3VQGA

Crystal structure analysis of the pdz domain derived from the tight junction regulating protein
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
85
structure length
85
Chain Sequence
SFHVILNKSSPEEQLGIKLVRRVDEPGVFIFNVLNGGVADRHGQLEENDRVLAINGHDLRFGSPESAAHLIQASERRVHLVVSRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 ubiquitin-protein ligase LNX
publication title Structural basis for down regulation of tight junction by PDZ-domain containing E3-Ubiquitin ligase
rcsb
source organism Mus musculus
molecule tags Peptide binding protein
total genus 22
structure length 85
sequence length 85
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2012-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 3vqgA00
2P3WA 1TP5A 2YUYA 3LNYA 2ENOA 2MHOA 3SOEA 1WIFA 2KV8A 4KFVA 3PDVA 1X45A 2CSSA 1Q7XA 1UFXA 1OZIA 2JWEA 3TSWA 1RY4A 2KG2A 3QE1A 2KYLA 1IHJA 2JILA 1BFEA 2OS6A 1W9OA 2PNTA 4REYA 4KFWA 3CBXA 4YDPA 3PV2A 1QAVA 4NNLA 1U38A 5HETA 2Q9VA 3CS0A 3HVQC 2I6VA 4IC6A 1I92A 2LA8A 1WF7A 1U37A 2VWRA 2EDPA 2IWPA 2M10A 1TQ3A 2E7KA 4L8NA 1ZOKA 2OZFA 3MH7A 4JOFA 2K20A 2PZDA 4OEOA 5JXBA 1VAEA 2KRGA 2KJDA 4Q2NA 2I04A 3I4WA 3CH8A 3OTPA 2I0IA 3VQFA 3I18A 2OCSA 1QLCA 1WH1A 2FNEA 3TSZA 5HEDA 1WFVA 1N6FA 4JOKA 1MFGA 5HEYA 1UITA 2PKTA 3MH6A 4PQWA 2X7ZA 2VSPA 2RRMA 5DTHA 1IU2A 2FE5A 3E17A 1MC7A 3GDSA 1U39A 1UF1A 2DB5A 3CYYA 3SHUA 2WL7A 4Q2OA 2UZCA 1LCYA 2YUBA 2KOJA 1GQ4A 5H3JA 5HDYA 2W7RA 3O46A 5GNDA 2DKRA 4JOHA 5G1EA 2KJKA 1X8SA 2M0UA 2EXGA 3DJ3A 2KJPA 4JOJA 2AINA 1UJVA 1B8QA 1QAVB 2QKUA 2GZVA 3K1RA 3DORA 4Z8JA 4O06A 4Q2PA 2YT8A 5HFCA 1UEQA 3L4FD 1KY9A 1TP3A 4JORA 2EDVA 4UU6A 1W9EA 3DIWA 5EZ0A 3TMHA 2H3LA 5F3XA 3GJ9A 4Q6HA 3GDVA 3K50A 1WF8A 3CBZA 3B76A 1V1TA 1MFLA 3WKLA 2IWNA 2KA9A 3SHWA 2M0ZA 1X5NA 1N6EA 2FCFA 1RZXA 5D13A 1FC6A 3QJMA 2ZPMA 1ZUBA 1UEWA 2OPGA 1FCFA 3ZRTA 2EGKA 2G5MB 3GCNA 2JOAA 4E35A 4HOPA 1OBYA 2I0LA 1P1DA 3QO6A 4G69A 1M5ZA 2LOBA 3GDUA 4Z33A 2PKUA 4NXQA 1WHAA 1X6DA 2YTWA 1WFGA 2M0TA 3GCOA 4P2AB 5E11A 2L97A 2D92A 4WYUA 2MX6A 2F0AA 3FY5A 2VZ5A 2KOMA 2CS5A 3I1EA 3HPKA 4NMSA 5HFDA 3R68A 2PDZA 3RL7A 4OAJA 2F5YA 5EYZA 5E21A 1UEZA 2K1ZA 1N99A 3GSLA 1OBZA 2EHRA 1UEPA 3PV5A 3RLEA 3R69A 2KAWA 4K75A 5HFFA 3K82A 1X5RA 4H11A 4K6YA 1FC9A 4Q2QA 2KPKA 1N7EA 2VPHA 1I16A 2JREA 4OEPA 5B6LA 2EV8A 1RGWA 2QT5A 4E34A 2H2CA 3PV4A 2EDZA 3PS4A 2D90A 2O2TA 2KBSA 1P1EA 3CC0A 2DMZA 1Q3PA 5E22A 2EEJA 3VQGA 4EDJA 3HPMA 4HOPB 4NMOA 2ZPLA 4NMRA 2VSVA 2Z9IA 2RCZA 4NXRA 4JOEA 4FGMA 2DM8A 4NMTA 1W9QA 1X5QA 1Q3OA 2KPLA 3ID2A 1FC7A 1OBXA 2IWOA 2EJYA 3EGHC 1BE9A 1UM1A 2DJTA 2QG1A 4GVDA 3NFKA 4JOGA 5GLJA 2L4SA 2LC7A 1R6JA 1K32A 3LNXA 3GGEA 2QKTA 1PDRA 2CSJA 5E6PB 2YT7A 2LUIA 2DAZA 3QIKA 2I4SA 1WJLA 3PDZA 1KWAA 2HE4A 3EGGC 2AWUA 3O5NA 2W4FA 3SUZA 1D5GA 2VRFA 4GHNA 4F8KA 1V5LA 4JOPA 2R3YA 4Q6SA 1U3BA 1N7FA 1WI4A 4K78A 2G2LA 1UJUA 3ID1A 4NMVA 2DLSA 2M3MA 3NFLA 4P0CA 3WKMA 3KHFA 4YYXA 2JIKA 2V90A 1T2MA 2EEHA 2OQSA 2JXOA 1IU0A 4JL7A 