1B8QA

Solution structure of the extended neuronal nitric oxide synthase pdz domain complexed with an associated peptide
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
127
structure length
127
Chain Sequence
b'GSHMIEPNVISVRLFKRKVGGLGFLVKERVSKPPVIISDLIRGGAAEQSGLIQAGDIILAVNDRPLVDLSYDSALEVLRGIASETHVVLILRGPEGFTTHLETTFTGDGTPKTIRVTQPLGPPTKAV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (NEURONAL NITRIC OXIDE SYNTHASE)
publication title Solution structure of the extended neuronal nitric oxide synthase PDZ domain complexed with an associated peptide.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
total genus 8
structure length 127
sequence length 127
ec nomenclature ec 1.14.13.39: Nitric-oxide synthase (NADPH).
pdb deposition date 1999-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 1b8qA00
5HEBA 4JL7A 3ID3A 2Q9VA 4R2ZA 4WYUA 1UF1A 2K20A 2PDZA 2QKTA 3ID2A 5FB8C 1V62A 2UZCA 2YT7A 2KG2A 5FHTA 1D5GA 1UJDA 2L4SA 1N7FA 4NNMA 5HFFA 2DC2A 1V5LA 3CC0A 2V1WA 3SHWA 3DJ1A 1Y7NA 3PS4A 2PA1A 1XZ9A 3RL8A 3HPMA 2H2CA 4P2AB 5F67A 4YDPA 1W9EA 4OEOA 4UU5A 1ZUBA 2FN5A 1R6JA 1RGRA 4EDJA 3O5NA 5HFBA 5GLJA 3OU0A 1QAUA 4Z33A 2MX6A 2QG1A 3TSVA 3AXAA 1UEQA 2DM8A 3B76A 5HETA 2AINA 2AWWA 2JREA 1P1EA 2QKVA 4NMRA 3PDZA 1WFGA 3QGLA 2LUIA 4YYXA 1Z86A 3MH4A 1MFGA 1FC6A 2RCZA 4PQWA 4OAJA 5E11A 2EXGA 5HF4A 4LMMA 2JILA 3WKLA 4Q6HA 3CBZA 1WF8A 5EYZA 2G5MB 2R4HA 4JORA 1Q3PA 1WF7A 1SOZA 1UM7A 2EEGA 3TSWA 4NMVA 2VWRA 2YUYA 2HGAA 3GDVA 1OZIA 1N6FA 1UHPA 2I4SA 1X8SA 3VQFA 2HE4A 1SOTA 1ZOKA 2KQFA 1L6OA 2PZDA 1FC7A 1G9OA 2ENOA 3QO6A 3GSLA 2PKUA 4G69A 4JOHA 1U3BA 2OCSA 3GDSA 3EGHC 2LA8A 2AWUA 5HDYA 1I92A 1W9OA 2D92A 4F8KA 3CBXA 1N7TA 1U37A 1W9QA 2EAQA 4K75A 2KPLA 5HEDA 4K78A 1VJ6A 4XHVA 2KJPA 1BE9A 2KOMA 3SUZA 3PV4A 2OS6A 5G1DA 5F3XA 1IU0A 2P3WA 3CYYA 3CBYA 2REYA 1Q3OA 1Q7XA 5HF1A 3GJ9A 3CH8A 3GCOA 3I1EA 3K1RA 3ZRTA 2QT5A 2LC7A 1GQ5A 1N6EA 1OBYA 3NGHA 4K6YA 2FNEA 3KZDA 2M10A 2YUBA 2H2BA 2MHOA 3ID1A 2Z17A 2EDPA 2D8IA 1UJUA 4NMTA 3SFJA 1UJVA 3DJ3A 3RLEA 2OGPA 1VCWA 4NNLA 5B6LA 4NMSA 2WL7A 2F0AA 1QLCA 2W4FA 2OPGA 2I1NA 4Q2NA 4K76A 4RI0A 4JOGA 2EHRA 4Q2QA 2M0UA 2EGKA 1RGWA 3PV2A 1KY9A 3DIWA 1IHJA 2KPKA 4NXPA 1X5RA 3RL7A 1MFLA 3DORA 2F5YA 4N6XA 1Y8TA 2OSGA 4MPAA 1WIFA 2EGNA 2KL1A 1GQ4A 1N99A 1PDRA 2EEHA 2YTWA 2BYGA 2IWOA 3GCNA 1UEPA 4NMOA 3OTPA 4NMPA 1KEFA 2W7RA 5A2PA 4NXQA 3NFLA 3QDOA 2QBWA 2I04A 5E6PB 2VSVA 2M0ZA 2EDVA 2LOBA 2JIKA 1TP5A 4JOPA 1RY4A 1TP3A 1NF3C 3PDVA 3KHFA 2E7KA 1QAVB 3SOEA 4KFVA 4L8NA 2DKRA 2I0IA 1UEZA 3K50A 2EJYA 5D13A 1U38A 2VRFA 5JXBA 2KJKA 3R69A 3QJMA 4NMQA 3O46A 2L4TA 3STJA 1T2MA 1Z87A 5HFDA 1QAVA 2KYLA 1WHAA 4JOJA 2M0VA 1V1TA 1M5ZA 1I16A 2DJTA 1LCYA 2ZPLA 4E34A 2HE2A 2PKTA 2OMJA 4Q6SA 4WYTA 5E21A 1TQ3A 4OEPA 3ID4A 3I18A 2DAZA 2FE5A 3VQGA 2RRMA 1X6DA 1RZXA 2IWPA 4JOKA 3QJNA 2OZFA 3HPKA 2AWXA 3BPUA 4FGMA 4Q2PA 1NTEA 2G2LA 2VPHA 4GVDA 4Q2OA 4REYA 2M3MA 1X5QA 4IC6A 2JXOA 3K82A 3R68A 2KRGA 2VZ5A 2DMZA 1UM1A 1VB7A 