3JXDL

Crystal structure of the p22 c2 repressor protein in complex with synthetic operator 9c in the presence of rb+
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
66
structure length
66
Chain Sequence
TQLMGERIRARRKKLKIRQAALGKMVGVSNVAISQWERSETEPNGENLLALSKALQCSPDYLLKGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords 5'-D(*CP*AP*TP*TP*TP*AP*AP*GP*AP*CP*GP*TP*CP*TP*TP*AP*AP*AP*
publication title Sequence Recognition of DNA by Protein-Induced Conformational Transitions.
pubmed doi rcsb
source organism Enterobacteria phage p22
total genus 21
structure length 66
sequence length 66
chains with identical sequence R
ec nomenclature
pdb deposition date 2009-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF01381 HTH_3 Helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 3jxdL00
2LYLA 3FMYA 4Z5CA 4IWRA 1B0NA 1PRAA 3CECA 3GN5A 4YG1A 4I6TA 2IVGA 3KJXA 4GQMA 1UXDA 2R63A 3UFDA 1CQTA 1LCCA 1JFSA 4JQDA 2IUOA 2PUAA 4PU8A 3F6WA 2HSGA 1WH6A 4PU7A 1L1MA 2LCVA 3G5GA 4NDWA 1QP7A 2CSFA 1SQ8A 1E3OC 1HF0A 1ZZ7A 2FJRA 2PIJA 3FYAA 3JXCL 2OR1L 4YG7B 1RIOA 4JCYA 2O49A 2AXUA 2PUFA 4X4BA 3IVPA 1WIZA 2EF8A 3OMTA 1Y9QA 4YARA 1ZVVA 1QPZA 4Z59A 3QF3A 1S7EA 1LMB3 3OQOA 3ZKCA 3MLFA 1PRUA 2GRLA 2AW6A 2EBYA 2GRMA 2XCJA 2KEJA 3S8QA 1AU7A 1X57A 1PRVA 4X4IA 1BDIA 1QQAA 2PUBA 4FBIA 2R1JL 1DW9A 1VPWA 1O4XA 4IA8A 1QP0A 3F51A 1ZZBA 2B5AA 2LYJA 3BDNA 2GZUA 2L8NA 3PXPA 3SCHA 1PNRA 2LYQA 1UTXA 4GHJA 3VK0A 1EFAA 2AXZA 2LYPA 2PUCA 2EWTA 4X4CA 4X4DA 2HINA 4Y42A 2PUDA 3FYMA 3GN5B 4Z5HA 4X4GA 3BS3A 2AUWA 3H5TA 3ZHMA 4J1XA 3JXBC 1ADRA 1ZZ6A 4OB4A 1OSLA 4MCTA 3RZZA 3D1NI 1JH9A 5A7LA 3CLCA 2BJCA 3CROL 1DWKA 1WH8A 2BNOA 3OQMA 3SCFA 1LQCA 3L1PA 4PU3C 1ZS4A 3EUSA 1BDHA 1PERL 4I6RA 4YBAA 3ZHIA 4I6UA 3LISA 2ICPA 3BD1A 1ZZ8A 3GBFA 4IVZA 3KXAA 2KEKA 2IU7A 1WETA 3TRBA 3JXDL 1ZZCA 2PE5A 1X2LA 2XI8A 4X4FA 2H8RA 5K98B 1OCTC 4Z5DA 2OFYA 1RZSA 2BNNA 2AWIA 2IV1A 2JVLA 2LYKA 2WIUB 3LFPA 2PUGA 2O38A 1NEQA 3KZ3A 2AXVA 1QP4A 3R1FA 2PUEA 2CROA 1IC8A 4X4HA 4MCXA 2ICTA 1NERA 1YSEA 1POUA 2JCGA 4I8TA 1JWLA 2LYRA 3U3WA 1R63A 1GT0C 1XWRA 