3DJ1A 3QJNA 2KOHA 5F67A 1V5QA 3RL8A 1G9OA 2OMJA 2H3MA 1Z87A 1UM7A 4K76A 4UU5A 1VCWA 5HEBA 1WI2A 4NXPA 1KEFA 4LMMA 4K72A 2Q3GA 4Q3HA 2LC6A 3DJAA 4WYTA 5E1YA 2HGAA 1Y7NA 5FB8C 1VA8A 2EEIA 1N6DA 2IWQA 2Z17A 1L6OA 1VB7A 1WG6A 2OGPA 1NTEA 2QBWA 3ID4A 3NGHA 3OU0A 4NMQA 3STJA 1RGRA 1YBOA 3BPUA 2R4HA 2REYA 1TE0A 5HJ1A 1GQ5A 4GVCA 1UJDA 4XHVA 1N7TA 1WHDA 2AWXA 2EEGA 2DC2A 5HF1A 2KQFA 2V1WA 1SOZA 2L4TA 1QAUA 1Y8TA 5HFBA 2EGOA 3AXAA 1V62A 2QKVA 3QDOA 4NNMA 4NMPA 2BYGA 4MPAA 3SFJA 2I1NA 2D8IA 2AWWA 2EAQA 1VJ6A 1V6BA 3KZDA 3JXTA 3QGLA 1GM1A 3R0HA 1UHPA 1NF3C 2HE2A 2M0VA 2FN5A 4RI0A 3ID3A 2DLUA 3MH4A 2PA1A 5HFEA 4R2ZA 1SOTA 2KL1A 4N6XA 5G1DA 5A2PA 1Z86A 5I7ZA 1XZ9A 2JINA 3TSVA 2OSGA 4AMHA 3CBYA 5FHTA 3KZEA 5HF4A 2EGNA 2H2BA 4E3BA
chains in the Genus database with same CATH superfamily
2P3WA 1TP5A 2YUYA 3LNYA 2ENOA 2MHOA 3SOEA 1WIFA 2KV8A 4JJ0A 3PDVA 4KFVA 1X45A 2CSSA 1Q7XA 1UFXA 1OZIA 2JWEA 3TSWA 1RY4A 2KG2A 3QE1A 2KYLA 1IHJA 2JILA 1BFEA 2OS6A 1W9OA 2PNTA 3KDGA 4REYA 4KFWA 3CBXA 4YDPA 3PV2A 1QAVA 4NNLA 1U38A 5HETA 2Q9VA 3CS0A 3HVQC 2I6VA 4IC6A 1I92A 5IL9A 2LA8A 1WF7A 1U37A 2VWRA 2EDPA 2IWPA 2M10A 1TQ3A 2E7KA 4L8NA 1ZOKA 2OZFA 3MH7A 4JOFA 2K20A 2PZDA 4OEOA 5JXBA 1VAEA 2KRGA 2KJDA 4Q2NA 2I04A 3I4WA 3CH8A 3OTPA 2I0IA 3VQFA 3I18A 2OCSA 1QLCA 1WH1A 2FNEA 3TSZA 5HEDA 1WFVA 1N6FA 4JOKA 1MFGA 5HEYA 1UITA 2PKTA 3MH6A 4PQWA 2X7ZA 2VSPA 2RRMA 5DTHA 1IU2A 2FE5A 3E17A 5B42A 1MC7A 3GDSA 1U39A 1UF1A 2DB5A 3CYYA 3SHUA 2WL7A 4Q2OA 2UZCA 2GEFA 1LCYA 2YUBA 2KOJA 1GQ4A 5H3JA 5HDYA 2W7RA 3O46A 5GNDA 2DKRA 4JOHA 5G1EA 2KJKA 1X8SA 2M0UA 2EXGA 3DJ3A 2KJPA 4JOJA 2AINA 1UJVA 1B8QA 1QAVB 2QKUA 2GZVA 3K1RA 3DORA 4Z8JA 4O06A 4Q2PA 2YT8A 5HFCA 1UEQA 3L4FD 1KY9A 1TP3A 4JORA 2EDVA 4UU6A 1W9EA 3DIWA 5EZ0A 3TMHA 3KDKA 2H3LA 5ILBA 5F3XA 3GJ9A 4Q6HA 3GDVA 3K50A 1WF8A 3CBZA 3B76A 1V1TA 1MFLA 3WKLA 2IWNA 2KA9A 3SHWA 2M0ZA 1X5NA 1N6EA 2FCFA 1RZXA 5D13A 1FC6A 3QJMA 2ZPMA 1ZUBA 1UEWA 2OPGA 1FCFA 3ZRTA 2EGKA 2G5MB 3GCNA 2JOAA 4E35A 4HOPA 1OBYA 2I0LA 1P1DA 3QO6A 4G69A 1M5ZA 2LOBA 3GDUA 4Z33A 2PKUA 4NXQA 1WHAA 1X6DA 2YTWA 1WFGA 2M0TA 3GCOA 4P2AB 5E11A 2L97A 2D92A 4WYUA 2MX6A 2F0AA 3FY5A 2VZ5A 2KOMA 2CS5A 3I1EA 3HPKA 4NMSA 5HFDA 3R68A 2PDZA 3RL7A 4OAJA 2F5YA 5EYZA 5E21A 1UEZA 2K1ZA 1N99A 3GSLA 1OBZA 2EHRA 1UEPA 3PV5A 3RLEA 3R69A 2KAWA 4K75A 5HFFA 3K82A 1X5RA 4H11A 4FLNA 4K6YA 1FC9A 4Q2QA 2KPKA 1N7EA 2VPHA 1I16A 2JREA 4OEPA 5B6LA 2EV8A 1RGWA 2QT5A 4E34A 2H2CA 3PV4A 2EDZA 3PS4A 2D90A 2O2TA 2KBSA 1P1EA 3CC0A 2DMZA 1Q3PA 4JJ3A 5E22A 2EEJA 3VQGA 4EDJA 3HPMA 4HOPB 4NMOA 2ZPLA 4NMRA 2VSVA 2Z9IA 2RCZA 4NXRA 4JOEA 4FGMA 2DM8A 4NMTA 1W9QA 1X5QA 1Q3OA 2KPLA 3ID2A 1FC7A 1OBXA 2IWOA 2EJYA 3EGHC 1BE9A 1UM1A 2DJTA 2QG1A 4GVDA 3NFKA 4JOGA 5GLJA 2L4SA 2LC7A 1R6JA 1K32A 3LNXA 3GGEA 2QKTA 1PDRA 2CSJA 5E6PB 2YT7A 2LUIA 2DAZA 3QIKA 2I4SA 1WJLA 3PDZA 1KWAA 2HE4A 3EGGC 2AWUA 3O5NA 2W4FA 3SUZA 1D5GA 2VRFA 4GHNA 4F8KA 1V5LA 4JOPA 2R3YA 4Q6SA 1U3BA 1N7FA 1WI4A 4K78A 2G2LA 