4G69A

Structure of the human discs large 1 pdz2 - adenomatous polyposis coli cytoskeletal polarity complex
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
97
structure length
97
Chain Sequence
RKPVSEKIMEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNNVCLEEVTHEEAVTALKNTSDFVYLKVAKPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Disks large homolog 1
publication title Structure of the Human Discs Large 1 PDZ2- Adenomatous Polyposis Coli Cytoskeletal Polarity Complex: Insight into Peptide Engagement and PDZ Clustering.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein/signaling protein
total genus 22
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2012-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 4g69A00
5HFDA 2VPHA 4Q2PA 1N99A 2I6VA 4OEPA 2KJPA 4REYA 1VCWA 1PDRA 1Q3PA 2OCSA 1M5ZA 2DM8A 5D13A 2FCFA 1W9EA 1K32A 2V90A 4NXQA 5HF4A 2DKRA 2Z17A 3CYYA 2QKUA 4YDPA 3PDZA 3NFLA 3O5NA 1SOTA 5EYZA 2EDZA 2G5MB 5G1EA 4Q6SA 2JINA 2PNTA 1V5LA 5E11A 2DLSA 1VA8A 2E7KA 3HVQC 5HFCA 2GZVA 1W9QA 2HE4A 1WI2A 5G1DA 4F8KA 1WJLA 3RLEA 3MH4A 3KZEA 2QG1A 2CSSA 3NFKA 1WHAA 1N6DA 2EEIA 2EAQA 1B8QA 1ZUBA 3QJMA 2VRFA 2EDVA 4Q2NA 1T2MA 4WYTA 1L6OA 2OPGA 3RL8A 2VWRA 2KA9A 1UJVA 2L4SA 2YTWA 2K1ZA 3WKMA 2KJDA 1V6BA 3B76A 1QAVA 2M10A 2ZPLA 5E21A 3SUZA 1UF1A 3CH8A 1TQ3A 2LOBA 3PS4A 3SFJA 3R69A 2WL7A 2KOHA 3JXTA 2QKTA 2G2LA 2L4TA 5HFFA 2I4SA 4Q3HA 2OZFA 2QT5A 2KBSA 1RGWA 4HOPB 4Q2QA 4UU5A 4NMOA 4NMSA 1ZOKA 3K50A 2OSGA 3GDVA 4MPAA 2REYA 2OQSA 5HEDA 2EGOA 3ID3A 1V1TA 2F5YA 1WI4A 2YT8A 2I04A 2MX6A 4Z8JA 1N7EA 1Z87A 2VSPA 2I1NA 3KZDA 4JOGA 2EGNA 3SHWA 2PDZA 2KPKA 1BFEA 1XZ9A 2F0AA 3E17A 1RGRA 2KRGA 4JOPA 5HETA 2FNEA 3FY5A 1WIFA 2Q9VA 1UEQA 3ID1A 3OU0A 3EGHC 1GQ4A 1X5RA 2JXOA 2I0LA 2LC7A 5E1YA 5FHTA 1UITA 2K20A 1UHPA 5HFBA 2D90A 4JL7A 1OBXA 4XHVA 4UU6A 2L97A 3GCOA 2LUIA 3ZRTA 1MC7A 3CBZA 2CSJA 2Q3GA 4NMTA 1WH1A 2KL1A 2IWPA 1KY9A 1N6FA 2M0UA 1WF8A 4Z33A 2P3WA 2IWNA 2PA1A 4JOJA 3SHUA 4JOHA 5GNDA 4O06A 1KEFA 5F3XA 3QIKA 4NMPA 4N6XA 4P0CA 3ID4A 2H2BA 4K75A 4NMQA 3DORA 5HJ1A 4NNLA 2DC2A 5DTHA 1RZXA 3CC0A 4NMRA 2KPLA 4JORA 3QGLA 3BPUA 2DLUA 4HOPA 3PV5A 2M0VA 1GM1A 2IWOA 4JOFA 1FC9A 2YUYA 3TSVA 2KYLA 2H3MA 1V62A 3OTPA 4YYXA 3TSWA 1N7FA 5B6LA 4G69A 2RRMA 5E6PB 2JOAA 3HPMA 3GGEA 5HFEA 1WHDA 2Z9IA 2KOMA 2QKVA 3R0HA 4EDJA 1TP3A 1WFGA 5HEYA 2PKUA 3CBYA 2DJTA 2M0TA 3ID2A 3MH7A 1YBOA 1U39A 5JXBA 1U38A 2OGPA 3LNXA 1OBZA 1MFLA 2JWEA 2RCZA 4IC6A 1FC6A 1Y8TA 4OAJA 3MH6A 1VAEA 3GCNA 3NGHA 3TMHA 2LA8A 2BYGA 2FN5A 4NNMA 4JOEA 1LCYA 4NXRA 1D5GA 1QAUA 2JREA 3GJ9A 1P1DA 1U3BA 1VB7A 2EV8A 1IU2A 3EGGC 4GVCA 2W7RA 3QJNA 2H3LA 5EZ0A 4WYUA 1UM1A 2EEJA 1X5QA 1KWAA 1UJUA 2O2TA 1Q3OA 4R2ZA 3I18A 2V1WA 2EHRA 2MHOA 2PZDA 3DJ3A 2H2CA 3GDSA 4GHNA 2AINA 4GVDA 4P2AB 4H11A 2DB5A 1SOZA 1X45A 4E35A 1W9OA 5F67A 2D8IA 2W4FA 3TSZA 3GDUA 1N7TA 1IU0A 4Q2OA 2KV8A 2KAWA 2EEGA 1IHJA 2YT7A 1WFVA 3HPKA 3QE1A 4FGMA 2R4HA 1X6DA 4E3BA 2KOJA 2EJYA 2YUBA 