5A2PA

The complex structure of pdz domains in syntenin-1 with 4l peptide
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
162
structure length
162
Chain Sequence
GIREVILCKDQDGKIGLRLKSVDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITMTIRDRPFERTVTMHKDSSGHVGFIFKSGKITSIVKDSSAARNGLLTDHHICEINGQNVIGLKDAQIADILSTAGTVVTITIMPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SYNTENIN-1
publication title Titl the Complex Structure of Pdz Domains in Syntenin-1 with 4L Peptide
rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
total genus 38
structure length 162
sequence length 162
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17820 PDZ_6 PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 5a2pA02
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 5a2pA01
4Q2PA 2RCZA 2GZVA 4E34A 2D90A 3CBZA 1Y8TA 1N6DA 3DJ1A 4E3BA 2H3LA 1UM1A 3E17A 1T2MA 2EXGA 1X8SA 1L6OA 5DTHA 4NXRA 3CC0A 5E11A 2LC7A 3SHWA 5HEBA 4NMPA 5E6PB 2AWXA 2EDVA 2IWOA 1GQ5A 2YUBA 5G1DA 3QE1A 2FN5A 4K72A 1VB7A 2DJTA 3ID2A 3HPKA 3MH4A 2KPLA 3GDSA 5E21A 2KOJA 3OU0A 2I4SA 1RGWA 4OAJA 1Q7XA 5JXBA 2E7KA 4R2ZA 1WG6A 2QT5A 2W7RA 1WI2A 2KOHA 4UU6A 3GJ9A 4NMOA 4IC6A 2DKRA 3RL7A 2I04A 5B6LA 4Q6HA 1N7TA 2DB5A 5HEDA 1X5RA 4GVDA 3DJAA 5I7ZA 2I0LA 2HGAA 1UHPA 1OZIA 3DIWA 3SUZA 2KPKA 2DMZA 2OSGA 1NF3C 3LNXA 3VQFA 5HFBA 1WFGA 5EZ0A 1UEWA 2QBWA 1TP3A 3PDVA 4JORA 1WH1A 1OBXA 2EEIA 3RL8A 3MH7A 3SOEA 3QIKA 1W9EA 4NMSA 3ID1A 5D13A 3O46A 2Q3GA 4K76A 4JOFA 5HFCA 4NNLA 5FB8C 3ZRTA 3NFKA 5HEYA 1QAUA 2WL7A 4Q2OA 2JXOA 2PZDA 2JILA 1N7FA 1VA8A 3KZDA 1M5ZA 2LA8A 3EGGC 2FNEA 4NMTA 2DC2A 2DAZA 5G1EA 1RGRA 2IWNA 2CSSA 2G2LA 1D5GA 4G69A 1VCWA 3OTPA 1N6FA 2KJPA 4GVCA 4MPAA 2AINA 1UJDA 2PNTA 2CS5A 3AXAA 3PS4A 5F67A 1KWAA 1SOTA 2HE2A 2OCSA 1QLCA 2EDZA 4NMQA 3RLEA 1U3BA 5HDYA 3CH8A 3TMHA 4Q3HA 2KQFA 4JOEA 2MHOA 5GLJA 5HFDA 1Z87A 1R6JA 4O06A 1X45A 1WF8A 1BE9A 3MH6A 2LUIA 2EEJA 1UF1A 4FGMA 2L4TA 2G5MB 2AWUA 2OZFA 1UEZA 3GCNA 1U37A 4P2AB 5HJ1A 2AWWA 2YTWA 3LNYA 4NNMA 2KBSA 3GDUA 2KJDA 1P1EA 3R69A 3NFLA 4AMHA 3R68A 5EYZA 2M3MA 3I1EA 4KFWA 4XHVA 3SHUA 2X7ZA 2KYLA 1N99A 1WFVA 2YT7A 4H11A 2PKUA 3K82A 1UITA 2EHRA 3KHFA 2EAQA 1OBZA 1W9OA 2VSPA 3VQGA 2DLUA 4JOGA 1UEQA 4NXQA 1TP5A 1TQ3A 2W4FA 3BPUA 5H3JA 5E1YA 3PV4A 4Q2NA 4Z8JA 2REYA 2YT8A 2MX6A 1UM7A 2IWPA 2H2CA 1Z86A 1WHDA 2FE5A 2K1ZA 2EV8A 3WKMA 3QGLA 1MC7A 1Y7NA 2OMJA 3O5NA 4LMMA 1FC6A 2DLSA 4JOHA 3QJNA 2VWRA 4F8KA 2M0VA 2LOBA 2I0IA 2ENOA 2H3MA 2R3YA 2VSVA 4Q6SA 1WHAA 4L8NA 2VRFA 1G9OA 1IU0A 2V1WA 2EGOA 5A2PA 3EGHC 5HF1A 2JINA 1UJVA 3QJMA 2LC6A 1N6EA 5HETA 1V5LA 4OEOA 2K20A 3PV2A 2EDPA 2YUYA 4K6YA 1KY9A 1X5QA 4WYUA 2JREA 3GDVA 4NXPA 4P0CA 3DJ3A 1V62A 2QKVA 1U39A 3K1RA 1VAEA 2I6VA 2KV8A 1LCYA 3R0HA 4NMVA 1RY4A 2JOAA 4YYXA 1PDRA 2L4SA 2KJKA 1YBOA 4JL7A 3TSVA 1W9QA 2RRMA 3NGHA 1IU2A 2JIKA 1UFXA 1B8QA 2KG2A 2H2BA 4GHNA 1N7EA 2M10A 3FY5A 5E22A 4REYA 3DORA 2D8IA 2PDZA 4OEPA 1ZOKA 1UJUA 2F5YA 1SOZA 1FC7A 1P1DA 3SFJA 1Q3PA 