1UJUA 3ID1A 4NMVA 2DLSA 2M3MA 3NFLA 4P0CA 3WKMA 3KHFA 4YYXA 2JIKA 2V90A 1T2MA 2EEHA 2OQSA 2JXOA 1IU0A 4JL7A 3DJ1A 3QJNA 2KOHA 5F67A 1V5QA 3RL8A 1G9OA 2OMJA 2H3MA 1Z87A 1UM7A 4K76A 4UU5A 1VCWA 5HEBA 1WI2A 4NXPA 1KEFA 4LMMA 4K72A 2Q3GA 4Q3HA 2LC6A 3DJAA 4WYTA 5E1YA 2HGAA 1Y7NA 5FB8C 1VA8A 2EEIA 1N6DA 2IWQA 2Z17A 1L6OA 1VB7A 1WG6A 2OGPA 1NTEA 2QBWA 3ID4A 3NGHA 3OU0A 4NMQA 3STJA 1RGRA 1YBOA 3BPUA 2R4HA 2REYA 1TE0A 5HJ1A 1GQ5A 4GVCA 1UJDA 4XHVA 1N7TA 1WHDA 2AWXA 2EEGA 2JSNA 2DC2A 5HF1A 2KQFA 2V1WA 1SOZA 2L4TA 1QAUA 1Y8TA 5HFBA 2EGOA 3AXAA 1V62A 2QKVA 3QDOA 4NNMA 4NMPA 2BYGA 4MPAA 3SFJA 2I1NA 2D8IA 2AWWA 2EAQA 1VJ6A 1V6BA 3KZDA 3JXTA 3QGLA 1GM1A 3NCVA 3R0HA 1UHPA 1NF3C 2HE2A 2M0VA 2FN5A 4RI0A 3ID3A 2DLUA 3MH4A 2PA1A 5HFEA 4R2ZA 1SOTA 2KL1A 4N6XA 5G1DA 5A2PA 1Z86A 5I7ZA 1XZ9A 2JINA 3TSVA 2OSGA 4AMHA 3GABA 3CBYA 5FHTA 3KZEA 5HF4A 2EGNA 2H2BA 4E3BA 1X9ZA
chains in the Genus database with same CATH topology
2P3WA 1TP5A 2YUYA 3LNYA 2ENOA 2MHOA 3SOEA 1WIFA 2KV8A 4JJ0A 3PDVA 4KFVA 1X45A 2CSSA 1Q7XA 1UFXA 1OZIA 2JWEA 3TSWA 1RY4A 2KG2A 3QE1A 2KYLA 1IHJA 2JILA 1BFEA 2OS6A 1W9OA 2PNTA 3KDGA 4REYA 4KFWA 3CBXA 4YDPA 3PV2A 1QAVA 4NNLA 1U38A 5HETA 2Q9VA 3CS0A 3HVQC 2I6VA 4IC6A 1I92A 5IL9A 2LA8A 1WF7A 1U37A 2VWRA 2EDPA 2IWPA 2M10A 1TQ3A 2E7KA 4L8NA 1ZOKA 2OZFA 3MH7A 4JOFA 2K20A 2PZDA 4OEOA 5JXBA 1VAEA 2KRGA 2KJDA 4Q2NA 2I04A 3I4WA 3CH8A 3OTPA 2I0IA 3VQFA 3I18A 2OCSA 1QLCA 1WH1A 2FNEA 3TSZA 5HEDA 1WFVA 1N6FA 4JOKA 1MFGA 5HEYA 1UITA 2PKTA 3MH6A 4PQWA 2X7ZA 2VSPA 2RRMA 5DTHA 1IU2A 2FE5A 3E17A 5B42A 1MC7A 3GDSA 1U39A 1UF1A 2DB5A 3CYYA 3SHUA 2WL7A 4Q2OA 2UZCA 2GEFA 1LCYA 2YUBA 2KOJA 1GQ4A 5H3JA 5HDYA 2W7RA 3O46A 5GNDA 2DKRA 4JOHA 5G1EA 2KJKA 1X8SA 2M0UA 2EXGA 3DJ3A 2KJPA 4JOJA 2AINA 1UJVA 1B8QA 1QAVB 2QKUA 2GZVA 3K1RA 3DORA 4Z8JA 4O06A 4Q2PA 2YT8A 5HFCA 1UEQA 3L4FD 1KY9A 1TP3A 4JORA 2EDVA 4UU6A 1W9EA 3DIWA 5EZ0A 3TMHA 3KDKA 2H3LA 5ILBA 5F3XA 3GJ9A 4Q6HA 3GDVA 3K50A 1WF8A 3CBZA 3B76A 1V1TA 1MFLA 3WKLA 2IWNA 2KA9A 3SHWA 2M0ZA 1X5NA 1N6EA 2FCFA 1RZXA 5D13A 1FC6A 3QJMA 2ZPMA 1ZUBA 1UEWA 2OPGA 1FCFA 3ZRTA 2EGKA 2G5MB 3GCNA 2JOAA 4E35A 4HOPA 1OBYA 2I0LA 1P1DA 3QO6A 4G69A 1M5ZA 2LOBA 3GDUA 4Z33A 2PKUA 4NXQA 1WHAA 1X6DA 2YTWA 1WFGA 2M0TA 3GCOA 4P2AB 5E11A 2L97A 2D92A 4WYUA 2MX6A 2F0AA 3FY5A 2VZ5A 2KOMA 2CS5A 3I1EA 3HPKA 4NMSA 5HFDA 3R68A 2PDZA 3RL7A 4OAJA 2F5YA 5EYZA 5E21A 1UEZA 2K1ZA 1N99A 3GSLA 1OBZA 2EHRA 1UEPA 3PV5A 3RLEA 3R69A 2KAWA 4K75A 5HFFA 3K82A 1X5RA 4H11A 4FLNA 4K6YA 1FC9A 4Q2QA 2KPKA 1N7EA 2VPHA 1I16A 2JREA 4OEPA 5B6LA 2EV8A 1RGWA 2QT5A 4E34A 2H2CA 3PV4A 2EDZA 3PS4A 2D90A 2O2TA 2KBSA 1P1EA 3CC0A 2DMZA 1Q3PA 4JJ3A 5E22A 2EEJA 3VQGA 4EDJA 3HPMA 4HOPB 4NMOA 2ZPLA 4NMRA 2VSVA 2Z9IA 2RCZA 4NXRA 4JOEA 4FGMA 2DM8A 4NMTA 1W9QA 1X5QA 1Q3OA 2KPLA 3ID2A 1FC7A 1OBXA 2IWOA 2EJYA 3EGHC 1BE9A 1UM1A 2DJTA 2QG1A 4GVDA 3NFKA 4JOGA 5GLJA 2L4SA 2LC7A 1R6JA 1K32A 3LNXA 3GGEA 2QKTA 1PDRA 2CSJA 5E6PB 2YT7A 2LUIA 2DAZA 3QIKA 2I4SA 1WJLA 