3DJAA 3QO6A 3VQFA 1MFGA 3R68A 2LC6A 3DIWA 1UEWA 4K6YA 1UFXA 1P1EA 1X8SA 1RY4A 2ZPMA 2QBWA 3STJA 1TP5A 3O46A 5H3JA 2ENOA 5HEBA 2DAZA 2M0ZA 4NMVA 1I16A 1WF7A 2OS6A 2OMJA 3K1RA 3K82A 4KFWA 4AMHA 2R3YA 3I1EA 1I92A 1TE0A 1UEZA 5E22A 1UJDA 1V5QA 3CS0A 3L4FD 1Z86A 3CBXA 1U37A 3QDOA 2EDPA 2EEHA 2EXGA 4Q6HA 2IWQA 1FC7A 5I7ZA 2PKTA 2M3MA 3AXAA 2AWXA 4L8NA 3DJ1A 3PV2A 2VZ5A 2KQFA 2AWUA 3GSLA 1N6EA 1X5NA 1UM7A 1FCFA 2EGKA 2HGAA 5GLJA 1WG6A 1OBYA 3WKLA 3VQGA 4K78A 1G9OA 4OEOA 5A2PA 1Q7XA 4NXPA 4KFVA 1VJ6A 3LNYA 4K72A 2X7ZA 4PQWA 1Y7NA 1QAVB 1OZIA 3PDVA 1NTEA 2KG2A 5FB8C 5HF1A 2FE5A 3I4WA 4K76A 2AWWA 1UEPA 2HE2A 4RI0A 1R6JA 2D92A 3RL7A 2KJKA 4JOKA 2DMZA 2JILA 5HDYA 4E34A 2VSVA 2JIKA 2UZCA 1BE9A 1QLCA 3PV4A 4LMMA 3SOEA 3KHFA 1GQ5A 2I0IA 1NF3C 2CS5A
chains in the Genus database with same CATH superfamily
5HFDA 2VPHA 4Q2PA 1N99A 2I6VA 4OEPA 2KJPA 4REYA 1VCWA 1PDRA 1Q3PA 2OCSA 4FLNA 1M5ZA 2DM8A 5D13A 2FCFA 1W9EA 1K32A 2V90A 4NXQA 5HF4A 2DKRA 2Z17A 3CYYA 2QKUA 4YDPA 3PDZA 3NFLA 3O5NA 1SOTA 5EYZA 2EDZA 2G5MB 5G1EA 4Q6SA 2JINA 2PNTA 1V5LA 5E11A 2DLSA 1VA8A 2E7KA 3HVQC 5HFCA 2GZVA 1W9QA 2HE4A 1WI2A 5G1DA 4F8KA 1WJLA 3RLEA 3MH4A 3KZEA 2QG1A 2CSSA 3NFKA 1WHAA 1N6DA 2EEIA 2EAQA 1B8QA 1ZUBA 3QJMA 2VRFA 2EDVA 4Q2NA 1T2MA 4WYTA 1L6OA 2OPGA 3RL8A 2VWRA 2KA9A 1UJVA 2L4SA 2YTWA 2K1ZA 3WKMA 2KJDA 1V6BA 3B76A 5B42A 1QAVA 2M10A 2ZPLA 5E21A 3SUZA 1UF1A 3CH8A 1TQ3A 2LOBA 3PS4A 3SFJA 3R69A 2WL7A 2KOHA 3JXTA 2QKTA 2G2LA 2L4TA 5HFFA 2I4SA 1X9ZA 4Q3HA 2OZFA 2QT5A 2KBSA 1RGWA 4HOPB 4Q2QA 4UU5A 4NMOA 4NMSA 1ZOKA 3K50A 2OSGA 3GDVA 4MPAA 2REYA 2OQSA 5HEDA 2EGOA 3ID3A 1V1TA 2F5YA 1WI4A 2YT8A 2I04A 2MX6A 4Z8JA 1N7EA 1Z87A 2VSPA 2I1NA 3KZDA 4JOGA 2EGNA 3SHWA 2PDZA 2KPKA 1BFEA 1XZ9A 2F0AA 3E17A 1RGRA 2KRGA 4JOPA 5HETA 2FNEA 3FY5A 1WIFA 2Q9VA 1UEQA 3ID1A 3OU0A 3EGHC 3NCVA 1GQ4A 1X5RA 2JXOA 2I0LA 2LC7A 5E1YA 5FHTA 1UITA 2K20A 1UHPA 5HFBA 2D90A 4JL7A 1OBXA 4XHVA 4UU6A 2L97A 3GCOA 2LUIA 3ZRTA 1MC7A 3CBZA 2CSJA 2Q3GA 4NMTA 1WH1A 2KL1A 2IWPA 1KY9A 1N6FA 2M0UA 1WF8A 4Z33A 2P3WA 2IWNA 2PA1A 4JOJA 3SHUA 4JOHA 5GNDA 4O06A 4JJ0A 1KEFA 5F3XA 3QIKA 4NMPA 4N6XA 4P0CA 3ID4A 2H2BA 4K75A 4NMQA 3DORA 5HJ1A 4NNLA 2DC2A 5DTHA 1RZXA 3CC0A 4NMRA 2KPLA 4JORA 3QGLA 3BPUA 2DLUA 4HOPA 3PV5A 2M0VA 1GM1A 2IWOA 2GEFA 4JOFA 1FC9A 2YUYA 3TSVA 2KYLA 2H3MA 1V62A 3OTPA 4YYXA 3TSWA 1N7FA 5B6LA 4G69A 2RRMA 5E6PB 2JOAA 3HPMA 3GGEA 5HFEA 1WHDA 2Z9IA 4JJ3A 2KOMA 2QKVA 3R0HA 4EDJA 1TP3A 1WFGA 5HEYA 2PKUA 3CBYA 2DJTA 2M0TA 3ID2A 3MH7A 1YBOA 1U39A 5JXBA 1U38A 2OGPA 3LNXA 1OBZA 1MFLA 2JWEA 2RCZA 4IC6A 1FC6A 1Y8TA 4OAJA 3MH6A 1VAEA 3GCNA 3NGHA 3TMHA 2LA8A 2BYGA 2FN5A 4NNMA 4JOEA 1LCYA 4NXRA 1D5GA 1QAUA 2JREA 3GJ9A 1P1DA 1U3BA 1VB7A 2EV8A 1IU2A 3EGGC 4GVCA 2W7RA 3GABA 3QJNA 2H3LA 3KDGA 5EZ0A 4WYUA 1UM1A 2EEJA 1X5QA 1KWAA 2JSNA 1UJUA 2O2TA 1Q3OA 4R2ZA 3I18A 2V1WA 2EHRA 2MHOA 2PZDA 3DJ3A 2H2CA 3GDSA 4GHNA 2AINA 4GVDA 4P2AB 4H11A 2DB5A 1SOZA 1X45A 4E35A 1W9OA 5F67A 2D8IA 2W4FA 3TSZA 