3O9XA 1ZZ9A 3HZIB 2L49A 3G7DA 2XIUA 4YG4A 3QYXA 2LYSA 2KPJA 1RZRA 1CJGA 1ZAYA 4FN3A 2MQKA 3OQNA 1LCDA 1ZPQA 2PPXA 1Y7YA 1R69A 3QQ6A 2XJ3A 2A6CA 3DNVB 3QWGA 1RPEL 2BNMA 2O4AA 3SCGA 3OP9A 1LLIA 2D5VA 2IVBA 2KZ8A 1ZUGA 2WUSR 2XSDC 4F8DA 4JCXA 3B7HA 1JFTA 4J1WA 4Z58A 1QQBA 1RZRD 4O8BA 2KEIA 4PU4C 2MEZA 3F52A 4X4EA 2IVQA 1UXCA
chains in the Genus database with same CATH superfamily
2LYLA 3FMYA 4IWRA 4I6TA 4EKGA 2IVGA 1UXDA 2R63A 1JFSA 4Q2JA 2MXDA 3PE5A 1ZZ7A 2PIJA 4JCYA 3NZLA 4YG7B 2OR1L 2O49A 2V3CC 3OWQA 1LMB3 2ODRD 4ER0A 4EKIA 1PRUA 2KEJA 1QQAA 1QB2A 2B5AA 2LYJA 5JUWA 2PXLA 2LYQA 2PUCA 4GHJA 3VK0A 2LYPA 3FYMA 4ER3A 4Z5HA 3BS3A 2AUWA 4J1XA 3JXBC 1ADRA 1ZZ6A 3CROL 2HFZA 2PXTA 3L1PA 2PXUA 4I6RA 2LLVA 3NROA 3SR4A 2PE5A 1X2LA 2L1PA 2OFYA 2BNNA 2IV1A 3LFPA 2O38A 2AXVA 1QP4A 2PUEA 4X4HA 1YSEA 2M4HA 1POUA 1JWLA 1GT0C 3A9XA 1ZZ9A 2L49A 3G7DA 3A9ZA 1LCDA 3QQ6A 1NW3A 2IVBA 2YBDA 2KEIA 4X4EA 2PXFA 2XXPA 3GUUA 4YG1A 4GQMA 1LCCA 4JQDA 2IUOA 4PU8A 3F6WA 2LCVA 3G5GA 1E3OC 2FJRA 2PXVA 3NXHA 2AXUA 1WIZA 1QZXA 1Y9QA 1ZVVA 1QPZA 3MLFA 2PXBA 2GRLA 2AW6A 2XCJA 4FBIA 1DW9A 1O4XA 2PXDA 1PNRA 1UTXA 1EFAA 2FFHA 2EWTA 1JH9A 1OSLA 4MCTA 3DM5A 1DWKA 2BNOA 3OQMA 2LLWA 4DE9A 3EUSA 1PERL 4YBAA 1ZZ8A 2JQEA 1WETA 3JXDL 1ZZCA 2XI8A 3GZDC 1RZSA 2JVLA 5DTRA 1NEQA 2ICTA 2PXEA 3U3WA 3O9XA 2KPJA 1HQ1A 2MQKA 2PPXA 1R69A 3DNVB 2J7UA 3QWGA 3OP9A 2D5VA 2KZ8A 2WUSR 2XSDC 4F8DA 4JCXA 3B7HA 5GAHi 1JFTA 5DSXA 1QQBA 4O8BA 3F52A 4DE8A 3GZCA 1B0NA 3LQXA 3GN5A 3KJXA 3UFDA 1CQTA 1WH6A 4NDWA 1QP7A 2CSFA 1SQ8A 3QFIA 2XXAA 2PUFA 4HRAA 2EF8A 3NDBB 4Z59A 1S7EA 5DT2A 3QOWA 2PXKA 2EBYA 1AU7A 3S8QA 1X57A 1PRVA 4X4IA 3A9YA 1VPWA 1QP0A 1ZZBA 2GZUA 2AXZA 4X4CA 4Y42A 3ZPXA 2PUDA 3GN5B 3RZZA 5A7LA 2PXPA 4PU3C 1ZS4A 3MEJA 2ICPA 3BD1A 3KXAA 2KEKA 4EZIA 3TFLA 2LYKA 2PUGA 3QOXA 3KZ3A 3R1FA 3G0TA 4EQZA 2CROA 1NERA 2JCGA 4ER7A 3HZIB 2XIUA 4YG4A 2LYSA 1ZAYA 4FN3A 1ZPQA 4ER6A 1Y7YA 2VEOA 2XJ3A 3SCGA 3TELA 4J1WA 4Z58A 1RZRD 3GZDA 2LNMA 3R09A 4ER5A 3BDNA 4Z5CA 1PRAA 3CECA 2PXQA 3ME5A 2PUAA 2HSGA 4PU7A 1L1MA 1HF0A 3FYAA 3JXCL 1RIOA 4X4BA 3IVPA 3OMTA 4YARA 