3PDZA 1KWAA 2HE4A 3EGGC 2AWUA 3O5NA 2W4FA 3SUZA 1D5GA 2VRFA 4GHNA 4F8KA 1V5LA 4JOPA 2R3YA 4Q6SA 1U3BA 1N7FA 1WI4A 4K78A 2G2LA 1UJUA 3ID1A 4NMVA 2DLSA 2M3MA 3NFLA 4P0CA 3WKMA 3KHFA 4YYXA 2JIKA 2V90A 1T2MA 2EEHA 2OQSA 2JXOA 1IU0A 4JL7A 3DJ1A 3QJNA 2KOHA 5F67A 1V5QA 3RL8A 1G9OA 2OMJA 2H3MA 1Z87A 1UM7A 4K76A 4UU5A 1VCWA 5HEBA 1WI2A 4NXPA 1KEFA 4LMMA 4K72A 2Q3GA 4Q3HA 2LC6A 3DJAA 4WYTA 5E1YA 2HGAA 1Y7NA 5FB8C 1VA8A 2EEIA 1N6DA 2IWQA 2Z17A 1L6OA 1VB7A 1WG6A 2OGPA 1NTEA 2QBWA 3ID4A 3NGHA 3OU0A 4NMQA 3STJA 1RGRA 1YBOA 3BPUA 2R4HA 2REYA 1TE0A 5HJ1A 1GQ5A 4GVCA 1UJDA 4XHVA 1N7TA 1WHDA 2AWXA 2EEGA 2JSNA 2DC2A 5HF1A 2KQFA 2V1WA 1SOZA 2L4TA 1QAUA 1Y8TA 5HFBA 2EGOA 3AXAA 1V62A 2QKVA 3QDOA 4NNMA 4NMPA 2BYGA 4MPAA 3SFJA 2I1NA 2D8IA 2AWWA 2EAQA 1VJ6A 1V6BA 3KZDA 3JXTA 3QGLA 1GM1A 3NCVA 3R0HA 1UHPA 1NF3C 2HE2A 2M0VA 2FN5A 4RI0A 3ID3A 2DLUA 3MH4A 2PA1A 5HFEA 4R2ZA 1SOTA 2KL1A 4N6XA 5G1DA 5A2PA 1Z86A 5I7ZA 1XZ9A 2JINA 3TSVA 2OSGA 4AMHA 3GABA 3CBYA 5FHTA 3KZEA 5HF4A 2EGNA 2H2BA 4E3BA 1X9ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P3W A;  1TP5 A;  2YUY A;  3LNY A;  2ENO A;  2MHO A;  3SOE A;  1WIF A;  2KV8 A;  4KFV A;  3PDV A;  1X45 A;  2CSS A;  1Q7X A;  1UFX A;  1OZI A;  2JWE A;  3TSW A;  1RY4 A;  2KG2 A;  3QE1 A;  2KYL A;  1IHJ A;  2JIL A;  1BFE A;  2OS6 A;  1W9O A;  2PNT A;  4REY A;  4KFW A;  3CBX A;  4YDP A;  3PV2 A;  1QAV A;  4NNL A;  1U38 A;  5HET A;  2Q9V A;  3CS0 A;  3HVQ C;  2I6V A;  4IC6 A;  1I92 A;  2LA8 A;  1WF7 A;  1U37 A;  2VWR A;  2EDP A;  2IWP A;  2M10 A;  1TQ3 A;  2E7K A;  4L8N A;  1ZOK A;  2OZF A;  3MH7 A;  4JOF A;  2K20 A;  2PZD A;  4OEO A;  5JXB A;  1VAE A;  2KRG A;  2KJD A;  4Q2N A;  2I04 A;  3I4W A;  3CH8 A;  3OTP A;  2I0I A;  3VQF A;  3I18 A;  2OCS A;  1QLC A;  1WH1 A;  2FNE A;  3TSZ A;  5HED A;  1WFV A;  1N6F A;  4JOK A;  1MFG A;  5HEY A;  1UIT A;  2PKT A;  3MH6 A;  4PQW A;  2X7Z A;  2VSP A;  2RRM A;  5DTH A;  1IU2 A;  2FE5 A;  3E17 A;  1MC7 A;  3GDS A;  1U39 A;  1UF1 A;  2DB5 A;  3CYY A;  3SHU A;  2WL7 A;  4Q2O A;  2UZC A;  1LCY A;  2YUB A;  2KOJ A;  1GQ4 A;  5H3J A;  5HDY A;  2W7R A;  3O46 A;  5GND A;  2DKR A;  4JOH A;  5G1E A;  2KJK A;  1X8S A;  2M0U A;  2EXG A;  3DJ3 A;  2KJP A;  4JOJ A;  2AIN A;  1UJV A;  1B8Q A;  1QAV B;  2QKU A;  2GZV A;  3K1R A;  3DOR A;  4Z8J A;  4O06 A;  4Q2P A;  2YT8 A;  5HFC A;  1UEQ A;  3L4F D;  1KY9 A;  1TP3 A;  4JOR A;  2EDV A;  4UU6 A;  1W9E A;  3DIW A;  5EZ0 A;  3TMH A;  2H3L A;  5F3X A;  3GJ9 A;  4Q6H A;  3GDV A;  3K50 A;  1WF8 A;  3CBZ A;  3B76 A;  1V1T A;  1MFL A;  3WKL A;  2IWN A;  2KA9 A;  3SHW A;  2M0Z A;  1X5N A;  1N6E A;  2FCF A;  1RZX A;  5D13 A;  1FC6 A;  3QJM A;  2ZPM A;  1ZUB A;  1UEW A;  2OPG A;  1FCF A;  3ZRT A;  2EGK A;  2G5M B;  3GCN A;  2JOA A;  4E35 A;  4HOP A;  1OBY A;  2I0L A;  1P1D A;  3QO6 A;  4G69 A;  1M5Z A;  2LOB A;  3GDU A;  4Z33 A;  2PKU A;  4NXQ A;  1WHA A;  1X6D A;  2YTW A;  1WFG A;  2M0T A;  3GCO A;  4P2A B;  5E11 