2PKUA

Solution structure of pick1 pdz in complex with the carboxyl tail peptide of glur2
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
87
structure length
87
Chain Sequence
TVPGKVTLQKDAQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PRKCA-binding protein
publication title Clustering and synaptic targeting of PICK1 requires direct interaction between the PDZ domain and lipid membranes
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Protein binding
total genus 10
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2007-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 2pkuA00
2MHOA 4N6XA 2M0TA 4IC6A 5HFDA 1M5ZA 2HE4A 1YBOA 1KWAA 1TE0A 1X5NA 5E6PB 2KOJA 4O06A 2K20A 5GLJA 1UM1A 2M0UA 3DJ3A 1R6JA 1MFLA 2AWUA 4Q6HA 1ZUBA 3VQFA 1FC9A 3TSZA 2F0AA 3HVQC 2LC7A 2D92A 2Q9VA 1P1DA 2X7ZA 3QJMA 5H3JA 4NMRA 1BFEA 3SFJA 4Q2NA 3OTPA 3VQGA 3GCNA 5E1YA 1UEZA 3SHUA 2JWEA 1D5GA 2KRGA 5A2PA 1WI4A 1UHPA 5EYZA 5I7ZA 1UEPA 1TP3A 2QG1A 2LC6A 4JOGA 5HF1A 1SOTA 1VB7A 2KJKA 4NNLA 2QT5A 3SHWA 2M0VA 4JORA 5HF4A 1Q3PA 5HEBA 4OEOA 2KQFA 1B8QA 3ID3A 4OEPA 2LOBA 3TSWA 3QDOA 1W9QA 1UEQA 2ENOA 3HPKA 1WFVA 2HGAA 4WYTA 2R4HA 5B6LA 2EDPA 4NMQA 1WG6A 2KBSA 4NNMA 3CC0A 1N7EA 2RRMA 2KA9A 1N99A 2O2TA 2M10A 2KG2A 1U37A 1Z87A 1NTEA 3O5NA 5JXBA 3NGHA 1KY9A 2CS5A 4YYXA 2LUIA 3ID2A 4JL7A 2H2BA 2VSPA 4NXQA 2OS6A 1K32A 5EZ0A 4JOHA 1OBYA 2IWNA 3WKLA 2F5YA 1OBXA 3PV2A 1QLCA 2K1ZA 2M0ZA 2VZ5A 2AINA 1I16A 4Z8JA 2EEHA 3DJ1A 3PV4A 1TQ3A 3CBXA 3GDVA 2Q3GA 2EJYA 2E7KA 5HJ1A 1QAVB 2KL1A 3I4WA 2JILA 1OBZA 1N7FA 2AWXA 3R0HA 1N6FA 1NF3C 4E3BA 5F67A 3STJA 1RGWA 3DIWA 3KHFA 2KAWA 2DM8A 1N7TA 5E11A 2H3MA 1W9EA 3WKMA 1RY4A 3O46A 2DJTA 2YT7A 3KZEA 1Z86A 2DB5A 3K1RA 1I92A 2JXOA 1LCYA 3GJ9A 4LMMA 4NMOA 2L4TA 1N6EA 4GHNA 2CSSA 2EDVA 1U3BA 3BPUA 1Q7XA 3SOEA 2KOMA 