3QF3A 3OQOA 3ZKCA 1MFQC 2GRMA 1BDIA 2PUBA 2HCSA 2R1JL 4IA8A 3F51A 2L8NA 3PXPA 3SCHA 4X4DA 2HINA 4X4GA 2J7WA 3VWSA 3H5TA 3ZHMA 4OB4A 3KL4A 3D1NI 3CLCA 2BJCA 1WH8A 3SCFA 1LQCA 1BDHA 3ZHIA 4I6UA 3LISA 4IVZA 3GBFA 2IU7A 3TRBA 4X4FA 2H8RA 5K98B 1OCTC 3TEPA 5DTMA 4Z5DA 2AWIA 2WIUB 3SX0A 1IC8A 2XXQA 4MCXA 4I8TA 2HCNA 2LYRA 1R63A 4EK9A 5DRTA 1XWRA 1RZRA 1CJGA 3OKZA 3QYXA 4OBMA 3OQNA 2A6CA 1RPEL 5GAGi 2O4AA 2BNMA 1LLIA 1ZUGA 1DULA 5DTQA 3UWPA 4WVLA 1U2ZA 4PU4C 2MEZA 5DRYA 3M9LA 2IVQA 1UXCA
chains in the Genus database with same CATH topology
2LYLA 3FMYA 4Z5CA 4IWRA 1B0NA 1PRAA 3CECA 3GN5A 4YG1A 4I6TA 2IVGA 3KJXA 4GQMA 1UXDA 2R63A 3UFDA 1CQTA 1LCCA 1JFSA 4JQDA 2IUOA 2PUAA 4PU8A 3F6WA 2HSGA 1WH6A 4PU7A 1L1MA 2LCVA 3G5GA 4NDWA 1QP7A 2CSFA 1SQ8A 1E3OC 1HF0A 1ZZ7A 2FJRA 2PIJA 3FYAA 3JXCL 2OR1L 4YG7B 1RIOA 4JCYA 2O49A 2AXUA 2PUFA 4X4BA 3IVPA 1WIZA 2EF8A 3OMTA 1Y9QA 4YARA 1ZVVA 1QPZA 4Z59A 3QF3A 1S7EA 1LMB3 3OQOA 3ZKCA 3MLFA 1PRUA 2GRLA 2AW6A 2EBYA 2GRMA 2XCJA 2KEJA 3S8QA 1AU7A 1X57A 1PRVA 4X4IA 1BDIA 1QQAA 2PUBA 4FBIA 2R1JL 1DW9A 1VPWA 1O4XA 4IA8A 1QP0A 3F51A 1ZZBA 2B5AA 2LYJA 3BDNA 2GZUA 2L8NA 3PXPA 3SCHA 1PNRA 2LYQA 1UTXA 4GHJA 3VK0A 1EFAA 2AXZA 2LYPA 2PUCA 2EWTA 4X4CA 4X4DA 2HINA 4Y42A 2PUDA 3FYMA 3GN5B 4Z5HA 4X4GA 3BS3A 2AUWA 3H5TA 3ZHMA 4J1XA 3JXBC 1ADRA 1ZZ6A 4OB4A 1OSLA 4MCTA 3RZZA 3D1NI 1JH9A 5A7LA 3CLCA 2BJCA 3CROL 1DWKA 1WH8A 2BNOA 3OQMA 3SCFA 1LQCA 3L1PA 4PU3C 1ZS4A 3EUSA 1BDHA 1PERL 4I6RA 4YBAA 3ZHIA 4I6UA 3LISA 2ICPA 3BD1A 1ZZ8A 3GBFA 4IVZA 3KXAA 2KEKA 2IU7A 1WETA 3TRBA 3JXDL 1ZZCA 2PE5A 1X2LA 2XI8A 4X4FA 2H8RA 5K98B 1OCTC 4Z5DA 2OFYA 1RZSA 2BNNA 2AWIA 2IV1A 2JVLA 2LYKA 2WIUB 3LFPA 2PUGA 2O38A 1NEQA 3KZ3A 2AXVA 1QP4A 3R1FA 2PUEA 2CROA 1IC8A 4X4HA 4MCXA 2ICTA 1NERA 1YSEA 1POUA 2JCGA 4I8TA 1JWLA 2LYRA 3U3WA 1R63A 1GT0C 1XWRA 3O9XA 1ZZ9A 3HZIB 2L49A 3G7DA 2XIUA 4YG4A 3QYXA 2LYSA 2KPJA 1RZRA 1CJGA 1ZAYA 4FN3A 2MQKA 3OQNA 1LCDA 1ZPQA 2PPXA 1Y7YA 1R69A 3QQ6A 2XJ3A 2A6CA 3DNVB 3QWGA 1RPEL 2BNMA 2O4AA 3SCGA 3OP9A 1LLIA 2D5VA 2IVBA 2KZ8A 1ZUGA 2WUSR 2XSDC 4F8DA 4JCXA 3B7HA 1JFTA 4J1WA 4Z58A 