A;  2L97 A;  2D92 A;  4WYU A;  2MX6 A;  2F0A A;  3FY5 A;  2VZ5 A;  2KOM A;  2CS5 A;  3I1E A;  3HPK A;  4NMS A;  5HFD A;  3R68 A;  2PDZ A;  3RL7 A;  4OAJ A;  2F5Y A;  5EYZ A;  5E21 A;  1UEZ A;  2K1Z A;  1N99 A;  3GSL A;  1OBZ A;  2EHR A;  1UEP A;  3PV5 A;  3RLE A;  3R69 A;  2KAW A;  4K75 A;  5HFF A;  3K82 A;  1X5R A;  4H11 A;  4K6Y A;  1FC9 A;  4Q2Q A;  2KPK A;  1N7E A;  2VPH A;  1I16 A;  2JRE A;  4OEP A;  5B6L A;  2EV8 A;  1RGW A;  2QT5 A;  4E34 A;  2H2C A;  3PV4 A;  2EDZ A;  3PS4 A;  2D90 A;  2O2T A;  2KBS A;  1P1E A;  3CC0 A;  2DMZ A;  1Q3P A;  5E22 A;  2EEJ A;  3VQG A;  4EDJ A;  3HPM A;  4HOP B;  4NMO A;  2ZPL A;  4NMR A;  2VSV A;  2Z9I A;  2RCZ A;  4NXR A;  4JOE A;  4FGM A;  2DM8 A;  4NMT A;  1W9Q A;  1X5Q A;  1Q3O A;  2KPL A;  3ID2 A;  1FC7 A;  1OBX A;  2IWO A;  2EJY A;  3EGH C;  1BE9 A;  1UM1 A;  2DJT A;  2QG1 A;  4GVD A;  3NFK A;  4JOG A;  5GLJ A;  2L4S A;  2LC7 A;  1R6J A;  1K32 A;  3LNX A;  3GGE A;  2QKT A;  1PDR A;  2CSJ A;  5E6P B;  2YT7 A;  2LUI A;  2DAZ A;  3QIK A;  2I4S A;  1WJL A;  3PDZ A;  1KWA A;  2HE4 A;  3EGG C;  2AWU A;  3O5N A;  2W4F A;  3SUZ A;  1D5G A;  2VRF A;  4GHN A;  4F8K A;  1V5L A;  4JOP A;  2R3Y A;  4Q6S A;  1U3B A;  1N7F A;  1WI4 A;  4K78 A;  2G2L A;  1UJU A;  3ID1 A;  4NMV A;  2DLS A;  2M3M A;  3NFL A;  4P0C A;  3WKM A;  3KHF A;  4YYX A;  2JIK A;  2V90 A;  1T2M A;  2EEH A;  2OQS A;  2JXO A;  1IU0 A;  4JL7 A;  3DJ1 A;  3QJN A;  2KOH A;  5F67 A;  1V5Q A;  3RL8 A;  1G9O A;  2OMJ A;  2H3M A;  1Z87 A;  1UM7 A;  4K76 A;  4UU5 A;  1VCW A;  5HEB A;  1WI2 A;  4NXP A;  1KEF A;  4LMM A;  4K72 A;  2Q3G A;  4Q3H A;  2LC6 A;  3DJA A;  4WYT A;  5E1Y A;  2HGA A;  1Y7N A;  5FB8 C;  1VA8 A;  2EEI A;  1N6D A;  2IWQ A;  2Z17 A;  1L6O A;  1VB7 A;  1WG6 A;  2OGP A;  1NTE A;  2QBW A;  3ID4 A;  3NGH A;  3OU0 A;  4NMQ A;  3STJ A;  1RGR A;  1YBO A;  3BPU A;  2R4H A;  2REY A;  1TE0 A;  5HJ1 A;  1GQ5 A;  4GVC A;  1UJD A;  4XHV A;  1N7T A;  1WHD A;  2AWX A;  2EEG A;  2DC2 A;  5HF1 A;  2KQF A;  2V1W A;  1SOZ A;  2L4T A;  1QAU A;  1Y8T A;  5HFB A;  2EGO A;  3AXA A;  1V62 A;  2QKV A;  3QDO A;  4NNM A;  4NMP A;  2BYG A;  4MPA A;  3SFJ A;  2I1N A;  2D8I A;  2AWW A;  2EAQ A;  1VJ6 A;  1V6B A;  3KZD A;  3JXT A;  3QGL A;  1GM1 A;  3R0H A;  1UHP A;  1NF3 C;  2HE2 A;  2M0V A;  2FN5 A;  4RI0 A;  3ID3 A;  2DLU A;  3MH4 A;  2PA1 A;  5HFE A;  4R2Z A;  1SOT A;  2KL1 A;  4N6X A;  5G1D A;  5A2P A;  1Z86 A;  5I7Z A;  1XZ9 A;  2JIN A;  3TSV A;  2OSG A;  4AMH A;  3CBY A;  5FHT A;  3KZE A;  5HF4 A;  2EGN A;  2H2B A;  4E3B A; 
#chains in the Genus database with same CATH topology