2EGNA 4HOPA 2QG1A 2EGKA 2D92A 2PKTA 1FC9A 2M0UA 5HFEA 2EEGA 1QAVA 4JOKA 2F0AA 4E35A 4NMRA 1Q3OA 3QDOA 1UEPA 3K50A 2M0ZA 3GGEA 2IWQA 1VJ6A 1GQ4A 5F3XA 1MFGA 3I18A 2DM8A 2R4HA 1GM1A 2OPGA 2Q9VA 2KOMA 3PV5A 4N6XA 1RZXA 4EDJA 2KAWA 2KA9A 2Z9IA 1I16A 1TE0A 2Z17A 2O2TA 2JWEA 3CS0A 3L4FD 2KL1A 3QO6A 1X5NA 3TSZA 4WYTA 1NTEA 1V5QA 1WF7A 4K78A 4KFVA 1KEFA 2OS6A 2QKUA 1X6DA 2EEHA 5HFFA 3GSLA 5HF4A 2ZPMA 3I4WA 2EJYA 3KZEA 3WKLA 2V90A 2M0TA 4HOPB 4PQWA 3GCOA 3CYYA 1QAVB 3ID4A 3PDZA 1FCFA 2VPHA 4JOJA 4RI0A 1K32A 3HPMA 1OBYA 1V6BA 1V1TA 1U38A 2UZCA 2FCFA 5GNDA 3HVQC 3JXTA 5FHTA 4Q2QA 4JOPA 2PA1A 3B76A 1ZUBA 2OQSA 4K75A 1WIFA 2QKTA 2CSJA 2ZPLA 4YDPA 2L97A 2VZ5A 2KRGA 1XZ9A 4Z33A 2OGPA 1BFEA 2BYGA 3CBYA 2HE4A 3ID3A 2I1NA 3CBXA 3TSWA 1MFLA 1IHJA 1WJLA 1I92A 3STJA 1WI4A 2P3WA 4UU5A
chains in the Genus database with same CATH superfamily
4Q2PA 2RCZA 2GZVA 4E34A 2D90A 3CBZA 1Y8TA 1N6DA 3DJ1A 4E3BA 2H3LA 1UM1A 3E17A 1T2MA 2EXGA 1X8SA 1L6OA 5DTHA 4NXRA 3CC0A 5E11A 2LC7A 3SHWA 5HEBA 4NMPA 5E6PB 2AWXA 2EDVA 2IWOA 1GQ5A 2YUBA 5G1DA 3QE1A 2FN5A 4FLNA 4K72A 3NCVA 1VB7A 2DJTA 3ID2A 3HPKA 3MH4A 2KPLA 3GDSA 5E21A 2KOJA 3OU0A 2I4SA 1RGWA 4OAJA 1Q7XA 5JXBA 2E7KA 4R2ZA 1WG6A 2QT5A 2W7RA 1WI2A 2KOHA 4UU6A 3GJ9A 4NMOA 4IC6A 2DKRA 3RL7A 2I04A 5B6LA 4Q6HA 1N7TA 2DB5A 5HEDA 1X5RA 4GVDA 3DJAA 5I7ZA 2I0LA 2HGAA 1UHPA 1OZIA 3DIWA 3SUZA 4JJ0A 2KPKA 2DMZA 2OSGA 1NF3C 3LNXA 3VQFA 5HFBA 1WFGA 5EZ0A 1UEWA 2QBWA 1TP3A 3PDVA 4JORA 1WH1A 1OBXA 2EEIA 3RL8A 3MH7A 3SOEA 3QIKA 1W9EA 4NMSA 3ID1A 5D13A 3O46A 2Q3GA 4K76A 4JOFA 5HFCA 4NNLA 5FB8C 3ZRTA 3NFKA 5HEYA 1QAUA 2WL7A 4Q2OA 2JXOA 2PZDA 2JILA 1N7FA 1VA8A 3KZDA 1M5ZA 2LA8A 3EGGC 2FNEA 4NMTA 2DC2A 2DAZA 4JJ3A 5G1EA 1RGRA 2IWNA 2CSSA 2G2LA 2JSNA 1D5GA 4G69A 1VCWA 3OTPA 1N6FA 2KJPA 4GVCA 4MPAA 2AINA 1UJDA 5ILBA 2PNTA 2CS5A 3AXAA 2GEFA 3PS4A 5F67A 1KWAA 1SOTA 2HE2A 2OCSA 1QLCA 2EDZA 4NMQA 3RLEA 1U3BA 5HDYA 3CH8A 3TMHA 4Q3HA 2KQFA 4JOEA 2MHOA 5GLJA 5HFDA 1Z87A 1R6JA 4O06A 1X45A 1WF8A 3GABA 1BE9A 3MH6A 2LUIA 2EEJA 1UF1A 4FGMA 2L4TA 2G5MB 2AWUA 2OZFA 1UEZA 3GCNA 1U37A 4P2AB 5HJ1A 2AWWA 2YTWA 3LNYA 4NNMA 2KBSA 3GDUA 2KJDA 1P1EA 3R69A 3NFLA 4AMHA 3R68A 5EYZA 2M3MA 3I1EA 4KFWA 4XHVA 3SHUA 2X7ZA 2KYLA 1N99A 1WFVA 2YT7A 4H11A 2PKUA 3K82A 1UITA 2EHRA 3KHFA 1X9ZA 3KDKA 2EAQA 1OBZA 1W9OA 2VSPA 3VQGA 2DLUA 4JOGA 1UEQA 4NXQA 1TP5A 1TQ3A 2W4FA 3BPUA 5H3JA 5E1YA 3PV4A 4Q2NA 4Z8JA 2REYA 2YT8A 2MX6A 1UM7A 2IWPA 2H2CA 1Z86A 1WHDA 2FE5A 2K1ZA 2EV8A 3WKMA 3QGLA 1MC7A 1Y7NA 2OMJA 3O5NA 4LMMA 1FC6A 2DLSA 4JOHA 3QJNA 2VWRA 4F8KA 2M0VA 2LOBA 2I0IA 2ENOA 2H3MA 2R3YA 2VSVA 4Q6SA 1WHAA 4L8NA 2VRFA 1G9OA 1IU0A 2V1WA 2EGOA 5A2PA 3EGHC 5HF1A 2JINA 1UJVA 3QJMA 2LC6A 1N6EA 5HETA 1V5LA 4OEOA 2K20A 3PV2A 2EDPA 2YUYA 4K6YA 1KY9A 1X5QA 4WYUA 2JREA 3GDVA 4NXPA 4P0CA 3DJ3A 5B42A 1V62A 2QKVA 1U39A 3K1RA 1VAEA 2I6VA 2KV8A 1LCYA 3R0HA 4NMVA 1RY4A 2JOAA 4YYXA 1PDRA 2L4SA 2KJKA 1YBOA 4JL7A 3TSVA 1W9QA 2RRMA 3NGHA 1IU2A 2JIKA 1UFXA 1B8QA 2KG2A 