3K50A 4F8KA 4NMPA 2EGNA 3GDUA 4YDPA 2KV8A 1UJUA 4JOPA 4UU5A 2G5MB 2DLUA 1ZOKA 4JOEA 3NFLA 2R3YA 3ID1A 1QAUA 1RGRA 2UZCA 1MFGA 3DJAA 1UITA 4L8NA 4Q2OA 4HOPA 5FB8C 1FCFA 3PDZA 2VSVA 4K72A 5E21A 2P3WA 5GNDA 1WF7A 2FE5A 2YTWA 4P0CA 2M3MA 3EGGC 4JOKA 2KJPA 3QIKA 1IU2A 1T2MA 4E35A 1TP5A 2OCSA 3TSVA 4KFVA 1WHDA 3ZRTA 3SUZA 4G69A 1P1EA 1FC7A 4P2AB 3RL7A 2EEJA 2H3LA 1X8SA 4FGMA 2EEGA 4GVDA 2I04A 2EEIA 3RL8A 2JREA 4E34A 2PNTA 1WI2A 1UEWA 1Y8TA 1V6BA 1UJDA 2EDZA 3I18A 4K6YA 1X45A 4K76A 2W7RA 2DLSA 2KJDA 1V5QA 2ZPLA 2JINA 5HFBA 3LNXA 1WH1A 2RCZA 2D8IA 2ZPMA 2YT8A 4GVCA 3EGHC 2VPHA 4Z33A 2G2LA 1UF1A 3HPMA 2KOHA 2WL7A 2PKTA 2PZDA 3PV5A 2VWRA 3PDVA 2EHRA 3MH4A 1V1TA 3QO6A 2OQSA 1UJVA 2EAQA 2H2CA 2EV8A 2EGOA 1MC7A 2FCFA 2MX6A 1V5LA 4AMHA 4OAJA 1Y7NA 2I4SA 3QE1A 3QJNA 1SOZA 1XZ9A 4UU6A 2KYLA 1GM1A 1WJLA 4WYUA 4JOJA 2QKVA 3ID4A 3OU0A 1BE9A 1RZXA 2I6VA 3CH8A 2L4SA 1V62A 2OPGA 2DKRA 1PDRA 4NMTA 2W4FA 5E22A 4NXRA 5F3XA 5FHTA 4K75A 5G1EA 4REYA 3MH7A 3K82A 2IWOA 1IHJA 1KEFA 4NMSA 2D90A 5D13A 3R68A 3GDSA 5HFEA 3CS0A 2IWPA 2KPLA 4PQWA 3JXTA 2EGKA 4KFWA 2PDZA 2L97A 5DTHA 1X5QA 1U38A 2YUYA 2V1WA 3TMHA 1U39A 3I1EA 1GQ4A 1FC6A 2OMJA 2AWWA 4H11A 1VA8A 2OGPA 2V90A 2Z17A 3B76A 3NFKA 1X6DA 2EXGA 5HEDA 1N6DA 3CBYA 1GQ5A 4Q3HA 2PA1A 3L4FD 2IWQA 3RLEA 2JOAA 2KPKA 5HFCA 4RI0A 2REYA 2CSJA 4EDJA 5HEYA 1QAVA 2DMZA 1L6OA 2OSGA 2I0LA 4NXPA 2QBWA 3R69A 1G9OA 4Q6SA 4K78A 1WHAA 2LA8A 1WFGA 3FY5A 2I1NA 2FN5A 1UFXA 1VCWA 4HOPB 3CYYA 2JIKA 2Z9IA 1VAEA 4MPAA 2PKUA 3DORA 4Q2QA 2QKUA 4NMVA 1UM7A 2FNEA 4R2ZA 3QGLA 1WF8A 2BYGA 3KZDA 1OZIA 2DAZA 5G1DA 4XHVA 1W9OA 3LNYA 2OZFA 1VJ6A 2I0IA 1IU0A 3PS4A 4Q2PA 1Q3OA 4JOFA 3GSLA 2GZVA 2HE2A 1X5RA 5HFFA 3AXAA 2QKTA 5HETA 3E17A 3CBZA 2VRFA 3GCOA 3GGEA 1WIFA 2YUBA 5HDYA 2DC2A 3MH6A
chains in the Genus database with same CATH superfamily
