;  3M9L A;  2IVQ A;  1RZR A;  1UXD A;  2FJR A;  1HQ1 A;  3PE5 A;  5DTM A;  3D1N I;  1QP0 A;  4OBM A;  3F52 A;  2KEJ A;  2XSD C;  2JVL A;  3MLF A;  2JQE A;  1ZZC A;  2LYL A;  2BJC A;  4ER3 A;  2PXP A;  4ER0 A;  2XCJ A;  1UTX A;  4Z58 A;  2MXD A;  3GUU A;  1Y7Y A;  1ZZ9 A;  3F51 A;  2FFH A;  4Z5H A;  3R09 A;  2AUW A;  2L8N A;  1OCT C;  3ZHI A;  3LFP A;  2JCG A;  2YBD A;  2L1P A;  1U2Z A;  4EKI A;  2GZU A;  4X4F A;  3KL4 A;  4JCY A;  1L1M A;  3G7D A;  3SX0 A;  4FN3 A;  2CRO A;  2CSF A;  4HRA A;  2PUE A;  3QWG A;  3NRO A;  1MFQ C;  4DE9 A;  1UXC A;  3A9Y A;  1BDI A;  3S8Q A;  3L1P A;  4X4I A;  3SCH A;  1WH6 A;  3LIS A;  1HF0 A;  1R63 A;  5JUW A;  1S7E A;  2PXT A;  2IV1 A;  2AWI A;  4JCX A;  4Q2J A;  1ZZ6 A;  3JXC L;  2MQK A;  2IVB A;  1LCC A;  2BNM A;  1WIZ A;  2HIN A;  3FYM A;  2PXK A;  2R63 A;  5A7L A;  2BNO A;  2J7U A;  4YAR A;  4PU7 A;  3R1F A;  2PUF A;  2XXA A;  2PXD A;  1ADR A;  4J1W A;  1LMB 3;  1PRV A;  2HFZ A;  4GHJ A;  2XXQ A;  3G0T A;  1NER A;  4I6T A;  3G5G A;  4X4B A;  1IC8 A;  3MEJ A;  3KXA A;  4MCT A;  1POU A;  1JH9 A;  1PNR A;  2PXL A;  4YG7 B;  1ZAY A;  2ODR D;  2LYP A;  2KEI A;  4J1X A;  3SCF A;  4GQM A;  1ZZ8 A;  2PUG A;  2VEO A;  4EKG A;  3BS3 A;  5GAG i;  4Z5D A;  4I8T A;  4OB4 A;  2PPX A;  3GZC A;  2IVG A;  4Y42 A;  3B7H A;  3UFD A;  2EBY A;  1CQT A;  2PUC A;  2KZ8 A;  3QYX A; 
#chains in the Genus database with same CATH homology
 2AXV A;  2LYJ A;  3EUS A;  4PU8 A;  4IVZ A;  1JFT A;  1NEQ A;  1X2L A;  2IU7 A;  1UXC A;  2IUO A;  2PIJ A;  3QQ6 A;  2AXU A;  1Y9Q A;  2L49 A;  2PE5 A;  3RZZ A;  4F8D A;  3F6W A;  1BDI A;  1ZUG A;  2EWT A;  3IVP A;  4X4I A;  4PU3 C;  3L1P A;  3SCH A;  2XIU A;  3FMY A;  3HZI B;  1QP4 A;  1WH6 A;  3LIS A;  1HF0 A;  2O4A A;  3ZKC A;  1R63 A;  1RZS A;  4Z5C A;  1S7E A;  4YG4 A;  1ZZ7 A;  1ZPQ A;  1ZZB A;  2IV1 A;  3TRB A;  3GN5 A;  3OQO A;  2AWI A;  4X4G A;  2OR1 L;  2PUB A;  2O49 A;  4JCX A;  2IVQ A;  3BDN A;  1RZR A;  1ZZ6 A;  1UXD A;  3JXC L;  2H8R A;  2MQK A;  1QPZ A;  2IVB A;  3VK0 A;  1LCC A;  2FJR A;  2OFY A;  2BNM A;  2LYK A;  1WIZ A;  2HIN A;  3FYM A;  4I6R A;  2HSG A;  2R63 A;  3OMT A;  1B0N A;  3D1N I;  5A7L A;  1QP0 A;  1PRU A;  2BNO A;  4YAR A;  2KEK A;  2MEZ A;  1BDH A;  2A6C A;  2LYQ A;  1OSL A;  4PU7 A;  1ZS4 A;  2D5V A;  3CEC A;  3H5T A;  3R1F A;  2PUF A;  1WH8 A;  1E3O C;  3F52 A;  1ADR A;  2KEJ A;  4J1W A;  4PU4 C;  2JVL A;  2XSD C;  1LMB 3;  2WIU B;  3MLF A;  1PRV A;  2PUA A;  3KJX A;  4GHJ A;  3GBF A;  1ZZC A;  4YG1 A;  4MCX A;  1CJG A;  2ICP A;  2LYL A;  1NER A;  4I6T A;  2BJC A;  3GN5 B;  3G5G A;  4X4B A;  1O4X A;  3ZHM A;  2XCJ A;  1JFS A;  1UTX A;  4Z58 A;  2XI8 A;  1IC8 A;  1XWR A;  1AU7 A;  2PUD A;  2O38 A;  4IA8 A;  3S8Q A;  3FYA A;  1LLI A;  3KXA A;  4MCT A;  1RZR D;  1POU A;  1R69 A;  1JH9 A;  2ICT A;  2LCV A;  3DNV B;  1SQ8 A;  1X57 A;  4O8B A;  1PNR A;  3QF3 A;  1Y7Y A;  3O9X A;  4X4D A;  3U3W A;  1WET A;  4FBI A;  4YG7 B;  1ZAY A;  1ZZ9 A;  3OQN A;  2LYP A;  3F51 A;  1PRA A;  2AXZ A;  4X4E A;  2KEI A;  4NDW A;  1GT0 C;  4J1X A;  4Z5H A;  3OQM A;  1LCD A;  1ZVV A;  1EFA A;  2AUW A;  2L8N A;  3SCF A;  1OCT C;  1RPE L;  4YBA A;  4X4C A;  3ZHI A;  3LFP A;  4GQM A;  2B5A A;  2JCG A;  2LYS A;  1ZZ8 A;  2EF8 A;  2GZU A;  2PUG A;  2XJ3 A;  3CRO L;  4X4F A;  2KPJ A;  1RIO A;  3BS3 A;  3PXP A;  1LQC A;  2WUS R;  2GRM A;  2BNN A;  4I6U A;  1L1M A;  4JCY A;  3G7D A;  2GRL A;  2R1J L;  1QQB A;  1VPW A;  4Z5D A;  1JWL A;  4I8T A;  4OB4 A;  1DW9 A;  4FN3 A;  2CRO A;  2PPX A;  2LYR A;  3OP9 A;  2CSF A;  3SCG A;  3BD1 A;  4X4H A;  2IVG A;  5K98 B;  4Y42 A;  1DWK A;  1YSE A;  3B7H A;  3JXD L;  3UFD A;  2PUE A;  3QWG A;  2EBY A;  1CQT A;  1QP7 A;  3CLC A;  2PUC A;  4Z59 A;  3KZ3 A;  1QQA A;  2KZ8 A;  1PER L;  2AW6 A;  3QYX A;  3JXB C;  4JQD A;  4IWR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...