2H2BA 4GHNA 1N7EA 2M10A 3FY5A 5E22A 4REYA 3DORA 2D8IA 2PDZA 4OEPA 1ZOKA 1UJUA 2F5YA 1SOZA 3KDGA 1FC7A 1P1DA 3SFJA 1Q3PA 2EGNA 4HOPA 2QG1A 2EGKA 2D92A 2PKTA 1FC9A 2M0UA 5HFEA 2EEGA 1QAVA 4JOKA 2F0AA 4E35A 4NMRA 1Q3OA 3QDOA 1UEPA 3K50A 2M0ZA 3GGEA 2IWQA 1VJ6A 1GQ4A 5F3XA 1MFGA 3I18A 2DM8A 2R4HA 1GM1A 2OPGA 2Q9VA 2KOMA 3PV5A 4N6XA 1RZXA 4EDJA 2KAWA 2KA9A 2Z9IA 1I16A 1TE0A 2Z17A 2O2TA 2JWEA 3CS0A 3L4FD 2KL1A 3QO6A 1X5NA 3TSZA 4WYTA 1NTEA 1V5QA 1WF7A 4K78A 4KFVA 1KEFA 5IL9A 2OS6A 2QKUA 1X6DA 2EEHA 5HFFA 3GSLA 5HF4A 2ZPMA 3I4WA 2EJYA 3KZEA 3WKLA 2V90A 2M0TA 4HOPB 4PQWA 3GCOA 3CYYA 1QAVB 3ID4A 3PDZA 1FCFA 2VPHA 4JOJA 4RI0A 1K32A 3HPMA 1OBYA 1V6BA 1V1TA 1U38A 2UZCA 2FCFA 5GNDA 3HVQC 3JXTA 5FHTA 4Q2QA 4JOPA 2PA1A 3B76A 1ZUBA 2OQSA 4K75A 1WIFA 2QKTA 2CSJA 2ZPLA 4YDPA 2L97A 2VZ5A 2KRGA 1XZ9A 4Z33A 2OGPA 1BFEA 2BYGA 3CBYA 2HE4A 3ID3A 2I1NA 3CBXA 3TSWA 1MFLA 1IHJA 1WJLA 1I92A 3STJA 1WI4A 2P3WA 4UU5A
chains in the Genus database with same CATH topology
4Q2PA 2RCZA 2GZVA 4E34A 2D90A 3CBZA 1Y8TA 1N6DA 3DJ1A 4E3BA 2H3LA 1UM1A 3E17A 1T2MA 2EXGA 1X8SA 1L6OA 5DTHA 4NXRA 3CC0A 5E11A 2LC7A 3SHWA 5HEBA 4NMPA 5E6PB 2AWXA 2EDVA 2IWOA 1GQ5A 2YUBA 5G1DA 3QE1A 2FN5A 4FLNA 4K72A 3NCVA 1VB7A 2DJTA 3ID2A 3HPKA 3MH4A 2KPLA 3GDSA 5E21A 2KOJA 3OU0A 2I4SA 1RGWA 4OAJA 1Q7XA 5JXBA 2E7KA 4R2ZA 1WG6A 2QT5A 2W7RA 1WI2A 2KOHA 4UU6A 3GJ9A 4NMOA 4IC6A 2DKRA 3RL7A 2I04A 5B6LA 4Q6HA 1N7TA 2DB5A 5HEDA 1X5RA 4GVDA 3DJAA 5I7ZA 2I0LA 2HGAA 1UHPA 1OZIA 3DIWA 3SUZA 4JJ0A 2KPKA 2DMZA 2OSGA 1NF3C 3LNXA 3VQFA 5HFBA 1WFGA 5EZ0A 1UEWA 2QBWA 1TP3A 3PDVA 4JORA 1WH1A 1OBXA 2EEIA 3RL8A 3MH7A 3SOEA 3QIKA 1W9EA 4NMSA 3ID1A 5D13A 3O46A 2Q3GA 4K76A 4JOFA 5HFCA 4NNLA 5FB8C 3ZRTA 3NFKA 5HEYA 1QAUA 2WL7A 4Q2OA 2JXOA 2PZDA 2JILA 1N7FA 1VA8A 3KZDA 1M5ZA 2LA8A 3EGGC 2FNEA 4NMTA 2DC2A 2DAZA 4JJ3A 5G1EA 1RGRA 2IWNA 2CSSA 2G2LA 2JSNA 1D5GA 4G69A 1VCWA 3OTPA 1N6FA 2KJPA 4GVCA 4MPAA 2AINA 1UJDA 5ILBA 2PNTA 2CS5A 3AXAA 2GEFA 3PS4A 5F67A 1KWAA 1SOTA 2HE2A 2OCSA 1QLCA 2EDZA 4NMQA 3RLEA 1U3BA 5HDYA 3CH8A 3TMHA 4Q3HA 2KQFA 4JOEA 2MHOA 5GLJA 5HFDA 1Z87A 1R6JA 4O06A 1X45A 1WF8A 3GABA 1BE9A 3MH6A 2LUIA 2EEJA 1UF1A 4FGMA 2L4TA 2G5MB 2AWUA 2OZFA 1UEZA 3GCNA 1U37A 4P2AB 5HJ1A 2AWWA 2YTWA 3LNYA 4NNMA 2KBSA 3GDUA 2KJDA 1P1EA 3R69A 3NFLA 4AMHA 3R68A 5EYZA 2M3MA 3I1EA 4KFWA 4XHVA 3SHUA 2X7ZA 2KYLA 1N99A 1WFVA 2YT7A 4H11A 2PKUA 3K82A 1UITA 2EHRA 3KHFA 1X9ZA 3KDKA 2EAQA 1OBZA 1W9OA 2VSPA 3VQGA 2DLUA 4JOGA 1UEQA 4NXQA 1TP5A 1TQ3A 2W4FA 3BPUA 5H3JA 5E1YA 3PV4A 4Q2NA 4Z8JA 2REYA 2YT8A 2MX6A 1UM7A 2IWPA 2H2CA 1Z86A 1WHDA 2FE5A 2K1ZA 2EV8A 3WKMA 3QGLA 1MC7A 1Y7NA 2OMJA 3O5NA 4LMMA 1FC6A 2DLSA 4JOHA 3QJNA 2VWRA 4F8KA 2M0VA 2LOBA 2I0IA 2ENOA 2H3MA 2R3YA 2VSVA 4Q6SA 1WHAA 4L8NA 2VRFA 1G9OA 1IU0A 2V1WA 2EGOA 5A2PA 3EGHC 5HF1A 2JINA 1UJVA 3QJMA 2LC6A 1N6EA 5HETA 1V5LA 4OEOA 2K20A 3PV2A 2EDPA 2YUYA 4K6YA 1KY9A 1X5QA 4WYUA 2JREA 3GDVA 4NXPA 4P0CA 3DJ3A 5B42A 1V62A 2QKVA 1U39A 3K1RA 1VAEA 2I6VA 2KV8A 