3GDUA 1N7TA 1IU0A 4Q2OA 2KV8A 2KAWA 2EEGA 1IHJA 2YT7A 1WFVA 3HPKA 3QE1A 4FGMA 2R4HA 1X6DA 4E3BA 2KOJA 2EJYA 2YUBA 3DJAA 3QO6A 3VQFA 1MFGA 3R68A 2LC6A 3DIWA 1UEWA 4K6YA 1UFXA 1P1EA 1X8SA 1RY4A 2ZPMA 2QBWA 3STJA 1TP5A 3O46A 5H3JA 2ENOA 5HEBA 2DAZA 2M0ZA 4NMVA 1I16A 1WF7A 2OS6A 2OMJA 3K1RA 3K82A 4KFWA 4AMHA 2R3YA 3I1EA 1I92A 1TE0A 1UEZA 5E22A 1UJDA 1V5QA 3CS0A 3L4FD 1Z86A 3CBXA 1U37A 3QDOA 2EDPA 2EEHA 2EXGA 4Q6HA 2IWQA 1FC7A 5I7ZA 2PKTA 2M3MA 3AXAA 2AWXA 4L8NA 3DJ1A 3PV2A 2VZ5A 2KQFA 2AWUA 3GSLA 1N6EA 1X5NA 1UM7A 1FCFA 2EGKA 2HGAA 5GLJA 1WG6A 1OBYA 3WKLA 3VQGA 4K78A 1G9OA 4OEOA 5A2PA 1Q7XA 4NXPA 4KFVA 1VJ6A 3LNYA 4K72A 2X7ZA 4PQWA 1Y7NA 1QAVB 1OZIA 3PDVA 1NTEA 2KG2A 5FB8C 5HF1A 2FE5A 3I4WA 4K76A 2AWWA 1UEPA 2HE2A 4RI0A 1R6JA 5ILBA 2D92A 3RL7A 2KJKA 4JOKA 3KDKA 2DMZA 2JILA 5HDYA 4E34A 2VSVA 2JIKA 2UZCA 1BE9A 1QLCA 3PV4A 4LMMA 3SOEA 5IL9A 3KHFA 1GQ5A 2I0IA 1NF3C 2CS5A
chains in the Genus database with same CATH topology
5HFDA 2VPHA 4Q2PA 1N99A 2I6VA 4OEPA 2KJPA 4REYA 1VCWA 1PDRA 1Q3PA 2OCSA 4FLNA 1M5ZA 2DM8A 5D13A 2FCFA 1W9EA 1K32A 2V90A 4NXQA 5HF4A 2DKRA 2Z17A 3CYYA 2QKUA 4YDPA 3PDZA 3NFLA 3O5NA 1SOTA 5EYZA 2EDZA 2G5MB 5G1EA 4Q6SA 2JINA 2PNTA 1V5LA 5E11A 2DLSA 1VA8A 2E7KA 3HVQC 5HFCA 2GZVA 1W9QA 2HE4A 1WI2A 5G1DA 4F8KA 1WJLA 3RLEA 3MH4A 3KZEA 2QG1A 2CSSA 3NFKA 1WHAA 1N6DA 2EEIA 2EAQA 1B8QA 1ZUBA 3QJMA 2VRFA 2EDVA 4Q2NA 1T2MA 4WYTA 1L6OA 2OPGA 3RL8A 2VWRA 2KA9A 1UJVA 2L4SA 2YTWA 2K1ZA 3WKMA 2KJDA 1V6BA 3B76A 5B42A 1QAVA 2M10A 2ZPLA 5E21A 3SUZA 1UF1A 3CH8A 1TQ3A 2LOBA 3PS4A 3SFJA 3R69A 2WL7A 2KOHA 3JXTA 2QKTA 2G2LA 2L4TA 5HFFA 2I4SA 1X9ZA 4Q3HA 2OZFA 2QT5A 2KBSA 1RGWA 4HOPB 4Q2QA 4UU5A 4NMOA 4NMSA 1ZOKA 3K50A 2OSGA 3GDVA 4MPAA 2REYA 2OQSA 5HEDA 2EGOA 3ID3A 1V1TA 2F5YA 1WI4A 2YT8A 2I04A 2MX6A 4Z8JA 1N7EA 1Z87A 2VSPA 2I1NA 3KZDA 4JOGA 2EGNA 3SHWA 2PDZA 2KPKA 1BFEA 1XZ9A 2F0AA 3E17A 1RGRA 2KRGA 4JOPA 5HETA 2FNEA 3FY5A 1WIFA 2Q9VA 1UEQA 3ID1A 3OU0A 3EGHC 3NCVA 1GQ4A 1X5RA 2JXOA 2I0LA 2LC7A 5E1YA 5FHTA 1UITA 2K20A 1UHPA 5HFBA 2D90A 4JL7A 1OBXA 4XHVA 4UU6A 2L97A 3GCOA 2LUIA 3ZRTA 1MC7A 3CBZA 2CSJA 2Q3GA 4NMTA 1WH1A 2KL1A 2IWPA 1KY9A 1N6FA 2M0UA 1WF8A 4Z33A 2P3WA 2IWNA 2PA1A 4JOJA 3SHUA 4JOHA 5GNDA 4O06A 4JJ0A 1KEFA 5F3XA 3QIKA 4NMPA 4N6XA 4P0CA 3ID4A 2H2BA 4K75A 4NMQA 3DORA 5HJ1A 4NNLA 2DC2A 5DTHA 1RZXA 3CC0A 4NMRA 2KPLA 4JORA 3QGLA 3BPUA 2DLUA 4HOPA 3PV5A 2M0VA 1GM1A 2IWOA 2GEFA 4JOFA 1FC9A 2YUYA 3TSVA 2KYLA 2H3MA 1V62A 3OTPA 4YYXA 3TSWA 1N7FA 5B6LA 4G69A 2RRMA 5E6PB 2JOAA 3HPMA 3GGEA 5HFEA 1WHDA 2Z9IA 4JJ3A 2KOMA 2QKVA 3R0HA 4EDJA 1TP3A 1WFGA 5HEYA 2PKUA 3CBYA 2DJTA 2M0TA 3ID2A 3MH7A 1YBOA 1U39A 5JXBA 1U38A 2OGPA 3LNXA 1OBZA 1MFLA 2JWEA 2RCZA 4IC6A 1FC6A 1Y8TA 4OAJA 3MH6A 1VAEA 3GCNA 3NGHA 3TMHA 2LA8A 2BYGA 2FN5A 4NNMA 4JOEA 1LCYA 4NXRA 1D5GA 1QAUA 2JREA 3GJ9A 1P1DA 1U3BA 1VB7A 2EV8A 1IU2A 3EGGC 4GVCA 2W7RA 3GABA 3QJNA 2H3LA 3KDGA 5EZ0A 4WYUA 1UM1A 2EEJA 1X5QA 1KWAA 2JSNA 1UJUA 2O2TA 1Q3OA 4R2ZA 3I18A 