2MHOA 4N6XA 2M0TA 4IC6A 5HFDA 1M5ZA 2HE4A 1YBOA 1KWAA 1TE0A 1X5NA 5E6PB 2KOJA 4O06A 2K20A 5GLJA 1UM1A 2M0UA 3DJ3A 1R6JA 1MFLA 2AWUA 4Q6HA 1ZUBA 3VQFA 1FC9A 3TSZA 2F0AA 3HVQC 2LC7A 2D92A 2Q9VA 1P1DA 2X7ZA 3QJMA 5H3JA 4NMRA 1BFEA 3SFJA 4Q2NA 3OTPA 3VQGA 3GCNA 5E1YA 1UEZA 3SHUA 2JWEA 1D5GA 1X9ZA 2KRGA 5A2PA 1WI4A 1UHPA 5EYZA 5I7ZA 1UEPA 1TP3A 2QG1A 2LC6A 4JOGA 5HF1A 1SOTA 1VB7A 2KJKA 4NNLA 2QT5A 3SHWA 2M0VA 4JORA 5HF4A 1Q3PA 5HEBA 4OEOA 2KQFA 1B8QA 3ID3A 4OEPA 2LOBA 3TSWA 3QDOA 1W9QA 1UEQA 2ENOA 3HPKA 5IL9A 1WFVA 2HGAA 4WYTA 2R4HA 5B6LA 2EDPA 4NMQA 1WG6A 2KBSA 4NNMA 3CC0A 4FLNA 5B42A 1N7EA 2RRMA 2KA9A 1N99A 2O2TA 2M10A 2KG2A 1U37A 1Z87A 1NTEA 3O5NA 5JXBA 3NGHA 1KY9A 2CS5A 4YYXA 2LUIA 3ID2A 4JL7A 2H2BA 2VSPA 4NXQA 2OS6A 1K32A 5EZ0A 4JOHA 1OBYA 2IWNA 3WKLA 2F5YA 1OBXA 3PV2A 1QLCA 2K1ZA 2M0ZA 2VZ5A 2AINA 1I16A 4Z8JA 2EEHA 3DJ1A 3PV4A 1TQ3A 3CBXA 3GDVA 2Q3GA 2EJYA 2E7KA 5HJ1A 1QAVB 2KL1A 3I4WA 2JILA 1OBZA 1N7FA 2AWXA 3R0HA 1N6FA 1NF3C 4E3BA 5F67A 3STJA 1RGWA 3DIWA 3KHFA 2KAWA 2DM8A 1N7TA 5E11A 2H3MA 1W9EA 3WKMA 1RY4A 3O46A 2DJTA 2YT7A 3KZEA 1Z86A 2DB5A 3K1RA 1I92A 2JXOA 1LCYA 3GJ9A 4LMMA 4NMOA 2L4TA 1N6EA 4GHNA 2CSSA 2EDVA 1U3BA 3BPUA 1Q7XA 3SOEA 2KOMA 3K50A 4F8KA 4NMPA 2EGNA 3GDUA 4YDPA 2KV8A 1UJUA 4JJ0A 4JOPA 4UU5A 2G5MB 2DLUA 1ZOKA 4JOEA 3NFLA 2R3YA 3ID1A 1QAUA 1RGRA 3GABA 2UZCA 1MFGA 3DJAA 1UITA 4L8NA 4Q2OA 4HOPA 5FB8C 1FCFA 3PDZA 2VSVA 4K72A 5E21A 2P3WA 5GNDA 1WF7A 2FE5A 2YTWA 4P0CA 2M3MA 3EGGC 4JOKA 2KJPA 3QIKA 1IU2A 1T2MA 4E35A 1TP5A 2OCSA 3TSVA 4KFVA 1WHDA 3ZRTA 3SUZA 4G69A 1P1EA 1FC7A 4P2AB 3RL7A 2EEJA 2H3LA 1X8SA 4FGMA 2EEGA 4GVDA 2I04A 2EEIA 3RL8A 2JREA 4E34A 2PNTA 1WI2A 1UEWA 1Y8TA 1V6BA 1UJDA 2EDZA 3I18A 4K6YA 1X45A 4K76A 2W7RA 2DLSA 2KJDA 1V5QA 2ZPLA 2JINA 5HFBA 3LNXA 1WH1A 2RCZA 2D8IA 2ZPMA 2YT8A 4GVCA 3EGHC 2VPHA 4Z33A 2G2LA 1UF1A 3HPMA 4JJ3A 2KOHA 2WL7A 2PKTA 2PZDA 3PV5A 2VWRA 3PDVA 2EHRA 3MH4A 5ILBA 1V1TA 3QO6A 2OQSA 1UJVA 2EAQA 2H2CA 2EV8A 2EGOA 1MC7A 2FCFA 2MX6A 1V5LA 4AMHA 4OAJA 1Y7NA 2I4SA 3QE1A 3QJNA 1SOZA 1XZ9A 4UU6A 2KYLA 1GM1A 1WJLA 4WYUA 4JOJA 2QKVA 3ID4A 3OU0A 1BE9A 1RZXA 2I6VA 3CH8A 2L4SA 1V62A 2OPGA 2DKRA 1PDRA 4NMTA 2W4FA 5E22A 4NXRA 5F3XA 5FHTA 4K75A 5G1EA 4REYA 3MH7A 3K82A 2IWOA 1IHJA 1KEFA 4NMSA 2D90A 5D13A 3R68A 2GEFA 3GDSA 5HFEA 3CS0A 2IWPA 2KPLA 4PQWA 3KDGA 3JXTA 2EGKA 4KFWA 2PDZA 2L97A 5DTHA 1X5QA 1U38A 2YUYA 2V1WA 3TMHA 1U39A 3I1EA 1GQ4A 1FC6A 2OMJA 2AWWA 4H11A 1VA8A 2OGPA 2V90A 2Z17A 3B76A 3NFKA 1X6DA 2EXGA 5HEDA 1N6DA 3CBYA 1GQ5A 4Q3HA 2PA1A 3L4FD 2IWQA 3RLEA 2JOAA 2KPKA 5HFCA 4RI0A 2REYA 2CSJA 4EDJA 5HEYA 1QAVA 2DMZA 1L6OA 2OSGA 2I0LA 4NXPA 2QBWA 3R69A 1G9OA 4Q6SA 4K78A 1WHAA 2LA8A 1WFGA 3FY5A 2I1NA 2FN5A 1UFXA 1VCWA 4HOPB 3CYYA 2JIKA 2Z9IA 1VAEA 4MPAA 2PKUA 3DORA 4Q2QA 2QKUA 4NMVA 1UM7A 2FNEA 4R2ZA 3QGLA 1WF8A 2BYGA 3KZDA 1OZIA 2DAZA 5G1DA 4XHVA 1W9OA 3LNYA 2OZFA 1VJ6A 2I0IA 1IU0A 3PS4A 3NCVA 4Q2PA 1Q3OA 3KDKA 4JOFA 3GSLA 2GZVA 2HE2A 1X5RA 5HFFA 3AXAA 2QKTA 5HETA 3E17A 3CBZA 2VRFA 2JSNA 3GCOA 1WIFA 3GGEA 2YUBA 5HDYA 2DC2A 3MH6A
chains in the Genus database with same CATH topology
2MHOA 4N6XA 2M0TA 4IC6A 5HFDA 1M5ZA 2HE4A 1YBOA 1KWAA 1TE0A 1X5NA 5E6PB 2KOJA 4O06A 2K20A 5GLJA 1UM1A 2M0UA 3DJ3A 1R6JA 1MFLA 2AWUA 4Q6HA 1ZUBA 3VQFA 1FC9A 3TSZA 2F0AA 3HVQC 2LC7A 2D92A 2Q9VA 1P1DA 2X7ZA 3QJMA 5H3JA 4NMRA 1BFEA 3SFJA 4Q2NA 3OTPA 3VQGA 3GCNA 5E1YA 1UEZA 3SHUA 2JWEA 1D5GA 1X9ZA 2KRGA 5A2PA 1WI4A 1UHPA 5EYZA 5I7ZA 1UEPA 1TP3A 2QG1A 2LC6A 4JOGA 5HF1A 1SOTA 1VB7A 2KJKA 4NNLA 2QT5A 3SHWA 2M0VA 4JORA 5HF4A 1Q3PA 5HEBA 4OEOA 2KQFA 1B8QA 3ID3A 4OEPA 2LOBA 3TSWA 3QDOA 1W9QA 1UEQA 2ENOA 3HPKA 5IL9A 1WFVA 2HGAA 