 2P3W A;  1TP5 A;  2YUY A;  3LNY A;  2ENO A;  2MHO A;  3SOE A;  1WIF A;  2KV8 A;  4JJ0 A;  3PDV A;  4KFV A;  1X45 A;  2CSS A;  1Q7X A;  1UFX A;  1OZI A;  2JWE A;  3TSW A;  1RY4 A;  2KG2 A;  3QE1 A;  2KYL A;  1IHJ A;  2JIL A;  1BFE A;  2OS6 A;  1W9O A;  2PNT A;  3KDG A;  4REY A;  4KFW A;  3CBX A;  4YDP A;  3PV2 A;  1QAV A;  4NNL A;  1U38 A;  5HET A;  2Q9V A;  3CS0 A;  3HVQ C;  2I6V A;  4IC6 A;  1I92 A;  5IL9 A;  2LA8 A;  1WF7 A;  1U37 A;  2VWR A;  2EDP A;  2IWP A;  2M10 A;  1TQ3 A;  2E7K A;  4L8N A;  1ZOK A;  2OZF A;  3MH7 A;  4JOF A;  2K20 A;  2PZD A;  4OEO A;  5JXB A;  1VAE A;  2KRG A;  2KJD A;  4Q2N A;  2I04 A;  3I4W A;  3CH8 A;  3OTP A;  2I0I A;  3VQF A;  3I18 A;  2OCS A;  1QLC A;  1WH1 A;  2FNE A;  3TSZ A;  5HED A;  1WFV A;  1N6F A;  4JOK A;  1MFG A;  5HEY A;  1UIT A;  2PKT A;  3MH6 A;  4PQW A;  2X7Z A;  2VSP A;  2RRM A;  5DTH A;  1IU2 A;  2FE5 A;  3E17 A;  5B42 A;  1MC7 A;  3GDS A;  1U39 A;  1UF1 A;  2DB5 A;  3CYY A;  3SHU A;  2WL7 A;  4Q2O A;  2UZC A;  2GEF A;  1LCY A;  2YUB A;  2KOJ A;  1GQ4 A;  5H3J A;  5HDY A;  2W7R A;  3O46 A;  5GND A;  2DKR A;  4JOH A;  5G1E A;  2KJK A;  1X8S A;  2M0U A;  2EXG A;  3DJ3 A;  2KJP A;  4JOJ A;  2AIN A;  1UJV A;  1B8Q A;  1QAV B;  2QKU A;  2GZV A;  3K1R A;  3DOR A;  4Z8J A;  4O06 A;  4Q2P A;  2YT8 A;  5HFC A;  1UEQ A;  3L4F D;  1KY9 A;  1TP3 A;  4JOR A;  2EDV A;  4UU6 A;  1W9E A;  3DIW A;  5EZ0 A;  3TMH A;  3KDK A;  2H3L A;  5ILB A;  5F3X A;  3GJ9 A;  4Q6H A;  3GDV A;  3K50 A;  1WF8 A;  3CBZ A;  3B76 A;  1V1T A;  1MFL A;  3WKL A;  2IWN A;  2KA9 A;  3SHW A;  2M0Z A;  1X5N A;  1N6E A;  2FCF A;  1RZX A;  5D13 A;  1FC6 A;  3QJM A;  2ZPM A;  1ZUB A;  1UEW A;  2OPG A;  1FCF A;  3ZRT A;  2EGK A;  2G5M B;  3GCN A;  2JOA A;  4E35 A;  4HOP A;  1OBY A;  2I0L A;  1P1D A;  3QO6 A;  4G69 A;  1M5Z A;  2LOB A;  3GDU A;  4Z33 A;  2PKU A;  4NXQ A;  1WHA A;  1X6D A;  2YTW A;  1WFG A;  2M0T A;  3GCO A;  4P2A B;  5E11 A;  2L97 A;  2D92 A;  4WYU A;  2MX6 A;  2F0A A;  3FY5 A;  2VZ5 A;  2KOM A;  2CS5 A;  3I1E A;  3HPK A;  4NMS A;  5HFD A;  3R68 A;  2PDZ A;  3RL7 A;  4OAJ A;  2F5Y A;  5EYZ A;  5E21 A;  1UEZ A;  2K1Z A;  1N99 A;  3GSL A;  1OBZ A;  2EHR A;  1UEP A;  3PV5 A;  3RLE A;  3R69 A;  2KAW A;  4K75 A;  5HFF A;  3K82 A;  1X5R A;  4H11 A;  4FLN A;  4K6Y A;  1FC9 A;  4Q2Q A;  2KPK A;  1N7E A;  2VPH A;  1I16 A;  2JRE A;  4OEP A;  5B6L A;  2EV8 A;  1RGW A;  2QT5 A;  4E34 A;  2H2C A;  3PV4 A;  2EDZ A;  3PS4 A;  2D90 A;  2O2T A;  2KBS A;  1P1E A;  3CC0 A;  2DMZ A;  1Q3P A;  4JJ3 A;  5E22 A;  2EEJ A;  3VQG A;  4EDJ A;  3HPM A;  4HOP B;  4NMO A;  2ZPL A;  4NMR A;  2VSV A;  2Z9I A;  2RCZ A;  4NXR A;  4JOE A;  4FGM A;  2DM8 A;  4NMT A;  1W9Q A;  1X5Q A;  1Q3O A;  2KPL A;  3ID2 A;  1FC7 A;  1OBX A;  2IWO A;  2EJY A;  3EGH C;  1BE9 A;  1UM1 A;  2DJT A;  2QG1 A;  4GVD A;  3NFK A;  4JOG A;  5GLJ A;  2L4S A;  2LC7 A;  1R6J A;  1K32 A;  3LNX A;  3GGE A;  2QKT A;  1PDR A;  2CSJ A;  5E6P B;  2YT7 A;  2LUI A;  2DAZ A;  3QIK A;  2I4S A;  1WJL A;  3PDZ A;  1KWA A;  2HE4 A;  3EGG C;  2AWU A;  3O5N A;  2W4F A;  3SUZ A;  1D5G A;  2VRF A;  4GHN A;  4F8K A;  1V5L A;  4JOP A;  2R3Y A;  4Q6S A;  1U3B A;  1N7F A;  1WI4 A;  4K78 A;  2G2L A;  1UJU A;  3ID1 A;  4NMV A;  2DLS A;  2M3M A;  3NFL A;  4P0C A;  3WKM A;  3KHF A;  4YYX