2V1WA 2EHRA 2MHOA 2PZDA 3DJ3A 2H2CA 3GDSA 4GHNA 2AINA 4GVDA 4P2AB 4H11A 2DB5A 1SOZA 1X45A 4E35A 1W9OA 5F67A 2D8IA 2W4FA 3TSZA 3GDUA 1N7TA 1IU0A 4Q2OA 2KV8A 2KAWA 2EEGA 1IHJA 2YT7A 1WFVA 3HPKA 3QE1A 4FGMA 2R4HA 1X6DA 4E3BA 2KOJA 2EJYA 2YUBA 3DJAA 3QO6A 3VQFA 1MFGA 3R68A 2LC6A 3DIWA 1UEWA 4K6YA 1UFXA 1P1EA 1X8SA 1RY4A 2ZPMA 2QBWA 3STJA 1TP5A 3O46A 5H3JA 2ENOA 5HEBA 2DAZA 2M0ZA 4NMVA 1I16A 1WF7A 2OS6A 2OMJA 3K1RA 3K82A 4KFWA 4AMHA 2R3YA 3I1EA 1I92A 1TE0A 1UEZA 5E22A 1UJDA 1V5QA 3CS0A 3L4FD 1Z86A 3CBXA 1U37A 3QDOA 2EDPA 2EEHA 2EXGA 4Q6HA 2IWQA 1FC7A 5I7ZA 2PKTA 2M3MA 3AXAA 2AWXA 4L8NA 3DJ1A 3PV2A 2VZ5A 2KQFA 2AWUA 3GSLA 1N6EA 1X5NA 1UM7A 1FCFA 2EGKA 2HGAA 5GLJA 1WG6A 1OBYA 3WKLA 3VQGA 4K78A 1G9OA 4OEOA 5A2PA 1Q7XA 4NXPA 4KFVA 1VJ6A 3LNYA 4K72A 2X7ZA 4PQWA 1Y7NA 1QAVB 1OZIA 3PDVA 1NTEA 2KG2A 5FB8C 5HF1A 2FE5A 3I4WA 4K76A 2AWWA 1UEPA 2HE2A 4RI0A 1R6JA 5ILBA 2D92A 3RL7A 2KJKA 4JOKA 3KDKA 2DMZA 2JILA 5HDYA 4E34A 2VSVA 2JIKA 2UZCA 1BE9A 1QLCA 3PV4A 4LMMA 3SOEA 5IL9A 3KHFA 1GQ5A 2I0IA 1NF3C 2CS5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HFD A;  2VPH A;  4Q2P A;  1N99 A;  2I6V A;  4OEP A;  2KJP A;  4REY A;  1VCW A;  1PDR A;  1Q3P A;  2OCS A;  1M5Z A;  2DM8 A;  5D13 A;  2FCF A;  1W9E A;  1K32 A;  2V90 A;  4NXQ A;  5HF4 A;  2DKR A;  2Z17 A;  3CYY A;  2QKU A;  4YDP A;  3PDZ A;  3NFL A;  3O5N A;  1SOT A;  5EYZ A;  2EDZ A;  2G5M B;  5G1E A;  4Q6S A;  2JIN A;  2PNT A;  1V5L A;  5E11 A;  2DLS A;  1VA8 A;  2E7K A;  3HVQ C;  5HFC A;  2GZV A;  1W9Q A;  2HE4 A;  1WI2 A;  5G1D A;  4F8K A;  1WJL A;  3RLE A;  3MH4 A;  3KZE A;  2QG1 A;  2CSS A;  3NFK A;  1WHA A;  1N6D A;  2EEI A;  2EAQ A;  1B8Q A;  1ZUB A;  3QJM A;  2VRF A;  2EDV A;  4Q2N A;  1T2M A;  4WYT A;  1L6O A;  2OPG A;  3RL8 A;  2VWR A;  2KA9 A;  1UJV A;  2L4S A;  2YTW A;  2K1Z A;  3WKM A;  2KJD A;  1V6B A;  3B76 A;  1QAV A;  2M10 A;  2ZPL A;  5E21 A;  3SUZ A;  1UF1 A;  3CH8 A;  1TQ3 A;  2LOB A;  3PS4 A;  3SFJ A;  3R69 A;  2WL7 A;  2KOH A;  3JXT A;  2QKT A;  2G2L A;  2L4T A;  5HFF A;  2I4S A;  4Q3H A;  2OZF A;  2QT5 A;  2KBS A;  1RGW A;  4HOP B;  4Q2Q A;  4UU5 A;  4NMO A;  4NMS A;  1ZOK A;  3K50 A;  2OSG A;  3GDV A;  4MPA A;  2REY A;  2OQS A;  5HED A;  2EGO A;  3ID3 A;  1V1T A;  2F5Y A;  1WI4 A;  2YT8 A;  2I04 A;  2MX6 A;  4Z8J A;  1N7E A;  1Z87 A;  2VSP A;  2I1N A;  3KZD A;  4JOG A;  2EGN A;  3SHW A;  2PDZ A;  2KPK A;  1BFE A;  1XZ9 A;  2F0A A;  3E17 A;  1RGR A;  2KRG A;  4JOP A;  5HET A;  2FNE A;  3FY5 A;  1WIF A;  2Q9V A;  1UEQ A;  3ID1 A;  3OU0 A;  3EGH C;  1GQ4 A;  1X5R A;  2JXO A;  2I0L A;  2LC7 A;  5E1Y A;  5FHT A;  1UIT A;  2K20 A;  1UHP A;  5HFB A;  2D90 A;  4JL7 A;  1OBX A;  4XHV A;  4UU6 A;  2L97 A;  3GCO A;  2LUI A;  3ZRT A;  1MC7 A;  3CBZ A;  2CSJ A;  2Q3G A;  4NMT A;  1WH1 A;  2KL1 A;  2IWP A;  1KY9 A;  1N6F A;  2M0U A;  1WF8 A;  4Z33 A;  2P3W A;  2IWN A;  2PA1 A;  4JOJ A;  3SHU A;  4JOH A;  5GND A;  4O06 A;  1KEF A;  5F3X A;  3QIK A;  4NMP