4WYTA 2R4HA 5B6LA 2EDPA 4NMQA 1WG6A 2KBSA 4NNMA 3CC0A 4FLNA 5B42A 1N7EA 2RRMA 2KA9A 1N99A 2O2TA 2M10A 2KG2A 1U37A 1Z87A 1NTEA 3O5NA 5JXBA 3NGHA 1KY9A 2CS5A 4YYXA 2LUIA 3ID2A 4JL7A 2H2BA 2VSPA 4NXQA 2OS6A 1K32A 5EZ0A 4JOHA 1OBYA 2IWNA 3WKLA 2F5YA 1OBXA 3PV2A 1QLCA 2K1ZA 2M0ZA 2VZ5A 2AINA 1I16A 4Z8JA 2EEHA 3DJ1A 3PV4A 1TQ3A 3CBXA 3GDVA 2Q3GA 2EJYA 2E7KA 5HJ1A 1QAVB 2KL1A 3I4WA 2JILA 1OBZA 1N7FA 2AWXA 3R0HA 1N6FA 1NF3C 4E3BA 5F67A 3STJA 1RGWA 3DIWA 3KHFA 2KAWA 2DM8A 1N7TA 5E11A 2H3MA 1W9EA 3WKMA 1RY4A 3O46A 2DJTA 2YT7A 3KZEA 1Z86A 2DB5A 3K1RA 1I92A 2JXOA 1LCYA 3GJ9A 4LMMA 4NMOA 2L4TA 1N6EA 4GHNA 2CSSA 2EDVA 1U3BA 3BPUA 1Q7XA 3SOEA 2KOMA 3K50A 4F8KA 4NMPA 2EGNA 3GDUA 4YDPA 2KV8A 1UJUA 4JJ0A 4JOPA 4UU5A 2G5MB 2DLUA 1ZOKA 4JOEA 3NFLA 2R3YA 3ID1A 1QAUA 1RGRA 3GABA 2UZCA 1MFGA 3DJAA 1UITA 4L8NA 4Q2OA 4HOPA 5FB8C 1FCFA 3PDZA 2VSVA 4K72A 5E21A 2P3WA 5GNDA 1WF7A 2FE5A 2YTWA 4P0CA 2M3MA 3EGGC 4JOKA 2KJPA 3QIKA 1IU2A 1T2MA 4E35A 1TP5A 2OCSA 3TSVA 4KFVA 1WHDA 3ZRTA 3SUZA 4G69A 1P1EA 1FC7A 4P2AB 3RL7A 2EEJA 2H3LA 1X8SA 4FGMA 2EEGA 4GVDA 2I04A 2EEIA 3RL8A 2JREA 4E34A 2PNTA 1WI2A 1UEWA 1Y8TA 1V6BA 1UJDA 2EDZA 3I18A 4K6YA 1X45A 4K76A 2W7RA 2DLSA 2KJDA 1V5QA 2ZPLA 2JINA 5HFBA 3LNXA 1WH1A 2RCZA 2D8IA 2ZPMA 2YT8A 4GVCA 3EGHC 2VPHA 4Z33A 2G2LA 1UF1A 3HPMA 4JJ3A 2KOHA 2WL7A 2PKTA 2PZDA 3PV5A 2VWRA 3PDVA 2EHRA 3MH4A 5ILBA 1V1TA 3QO6A 2OQSA 1UJVA 2EAQA 2H2CA 2EV8A 2EGOA 1MC7A 2FCFA 2MX6A 1V5LA 4AMHA 4OAJA 1Y7NA 2I4SA 3QE1A 3QJNA 1SOZA 1XZ9A 4UU6A 2KYLA 1GM1A 1WJLA 4WYUA 4JOJA 2QKVA 3ID4A 3OU0A 1BE9A 1RZXA 2I6VA 3CH8A 2L4SA 1V62A 2OPGA 2DKRA 1PDRA 4NMTA 2W4FA 5E22A 4NXRA 5F3XA 5FHTA 4K75A 5G1EA 4REYA 3MH7A 3K82A 2IWOA 1IHJA 1KEFA 4NMSA 2D90A 5D13A 3R68A 2GEFA 3GDSA 5HFEA 3CS0A 2IWPA 2KPLA 4PQWA 3KDGA 3JXTA 2EGKA 4KFWA 2PDZA 2L97A 5DTHA 1X5QA 