1QQBA 1RZRD 4O8BA 2KEIA 4PU4C 2MEZA 3F52A 4X4EA 2IVQA 1UXCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LYL A;  3FMY A;  4Z5C A;  4IWR A;  1B0N A;  1PRA A;  3CEC A;  3GN5 A;  4YG1 A;  4I6T A;  2IVG A;  3KJX A;  4GQM A;  1UXD A;  2R63 A;  3UFD A;  1CQT A;  1LCC A;  1JFS A;  4JQD A;  2IUO A;  2PUA A;  4PU8 A;  3F6W A;  2HSG A;  1WH6 A;  4PU7 A;  1L1M A;  2LCV A;  3G5G A;  4NDW A;  1QP7 A;  2CSF A;  1SQ8 A;  1E3O C;  1HF0 A;  1ZZ7 A;  2FJR A;  2PIJ A;  3FYA A;  3JXC L;  2OR1 L;  4YG7 B;  1RIO A;  4JCY A;  2O49 A;  2AXU A;  2PUF A;  4X4B A;  3IVP A;  1WIZ A;  2EF8 A;  3OMT A;  1Y9Q A;  4YAR A;  1ZVV A;  1QPZ A;  4Z59 A;  3QF3 A;  1S7E A;  1LMB 3;  3OQO A;  3ZKC A;  3MLF A;  1PRU A;  2GRL A;  2AW6 A;  2EBY A;  2GRM A;  2XCJ A;  2KEJ A;  3S8Q A;  1AU7 A;  1X57 A;  1PRV A;  4X4I A;  1BDI A;  1QQA A;  2PUB A;  4FBI A;  2R1J L;  1DW9 A;  1VPW A;  1O4X A;  4IA8 A;  1QP0 A;  3F51 A;  1ZZB A;  2B5A A;  2LYJ A;  3BDN A;  2GZU A;  2L8N A;  3PXP A;  3SCH A;  1PNR A;  2LYQ A;  1UTX A;  4GHJ A;  3VK0 A;  1EFA A;  2AXZ A;  2LYP A;  2PUC A;  2EWT A;  4X4C A;  4X4D A;  2HIN A;  4Y42 A;  2PUD A;  3FYM A;  3GN5 B;  4Z5H A;  4X4G A;  3BS3 A;  2AUW A;  3H5T A;  3ZHM A;  4J1X A;  3JXB C;  1ADR A;  1ZZ6 A;  4OB4 A;  1OSL A;  4MCT A;  3RZZ A;  3D1N I;  1JH9 A;  5A7L A;  3CLC A;  2BJC A;  3CRO L;  1DWK A;  1WH8 A;  2BNO A;  3OQM A;  3SCF A;  1LQC A;  3L1P A;  4PU3 C;  1ZS4 A;  3EUS A;  1BDH A;  1PER L;  4I6R A;  4YBA A;  3ZHI A;  4I6U A;  3LIS A;  2ICP A;  3BD1 A;  1ZZ8 A;  3GBF A;  4IVZ A;  3KXA A;  2KEK A;  2IU7 A;  1WET A;  3TRB A;  3JXD L;  1ZZC A;  2PE5 A;  1X2L A;  2XI8 A;  4X4F A;  2H8R A;  5K98 B;  1OCT C;  4Z5D A;  2OFY A;  1RZS A;  2BNN A;  2AWI A;  2IV1 A;  2JVL A;  2LYK A;  2WIU B;  3LFP A;  2PUG A;  2O38 A;  1NEQ A;  3KZ3 A;  2AXV A;  1QP4 A;  3R1F A;  2PUE A;  2CRO A;  1IC8 A;  4X4H A;  4MCX A;  2ICT A;  1NER A;  1YSE A;  1POU A;  2JCG A;  4I8T A;  1JWL A;  2LYR A;  3U3W A;  1R63 A;  1GT0 C;  1XWR A;  3O9X A;  1ZZ9 A;  3HZI B;  2L49 A;  3G7D A;  2XIU A;  4YG4 A;  3QYX A;  2LYS A;  2KPJ A;  1RZR A;  1CJG A;  1ZAY A;  4FN3 A;  2MQK A;  3OQN A;  1LCD A;  1ZPQ A;  2PPX A;  1Y7Y A;  1R69 A;  3QQ6 A;  2XJ3 A;  2A6C A;  3DNV B;  3QWG A;  1RPE L;  2BNM A;  2O4A A;  3SCG A;  3OP9 A;  1LLI A;  2D5V A;  2IVB A;  2KZ8 A;  1ZUG A;  2WUS R;  2XSD C;  4F8D A;  4JCX A;  3B7H A;  1JFT A;  4J1W A;  4Z58 A;  1QQB A;  1RZR D;  4O8B A;  2KEI A;  4PU4 C;  2MEZ A;  3F52 A;  4X4E A;  2IVQ A;  1UXC A; 
#chains in the Genus database with same CATH topology
 2LYL A;  3FMY A;  4IWR A;  4I6T A;  4EKG A;  2IVG A;  1UXD A;  2R63 A;  1JFS A;  4Q2J A;  2MXD A;  3PE5 A;  1ZZ7 A;  2PIJ A;  4JCY A;  3NZL A;  4YG7 B;  2OR1 L;  2O49 A;  2V3C C;  3OWQ A;  1LMB 3;  2ODR D;  4ER0 A;  4EKI A;  1PRU A;  2KEJ A;  1QQA A;  1QB2 A;  2B5A A;  2LYJ A;  5JUW A;  2PXL A;  2LYQ A;  2PUC A;  4GHJ A;  3VK0 A;  2LYP A;  3FYM A;  4ER3 A;  4Z5H A;  3BS3 A;  2AUW A;  4J1X A;  3JXB C;  1ADR A;  1ZZ6 A;  3CRO L;  2HFZ A;  2PXT A;  3L1P A;  2PXU A;  4I6R A;  2LLV A;  3NRO A;  3SR4 A;  2PE5 A;  1X2L A;  2L1P A;  2OFY A;  2BNN A;  2IV1 A;  3LFP A;  2O38 A;  2AXV A;  1QP4 A;  2PUE A;  4X4H A;  1YSE A;  2M4H A;  1POU A;  1JWL A;  1GT0 C;  3A9X A;  1ZZ9 A;  2L49 A;  3G7D A;  3A9Z A;  1LCD A;  3QQ6 A;  1NW3 A;  2IVB A;  2YBD A;  2KEI A;  4X4E A;  2PXF A;  2XXP A;  3GUU A;  4YG1 A;  4GQM A;  1LCC A;  4JQD A;  2IUO A;  4PU8 A;  3F6W A;  2LCV A;  3G5G A;  1E3O C;  2FJR A;  2PXV A;  3NXH A;  2AXU A;  1WIZ A;  1QZX A;  1Y9Q A;  1ZVV A;  1QPZ A;  3MLF A;  2PXB A;  2GRL A;  2AW6 A;  2XCJ A;  4FBI A;  1DW9 A;  1O4X A;  2PXD A;  1PNR A;  1UTX A;  1EFA A;  2FFH A;  2EWT A;  1JH9 A;  1OSL A;  4MCT A;  3DM5 A;  1DWK A;  2BNO A;  3OQM A;  2LLW A;  4DE9 A;  3EUS A;  1PER L;  4YBA A;  1ZZ8 A;  2JQE A;  1WET A;  3JXD L;  1ZZC A;  2XI8 A;  3GZD C;  1RZS A;  2JVL A;  5DTR A;  1NEQ A;  2ICT A;  2PXE A;  3U3W A;  3O9X A;  2KPJ A;  1HQ1 A;  2MQK A;  2PPX A;  1R69 A;  3DNV B;  2J7U A;  3QWG A;  3OP9 A;  2D5V A;  2KZ8 A;  2WUS R;  2XSD C;  4F8D A;  4JCX A;  3B7H A;  5GAH i;  1JFT A;  5DSX A;  1QQB A;  4O8B A;  3F52 A;  4DE8 A;  3GZC A;  1B0N A;  