A;  4N6X A;  4P0C A;  3ID4 A;  2H2B A;  4K75 A;  4NMQ A;  3DOR A;  5HJ1 A;  4NNL A;  2DC2 A;  5DTH A;  1RZX A;  3CC0 A;  4NMR A;  2KPL A;  4JOR A;  3QGL A;  3BPU A;  2DLU A;  4HOP A;  3PV5 A;  2M0V A;  1GM1 A;  2IWO A;  4JOF A;  1FC9 A;  2YUY A;  3TSV A;  2KYL A;  2H3M A;  1V62 A;  3OTP A;  4YYX A;  3TSW A;  1N7F A;  5B6L A;  4G69 A;  2RRM A;  5E6P B;  2JOA A;  3HPM A;  3GGE A;  5HFE A;  1WHD A;  2Z9I A;  2KOM A;  2QKV A;  3R0H A;  4EDJ A;  1TP3 A;  1WFG A;  5HEY A;  2PKU A;  3CBY A;  2DJT A;  2M0T A;  3ID2 A;  3MH7 A;  1YBO A;  1U39 A;  5JXB A;  1U38 A;  2OGP A;  3LNX A;  1OBZ A;  1MFL A;  2JWE A;  2RCZ A;  4IC6 A;  1FC6 A;  1Y8T A;  4OAJ A;  3MH6 A;  1VAE A;  3GCN A;  3NGH A;  3TMH A;  2LA8 A;  2BYG A;  2FN5 A;  4NNM A;  4JOE A;  1LCY A;  4NXR A;  1D5G A;  1QAU A;  2JRE A;  3GJ9 A;  1P1D A;  1U3B A;  1VB7 A;  2EV8 A;  1IU2 A;  3EGG C;  4GVC A;  2W7R A;  3QJN A;  2H3L A;  5EZ0 A;  4WYU A;  1UM1 A;  2EEJ A;  1X5Q A;  1KWA A;  1UJU A;  2O2T A;  1Q3O A;  4R2Z A;  3I18 A;  2V1W A;  2EHR A;  2MHO A;  2PZD A;  3DJ3 A;  2H2C A;  3GDS A;  4GHN A;  2AIN A;  4GVD A;  4P2A B;  4H11 A;  2DB5 A;  1SOZ A;  1X45 A;  4E35 A;  1W9O A;  5F67 A;  2D8I A;  2W4F A;  3TSZ A;  3GDU A;  1N7T A;  1IU0 A;  4Q2O A;  2KV8 A;  2KAW A;  2EEG A;  1IHJ A;  2YT7 A;  1WFV A;  3HPK A;  3QE1 A;  4FGM A;  2R4H A;  1X6D A;  4E3B A;  2KOJ A;  2EJY A;  2YUB A;  3DJA A;  3QO6 A;  3VQF A;  1MFG A;  3R68 A;  2LC6 A;  3DIW A;  1UEW A;  4K6Y A;  1UFX A;  1P1E A;  1X8S A;  1RY4 A;  2ZPM A;  2QBW A;  3STJ A;  1TP5 A;  3O46 A;  5H3J A;  2ENO A;  5HEB A;  2DAZ A;  2M0Z A;  4NMV A;  1I16 A;  1WF7 A;  2OS6 A;  2OMJ A;  3K1R A;  3K82 A;  4KFW A;  4AMH A;  2R3Y A;  3I1E A;  1I92 A;  1TE0 A;  1UEZ A;  5E22 A;  1UJD A;  1V5Q A;  3CS0 A;  3L4F D;  1Z86 A;  3CBX A;  1U37 A;  3QDO A;  2EDP A;  2EEH A;  2EXG A;  4Q6H A;  2IWQ A;  1FC7 A;  5I7Z A;  2PKT A;  2M3M A;  3AXA A;  2AWX A;  4L8N A;  3DJ1 A;  3PV2 A;  2VZ5 A;  2KQF A;  2AWU A;  3GSL A;  1N6E A;  1X5N A;  1UM7 A;  1FCF A;  2EGK A;  2HGA A;  5GLJ A;  1WG6 A;  1OBY A;  3WKL A;  3VQG A;  4K78 A;  1G9O A;  4OEO A;  5A2P A;  1Q7X A;  4NXP A;  4KFV A;  1VJ6 A;  3LNY A;  4K72 A;  2X7Z A;  4PQW A;  1Y7N A;  1QAV B;  1OZI A;  3PDV A;  1NTE A;  2KG2 A;  5FB8 C;  5HF1 A;  2FE5 A;  3I4W A;  4K76 A;  2AWW A;  1UEP A;  2HE2 A;  4RI0 A;  1R6J A;  2D92 A;  3RL7 A;  2KJK A;  4JOK A;  2DMZ A;  2JIL A;  5HDY A;  4E34 A;  2VSV A;  2JIK A;  2UZC A;  1BE9 A;  1QLC A;  3PV4 A;  4LMM A;  3SOE A;  3KHF A;  1GQ5 A;  2I0I A;  1NF3 C;  2CS5 A; 
#chains in the Genus database with same CATH topology