1LCYA 3R0HA 4NMVA 1RY4A 2JOAA 4YYXA 1PDRA 2L4SA 2KJKA 1YBOA 4JL7A 3TSVA 1W9QA 2RRMA 3NGHA 1IU2A 2JIKA 1UFXA 1B8QA 2KG2A 2H2BA 4GHNA 1N7EA 2M10A 3FY5A 5E22A 4REYA 3DORA 2D8IA 2PDZA 4OEPA 1ZOKA 1UJUA 2F5YA 1SOZA 3KDGA 1FC7A 1P1DA 3SFJA 1Q3PA 2EGNA 4HOPA 2QG1A 2EGKA 2D92A 2PKTA 1FC9A 2M0UA 5HFEA 2EEGA 1QAVA 4JOKA 2F0AA 4E35A 4NMRA 1Q3OA 3QDOA 1UEPA 3K50A 2M0ZA 3GGEA 2IWQA 1VJ6A 1GQ4A 5F3XA 1MFGA 3I18A 2DM8A 2R4HA 1GM1A 2OPGA 2Q9VA 2KOMA 3PV5A 4N6XA 1RZXA 4EDJA 2KAWA 2KA9A 2Z9IA 1I16A 1TE0A 2Z17A 2O2TA 2JWEA 3CS0A 3L4FD 2KL1A 3QO6A 1X5NA 3TSZA 4WYTA 1NTEA 1V5QA 1WF7A 4K78A 4KFVA 1KEFA 5IL9A 2OS6A 2QKUA 1X6DA 2EEHA 5HFFA 3GSLA 5HF4A 2ZPMA 3I4WA 2EJYA 3KZEA 3WKLA 2V90A 2M0TA 4HOPB 4PQWA 3GCOA 3CYYA 1QAVB 3ID4A 3PDZA 1FCFA 2VPHA 4JOJA 4RI0A 1K32A 3HPMA 1OBYA 1V6BA 1V1TA 1U38A 2UZCA 2FCFA 5GNDA 3HVQC 3JXTA 5FHTA 4Q2QA 4JOPA 2PA1A 3B76A 1ZUBA 2OQSA 4K75A 1WIFA 2QKTA 2CSJA 2ZPLA 4YDPA 2L97A 2VZ5A 2KRGA 1XZ9A 4Z33A 2OGPA 1BFEA 2BYGA 3CBYA 2HE4A 3ID3A 2I1NA 3CBXA 3TSWA 1MFLA 1IHJA 1WJLA 1I92A 3STJA 1WI4A 2P3WA 4UU5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q2P A;  2RCZ A;  2GZV A;  4E34 A;  2D90 A;  3CBZ A;  1Y8T A;  1N6D A;  3DJ1 A;  4E3B A;  2H3L A;  1UM1 A;  3E17 A;  1T2M A;  2EXG A;  1X8S A;  1L6O A;  5DTH A;  4NXR A;  3CC0 A;  5E11 A;  2LC7 A;  3SHW A;  5HEB A;  4NMP A;  5E6P B;  2AWX A;  2EDV A;  2IWO A;  1GQ5 A;  2YUB A;  5G1D A;  3QE1 A;  2FN5 A;  4K72 A;  1VB7 A;  2DJT A;  3ID2 A;  3HPK A;  3MH4 A;  2KPL A;  3GDS A;  5E21 A;  2KOJ A;  3OU0 A;  2I4S A;  1RGW A;  4OAJ A;  1Q7X A;  5JXB A;  2E7K A;  4R2Z A;  1WG6 A;  2QT5 A;  2W7R A;  1WI2 A;  2KOH A;  4UU6 A;  3GJ9 A;  4NMO A;  4IC6 A;  2DKR A;  3RL7 A;  2I04 A;  5B6L A;  4Q6H A;  1N7T A;  2DB5 A;  5HED A;  1X5R A;  4GVD A;  3DJA A;  5I7Z A;  2I0L A;  2HGA A;  1UHP A;  1OZI A;  3DIW A;  3SUZ A;  2KPK A;  2DMZ A;  2OSG A;  1NF3 C;  3LNX A;  3VQF A;  5HFB A;  1WFG A;  5EZ0 A;  1UEW A;  2QBW A;  1TP3 A;  3PDV A;  4JOR A;  1WH1 A;  1OBX A;  2EEI A;  3RL8 A;  3MH7 A;  3SOE A;  3QIK A;  1W9E A;  4NMS A;  3ID1 A;  5D13 A;  3O46 A;  2Q3G A;  4K76 A;  4JOF A;  5HFC A;  4NNL A;  5FB8 C;  3ZRT A;  3NFK A;  5HEY A;  1QAU A;  2WL7 A;  4Q2O A;  2JXO A;  2PZD A;  2JIL A;  1N7F A;  1VA8 A;  3KZD A;  1M5Z A;  2LA8 A;  3EGG C;  2FNE A;  4NMT A;  2DC2 A;  2DAZ A;  5G1E A;  1RGR A;  2IWN A;  2CSS A;  2G2L A;  1D5G A;  4G69 A;  1VCW A;  3OTP A;  1N6F A;  2KJP A;  4GVC A;  4MPA A;  2AIN A;  1UJD A;  2PNT A;  2CS5 A;  3AXA A;  3PS4 A;  5F67 A;  1KWA A;  1SOT A;  2HE2 A;  2OCS A;  1QLC A;  2EDZ A;  4NMQ A;  3RLE A;  1U3B A;  5HDY A;  3CH8 A;  3TMH A;  4Q3H A;  2KQF A;  4JOE A;  2MHO A;  5GLJ A;  5HFD A;  1Z87 A;  1R6J A;  4O06 A;  1X45 A;  1WF8 A;  1BE9 A;  3MH6 A;  2LUI A;  2EEJ A;  1UF1 A;  4FGM A;  2L4T A;  2G5M B;  2AWU A;  2OZF A;  1UEZ A;  3GCN A;  1U37 A;  4P2A B;  5HJ1 A;  2AWW A;  2YTW A;  3LNY A;  4NNM A;  2KBS A;  3GDU A;  2KJD A;  1P1E A;  3R69 A;  3NFL