3LQX A;  3GN5 A;  3KJX A;  3UFD A;  1CQT A;  1WH6 A;  4NDW A;  1QP7 A;  2CSF A;  1SQ8 A;  3QFI A;  2XXA A;  2PUF A;  4HRA A;  2EF8 A;  3NDB B;  4Z59 A;  1S7E A;  5DT2 A;  3QOW A;  2PXK A;  2EBY A;  1AU7 A;  3S8Q A;  1X57 A;  1PRV A;  4X4I A;  3A9Y A;  1VPW A;  1QP0 A;  1ZZB A;  2GZU A;  2AXZ A;  4X4C A;  4Y42 A;  3ZPX A;  2PUD A;  3GN5 B;  3RZZ A;  5A7L A;  2PXP A;  4PU3 C;  1ZS4 A;  3MEJ A;  2ICP A;  3BD1 A;  3KXA A;  2KEK A;  4EZI A;  3TFL A;  2LYK A;  2PUG A;  3QOX A;  3KZ3 A;  3R1F A;  3G0T A;  4EQZ A;  2CRO A;  1NER A;  2JCG A;  4ER7 A;  3HZI B;  2XIU A;  4YG4 A;  2LYS A;  1ZAY A;  4FN3 A;  1ZPQ A;  4ER6 A;  1Y7Y A;  2VEO A;  2XJ3 A;  3SCG A;  3TEL A;  4J1W A;  4Z58 A;  1RZR D;  3GZD A;  2LNM A;  3R09 A;  4ER5 A;  3BDN A;  4Z5C A;  1PRA A;  3CEC A;  2PXQ A;  3ME5 A;  2PUA A;  2HSG A;  4PU7 A;  1L1M A;  1HF0 A;  3FYA A;  3JXC L;  1RIO A;  4X4B A;  3IVP A;  3OMT A;  4YAR A;  3QF3 A;  3OQO A;  3ZKC A;  1MFQ C;  2GRM A;  1BDI A;  2PUB A;  2HCS A;  2R1J L;  4IA8 A;  3F51 A;  2L8N A;  3PXP A;  3SCH A;  4X4D A;  2HIN A;  4X4G A;  2J7W A;  3VWS A;  3H5T A;  3ZHM A;  4OB4 A;  3KL4 A;  3D1N I;  3CLC A;  2BJC A;  1WH8 A;  3SCF A;  1LQC A;  1BDH A;  3ZHI A;  4I6U A;  3LIS A;  4IVZ A;  3GBF A;  2IU7 A;  3TRB A;  4X4F A;  2H8R A;  5K98 B;  1OCT C;  3TEP A;  5DTM A;  4Z5D A;  2AWI A;  2WIU B;  3SX0 A;  1IC8 A;  2XXQ A;  4MCX A;  4I8T A;  2HCN A;  2LYR A;  1R63 A;  4EK9 A;  5DRT A;  1XWR A;  1RZR A;  1CJG A;  3OKZ A;  3QYX A;  4OBM A;  3OQN A;  2A6C A;  1RPE L;  5GAG i;  2O4A A;  2BNM A;  1LLI A;  1ZUG A;  1DUL A;  5DTQ A;  3UWP A;  4WVL A;  1U2Z A;  4PU4 C;  2MEZ A;  5DRY A;  3M9L A;  2IVQ A;  1UXC A; 
#chains in the Genus database with same CATH homology
 2LYL A;  3FMY A;  4Z5C A;  4IWR A;  1B0N A;  1PRA A;  3CEC A;  3GN5 A;  4YG1 A;  4I6T A;  2IVG A;  3KJX A;  4GQM A;  1UXD A;  2R63 A;  3UFD A;  1CQT A;  1LCC A;  1JFS A;  4JQD A;  2IUO A;  2PUA A;  4PU8 A;  3F6W A;  2HSG A;  1WH6 A;  4PU7 A;  1L1M A;  2LCV A;  3G5G A;  4NDW A;  1QP7 A;  2CSF A;  1SQ8 A;  1E3O C;  1HF0 A;  1ZZ7 A;  2FJR A;  