 5HFD A;  2VPH A;  4Q2P A;  1N99 A;  2I6V A;  4OEP A;  2KJP A;  4REY A;  1VCW A;  1PDR A;  1Q3P A;  2OCS A;  4FLN A;  1M5Z A;  2DM8 A;  5D13 A;  2FCF A;  1W9E A;  1K32 A;  2V90 A;  4NXQ A;  5HF4 A;  2DKR A;  2Z17 A;  3CYY A;  2QKU A;  4YDP A;  3PDZ A;  3NFL A;  3O5N A;  1SOT A;  5EYZ A;  2EDZ A;  2G5M B;  5G1E A;  4Q6S A;  2JIN A;  2PNT A;  1V5L A;  5E11 A;  2DLS A;  1VA8 A;  2E7K A;  3HVQ C;  5HFC A;  2GZV A;  1W9Q A;  2HE4 A;  1WI2 A;  5G1D A;  4F8K A;  1WJL A;  3RLE A;  3MH4 A;  3KZE A;  2QG1 A;  2CSS A;  3NFK A;  1WHA A;  1N6D A;  2EEI A;  2EAQ A;  1B8Q A;  1ZUB A;  3QJM A;  2VRF A;  2EDV A;  4Q2N A;  1T2M A;  4WYT A;  1L6O A;  2OPG A;  3RL8 A;  2VWR A;  2KA9 A;  1UJV A;  2L4S A;  2YTW A;  2K1Z A;  3WKM A;  2KJD A;  1V6B A;  3B76 A;  5B42 A;  1QAV A;  2M10 A;  2ZPL A;  5E21 A;  3SUZ A;  1UF1 A;  3CH8 A;  1TQ3 A;  2LOB A;  3PS4 A;  3SFJ A;  3R69 A;  2WL7 A;  2KOH A;  3JXT A;  2QKT A;  2G2L A;  2L4T A;  5HFF A;  2I4S A;  1X9Z A;  4Q3H A;  2OZF A;  2QT5 A;  2KBS A;  1RGW A;  4HOP B;  4Q2Q A;  4UU5 A;  4NMO A;  4NMS A;  1ZOK A;  3K50 A;  2OSG A;  3GDV A;  4MPA A;  2REY A;  2OQS A;  5HED A;  2EGO A;  3ID3 A;  1V1T A;  2F5Y A;  1WI4 A;  2YT8 A;  2I04 A;  2MX6 A;  4Z8J A;  1N7E A;  1Z87 A;  2VSP A;  2I1N A;  3KZD A;  4JOG A;  2EGN A;  3SHW A;  2PDZ A;  2KPK A;  1BFE A;  1XZ9 A;  2F0A A;  3E17 A;  1RGR A;  2KRG A;  4JOP A;  5HET A;  2FNE A;  3FY5 A;  1WIF A;  2Q9V A;  1UEQ A;  3ID1 A;  3OU0 A;  3EGH C;  3NCV A;  1GQ4 A;  1X5R A;  2JXO A;  2I0L A;  2LC7 A;  5E1Y A;  5FHT A;  1UIT A;  2K20 A;  1UHP A;  5HFB A;  2D90 A;  4JL7 A;  1OBX A;  4XHV A;  4UU6 A;  2L97 A;  3GCO A;  2LUI A;  3ZRT A;  1MC7 A;  3CBZ A;  2CSJ A;  2Q3G A;  4NMT A;  1WH1 A;  2KL1 A;  2IWP A;  1KY9 A;  1N6F A;  2M0U A;  1WF8 A;  4Z33 A;  2P3W A;  2IWN A;  2PA1 A;  4JOJ A;  3SHU A;  4JOH A;  5GND A;  4O06 A;  4JJ0 A;  1KEF A;  5F3X A;  3QIK A;  4NMP A;  4N6X A;  4P0C A;  3ID4 A;  2H2B A;  4K75 A;  4NMQ A;  3DOR A;  5HJ1 A;  4NNL A;  2DC2 A;  5DTH A;  1RZX A;  3CC0 A;  4NMR A;  2KPL A;  4JOR A;  3QGL A;  3BPU A;  2DLU A;  4HOP A;  3PV5 A;  2M0V A;  1GM1 A;  2IWO A;  2GEF A;  4JOF A;  1FC9 A;  2YUY A;  3TSV A;  2KYL A;  2H3M A;  1V62 A;  3OTP A;  4YYX A;  3TSW A;  1N7F A;  5B6L A;  4G69 A;  2RRM A;  5E6P B;  2JOA A;  3HPM A;  3GGE A;  5HFE A;  1WHD A;  2Z9I A;  4JJ3 A;  2KOM A;  2QKV A;  3R0H A;  4EDJ A;  1TP3 A;  1WFG A;  5HEY A;  2PKU A;  3CBY A;  2DJT A;  2M0T A;  3ID2 A;  3MH7 A;  1YBO A;  1U39 A;  5JXB A;  1U38 A;  2OGP A;  3LNX A;  1OBZ A;  1MFL A;  2JWE A;  2RCZ A;  4IC6 A;  1FC6 A;  1Y8T A;  4OAJ A;  3MH6 A;  1VAE A;  3GCN A;  3NGH A;  3TMH A;  2LA8 A;  2BYG A;  2FN5 A;  4NNM A;  4JOE A;  1LCY A;  4NXR A;  1D5G A;  1QAU A;  2JRE A;  3GJ9 A;  1P1D A;  1U3B A;  1VB7 A;  2EV8 A;  1IU2 A;  3EGG C;  4GVC A;  2W7R A;  3GAB A;  3QJN A;  2H3L A;  3KDG A;  5EZ0 A;  4WYU A;  1UM1 A;  2EEJ A;  1X5Q A;  1KWA A;  2JSN A;  1UJU A;  2O2T A;  1Q3O A;  4R2Z A;  3I18 A;  2V1W A;  2EHR A;  2MHO A;  2PZD A;  3DJ3 A;  2H2C A;  3GDS A;  4GHN A;  2AIN A;  4GVD A;  4P2A B;  4H11 A;  2DB5 A;  1SOZ A;  1X45 A;  4E35 A;  1W9O A;  5F67 A;  2D8I A;  2W4F A;  3TSZ A;  3GDU A;  1N7T A;  1IU0 A;  4Q2O A;  2KV8 A;  2KAW A;  2EEG A;  1IHJ A;  2YT7 A;  1WFV A;  3HPK A;  3QE1 A;  