A;  4AMH A;  3R68 A;  5EYZ A;  2M3M A;  3I1E A;  4KFW A;  4XHV A;  3SHU A;  2X7Z A;  2KYL A;  1N99 A;  1WFV A;  2YT7 A;  4H11 A;  2PKU A;  3K82 A;  1UIT A;  2EHR A;  3KHF A;  2EAQ A;  1OBZ A;  1W9O A;  2VSP A;  3VQG A;  2DLU A;  4JOG A;  1UEQ A;  4NXQ A;  1TP5 A;  1TQ3 A;  2W4F A;  3BPU A;  5H3J A;  5E1Y A;  3PV4 A;  4Q2N A;  4Z8J A;  2REY A;  2YT8 A;  2MX6 A;  1UM7 A;  2IWP A;  2H2C A;  1Z86 A;  1WHD A;  2FE5 A;  2K1Z A;  2EV8 A;  3WKM A;  3QGL A;  1MC7 A;  1Y7N A;  2OMJ A;  3O5N A;  4LMM A;  1FC6 A;  2DLS A;  4JOH A;  3QJN A;  2VWR A;  4F8K A;  2M0V A;  2LOB A;  2I0I A;  2ENO A;  2H3M A;  2R3Y A;  2VSV A;  4Q6S A;  1WHA A;  4L8N A;  2VRF A;  1G9O A;  1IU0 A;  2V1W A;  2EGO A;  5A2P A;  3EGH C;  5HF1 A;  2JIN A;  1UJV A;  3QJM A;  2LC6 A;  1N6E A;  5HET A;  1V5L A;  4OEO A;  2K20 A;  3PV2 A;  2EDP A;  2YUY A;  4K6Y A;  1KY9 A;  1X5Q A;  4WYU A;  2JRE A;  3GDV A;  4NXP A;  4P0C A;  3DJ3 A;  1V62 A;  2QKV A;  1U39 A;  3K1R A;  1VAE A;  2I6V A;  2KV8 A;  1LCY A;  3R0H A;  4NMV A;  1RY4 A;  2JOA A;  4YYX A;  1PDR A;  2L4S A;  2KJK A;  1YBO A;  4JL7 A;  3TSV A;  1W9Q A;  2RRM A;  3NGH A;  1IU2 A;  2JIK A;  1UFX A;  1B8Q A;  2KG2 A;  2H2B A;  4GHN A;  1N7E A;  2M10 A;  3FY5 A;  5E22 A;  4REY A;  3DOR A;  2D8I A;  2PDZ A;  4OEP A;  1ZOK A;  1UJU A;  2F5Y A;  1SOZ A;  1FC7 A;  1P1D A;  3SFJ A;  1Q3P A;  2EGN A;  4HOP A;  2QG1 A;  2EGK A;  2D92 A;  2PKT A;  1FC9 A;  2M0U A;  5HFE A;  2EEG A;  1QAV A;  4JOK A;  2F0A A;  4E35 A;  4NMR A;  1Q3O A;  3QDO A;  1UEP A;  3K50 A;  2M0Z A;  3GGE A;  2IWQ A;  1VJ6 A;  1GQ4 A;  5F3X A;  1MFG A;  3I18 A;  2DM8 A;  2R4H A;  1GM1 A;  2OPG A;  2Q9V A;  2KOM A;  3PV5 A;  4N6X A;  1RZX A;  4EDJ A;  2KAW A;  2KA9 A;  2Z9I A;  1I16 A;  1TE0 A;  2Z17 A;  2O2T A;  2JWE A;  3CS0 A;  3L4F D;  2KL1 A;  3QO6 A;  1X5N A;  3TSZ A;  4WYT A;  1NTE A;  1V5Q A;  1WF7 A;  4K78 A;  4KFV A;  1KEF A;  2OS6 A;  2QKU A;  1X6D A;  2EEH A;  5HFF A;  3GSL A;  5HF4 A;  2ZPM A;  3I4W A;  2EJY A;  3KZE A;  3WKL A;  2V90 A;  2M0T A;  4HOP B;  4PQW A;  3GCO A;  3CYY A;  1QAV B;  3ID4 A;  3PDZ A;  1FCF A;  2VPH A;  4JOJ A;  4RI0 A;  1K32 A;  3HPM A;  1OBY A;  1V6B A;  1V1T A;  1U38 A;  2UZC A;  2FCF A;  5GND A;  3HVQ C;  3JXT A;  5FHT A;  4Q2Q A;  4JOP A;  2PA1 A;  3B76 A;  1ZUB A;  2OQS A;  4K75 A;  1WIF A;  2QKT A;  2CSJ A;  2ZPL A;  4YDP A;  2L97 A;  2VZ5 A;  2KRG A;  1XZ9 A;  4Z33 A;  2OGP A;  1BFE A;  2BYG A;  3CBY A;  2HE4 A;  3ID3 A;  2I1N A;  3CBX A;  3TSW A;  1MFL A;  1IHJ A;  1WJL A;  1I92 A;  3STJ A;  1WI4 A;  2P3W A;  4UU5 A; 
#chains in the Genus database with same CATH topology