A;  2JIK A;  2V90 A;  1T2M A;  2EEH A;  2OQS A;  2JXO A;  1IU0 A;  4JL7 A;  3DJ1 A;  3QJN A;  2KOH A;  5F67 A;  1V5Q A;  3RL8 A;  1G9O A;  2OMJ A;  2H3M A;  1Z87 A;  1UM7 A;  4K76 A;  4UU5 A;  1VCW A;  5HEB A;  1WI2 A;  4NXP A;  1KEF A;  4LMM A;  4K72 A;  2Q3G A;  4Q3H A;  2LC6 A;  3DJA A;  4WYT A;  5E1Y A;  2HGA A;  1Y7N A;  5FB8 C;  1VA8 A;  2EEI A;  1N6D A;  2IWQ A;  2Z17 A;  1L6O A;  1VB7 A;  1WG6 A;  2OGP A;  1NTE A;  2QBW A;  3ID4 A;  3NGH A;  3OU0 A;  4NMQ A;  3STJ A;  1RGR A;  1YBO A;  3BPU A;  2R4H A;  2REY A;  1TE0 A;  5HJ1 A;  1GQ5 A;  4GVC A;  1UJD A;  4XHV A;  1N7T A;  1WHD A;  2AWX A;  2EEG A;  2JSN A;  2DC2 A;  5HF1 A;  2KQF A;  2V1W A;  1SOZ A;  2L4T A;  1QAU A;  1Y8T A;  5HFB A;  2EGO A;  3AXA A;  1V62 A;  2QKV A;  3QDO A;  4NNM A;  4NMP A;  2BYG A;  4MPA A;  3SFJ A;  2I1N A;  2D8I A;  2AWW A;  2EAQ A;  1VJ6 A;  1V6B A;  3KZD A;  3JXT A;  3QGL A;  1GM1 A;  3NCV A;  3R0H A;  1UHP A;  1NF3 C;  2HE2 A;  2M0V A;  2FN5 A;  4RI0 A;  3ID3 A;  2DLU A;  3MH4 A;  2PA1 A;  5HFE A;  4R2Z A;  1SOT A;  2KL1 A;  4N6X A;  5G1D A;  5A2P A;  1Z86 A;  5I7Z A;  1XZ9 A;  2JIN A;  3TSV A;  2OSG A;  4AMH A;  3GAB A;  3CBY A;  5FHT A;  3KZE A;  5HF4 A;  2EGN A;  2H2B A;  4E3B A;  1X9Z A; 
#chains in the Genus database with same CATH homology
 2P3W A;  1TP5 A;  2YUY A;  3LNY A;  2ENO A;  2MHO A;  3SOE A;  1WIF A;  2KV8 A;  4JJ0 A;  3PDV A;  4KFV A;  1X45 A;  2CSS A;  1Q7X A;  1UFX A;  1OZI A;  2JWE A;  3TSW A;  1RY4 A;  2KG2 A;  3QE1 A;  2KYL A;  1IHJ A;  2JIL A;  1BFE A;  2OS6 A;  1W9O A;  2PNT A;  3KDG A;  4REY A;  4KFW A;  3CBX A;  4YDP A;  3PV2 A;  1QAV A;  4NNL A;  1U38 A;  5HET A;  2Q9V A;  3CS0 A;  3HVQ C;  2I6V A;  4IC6 A;  1I92 A;  5IL9 A;  2LA8 A;  1WF7 A;  1U37 A;  2VWR A;  2EDP A;  2IWP A;  2M10 A;  1TQ3 A;  2E7K A;  4L8N A;  1ZOK A;  2OZF A;  3MH7 A;  4JOF A;  2K20 A;  2PZD A;  4OEO A;  5JXB A;  1VAE A;  2KRG A;  2KJD A;  4Q2N A;  2I04 A;  3I4W A;  3CH8 A;  3OTP A;  2I0I A;  3VQF A;  3I18 A;  2OCS A;  1QLC A;  1WH1 A;  2FNE A;  3TSZ A;  5HED A;  1WFV A;  1N6F A;  4JOK A;  1MFG A;  5HEY A;  1UIT A;  2PKT A;  3MH6 A;  4PQW A;  2X7Z A;  2VSP A;  2RRM A;  5DTH A;  1IU2 A;  2FE5 A;  3E17 A;  5B42 A;  1MC7 A;  3GDS A;  1U39 A;  1UF1 A;  2DB5 A;  3CYY A;  3SHU A;  2WL7 A;  4Q2O A;  2UZC A;  2GEF A;  1LCY A;  2YUB A;  2KOJ A;  1GQ4 A;  5H3J A;  5HDY A;  2W7R A;  3O46 A;  5GND A;  2DKR A;  4JOH A;  5G1E A;  2KJK A;  1X8S A;  2M0U A;  2EXG A;  3DJ3 A;  2KJP A;  4JOJ A;  2AIN A;  1UJV A;  1B8Q A;  1QAV B;  2QKU A;  2GZV A;  3K1R A;  3DOR A;  4Z8J A;  4O06 A;  4Q2P A;  2YT8 A;  5HFC A;  1UEQ A;  3L4F D;  1KY9 A;  1TP3 A;  4JOR A;  2EDV A;  4UU6 A;  1W9E A;  3DIW A;  5EZ0 A;  3TMH A;  3KDK A;  2H3L A;  5ILB A;  5F3X A;  3GJ9 A;  4Q6H A;  3GDV A;  3K50 A;  1WF8 A;  3CBZ A;  3B76 A;  1V1T A;  1MFL A;  3WKL A;  2IWN A;  2KA9 A;  3SHW A;  2M0Z A;  1X5N A;  1N6E A;  2FCF A;  1RZX A;  5D13 A;  1FC6 A;  