1VA8A 1X45A 1FC9A 2Q3GA 2CSSA 2OQSA 4JOFA 2H3MA 4P0CA 3MH7A 1FCFA 1WI2A 1N7EA 3QIKA 4K72A 3L4FD 3DJAA 3LNYA 5HEYA 2PNTA 2Z9IA 3I4WA 2VSPA 1WG6A 2DLSA 2KBSA 1V6BA 2EEJA 2H3LA 3KZEA 1IU2A 2JOAA 1UFXA 4HOPB 3TMHA 2KV8A 5DTHA 2YT8A 1VAEA 4JOEA 2JINA 2K1ZA 4UU6A 2L97A 1GM1A 1N6DA 5H3JA 3CS0A 2CSJA 2EEIA 4HOPA 3GGEA 3NFKA 2KOHA 4Z8JA 3WKMA 3JXTA 4NXRA 2DLUA 2GZVA 2JWEA 2R3YA 5G1EA 1WI4A 3SHUA 1WJLA 2KA9A 3HVQC 4O06A 4E3BA 2QKUA 1OBXA 5E22A 3R0HA 1P1DA 1TE0A 3FY5A 2IWQA 2V90A 1U39A 2O2TA 4KFWA 2EGOA 3TSZA 3LNXA 4GVCA 1V5QA 1KWAA 2KAWA 1B8QA 1WH1A 2I6VA 2FCFA 2DB5A 3PV5A 5GNDA 2KJDA 1YBOA 2D90A 5HFCA 1OBZA 3E17A 2CS5A 1BFEA 1K32A 2KOJA 1WFVA 4AMHA 2ZPMA 3QE1A 3GDUA 5E1YA 2EDZA 1X5NA 2LC6A 5HFEA 4GHNA 1UEWA 3EGGC 2M0TA 2EV8A 1UITA 5EZ0A 2I0LA 4Q3HA 4E35A 2IWNA 1MC7A 3MH6A 5I7ZA 1WHDA 5HJ1A 2X7ZA 4H11A
chains in the Genus database with same CATH superfamily
5HEBA 4JL7A 3ID3A 2Q9VA 4R2ZA 4WYUA 1UF1A 2K20A 2PDZA 2QKTA 3ID2A 5FB8C 1V62A 2UZCA 2YT7A 1X9ZA 2KG2A 5FHTA 1D5GA 1UJDA 2L4SA 1N7FA 3NCVA 4NNMA 5HFFA 2DC2A 1V5LA 3CC0A 2V1WA 3SHWA 3DJ1A 1Y7NA 3PS4A 2PA1A 1XZ9A 3RL8A 3HPMA 2H2CA 4P2AB 5F67A 4YDPA 1W9EA 4OEOA 4UU5A 1ZUBA 2FN5A 1R6JA 1RGRA 4EDJA 3O5NA 5HFBA 5GLJA 3OU0A 1QAUA 4Z33A 2MX6A 2QG1A 3TSVA 3AXAA 1UEQA 2DM8A 3B76A 5HETA 2AINA 2AWWA 2JREA 1P1EA 2QKVA 4NMRA 3PDZA 1WFGA 4FLNA 3QGLA 2LUIA 4YYXA 1Z86A 3MH4A 1MFGA 1FC6A 2RCZA 4PQWA 4OAJA 5E11A 2EXGA 5HF4A 4LMMA 2JILA 3WKLA 4Q6HA 3CBZA 1WF8A 5EYZA 2G5MB 2R4HA 4JORA 1Q3PA 1WF7A 1SOZA 1UM7A 2EEGA 3TSWA 4NMVA 2VWRA 2YUYA 2HGAA 3GDVA 1OZIA 1N6FA 1UHPA 2I4SA 1X8SA 3VQFA 2HE4A 1SOTA 1ZOKA 2KQFA 1L6OA 2PZDA 1FC7A 1G9OA 2ENOA 3QO6A 3GSLA 2PKUA 4G69A 4JOHA 1U3BA 2OCSA 3GDSA 3EGHC 2LA8A 2AWUA 5HDYA 1I92A 1W9OA 2D92A 4F8KA 3CBXA 1N7TA 1U37A 1W9QA 2EAQA 4K75A 2KPLA 5HEDA 4K78A 1VJ6A 4XHVA 2KJPA 1BE9A 2KOMA 3SUZA 3PV4A 2OS6A 5G1DA 5F3XA 1IU0A 2P3WA 3CYYA 3CBYA 2REYA 1Q3OA 1Q7XA 4JJ0A 5HF1A 3GJ9A 3CH8A 3GCOA 3I1EA 3K1RA 3ZRTA 5ILBA 2QT5A 2LC7A 1GQ5A 1N6EA 1OBYA 3NGHA 4K6YA 2FNEA 3KZDA 2M10A 2YUBA 2H2BA 2MHOA 3ID1A 2Z17A 2EDPA 2D8IA 1UJUA 4NMTA 3SFJA 1UJVA 3DJ3A 3RLEA 2OGPA 1VCWA 4NNLA 5B6LA 4NMSA 2WL7A 2F0AA 1QLCA 2W4FA 2OPGA 2I1NA 4Q2NA 4K76A 4RI0A 4JOGA 2EHRA 3KDGA 4Q2QA 2M0UA 2EGKA 1RGWA 3PV2A 1KY9A 3DIWA 1IHJA 2KPKA 4NXPA 1X5RA 3RL7A 1MFLA 3DORA 2F5YA 4N6XA 1Y8TA 2OSGA 4MPAA 1WIFA 2EGNA 2KL1A 1GQ4A 2JSNA 1N99A 1PDRA 2EEHA 2YTWA 2BYGA 2IWOA 3GCNA 1UEPA 4NMOA 3OTPA 4NMPA 1KEFA 2W7RA 5A2PA 4NXQA 3NFLA 3QDOA 2QBWA 2I04A 5E6PB 2VSVA 2M0ZA 2EDVA 2LOBA 2JIKA 1TP5A 4JOPA 1RY4A 1TP3A 1NF3C 3PDVA 3KHFA 2E7KA 1QAVB 3SOEA 4KFVA 4L8NA 2DKRA 2I0IA 1UEZA 3K50A 2EJYA 5D13A 1U38A 2VRFA 5JXBA 2KJKA 3R69A 3QJMA 4NMQA 3O46A 2L4TA 3STJA 1T2MA 1Z87A 5HFDA 1QAVA 2KYLA 1WHAA 4JOJA 2M0VA 1V1TA 1M5ZA 1I16A 2DJTA 1LCYA 2ZPLA 4E34A 2HE2A 2PKTA 2OMJA 4Q6SA 4WYTA 5E21A 1TQ3A 4OEPA 3ID4A 3I18A 2DAZA 2FE5A 3VQGA 2RRMA 1X6DA 1RZXA 2IWPA 4JOKA 3QJNA 2OZFA 2GEFA 3HPKA 2AWXA 3BPUA 4FGMA 4Q2PA 1NTEA 2G2LA 