1U38A 2YUYA 2V1WA 3TMHA 1U39A 3I1EA 1GQ4A 1FC6A 2OMJA 2AWWA 4H11A 1VA8A 2OGPA 2V90A 2Z17A 3B76A 3NFKA 1X6DA 2EXGA 5HEDA 1N6DA 3CBYA 1GQ5A 4Q3HA 2PA1A 3L4FD 2IWQA 3RLEA 2JOAA 2KPKA 5HFCA 4RI0A 2REYA 2CSJA 4EDJA 5HEYA 1QAVA 2DMZA 1L6OA 2OSGA 2I0LA 4NXPA 2QBWA 3R69A 1G9OA 4Q6SA 4K78A 1WHAA 2LA8A 1WFGA 3FY5A 2I1NA 2FN5A 1UFXA 1VCWA 4HOPB 3CYYA 2JIKA 2Z9IA 1VAEA 4MPAA 2PKUA 3DORA 4Q2QA 2QKUA 4NMVA 1UM7A 2FNEA 4R2ZA 3QGLA 1WF8A 2BYGA 3KZDA 1OZIA 2DAZA 5G1DA 4XHVA 1W9OA 3LNYA 2OZFA 1VJ6A 2I0IA 1IU0A 3PS4A 3NCVA 4Q2PA 1Q3OA 3KDKA 4JOFA 3GSLA 2GZVA 2HE2A 1X5RA 5HFFA 3AXAA 2QKTA 5HETA 3E17A 3CBZA 2VRFA 2JSNA 3GCOA 1WIFA 3GGEA 2YUBA 5HDYA 2DC2A 3MH6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MHO A;  4N6X A;  2M0T A;  4IC6 A;  5HFD A;  1M5Z A;  2HE4 A;  1YBO A;  1KWA A;  1TE0 A;  1X5N A;  5E6P B;  2KOJ A;  4O06 A;  2K20 A;  5GLJ A;  1UM1 A;  2M0U A;  3DJ3 A;  1R6J A;  1MFL A;  2AWU A;  4Q6H A;  1ZUB A;  3VQF A;  1FC9 A;  3TSZ A;  2F0A A;  3HVQ C;  2LC7 A;  2D92 A;  2Q9V A;  1P1D A;  2X7Z A;  3QJM A;  5H3J A;  4NMR A;  1BFE A;  3SFJ A;  4Q2N A;  3OTP A;  3VQG A;  3GCN A;  5E1Y A;  1UEZ A;  3SHU A;  2JWE A;  1D5G A;  2KRG A;  5A2P A;  1WI4 A;  1UHP A;  5EYZ A;  5I7Z A;  1UEP A;  1TP3 A;  2QG1 A;  2LC6 A;  4JOG A;  5HF1 A;  1SOT A;  1VB7 A;  2KJK A;  4NNL A;  2QT5 A;  3SHW A;  2M0V A;  4JOR A;  5HF4 A;  1Q3P A;  5HEB A;  4OEO A;  2KQF A;  1B8Q A;  3ID3 A;  4OEP A;  2LOB A;  3TSW A;  3QDO A;  1W9Q A;  1UEQ A;  2ENO A;  3HPK A;  1WFV A;  2HGA A;  4WYT A;  2R4H A;  5B6L A;  2EDP A;  4NMQ A;  1WG6 A;  2KBS A;  4NNM A;  3CC0 A;  1N7E A;  2RRM A;  2KA9 A;  1N99 A;  2O2T A;  2M10 A;  2KG2 A;  1U37 A;  1Z87 A;  1NTE A;  3O5N A;  5JXB A;  3NGH A;  1KY9 A;  2CS5 A;  4YYX A;  2LUI A;  3ID2 A;  4JL7 A;  2H2B A;  2VSP A;  4NXQ A;  2OS6 A;  