 4Q2P A;  2RCZ A;  2GZV A;  4E34 A;  2D90 A;  3CBZ A;  1Y8T A;  1N6D A;  3DJ1 A;  4E3B A;  2H3L A;  1UM1 A;  3E17 A;  1T2M A;  2EXG A;  1X8S A;  1L6O A;  5DTH A;  4NXR A;  3CC0 A;  5E11 A;  2LC7 A;  3SHW A;  5HEB A;  4NMP A;  5E6P B;  2AWX A;  2EDV A;  2IWO A;  1GQ5 A;  2YUB A;  5G1D A;  3QE1 A;  2FN5 A;  4FLN A;  4K72 A;  3NCV A;  1VB7 A;  2DJT A;  3ID2 A;  3HPK A;  3MH4 A;  2KPL A;  3GDS A;  5E21 A;  2KOJ A;  3OU0 A;  2I4S A;  1RGW A;  4OAJ A;  1Q7X A;  5JXB A;  2E7K A;  4R2Z A;  1WG6 A;  2QT5 A;  2W7R A;  1WI2 A;  2KOH A;  4UU6 A;  3GJ9 A;  4NMO A;  4IC6 A;  2DKR A;  3RL7 A;  2I04 A;  5B6L A;  4Q6H A;  1N7T A;  2DB5 A;  5HED A;  1X5R A;  4GVD A;  3DJA A;  5I7Z A;  2I0L A;  2HGA A;  1UHP A;  1OZI A;  3DIW A;  3SUZ A;  4JJ0 A;  2KPK A;  2DMZ A;  2OSG A;  1NF3 C;  3LNX A;  3VQF A;  5HFB A;  1WFG A;  5EZ0 A;  1UEW A;  2QBW A;  1TP3 A;  3PDV A;  4JOR A;  1WH1 A;  1OBX A;  2EEI A;  3RL8 A;  3MH7 A;  3SOE A;  3QIK A;  1W9E A;  4NMS A;  3ID1 A;  5D13 A;  3O46 A;  2Q3G A;  4K76 A;  4JOF A;  5HFC A;  4NNL A;  5FB8 C;  3ZRT A;  3NFK A;  5HEY A;  1QAU A;  2WL7 A;  4Q2O A;  2JXO A;  2PZD A;  2JIL A;  1N7F A;  1VA8 A;  3KZD A;  1M5Z A;  2LA8 A;  3EGG C;  2FNE A;  4NMT A;  2DC2 A;  2DAZ A;  4JJ3 A;  5G1E A;  1RGR A;  2IWN A;  2CSS A;  2G2L A;  2JSN A;  1D5G A;  4G69 A;  1VCW A;  3OTP A;  1N6F A;  2KJP A;  4GVC A;  4MPA A;  2AIN A;  1UJD A;  5ILB A;  2PNT A;  2CS5 A;  3AXA A;  2GEF A;  3PS4 A;  5F67 A;  1KWA A;  1SOT A;  2HE2 A;  2OCS A;  1QLC A;  2EDZ A;  4NMQ A;  3RLE A;  1U3B A;  5HDY A;  3CH8 A;  3TMH A;  4Q3H A;  2KQF A;  4JOE A;  2MHO A;  5GLJ A;  5HFD A;  1Z87 A;  1R6J A;  4O06 A;  1X45 A;  1WF8 A;  3GAB A;  1BE9 A;  3MH6 A;  2LUI A;  2EEJ A;  1UF1 A;  4FGM A;  2L4T A;  2G5M B;  2AWU A;  2OZF A;  1UEZ A;  3GCN A;  1U37 A;  4P2A B;  5HJ1 A;  2AWW A;  2YTW A;  3LNY A;  4NNM A;  2KBS A;  3GDU A;  2KJD A;  1P1E A;  3R69 A;  3NFL A;  4AMH A;  3R68 A;  5EYZ A;  2M3M A;  3I1E A;  4KFW A;  4XHV A;  3SHU A;  2X7Z A;  2KYL A;  1N99 A;  1WFV A;  2YT7 A;  4H11 A;  2PKU A;  3K82 A;  1UIT A;  2EHR A;  3KHF A;  1X9Z A;  3KDK A;  2EAQ A;  1OBZ A;  1W9O A;  2VSP A;  3VQG A;  2DLU A;  4JOG A;  1UEQ A;  4NXQ A;  1TP5 A;  1TQ3 A;  2W4F A;  3BPU A;  5H3J A;  5E1Y A;  3PV4 A;  4Q2N A;  4Z8J A;  2REY A;  2YT8 A;  2MX6 A;  1UM7 A;  2IWP A;  2H2C A;  1Z86 A;  1WHD A;  2FE5 A;  2K1Z A;  2EV8 A;  3WKM A;  3QGL A;  1MC7 A;  1Y7N A;  2OMJ A;  3O5N A;  4LMM A;  1FC6 A;  2DLS A;  4JOH A;  3QJN A;  2VWR A;  4F8K A;  2M0V A;  2LOB A;  2I0I A;  2ENO A;  2H3M A;  2R3Y A;  2VSV A;  4Q6S A;  1WHA A;  4L8N A;  2VRF A;  1G9O A;  1IU0 A;  2V1W A;  2EGO A;  5A2P A;  3EGH C;  5HF1 A;  2JIN A;  1UJV A;  3QJM A;  2LC6 A;  1N6E A;  5HET A;  1V5L A;  4OEO A;  2K20 A;  3PV2 A;  2EDP A;  2YUY A;  4K6Y A;  1KY9 A;  1X5Q A;  4WYU A;  2JRE A;  3GDV A;  4NXP A;  4P0C A;  3DJ3 A;  5B42 A;  1V62 A;  2QKV A;  1U39 A;  3K1R A;  1VAE A;  2I6V A;  2KV8 A;  1LCY A;  3R0H A;  4NMV A;  1RY4 A;  2JOA A;  4YYX A;  1PDR A;  2L4S A;  2KJK A;  1YBO A;  4JL7 A;  3TSV A;  1W9Q A;  2RRM A;  3NGH A;  1IU2 A;  2JIK A;  1UFX A;  1B8Q A;  2KG2 A;  2H2B A;  4GHN A;  1N7E A;  2M10 A;  3FY5 A;  5E22 A;  4REY A;  3DOR A;  2D8I A;  2PDZ A;  4OEP A;  1ZOK A;  1UJU A;  2F5Y A;  1SOZ A;  