2VPHA 4GVDA 4Q2OA 4REYA 2M3MA 1X5QA 4IC6A 2JXOA 3K82A 3R68A 2KRGA 2VZ5A 2DMZA 1UM1A 1VB7A 1VA8A 1X45A 1FC9A 2Q3GA 2CSSA 2OQSA 4JOFA 2H3MA 4P0CA 3MH7A 1FCFA 1WI2A 1N7EA 3QIKA 4K72A 3L4FD 3DJAA 3LNYA 5HEYA 2PNTA 2Z9IA 3I4WA 2VSPA 1WG6A 2DLSA 2KBSA 1V6BA 2EEJA 2H3LA 3KZEA 1IU2A 2JOAA 1UFXA 4HOPB 3TMHA 2KV8A 5DTHA 3KDKA 2YT8A 1VAEA 4JOEA 2JINA 2K1ZA 4UU6A 2L97A 1GM1A 1N6DA 5H3JA 3CS0A 2CSJA 2EEIA 4HOPA 3GGEA 3NFKA 2KOHA 4Z8JA 3WKMA 3JXTA 4NXRA 2DLUA 2GZVA 2JWEA 2R3YA 5G1EA 1WI4A 3SHUA 1WJLA 2KA9A 3HVQC 4O06A 4E3BA 2QKUA 1OBXA 5E22A 3R0HA 1P1DA 1TE0A 3FY5A 2IWQA 2V90A 1U39A 5IL9A 2O2TA 4KFWA 2EGOA 3TSZA 5B42A 3LNXA 4GVCA 1V5QA 1KWAA 2KAWA 1B8QA 1WH1A 2I6VA 2FCFA 2DB5A 3PV5A 5GNDA 2KJDA 1YBOA 2D90A 5HFCA 1OBZA 3E17A 2CS5A 1BFEA 1K32A 2KOJA 4JJ3A 1WFVA 4AMHA 2ZPMA 3QE1A 3GDUA 5E1YA 3GABA 2EDZA 1X5NA 2LC6A 5HFEA 4GHNA 1UEWA 3EGGC 2M0TA 2EV8A 1UITA 5EZ0A 2I0LA 4Q3HA 4E35A 2IWNA 1MC7A 3MH6A 5I7ZA 1WHDA 5HJ1A 2X7ZA 4H11A
chains in the Genus database with same CATH topology
5HEBA 4JL7A 3ID3A 2Q9VA 4R2ZA 4WYUA 1UF1A 2K20A 2PDZA 2QKTA 3ID2A 5FB8C 1V62A 2UZCA 2YT7A 1X9ZA 2KG2A 5FHTA 1D5GA 1UJDA 2L4SA 1N7FA 3NCVA 4NNMA 5HFFA 2DC2A 1V5LA 3CC0A 2V1WA 3SHWA 3DJ1A 1Y7NA 3PS4A 2PA1A 1XZ9A 3RL8A 3HPMA 2H2CA 4P2AB 5F67A 4YDPA 1W9EA 4OEOA 4UU5A 1ZUBA 2FN5A 1R6JA 1RGRA 4EDJA 3O5NA 5HFBA 5GLJA 3OU0A 1QAUA 4Z33A 2MX6A 2QG1A 3TSVA 3AXAA 1UEQA 2DM8A 3B76A 5HETA 2AINA 2AWWA 2JREA 1P1EA 2QKVA 4NMRA 3PDZA 1WFGA 4FLNA 3QGLA 2LUIA 4YYXA 1Z86A 3MH4A 1MFGA 1FC6A 2RCZA 4PQWA 4OAJA 5E11A 2EXGA 5HF4A 4LMMA 2JILA 3WKLA 4Q6HA 3CBZA 1WF8A 5EYZA 2G5MB 2R4HA 4JORA 1Q3PA 1WF7A 1SOZA 1UM7A 2EEGA 3TSWA 4NMVA 2VWRA 2YUYA 2HGAA 3GDVA 1OZIA 1N6FA 1UHPA 2I4SA 1X8SA 3VQFA 2HE4A 1SOTA 1ZOKA 2KQFA 1L6OA 2PZDA 1FC7A 1G9OA 2ENOA 3QO6A 3GSLA 2PKUA 4G69A 4JOHA 1U3BA 2OCSA 3GDSA 3EGHC 2LA8A 2AWUA 5HDYA 1I92A 1W9OA 2D92A 4F8KA 3CBXA 1N7TA 1U37A 1W9QA 2EAQA 4K75A 2KPLA 5HEDA 4K78A 1VJ6A 4XHVA 2KJPA 1BE9A 2KOMA 3SUZA 3PV4A 2OS6A 5G1DA 5F3XA 1IU0A 2P3WA 3CYYA 3CBYA 2REYA 1Q3OA 1Q7XA 4JJ0A 5HF1A 3GJ9A 3CH8A 3GCOA 3I1EA 3K1RA 3ZRTA 5ILBA 2QT5A 2LC7A 1GQ5A 1N6EA 1OBYA 3NGHA 4K6YA 2FNEA 3KZDA 2M10A 2YUBA 2H2BA 2MHOA 3ID1A 2Z17A 2EDPA 2D8IA 1UJUA 4NMTA 3SFJA 1UJVA 3DJ3A 3RLEA 2OGPA 1VCWA 4NNLA 5B6LA 4NMSA 2WL7A 2F0AA 1QLCA 2W4FA 2OPGA 2I1NA 4Q2NA 4K76A 4RI0A 4JOGA 2EHRA 3KDGA 4Q2QA 2M0UA 2EGKA 1RGWA 3PV2A 1KY9A 3DIWA 1IHJA 2KPKA 4NXPA 1X5RA 3RL7A 1MFLA 3DORA 2F5YA 4N6XA 1Y8TA 2OSGA 4MPAA 1WIFA 2EGNA 2KL1A 1GQ4A 2JSNA 1N99A 1PDRA 2EEHA 2YTWA 2BYGA 2IWOA 3GCNA 1UEPA 4NMOA 3OTPA 4NMPA 1KEFA 2W7RA 5A2PA 4NXQA 3NFLA 3QDOA 2QBWA 2I04A 5E6PB 2VSVA 2M0ZA 2EDVA 2LOBA 2JIKA 1TP5A 4JOPA 1RY4A 1TP3A 1NF3C 3PDVA 3KHFA 2E7KA 1QAVB 3SOEA 4KFVA 4L8NA 2DKRA 2I0IA 1UEZA 3K50A 2EJYA 5D13A 1U38A 2VRFA 5JXBA 2KJKA 3R69A 3QJMA 4NMQA 3O46A 2L4TA 3STJA 1T2MA 1Z87A 5HFDA 1QAVA 2KYLA 1WHAA 4JOJA 2M0VA 1V1TA 1M5ZA 1I16A 2DJTA 1LCYA 2ZPLA 4E34A 2HE2A 2PKTA 2OMJA 4Q6SA 4WYTA 5E21A 1TQ3A 4OEPA 