2PIJ A;  3FYA A;  3JXC L;  2OR1 L;  4YG7 B;  1RIO A;  4JCY A;  2O49 A;  2AXU A;  2PUF A;  4X4B A;  3IVP A;  1WIZ A;  2EF8 A;  3OMT A;  1Y9Q A;  4YAR A;  1ZVV A;  1QPZ A;  4Z59 A;  3QF3 A;  1S7E A;  1LMB 3;  3OQO A;  3ZKC A;  3MLF A;  1PRU A;  2GRL A;  2AW6 A;  2EBY A;  2GRM A;  2XCJ A;  2KEJ A;  3S8Q A;  1AU7 A;  1X57 A;  1PRV A;  4X4I A;  1BDI A;  1QQA A;  2PUB A;  4FBI A;  2R1J L;  1DW9 A;  1VPW A;  1O4X A;  4IA8 A;  1QP0 A;  3F51 A;  1ZZB A;  2B5A A;  2LYJ A;  3BDN A;  2GZU A;  2L8N A;  3PXP A;  3SCH A;  1PNR A;  2LYQ A;  1UTX A;  4GHJ A;  3VK0 A;  1EFA A;  2AXZ A;  2LYP A;  2PUC A;  2EWT A;  4X4C A;  4X4D A;  2HIN A;  4Y42 A;  2PUD A;  3FYM A;  3GN5 B;  4Z5H A;  4X4G A;  3BS3 A;  2AUW A;  3H5T A;  3ZHM A;  4J1X A;  3JXB C;  1ADR A;  1ZZ6 A;  4OB4 A;  1OSL A;  4MCT A;  3RZZ A;  3D1N I;  1JH9 A;  5A7L A;  3CLC A;  2BJC A;  3CRO L;  1DWK A;  1WH8 A;  2BNO A;  3OQM A;  3SCF A;  1LQC A;  3L1P A;  4PU3 C;  1ZS4 A;  3EUS A;  1BDH A;  1PER L;  4I6R A;  4YBA A;  3ZHI A;  4I6U A;  3LIS A;  2ICP A;  3BD1 A;  1ZZ8 A;  3GBF A;  4IVZ A;  3KXA A;  2KEK A;  2IU7 A;  1WET A;  3TRB A;  3JXD L;  1ZZC A;  2PE5 A;  1X2L A;  2XI8 A;  4X4F A;  2H8R A;  5K98 B;  1OCT C;  4Z5D A;  2OFY A;  1RZS A;  2BNN A;  2AWI A;  2IV1 A;  2JVL A;  2LYK A;  2WIU B;  3LFP A;  2PUG A;  2O38 A;  1NEQ A;  3KZ3 A;  2AXV A;  1QP4 A;  3R1F A;  2PUE A;  2CRO A;  1IC8 A;  4X4H A;  4MCX A;  2ICT A;  1NER A;  1YSE A;  1POU A;  2JCG A;  4I8T A;  1JWL A;  2LYR A;  3U3W A;  1R63 A;  1GT0 C;  1XWR A;  3O9X A;  1ZZ9 A;  3HZI B;  2L49 A;  3G7D A;  2XIU A;  4YG4 A;  3QYX A;  2LYS A;  2KPJ A;  1RZR A;  1CJG A;  1ZAY A;  4FN3 A;  2MQK A;  3OQN A;  1LCD A;  1ZPQ A;  2PPX A;  1Y7Y A;  1R69 A;  3QQ6 A;  2XJ3 A;  2A6C A;  3DNV B;  3QWG A;  1RPE L;  2BNM A;  2O4A A;  3SCG A;  3OP9 A;  1LLI A;  2D5V A;  2IVB A;  2KZ8 A;  1ZUG A;  2WUS R;  2XSD C;  4F8D A;  4JCX A;  3B7H A;  1JFT A;  4J1W A;  4Z58 A;  1QQB A;  1RZR D;  4O8B A;  2KEI A;  4PU4 C;  2MEZ A;  3F52 A;  4X4E A;  2IVQ A;  1UXC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...