3QJM A;  2ZPM A;  1ZUB A;  1UEW A;  2OPG A;  1FCF A;  3ZRT A;  2EGK A;  2G5M B;  3GCN A;  2JOA A;  4E35 A;  4HOP A;  1OBY A;  2I0L A;  1P1D A;  3QO6 A;  4G69 A;  1M5Z A;  2LOB A;  3GDU A;  4Z33 A;  2PKU A;  4NXQ A;  1WHA A;  1X6D A;  2YTW A;  1WFG A;  2M0T A;  3GCO A;  4P2A B;  5E11 A;  2L97 A;  2D92 A;  4WYU A;  2MX6 A;  2F0A A;  3FY5 A;  2VZ5 A;  2KOM A;  2CS5 A;  3I1E A;  3HPK A;  4NMS A;  5HFD A;  3R68 A;  2PDZ A;  3RL7 A;  4OAJ A;  2F5Y A;  5EYZ A;  5E21 A;  1UEZ A;  2K1Z A;  1N99 A;  3GSL A;  1OBZ A;  2EHR A;  1UEP A;  3PV5 A;  3RLE A;  3R69 A;  2KAW A;  4K75 A;  5HFF A;  3K82 A;  1X5R A;  4H11 A;  4FLN A;  4K6Y A;  1FC9 A;  4Q2Q A;  2KPK A;  1N7E A;  2VPH A;  1I16 A;  2JRE A;  4OEP A;  5B6L A;  2EV8 A;  1RGW A;  2QT5 A;  4E34 A;  2H2C A;  3PV4 A;  2EDZ A;  3PS4 A;  2D90 A;  2O2T A;  2KBS A;  1P1E A;  3CC0 A;  2DMZ A;  1Q3P A;  4JJ3 A;  5E22 A;  2EEJ A;  3VQG A;  4EDJ A;  3HPM A;  4HOP B;  4NMO A;  2ZPL A;  4NMR A;  2VSV A;  2Z9I A;  2RCZ A;  4NXR A;  4JOE A;  4FGM A;  2DM8 A;  4NMT A;  1W9Q A;  1X5Q A;  1Q3O A;  2KPL A;  3ID2 A;  1FC7 A;  1OBX A;  2IWO A;  2EJY A;  3EGH C;  1BE9 A;  1UM1 A;  2DJT A;  2QG1 A;  4GVD A;  3NFK A;  4JOG A;  5GLJ A;  2L4S A;  2LC7 A;  1R6J A;  1K32 A;  3LNX A;  3GGE A;  2QKT A;  1PDR A;  2CSJ A;  5E6P B;  2YT7 A;  2LUI A;  2DAZ A;  3QIK A;  2I4S A;  1WJL A;  3PDZ A;  1KWA A;  2HE4 A;  3EGG C;  2AWU A;  3O5N A;  2W4F A;  3SUZ A;  1D5G A;  2VRF A;  4GHN A;  4F8K A;  1V5L A;  4JOP A;  2R3Y A;  4Q6S A;  1U3B A;  1N7F A;  1WI4 A;  4K78 A;  2G2L A;  1UJU A;  3ID1 A;  4NMV A;  2DLS A;  2M3M A;  3NFL A;  4P0C A;  3WKM A;  3KHF A;  4YYX A;  2JIK A;  2V90 A;  1T2M A;  2EEH A;  2OQS A;  2JXO A;  1IU0 A;  4JL7 A;  3DJ1 A;  3QJN A;  2KOH A;  5F67 A;  1V5Q A;  3RL8 A;  1G9O A;  2OMJ A;  2H3M A;  1Z87 A;  1UM7 A;  4K76 A;  4UU5 A;  1VCW A;  5HEB A;  1WI2 A;  4NXP A;  1KEF A;  4LMM A;  4K72 A;  2Q3G A;  4Q3H A;  2LC6 A;  3DJA A;  4WYT A;  5E1Y A;  2HGA A;  1Y7N A;  5FB8 C;  1VA8 A;  2EEI A;  1N6D A;  2IWQ A;  2Z17 A;  1L6O A;  1VB7 A;  1WG6 A;  2OGP A;  1NTE A;  2QBW A;  3ID4 A;  3NGH A;  3OU0 A;  4NMQ A;  3STJ A;  1RGR A;  1YBO A;  3BPU A;  2R4H A;  2REY A;  1TE0 A;  5HJ1 A;  1GQ5 A;  4GVC A;  1UJD A;  4XHV A;  1N7T A;  1WHD A;  2AWX A;  2EEG A;  2JSN A;  2DC2 A;  5HF1 A;  2KQF A;  2V1W A;  1SOZ A;  2L4T A;  1QAU A;  1Y8T A;  5HFB A;  2EGO A;  3AXA A;  1V62 A;  2QKV A;  3QDO A;  4NNM A;  4NMP A;  2BYG A;  4MPA A;  3SFJ A;  2I1N A;  2D8I A;  2AWW A;  2EAQ A;  1VJ6 A;  1V6B A;  3KZD A;  3JXT A;  3QGL A;  1GM1 A;  3NCV A;  3R0H A;  1UHP A;  1NF3 C;  2HE2 A;  2M0V A;  2FN5 A;  4RI0 A;  3ID3 A;  2DLU A;  3MH4 A;  2PA1 A;  5HFE A;  4R2Z A;  1SOT A;  2KL1 A;  4N6X A;  5G1D A;  5A2P A;  1Z86 A;  5I7Z A;  1XZ9 A;  2JIN A;  3TSV A;  2OSG A;  4AMH A;  3GAB A;  3CBY A;  5FHT A;  3KZE A;  5HF4 A;  2EGN A;  2H2B A;  4E3B A;  1X9Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...