3ID4A 3I18A 2DAZA 2FE5A 3VQGA 2RRMA 1X6DA 1RZXA 2IWPA 4JOKA 3QJNA 2OZFA 2GEFA 3HPKA 2AWXA 3BPUA 4FGMA 4Q2PA 1NTEA 2G2LA 2VPHA 4GVDA 4Q2OA 4REYA 2M3MA 1X5QA 4IC6A 2JXOA 3K82A 3R68A 2KRGA 2VZ5A 2DMZA 1UM1A 1VB7A 1VA8A 1X45A 1FC9A 2Q3GA 2CSSA 2OQSA 4JOFA 2H3MA 4P0CA 3MH7A 1FCFA 1WI2A 1N7EA 3QIKA 4K72A 3L4FD 3DJAA 3LNYA 5HEYA 2PNTA 2Z9IA 3I4WA 2VSPA 1WG6A 2DLSA 2KBSA 1V6BA 2EEJA 2H3LA 3KZEA 1IU2A 2JOAA 1UFXA 4HOPB 3TMHA 2KV8A 5DTHA 3KDKA 2YT8A 1VAEA 4JOEA 2JINA 2K1ZA 4UU6A 2L97A 1GM1A 1N6DA 5H3JA 3CS0A 2CSJA 2EEIA 4HOPA 3GGEA 3NFKA 2KOHA 4Z8JA 3WKMA 3JXTA 4NXRA 2DLUA 2GZVA 2JWEA 2R3YA 5G1EA 1WI4A 3SHUA 1WJLA 2KA9A 3HVQC 4O06A 4E3BA 2QKUA 1OBXA 5E22A 3R0HA 1P1DA 1TE0A 3FY5A 2IWQA 2V90A 1U39A 5IL9A 2O2TA 4KFWA 2EGOA 3TSZA 5B42A 3LNXA 4GVCA 1V5QA 1KWAA 2KAWA 1B8QA 1WH1A 2I6VA 2FCFA 2DB5A 3PV5A 5GNDA 2KJDA 1YBOA 2D90A 5HFCA 1OBZA 3E17A 2CS5A 1BFEA 1K32A 2KOJA 4JJ3A 1WFVA 4AMHA 2ZPMA 3QE1A 3GDUA 5E1YA 3GABA 2EDZA 1X5NA 2LC6A 5HFEA 4GHNA 1UEWA 3EGGC 2M0TA 2EV8A 1UITA 5EZ0A 2I0LA 4Q3HA 4E35A 2IWNA 1MC7A 3MH6A 5I7ZA 1WHDA 5HJ1A 2X7ZA 4H11A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HEB A;  4JL7 A;  3ID3 A;  2Q9V A;  4R2Z A;  4WYU A;  1UF1 A;  2K20 A;  2PDZ A;  2QKT A;  3ID2 A;  5FB8 C;  1V62 A;  2UZC A;  2YT7 A;  2KG2 A;  5FHT A;  1D5G A;  1UJD A;  2L4S A;  1N7F A;  4NNM A;  5HFF A;  2DC2 A;  1V5L A;  3CC0 A;  2V1W A;  3SHW A;  3DJ1 A;  1Y7N A;  3PS4 A;  2PA1 A;  1XZ9 A;  3RL8 A;  3HPM A;  2H2C A;  4P2A B;  5F67 A;  4YDP A;  1W9E A;  4OEO A;  4UU5 A;  1ZUB A;  2FN5 A;  1R6J A;  1RGR A;  4EDJ A;  3O5N A;  5HFB A;  5GLJ A;  3OU0 A;  1QAU A;  4Z33 A;  2MX6 A;  2QG1 A;  3TSV A;  3AXA A;  1UEQ A;  2DM8 A;  3B76 A;  5HET A;  2AIN A;  2AWW A;  2JRE A;  1P1E A;  2QKV A;  4NMR A;  3PDZ A;  1WFG A;  3QGL A;  2LUI A;  4YYX A;  1Z86 A;  3MH4 A;  1MFG A;  1FC6 A;  2RCZ A;  4PQW A;  4OAJ A;  5E11 A;  2EXG A;  5HF4 A;  4LMM A;  2JIL A;  3WKL A;  4Q6H A;  3CBZ A;  1WF8 A;  5EYZ A;  2G5M B;  2R4H A;  4JOR A;  1Q3P A;  1WF7 A;  1SOZ A;  1UM7 A;  2EEG A;  3TSW A;  4NMV A;  2VWR A;  2YUY A;  2HGA A;  3GDV A;  1OZI A;  1N6F A;  1UHP A;  2I4S A;  1X8S A;  3VQF A;  2HE4 A;  1SOT A;  1ZOK A;  2KQF A;  1L6O A;  2PZD A;  1FC7 A;  1G9O A;  2ENO A;  3QO6 A;  3GSL A;  2PKU A;  4G69 A;  4JOH A;  1U3B A;  2OCS A;  3GDS A;  3EGH C;  2LA8 A;  2AWU A;  5HDY A;  1I92 A;  1W9O A;  2D92 A;  4F8K A;  3CBX A;  1N7T A;  1U37 A;  1W9Q A;  2EAQ A;  4K75 A;  2KPL A;  5HED A;  4K78 A;  1VJ6 A;  4XHV A;  2KJP A;  1BE9 A;  2KOM A;  3SUZ A;  3PV4 A;  2OS6 A;  5G1D A;  5F3X A;  1IU0 A;  2P3W A;  3CYY A;  3CBY A;  2REY A;  1Q3O A;  1Q7X A;  5HF1 A;  3GJ9 A;  3CH8 A;  3GCO A;  3I1E A;  3K1R A;  3ZRT A;  2QT5 A;  2LC7 A;  1GQ5 A;  1N6E A;  1OBY A;  3NGH A;  4K6Y A;  2FNE A;  3KZD A;  2M10 A;  2YUB A;  2H2B A;  2MHO A;  3ID1 A;  2Z17 A;  2EDP A;  2D8I A;  1UJU A;  4NMT A;  3SFJ A;  1UJV A;  3DJ3 A;  3RLE A;  2OGP A;  1VCW A;  4NNL A;  5B6L A;  4NMS A;  2WL7 