3KDG A;  1FC7 A;  1P1D A;  3SFJ A;  1Q3P A;  2EGN A;  4HOP A;  2QG1 A;  2EGK A;  2D92 A;  2PKT A;  1FC9 A;  2M0U A;  5HFE A;  2EEG A;  1QAV A;  4JOK A;  2F0A A;  4E35 A;  4NMR A;  1Q3O A;  3QDO A;  1UEP A;  3K50 A;  2M0Z A;  3GGE A;  2IWQ A;  1VJ6 A;  1GQ4 A;  5F3X A;  1MFG A;  3I18 A;  2DM8 A;  2R4H A;  1GM1 A;  2OPG A;  2Q9V A;  2KOM A;  3PV5 A;  4N6X A;  1RZX A;  4EDJ A;  2KAW A;  2KA9 A;  2Z9I A;  1I16 A;  1TE0 A;  2Z17 A;  2O2T A;  2JWE A;  3CS0 A;  3L4F D;  2KL1 A;  3QO6 A;  1X5N A;  3TSZ A;  4WYT A;  1NTE A;  1V5Q A;  1WF7 A;  4K78 A;  4KFV A;  1KEF A;  5IL9 A;  2OS6 A;  2QKU A;  1X6D A;  2EEH A;  5HFF A;  3GSL A;  5HF4 A;  2ZPM A;  3I4W A;  2EJY A;  3KZE A;  3WKL A;  2V90 A;  2M0T A;  4HOP B;  4PQW A;  3GCO A;  3CYY A;  1QAV B;  3ID4 A;  3PDZ A;  1FCF A;  2VPH A;  4JOJ A;  4RI0 A;  1K32 A;  3HPM A;  1OBY A;  1V6B A;  1V1T A;  1U38 A;  2UZC A;  2FCF A;  5GND A;  3HVQ C;  3JXT A;  5FHT A;  4Q2Q A;  4JOP A;  2PA1 A;  3B76 A;  1ZUB A;  2OQS A;  4K75 A;  1WIF A;  2QKT A;  2CSJ A;  2ZPL A;  4YDP A;  2L97 A;  2VZ5 A;  2KRG A;  1XZ9 A;  4Z33 A;  2OGP A;  1BFE A;  2BYG A;  3CBY A;  2HE4 A;  3ID3 A;  2I1N A;  3CBX A;  3TSW A;  1MFL A;  1IHJ A;  1WJL A;  1I92 A;  3STJ A;  1WI4 A;  2P3W A;  4UU5 A; 
#chains in the Genus database with same CATH homology
 4Q2P A;  2RCZ A;  2GZV A;  4E34 A;  2D90 A;  3CBZ A;  1Y8T A;  1N6D A;  3DJ1 A;  4E3B A;  2H3L A;  1UM1 A;  3E17 A;  1T2M A;  2EXG A;  1X8S A;  1L6O A;  5DTH A;  4NXR A;  3CC0 A;  5E11 A;  2LC7 A;  3SHW A;  5HEB A;  4NMP A;  5E6P B;  2AWX A;  2EDV A;  2IWO A;  1GQ5 A;  2YUB A;  5G1D A;  3QE1 A;  2FN5 A;  4FLN A;  4K72 A;  3NCV A;  1VB7 A;  2DJT A;  3ID2 A;  3HPK A;  3MH4 A;  2KPL A;  3GDS A;  5E21 A;  2KOJ A;  3OU0 A;  2I4S A;  1RGW A;  4OAJ A;  1Q7X A;  5JXB A;  2E7K A;  4R2Z A;  1WG6 A;  2QT5 A;  2W7R A;  1WI2 A;  2KOH A;  4UU6 A;  3GJ9 A;  4NMO A;  4IC6 A;  2DKR A;  3RL7 A;  2I04 A;  5B6L A;  4Q6H A;  1N7T A;  2DB5 A;  5HED A;  1X5R A;  4GVD A;  3DJA A;  5I7Z A;  2I0L A;  2HGA A;  1UHP A;  1OZI A;  3DIW A;  3SUZ A;  4JJ0 A;  2KPK A;  2DMZ A;  2OSG A;  1NF3 C;  3LNX A;  3VQF A;  5HFB A;  1WFG A;  5EZ0 A;  1UEW A;  2QBW A;  1TP3 A;  3PDV A;  4JOR A;  1WH1 A;  1OBX A;  2EEI A;  3RL8 A;  3MH7 A;  3SOE A;  3QIK A;  1W9E A;  4NMS A;  3ID1 A;  5D13 A;  3O46 A;  2Q3G A;  4K76 A;  4JOF A;  5HFC A;  4NNL A;  5FB8 C;  3ZRT A;  3NFK A;  5HEY A;  1QAU A;  2WL7 A;  4Q2O A;  2JXO A;  2PZD A;  2JIL A;  1N7F A;  1VA8 A;  3KZD A;  1M5Z A;  2LA8 A;  3EGG C;  2FNE A;  4NMT A;  2DC2 A;  2DAZ A;  4JJ3 A;  5G1E A;  1RGR A;  2IWN A;  2CSS A;  2G2L A;  2JSN A;  1D5G A;  4G69 A;  1VCW A;  3OTP A;  1N6F A;  2KJP A;  4GVC A;  4MPA A;  2AIN A;  1UJD A;  5ILB A;  2PNT A;  2CS5 A;  3AXA A;  2GEF A;  3PS4 A;  5F67 A;  1KWA A;  1SOT A;  2HE2 A;  2OCS A;  1QLC A;  2EDZ A;  4NMQ A;  3RLE A;  1U3B A;  5HDY A;  3CH8 A;  3TMH A;  4Q3H A;  2KQF A;  4JOE A;  2MHO A;  5GLJ A;  5HFD A;  