4FGM A;  2R4H A;  1X6D A;  4E3B A;  2KOJ A;  2EJY A;  2YUB A;  3DJA A;  3QO6 A;  3VQF A;  1MFG A;  3R68 A;  2LC6 A;  3DIW A;  1UEW A;  4K6Y A;  1UFX A;  1P1E A;  1X8S A;  1RY4 A;  2ZPM A;  2QBW A;  3STJ A;  1TP5 A;  3O46 A;  5H3J A;  2ENO A;  5HEB A;  2DAZ A;  2M0Z A;  4NMV A;  1I16 A;  1WF7 A;  2OS6 A;  2OMJ A;  3K1R A;  3K82 A;  4KFW A;  4AMH A;  2R3Y A;  3I1E A;  1I92 A;  1TE0 A;  1UEZ A;  5E22 A;  1UJD A;  1V5Q A;  3CS0 A;  3L4F D;  1Z86 A;  3CBX A;  1U37 A;  3QDO A;  2EDP A;  2EEH A;  2EXG A;  4Q6H A;  2IWQ A;  1FC7 A;  5I7Z A;  2PKT A;  2M3M A;  3AXA A;  2AWX A;  4L8N A;  3DJ1 A;  3PV2 A;  2VZ5 A;  2KQF A;  2AWU A;  3GSL A;  1N6E A;  1X5N A;  1UM7 A;  1FCF A;  2EGK A;  2HGA A;  5GLJ A;  1WG6 A;  1OBY A;  3WKL A;  3VQG A;  4K78 A;  1G9O A;  4OEO A;  5A2P A;  1Q7X A;  4NXP A;  4KFV A;  1VJ6 A;  3LNY A;  4K72 A;  2X7Z A;  4PQW A;  1Y7N A;  1QAV B;  1OZI A;  3PDV A;  1NTE A;  2KG2 A;  5FB8 C;  5HF1 A;  2FE5 A;  3I4W A;  4K76 A;  2AWW A;  1UEP A;  2HE2 A;  4RI0 A;  1R6J A;  5ILB A;  2D92 A;  3RL7 A;  2KJK A;  4JOK A;  3KDK A;  2DMZ A;  2JIL A;  5HDY A;  4E34 A;  2VSV A;  2JIK A;  2UZC A;  1BE9 A;  1QLC A;  3PV4 A;  4LMM A;  3SOE A;  5IL9 A;  3KHF A;  1GQ5 A;  2I0I A;  1NF3 C;  2CS5 A; 
#chains in the Genus database with same CATH homology
 5HFD A;  2VPH A;  4Q2P A;  1N99 A;  2I6V A;  4OEP A;  2KJP A;  4REY A;  1VCW A;  1PDR A;  1Q3P A;  2OCS A;  4FLN A;  1M5Z A;  2DM8 A;  5D13 A;  2FCF A;  1W9E A;  1K32 A;  2V90 A;  4NXQ A;  5HF4 A;  2DKR A;  2Z17 A;  3CYY A;  2QKU A;  4YDP A;  3PDZ A;  3NFL A;  3O5N A;  1SOT A;  5EYZ A;  2EDZ A;  2G5M B;  5G1E A;  4Q6S A;  2JIN A;  2PNT A;  1V5L A;  5E11 A;  2DLS A;  1VA8 A;  2E7K A;  3HVQ C;  5HFC A;  2GZV A;  1W9Q A;  2HE4 A;  1WI2 A;  5G1D A;  4F8K A;  1WJL A;  3RLE A;  3MH4 A;  3KZE A;  2QG1 A;  2CSS A;  3NFK A;  1WHA A;  1N6D A;  2EEI A;  2EAQ A;  1B8Q A;  1ZUB A;  3QJM A;  2VRF A;  2EDV A;  4Q2N A;  1T2M A;  4WYT A;  1L6O A;  2OPG A;  3RL8 A;  2VWR A;  2KA9 A;  1UJV A;  2L4S A;  2YTW A;  2K1Z A;  3WKM A;  2KJD A;  1V6B A;  3B76 A;  5B42 A;  1QAV A;  2M10 A;  2ZPL A;  5E21 A;  3SUZ A;  1UF1 A;  3CH8 A;  1TQ3 A;  2LOB A;  3PS4 A;  3SFJ A;  3R69 A;  2WL7 A;  2KOH A;  3JXT A;  2QKT A;  2G2L A;  2L4T A;  5HFF A;  2I4S A;  1X9Z A;  4Q3H A;  2OZF A;  2QT5 A;  2KBS A;  1RGW A;  4HOP B;  4Q2Q A;  4UU5 A;  4NMO A;  4NMS A;  1ZOK A;  3K50 A;  2OSG A;  3GDV A;  4MPA A;  2REY A;  2OQS A;  5HED A;  2EGO A;  3ID3 A;  1V1T A;  2F5Y A;  1WI4 A;  2YT8 A;  2I04 A;  2MX6 A;  4Z8J A;  1N7E A;  1Z87 A;  2VSP A;  2I1N A;  3KZD A;  4JOG A;  2EGN A;  3SHW A;  2PDZ A;  2KPK A;  1BFE A;  1XZ9 A;  2F0A A;  3E17 A;  1RGR A;  2KRG A;  4JOP A;  5HET A;  2FNE A;  3FY5 A;  1WIF A;  2Q9V A;  1UEQ A;  3ID1 A;  3OU0 A;  3EGH C;  3NCV A;  1GQ4 A;  1X5R A;  2JXO A;  2I0L A;  2LC7 A;  5E1Y A;  5FHT A;  1UIT A;  2K20 A;  1UHP A;  5HFB A;  2D90 A;  4JL7 A;  1OBX A;  4XHV A;  4UU6 A;  2L97 