A;  2F0A A;  1QLC A;  2W4F A;  2OPG A;  2I1N A;  4Q2N A;  4K76 A;  4RI0 A;  4JOG A;  2EHR A;  4Q2Q A;  2M0U A;  2EGK A;  1RGW A;  3PV2 A;  1KY9 A;  3DIW A;  1IHJ A;  2KPK A;  4NXP A;  1X5R A;  3RL7 A;  1MFL A;  3DOR A;  2F5Y A;  4N6X A;  1Y8T A;  2OSG A;  4MPA A;  1WIF A;  2EGN A;  2KL1 A;  1GQ4 A;  1N99 A;  1PDR A;  2EEH A;  2YTW A;  2BYG A;  2IWO A;  3GCN A;  1UEP A;  4NMO A;  3OTP A;  4NMP A;  1KEF A;  2W7R A;  5A2P A;  4NXQ A;  3NFL A;  3QDO A;  2QBW A;  2I04 A;  5E6P B;  2VSV A;  2M0Z A;  2EDV A;  2LOB A;  2JIK A;  1TP5 A;  4JOP A;  1RY4 A;  1TP3 A;  1NF3 C;  3PDV A;  3KHF A;  2E7K A;  1QAV B;  3SOE A;  4KFV A;  4L8N A;  2DKR A;  2I0I A;  1UEZ A;  3K50 A;  2EJY A;  5D13 A;  1U38 A;  2VRF A;  5JXB A;  2KJK A;  3R69 A;  3QJM A;  4NMQ A;  3O46 A;  2L4T A;  3STJ A;  1T2M A;  1Z87 A;  5HFD A;  1QAV A;  2KYL A;  1WHA A;  4JOJ A;  2M0V A;  1V1T A;  1M5Z A;  1I16 A;  2DJT A;  1LCY A;  2ZPL A;  4E34 A;  2HE2 A;  2PKT A;  2OMJ A;  4Q6S A;  4WYT A;  5E21 A;  1TQ3 A;  4OEP A;  3ID4 A;  3I18 A;  2DAZ A;  2FE5 A;  3VQG A;  2RRM A;  1X6D A;  1RZX A;  2IWP A;  4JOK A;  3QJN A;  2OZF A;  3HPK A;  2AWX A;  3BPU A;  4FGM A;  4Q2P A;  1NTE A;  2G2L A;  2VPH A;  4GVD A;  4Q2O A;  4REY A;  2M3M A;  1X5Q A;  4IC6 A;  2JXO A;  3K82 A;  3R68 A;  2KRG A;  2VZ5 A;  2DMZ A;  1UM1 A;  1VB7 A;  1VA8 A;  1X45 A;  1FC9 A;  2Q3G A;  2CSS A;  2OQS A;  4JOF A;  2H3M A;  4P0C A;  3MH7 A;  1FCF A;  1WI2 A;  1N7E A;  3QIK A;  4K72 A;  3L4F D;  3DJA A;  3LNY A;  5HEY A;  2PNT A;  2Z9I A;  3I4W A;  2VSP A;  1WG6 A;  2DLS A;  2KBS A;  1V6B A;  2EEJ A;  2H3L A;  3KZE A;  1IU2 A;  2JOA A;  1UFX A;  4HOP B;  3TMH A;  2KV8 A;  5DTH A;  2YT8 A;  1VAE A;  4JOE A;  2JIN A;  2K1Z A;  4UU6 A;  2L97 A;  1GM1 A;  1N6D A;  5H3J A;  3CS0 A;  2CSJ A;  2EEI A;  4HOP A;  3GGE A;  3NFK A;  2KOH A;  4Z8J A;  3WKM A;  3JXT A;  4NXR A;  2DLU A;  2GZV A;  2JWE A;  2R3Y A;  5G1E A;  1WI4 A;  3SHU A;  1WJL A;  2KA9 A;  3HVQ C;  4O06 A;  4E3B A;  2QKU A;  1OBX A;  5E22 A;  3R0H A;  1P1D A;  1TE0 A;  3FY5 A;  2IWQ A;  2V90 A;  1U39 A;  2O2T A;  4KFW A;  2EGO A;  3TSZ A;  3LNX A;  4GVC A;  1V5Q A;  1KWA A;  2KAW A;  1B8Q A;  1WH1 A;  2I6V A;  2FCF A;  2DB5 A;  3PV5 A;  5GND A;  2KJD A;  1YBO A;  2D90 A;  5HFC A;  1OBZ A;  3E17 A;  2CS5 A;  1BFE A;  1K32 A;  2KOJ A;  1WFV A;  4AMH A;  2ZPM A;  3QE1 A;  3GDU A;  5E1Y A;  2EDZ A;  1X5N A;  2LC6 A;  5HFE A;  4GHN A;  1UEW A;  3EGG C;  2M0T A;  2EV8 A;  1UIT A;  5EZ0 A;  2I0L A;  4Q3H A;  4E35 A;  2IWN A;  1MC7 A;  3MH6 A;  5I7Z A;  1WHD A;  5HJ1 A;  2X7Z A;  4H11 A; 
#chains in the Genus database with same CATH topology