1Z87 A;  1R6J A;  4O06 A;  1X45 A;  1WF8 A;  3GAB A;  1BE9 A;  3MH6 A;  2LUI A;  2EEJ A;  1UF1 A;  4FGM A;  2L4T A;  2G5M B;  2AWU A;  2OZF A;  1UEZ A;  3GCN A;  1U37 A;  4P2A B;  5HJ1 A;  2AWW A;  2YTW A;  3LNY A;  4NNM A;  2KBS A;  3GDU A;  2KJD A;  1P1E A;  3R69 A;  3NFL A;  4AMH A;  3R68 A;  5EYZ A;  2M3M A;  3I1E A;  4KFW A;  4XHV A;  3SHU A;  2X7Z A;  2KYL A;  1N99 A;  1WFV A;  2YT7 A;  4H11 A;  2PKU A;  3K82 A;  1UIT A;  2EHR A;  3KHF A;  1X9Z A;  3KDK A;  2EAQ A;  1OBZ A;  1W9O A;  2VSP A;  3VQG A;  2DLU A;  4JOG A;  1UEQ A;  4NXQ A;  1TP5 A;  1TQ3 A;  2W4F A;  3BPU A;  5H3J A;  5E1Y A;  3PV4 A;  4Q2N A;  4Z8J A;  2REY A;  2YT8 A;  2MX6 A;  1UM7 A;  2IWP A;  2H2C A;  1Z86 A;  1WHD A;  2FE5 A;  2K1Z A;  2EV8 A;  3WKM A;  3QGL A;  1MC7 A;  1Y7N A;  2OMJ A;  3O5N A;  4LMM A;  1FC6 A;  2DLS A;  4JOH A;  3QJN A;  2VWR A;  4F8K A;  2M0V A;  2LOB A;  2I0I A;  2ENO A;  2H3M A;  2R3Y A;  2VSV A;  4Q6S A;  1WHA A;  4L8N A;  2VRF A;  1G9O A;  1IU0 A;  2V1W A;  2EGO A;  5A2P A;  3EGH C;  5HF1 A;  2JIN A;  1UJV A;  3QJM A;  2LC6 A;  1N6E A;  5HET A;  1V5L A;  4OEO A;  2K20 A;  3PV2 A;  2EDP A;  2YUY A;  4K6Y A;  1KY9 A;  1X5Q A;  4WYU A;  2JRE A;  3GDV A;  4NXP A;  4P0C A;  3DJ3 A;  5B42 A;  1V62 A;  2QKV A;  1U39 A;  3K1R A;  1VAE A;  2I6V A;  2KV8 A;  1LCY A;  3R0H A;  4NMV A;  1RY4 A;  2JOA A;  4YYX A;  1PDR A;  2L4S A;  2KJK A;  1YBO A;  4JL7 A;  3TSV A;  1W9Q A;  2RRM A;  3NGH A;  1IU2 A;  2JIK A;  1UFX A;  1B8Q A;  2KG2 A;  2H2B A;  4GHN A;  1N7E A;  2M10 A;  3FY5 A;  5E22 A;  4REY A;  3DOR A;  2D8I A;  2PDZ A;  4OEP A;  1ZOK A;  1UJU A;  2F5Y A;  1SOZ A;  3KDG A;  1FC7 A;  1P1D A;  3SFJ A;  1Q3P A;  2EGN A;  4HOP A;  2QG1 A;  2EGK A;  2D92 A;  2PKT A;  1FC9 A;  2M0U A;  5HFE A;  2EEG A;  1QAV A;  4JOK A;  2F0A A;  4E35 A;  4NMR A;  1Q3O A;  3QDO A;  1UEP A;  3K50 A;  2M0Z A;  3GGE A;  2IWQ A;  1VJ6 A;  1GQ4 A;  5F3X A;  1MFG A;  3I18 A;  2DM8 A;  2R4H A;  1GM1 A;  2OPG A;  2Q9V A;  2KOM A;  3PV5 A;  4N6X A;  1RZX A;  4EDJ A;  2KAW A;  2KA9 A;  2Z9I A;  1I16 A;  1TE0 A;  2Z17 A;  2O2T A;  2JWE A;  3CS0 A;  3L4F D;  2KL1 A;  3QO6 A;  1X5N A;  3TSZ A;  4WYT A;  1NTE A;  1V5Q A;  1WF7 A;  4K78 A;  4KFV A;  1KEF A;  5IL9 A;  2OS6 A;  2QKU A;  1X6D A;  2EEH A;  5HFF A;  3GSL A;  5HF4 A;  2ZPM A;  3I4W A;  2EJY A;  3KZE A;  3WKL A;  2V90 A;  2M0T A;  4HOP B;  4PQW A;  3GCO A;  3CYY A;  1QAV B;  3ID4 A;  3PDZ A;  1FCF A;  2VPH A;  4JOJ A;  4RI0 A;  1K32 A;  3HPM A;  1OBY A;  1V6B A;  1V1T A;  1U38 A;  2UZC A;  2FCF A;  5GND A;  3HVQ C;  3JXT A;  5FHT A;  4Q2Q A;  4JOP A;  2PA1 A;  3B76 A;  1ZUB A;  2OQS A;  4K75 A;  1WIF A;  2QKT A;  2CSJ A;  2ZPL A;  4YDP A;  2L97 A;  2VZ5 A;  2KRG A;  1XZ9 A;  4Z33 A;  2OGP A;  1BFE A;  2BYG A;  3CBY A;  2HE4 A;  3ID3 A;  2I1N A;  3CBX A;  3TSW A;  1MFL A;  1IHJ A;  1WJL A;  1I92 A;  3STJ A;  1WI4 A;  2P3W A;  4UU5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...