A;  3GCO A;  2LUI A;  3ZRT A;  1MC7 A;  3CBZ A;  2CSJ A;  2Q3G A;  4NMT A;  1WH1 A;  2KL1 A;  2IWP A;  1KY9 A;  1N6F A;  2M0U A;  1WF8 A;  4Z33 A;  2P3W A;  2IWN A;  2PA1 A;  4JOJ A;  3SHU A;  4JOH A;  5GND A;  4O06 A;  4JJ0 A;  1KEF A;  5F3X A;  3QIK A;  4NMP A;  4N6X A;  4P0C A;  3ID4 A;  2H2B A;  4K75 A;  4NMQ A;  3DOR A;  5HJ1 A;  4NNL A;  2DC2 A;  5DTH A;  1RZX A;  3CC0 A;  4NMR A;  2KPL A;  4JOR A;  3QGL A;  3BPU A;  2DLU A;  4HOP A;  3PV5 A;  2M0V A;  1GM1 A;  2IWO A;  2GEF A;  4JOF A;  1FC9 A;  2YUY A;  3TSV A;  2KYL A;  2H3M A;  1V62 A;  3OTP A;  4YYX A;  3TSW A;  1N7F A;  5B6L A;  4G69 A;  2RRM A;  5E6P B;  2JOA A;  3HPM A;  3GGE A;  5HFE A;  1WHD A;  2Z9I A;  4JJ3 A;  2KOM A;  2QKV A;  3R0H A;  4EDJ A;  1TP3 A;  1WFG A;  5HEY A;  2PKU A;  3CBY A;  2DJT A;  2M0T A;  3ID2 A;  3MH7 A;  1YBO A;  1U39 A;  5JXB A;  1U38 A;  2OGP A;  3LNX A;  1OBZ A;  1MFL A;  2JWE A;  2RCZ A;  4IC6 A;  1FC6 A;  1Y8T A;  4OAJ A;  3MH6 A;  1VAE A;  3GCN A;  3NGH A;  3TMH A;  2LA8 A;  2BYG A;  2FN5 A;  4NNM A;  4JOE A;  1LCY A;  4NXR A;  1D5G A;  1QAU A;  2JRE A;  3GJ9 A;  1P1D A;  1U3B A;  1VB7 A;  2EV8 A;  1IU2 A;  3EGG C;  4GVC A;  2W7R A;  3GAB A;  3QJN A;  2H3L A;  3KDG A;  5EZ0 A;  4WYU A;  1UM1 A;  2EEJ A;  1X5Q A;  1KWA A;  2JSN A;  1UJU A;  2O2T A;  1Q3O A;  4R2Z A;  3I18 A;  2V1W A;  2EHR A;  2MHO A;  2PZD A;  3DJ3 A;  2H2C A;  3GDS A;  4GHN A;  2AIN A;  4GVD A;  4P2A B;  4H11 A;  2DB5 A;  1SOZ A;  1X45 A;  4E35 A;  1W9O A;  5F67 A;  2D8I A;  2W4F A;  3TSZ A;  3GDU A;  1N7T A;  1IU0 A;  4Q2O A;  2KV8 A;  2KAW A;  2EEG A;  1IHJ A;  2YT7 A;  1WFV A;  3HPK A;  3QE1 A;  4FGM A;  2R4H A;  1X6D A;  4E3B A;  2KOJ A;  2EJY A;  2YUB A;  3DJA A;  3QO6 A;  3VQF A;  1MFG A;  3R68 A;  2LC6 A;  3DIW A;  1UEW A;  4K6Y A;  1UFX A;  1P1E A;  1X8S A;  1RY4 A;  2ZPM A;  2QBW A;  3STJ A;  1TP5 A;  3O46 A;  5H3J A;  2ENO A;  5HEB A;  2DAZ A;  2M0Z A;  4NMV A;  1I16 A;  1WF7 A;  2OS6 A;  2OMJ A;  3K1R A;  3K82 A;  4KFW A;  4AMH A;  2R3Y A;  3I1E A;  1I92 A;  1TE0 A;  1UEZ A;  5E22 A;  1UJD A;  1V5Q A;  3CS0 A;  3L4F D;  1Z86 A;  3CBX A;  1U37 A;  3QDO A;  2EDP A;  2EEH A;  2EXG A;  4Q6H A;  2IWQ A;  1FC7 A;  5I7Z A;  2PKT A;  2M3M A;  3AXA A;  2AWX A;  4L8N A;  3DJ1 A;  3PV2 A;  2VZ5 A;  2KQF A;  2AWU A;  3GSL A;  1N6E A;  1X5N A;  1UM7 A;  1FCF A;  2EGK A;  2HGA A;  5GLJ A;  1WG6 A;  1OBY A;  3WKL A;  3VQG A;  4K78 A;  1G9O A;  4OEO A;  5A2P A;  1Q7X A;  4NXP A;  4KFV A;  1VJ6 A;  3LNY A;  4K72 A;  2X7Z A;  4PQW A;  1Y7N A;  1QAV B;  1OZI A;  3PDV A;  1NTE A;  2KG2 A;  5FB8 C;  5HF1 A;  2FE5 A;  3I4W A;  4K76 A;  2AWW A;  1UEP A;  2HE2 A;  4RI0 A;  1R6J A;  5ILB A;  2D92 A;  3RL7 A;  2KJK A;  4JOK A;  3KDK A;  2DMZ A;  2JIL A;  5HDY A;  4E34 A;  2VSV A;  2JIK A;  2UZC A;  1BE9 A;  1QLC A;  3PV4 A;  4LMM A;  3SOE A;  5IL9 A;  3KHF A;  1GQ5 A;  2I0I A;  1NF3 C;  2CS5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...