 5HEB A;  4JL7 A;  3ID3 A;  2Q9V A;  4R2Z A;  4WYU A;  1UF1 A;  2K20 A;  2PDZ A;  2QKT A;  3ID2 A;  5FB8 C;  1V62 A;  2UZC A;  2YT7 A;  1X9Z A;  2KG2 A;  5FHT A;  1D5G A;  1UJD A;  2L4S A;  1N7F A;  3NCV A;  4NNM A;  5HFF A;  2DC2 A;  1V5L A;  3CC0 A;  2V1W A;  3SHW A;  3DJ1 A;  1Y7N A;  3PS4 A;  2PA1 A;  1XZ9 A;  3RL8 A;  3HPM A;  2H2C A;  4P2A B;  5F67 A;  4YDP A;  1W9E A;  4OEO A;  4UU5 A;  1ZUB A;  2FN5 A;  1R6J A;  1RGR A;  4EDJ A;  3O5N A;  5HFB A;  5GLJ A;  3OU0 A;  1QAU A;  4Z33 A;  2MX6 A;  2QG1 A;  3TSV A;  3AXA A;  1UEQ A;  2DM8 A;  3B76 A;  5HET A;  2AIN A;  2AWW A;  2JRE A;  1P1E A;  2QKV A;  4NMR A;  3PDZ A;  1WFG A;  4FLN A;  3QGL A;  2LUI A;  4YYX A;  1Z86 A;  3MH4 A;  1MFG A;  1FC6 A;  2RCZ A;  4PQW A;  4OAJ A;  5E11 A;  2EXG A;  5HF4 A;  4LMM A;  2JIL A;  3WKL A;  4Q6H A;  3CBZ A;  1WF8 A;  5EYZ A;  2G5M B;  2R4H A;  4JOR A;  1Q3P A;  1WF7 A;  1SOZ A;  1UM7 A;  2EEG A;  3TSW A;  4NMV A;  2VWR A;  2YUY A;  2HGA A;  3GDV A;  1OZI A;  1N6F A;  1UHP A;  2I4S A;  1X8S A;  3VQF A;  2HE4 A;  1SOT A;  1ZOK A;  2KQF A;  1L6O A;  2PZD A;  1FC7 A;  1G9O A;  2ENO A;  3QO6 A;  3GSL A;  2PKU A;  4G69 A;  4JOH A;  1U3B A;  2OCS A;  3GDS A;  3EGH C;  2LA8 A;  2AWU A;  5HDY A;  1I92 A;  1W9O A;  2D92 A;  4F8K A;  3CBX A;  1N7T A;  1U37 A;  1W9Q A;  2EAQ A;  4K75 A;  2KPL A;  5HED A;  4K78 A;  1VJ6 A;  4XHV A;  2KJP A;  1BE9 A;  2KOM A;  3SUZ A;  3PV4 A;  2OS6 A;  5G1D A;  5F3X A;  1IU0 A;  2P3W A;  3CYY A;  3CBY A;  2REY A;  1Q3O A;  1Q7X A;  4JJ0 A;  5HF1 A;  3GJ9 A;  3CH8 A;  3GCO A;  3I1E A;  3K1R A;  3ZRT A;  5ILB A;  2QT5 A;  2LC7 A;  1GQ5 A;  1N6E A;  1OBY A;  3NGH A;  4K6Y A;  2FNE A;  3KZD A;  2M10 A;  2YUB A;  2H2B A;  2MHO A;  3ID1 A;  2Z17 A;  2EDP A;  2D8I A;  1UJU A;  4NMT A;  3SFJ A;  1UJV A;  3DJ3 A;  3RLE A;  2OGP A;  1VCW A;  4NNL A;  5B6L A;  4NMS A;  2WL7 A;  2F0A A;  1QLC A;  2W4F A;  2OPG A;  2I1N A;  4Q2N A;  4K76 A;  4RI0 A;  4JOG A;  2EHR A;  3KDG A;  4Q2Q A;  2M0U A;  2EGK A;  1RGW A;  3PV2 A;  1KY9 A;  3DIW A;  1IHJ A;  2KPK A;  4NXP A;  1X5R A;  3RL7 A;  1MFL A;  3DOR A;  2F5Y A;  4N6X A;  1Y8T A;  2OSG A;  4MPA A;  1WIF A;  2EGN A;  2KL1 A;  1GQ4 A;  2JSN A;  1N99 A;  1PDR A;  2EEH A;  2YTW A;  2BYG A;  2IWO A;  3GCN A;  1UEP A;  4NMO A;  3OTP A;  4NMP A;  1KEF A;  2W7R A;  5A2P A;  4NXQ A;  3NFL A;  3QDO A;  2QBW A;  2I04 A;  5E6P B;  2VSV A;  2M0Z A;  2EDV A;  2LOB A;  2JIK A;  1TP5 A;  4JOP A;  1RY4 A;  1TP3 A;  1NF3 C;  3PDV A;  3KHF A;  2E7K A;  1QAV B;  3SOE A;  4KFV A;  4L8N A;  2DKR A;  2I0I A;  1UEZ A;  3K50 A;  2EJY A;  5D13 A;  1U38 A;  2VRF A;  5JXB A;  2KJK A;  3R69 A;  3QJM A;  4NMQ A;  3O46 A;  2L4T A;  3STJ A;  1T2M A;  1Z87 A;  5HFD A;  1QAV A;  2KYL A;  1WHA A;  4JOJ A;  2M0V A;  1V1T A;  1M5Z A;  1I16 A;  2DJT A;  1LCY A;  2ZPL A;  4E34 A;  2HE2 A;  2PKT A;  2OMJ A;  4Q6S A;  4WYT A;  5E21 A;  1TQ3 A;  4OEP A;  3ID4 A;  3I18 A;  2DAZ A;  2FE5 A;  3VQG A;  2RRM A;  1X6D A;  1RZX A;  2IWP A;  4JOK A;  3QJN A;  2OZF A;  2GEF A;  3HPK A;  2AWX A;  3BPU A;  4FGM A;  4Q2P A;  1NTE A;  2G2L A;  2VPH A;  4GVD A;  4Q2O A;  4REY A;  2M3M A;  1X5Q A;  4IC6 A;  2JXO A;  3K82 A;  3R68 A;  2KRG A;  2VZ5 A;  2DMZ A;  1UM1 A;  1VB7 A;  1VA8 A;  1X45 A;  1FC9 A;  2Q3G A;  2CSS A;  2OQS A;  4JOF A;  2H3M A;  4P0C A;  3MH7 A;  1FCF A;  1WI2 A;  1N7E A;  3QIK A;  4K72 A;  3L4F D;  3DJA A;  3LNY A;  5HEY A;  2PNT A;  2Z9I A;  3I4W A;  2VSP A;  1WG6 A;  2DLS A;  2KBS A;  1V6B A;  2EEJ A;  2H3L A;  3KZE A;  1IU2 A;  2JOA A;  1UFX A;  4HOP B;  3TMH A;  2KV8 A;  5DTH A;  3KDK A;  2YT8 A;  1VAE A;  4JOE A;  2JIN A;  2K1Z A;  4UU6 A;  2L97 A;  1GM1 A;  1N6D A;  5H3J A;  3CS0 A;  2CSJ A;  2EEI A;  4HOP A;  3GGE A;  3NFK A;  2KOH A;  4Z8J A;  3WKM A;  3JXT A;  4NXR A;  2DLU A;  2GZV A;  2JWE A;  2R3Y A;  5G1E A;  1WI4 A;  3SHU A;  1WJL A;  2KA9 A;  3HVQ C;  4O06 A;  4E3B A;  2QKU A;  1OBX A;  5E22 A;  3R0H A;  1P1D A;  1TE0 A;  3FY5 A;  2IWQ A;  2V90 A;  1U39 A;  5IL9 A;  2O2T A;  4KFW A;  2EGO A;  3TSZ A;  5B42 A;  3LNX A;  4GVC A;  1V5Q A;  1KWA A;  2KAW A;  1B8Q A;  1WH1 A;  2I6V A;  2FCF A;  2DB5 A;  3PV5 A;  5GND A;  2KJD A;  1YBO A;  2D90 A;  5HFC A;  1OBZ A;  3E17 A;  2CS5 A;  1BFE A;  1K32 A;  2KOJ A;  4JJ3 A;  1WFV A;  4AMH A;  2ZPM A;  3QE1 A;  3GDU A;  5E1Y A;  3GAB A;  2EDZ A;  1X5N A;  2LC6 A;  5HFE A;  4GHN A;  1UEW A;  3EGG C;  2M0T A;  2EV8 A;  1UIT A;  5EZ0 A;  2I0L A;  4Q3H A;  4E35 A;  2IWN A;  1MC7 A;  3MH6 A;  5I7Z A;  1WHD A;  5HJ1 A;  2X7Z A;  4H11 A; 
#chains in the Genus database with same CATH homology
 5HEB A;  4JL7 A;  3ID3 A;  2Q9V A;  4R2Z A;  4WYU A;  1UF1 A;  2K20 A;  2PDZ A;  2QKT A;  3ID2 A;  5FB8 C;  1V62 A;  2UZC A;  2YT7 A;  1X9Z A;  2KG2 A;  5FHT A;  1D5G A;  1UJD A;  2L4S A;  1N7F A;  3NCV A;  4NNM A;  5HFF A;  2DC2 A;  1V5L A;  3CC0 A;  2V1W A;  3SHW A;  3DJ1 A;  1Y7N A;  3PS4 A;  2PA1 A;  1XZ9 A;  3RL8 A;  3HPM A;  2H2C A;  4P2A B;  5F67 A;  4YDP A;  1W9E A;  4OEO A;  4UU5 A;  1ZUB A;  2FN5 A;  1R6J A;  1RGR A;  4EDJ A;  3O5N A;  5HFB A;  5GLJ A;  3OU0 A;  1QAU A;  4Z33 A;  2MX6 A;  2QG1 A;  3TSV A;  3AXA A;  1UEQ A;  2DM8 A;  3B76 A;  5HET A;  2AIN A;  2AWW A;  2JRE A;  1P1E A;  2QKV A;  4NMR A;  3PDZ A;  1WFG A;  4FLN A;  3QGL A;  2LUI A;  4YYX A;  1Z86 A;  3MH4 A;  1MFG A;  1FC6 A;  2RCZ A;  4PQW A;  4OAJ A;  5E11 A;  2EXG A;  5HF4 A;  4LMM A;  2JIL A;  3WKL A;  4Q6H A;  3CBZ A;  1WF8 A;  5EYZ A;  2G5M B;  2R4H A;  4JOR A;  1Q3P A;  1WF7 A;  1SOZ A;  1UM7 A;  2EEG A;  3TSW A;  4NMV A;  2VWR A;  2YUY A;  2HGA A;  3GDV A;  1OZI A;  1N6F A;  1UHP A;  2I4S A;  1X8S A;  3VQF A;  2HE4 A;  1SOT A;  1ZOK A;  2KQF A;  1L6O A;  2PZD A;  1FC7 A;  1G9O A;  2ENO A;  3QO6 A;  3GSL A;  2PKU A;  4G69 A;  4JOH A;  1U3B A;  2OCS A;  3GDS A;  3EGH C;  2LA8 A;  2AWU A;  5HDY A;  1I92 A;  1W9O A;  2D92 A;  4F8K A;  3CBX A;  1N7T A;  1U37 A;  1W9Q A;  2EAQ A;  4K75 A;  2KPL A;  5HED A;  4K78 A;  1VJ6 A;  4XHV A;  2KJP A;  1BE9 A;  2KOM A;  3SUZ A;  3PV4 A;  2OS6 A;  5G1D A;  5F3X A;  1IU0 A;  2P3W A;  3CYY A;  3CBY A;  2REY A;  1Q3O A;  1Q7X A;  4JJ0 A;  5HF1 A;  3GJ9 A;  3CH8 A;  3GCO A;  3I1E A;  3K1R A;  3ZRT A;  5ILB A;  2QT5 A;  2LC7 A;  1GQ5 A;  1N6E A;  1OBY A;  3NGH A;  4K6Y A;  2FNE A;  3KZD A;  2M10 A;  2YUB A;  2H2B A;  2MHO A;  3ID1 A;  2Z17 A;  2EDP A;  2D8I A;  1UJU A;  4NMT A;  3SFJ A;  1UJV A;  3DJ3 A;  3RLE A;  2OGP A;  1VCW A;  4NNL A;  5B6L A;  4NMS A;  2WL7 A;  2F0A A;  1QLC A;  2W4F A;  2OPG A;  2I1N A;  4Q2N A;  4K76 A;  4RI0 A;  4JOG A;  2EHR A;  3KDG A;  4Q2Q A;  2M0U A;  2EGK A;  1RGW A;  3PV2 A;  1KY9 A;  3DIW A;  1IHJ A;  2KPK A;  4NXP A;  1X5R A;  3RL7 A;  1MFL A;  3DOR A;  2F5Y A;  4N6X A;  1Y8T A;  2OSG A;  4MPA A;  1WIF A;  2EGN A;  2KL1 A;  1GQ4 A;  2JSN A;  1N99 A;  1PDR A;  2EEH A;  2YTW A;  2BYG A;  2IWO A;  3GCN A;  1UEP A;  4NMO A;  3OTP A;  4NMP A;  1KEF A;  2W7R A;  5A2P A;  4NXQ A;  3NFL A;  3QDO A;  2QBW A;  2I04 A;  5E6P B;  2VSV A;  2M0Z A;  2EDV A;  2LOB A;  2JIK A;  1TP5 A;  4JOP A;  1RY4 A;  1TP3 A;  1NF3 C;  3PDV A;  3KHF A;  2E7K A;  1QAV B;  3SOE A;  4KFV A;  4L8N A;  2DKR A;  2I0I A;  1UEZ A;  3K50 A;  2EJY A;  5D13 A;  1U38 A;  2VRF A;  5JXB A;  2KJK A;  3R69 A;  3QJM A;  4NMQ A;  3O46 A;  2L4T A;  3STJ A;  1T2M A;  1Z87 A;  5HFD A;  1QAV A;  2KYL A;  1WHA A;  4JOJ A;  2M0V A;  1V1T A;  1M5Z A;  1I16 A;  2DJT A;  1LCY A;  2ZPL A;  4E34 A;  2HE2 A;  2PKT A;  2OMJ A;  4Q6S A;  4WYT A;  5E21 A;  1TQ3 A;  4OEP A;  3ID4 A;  3I18 A;  2DAZ A;  2FE5 A;  3VQG A;  2RRM A;  1X6D A;  1RZX A;  2IWP A;  4JOK A;  3QJN A;  2OZF A;  2GEF A;  3HPK A;  2AWX A;  3BPU A;  4FGM A;  4Q2P A;  1NTE A;  2G2L A;  2VPH A;  4GVD A;  4Q2O A;  4REY A;  2M3M A;  1X5Q A;  4IC6 A;  2JXO A;  3K82 A;  3R68 A;  2KRG A;  2VZ5 A;  2DMZ A;  1UM1 A;  1VB7 A;  1VA8 A;  1X45 A;  1FC9 A;  2Q3G A;  2CSS A;  2OQS A;  4JOF A;  2H3M A;  4P0C A;  3MH7 A;  1FCF A;  1WI2 A;  1N7E A;  3QIK A;  4K72 A;  3L4F D;  3DJA A;  3LNY A;  5HEY A;  2PNT A;  2Z9I A;  3I4W A;  2VSP A;  1WG6 A;  2DLS A;  2KBS A;  1V6B A;  2EEJ A;  2H3L A;  3KZE A;  1IU2 A;  2JOA A;  1UFX A;  4HOP B;  3TMH A;  2KV8 A;  5DTH A;  3KDK A;  2YT8 A;  1VAE A;  4JOE A;  2JIN A;  2K1Z A;  4UU6 A;  2L97 A;  1GM1 A;  1N6D A;  5H3J A;  3CS0 A;  2CSJ A;  2EEI A;  4HOP A;  3GGE A;  3NFK A;  2KOH A;  4Z8J A;  3WKM A;  3JXT A;  4NXR A;  2DLU A;  2GZV A;  2JWE A;  2R3Y A;  5G1E A;  1WI4 A;  3SHU A;  1WJL A;  2KA9 A;  3HVQ C;  4O06 A;  4E3B A;  2QKU A;  1OBX A;  5E22 A;  3R0H A;  1P1D A;  1TE0 A;  3FY5 A;  2IWQ A;  2V90 A;  1U39 A;  5IL9 A;  2O2T A;  4KFW A;  2EGO A;  3TSZ A;  5B42 A;  3LNX A;  4GVC A;  1V5Q A;  1KWA A;  2KAW A;  1B8Q A;  1WH1 A;  2I6V A;  2FCF A;  2DB5 A;  3PV5 A;  5GND A;  2KJD A;  1YBO A;  2D90 A;  5HFC A;  1OBZ A;  3E17 A;  2CS5 A;  1BFE A;  1K32 A;  2KOJ A;  4JJ3 A;  1WFV A;  4AMH A;  2ZPM A;  3QE1 A;  3GDU A;  5E1Y A;  3GAB A;  2EDZ A;  1X5N A;  2LC6 A;  5HFE A;  4GHN A;  1UEW A;  3EGG C;  2M0T A;  2EV8 A;  1UIT A;  5EZ0 A;  2I0L A;  4Q3H A;  4E35 A;  2IWN A;  1MC7 A;  3MH6 A;  5I7Z A;  1WHD A;  5HJ1 A;  2X7Z A;  4H11 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...