1K32 A;  5EZ0 A;  4JOH A;  1OBY A;  2IWN A;  3WKL A;  2F5Y A;  1OBX A;  3PV2 A;  1QLC A;  2K1Z A;  2M0Z A;  2VZ5 A;  2AIN A;  1I16 A;  4Z8J A;  2EEH A;  3DJ1 A;  3PV4 A;  1TQ3 A;  3CBX A;  3GDV A;  2Q3G A;  2EJY A;  2E7K A;  5HJ1 A;  1QAV B;  2KL1 A;  3I4W A;  2JIL A;  1OBZ A;  1N7F A;  2AWX A;  3R0H A;  1N6F A;  1NF3 C;  4E3B A;  5F67 A;  3STJ A;  1RGW A;  3DIW A;  3KHF A;  2KAW A;  2DM8 A;  1N7T A;  5E11 A;  2H3M A;  1W9E A;  3WKM A;  1RY4 A;  3O46 A;  2DJT A;  2YT7 A;  3KZE A;  1Z86 A;  2DB5 A;  3K1R A;  1I92 A;  2JXO A;  1LCY A;  3GJ9 A;  4LMM A;  4NMO A;  2L4T A;  1N6E A;  4GHN A;  2CSS A;  2EDV A;  1U3B A;  3BPU A;  1Q7X A;  3SOE A;  2KOM A;  3K50 A;  4F8K A;  4NMP A;  2EGN A;  3GDU A;  4YDP A;  2KV8 A;  1UJU A;  4JOP A;  4UU5 A;  2G5M B;  2DLU A;  1ZOK A;  4JOE A;  3NFL A;  2R3Y A;  3ID1 A;  1QAU A;  1RGR A;  2UZC A;  1MFG A;  3DJA A;  1UIT A;  4L8N A;  4Q2O A;  4HOP A;  5FB8 C;  1FCF A;  3PDZ A;  2VSV A;  4K72 A;  5E21 A;  2P3W A;  5GND A;  1WF7 A;  2FE5 A;  2YTW A;  4P0C A;  2M3M A;  3EGG C;  4JOK A;  2KJP A;  3QIK A;  1IU2 A;  1T2M A;  4E35 A;  1TP5 A;  2OCS A;  3TSV A;  4KFV A;  1WHD A;  3ZRT A;  3SUZ A;  4G69 A;  1P1E A;  1FC7 A;  4P2A B;  3RL7 A;  2EEJ A;  2H3L A;  1X8S A;  4FGM A;  2EEG A;  4GVD A;  2I04 A;  2EEI A;  3RL8 A;  2JRE A;  4E34 A;  2PNT A;  1WI2 A;  1UEW A;  1Y8T A;  1V6B A;  1UJD A;  2EDZ A;  3I18 A;  4K6Y A;  1X45 A;  4K76 A;  2W7R A;  2DLS A;  2KJD A;  1V5Q A;  2ZPL A;  2JIN A;  5HFB A;  3LNX A;  1WH1 A;  2RCZ A;  2D8I A;  2ZPM A;  2YT8 A;  4GVC A;  3EGH C;  2VPH A;  4Z33 A;  2G2L A;  1UF1 A;  3HPM A;  2KOH A;  2WL7 A;  2PKT A;  2PZD A;  3PV5 A;  2VWR A;  3PDV A;  2EHR A;  3MH4 A;  1V1T A;  3QO6 A;  2OQS A;  1UJV A;  2EAQ A;  2H2C A;  2EV8 A;  2EGO A;  1MC7 A;  2FCF A;  2MX6 A;  1V5L A;  4AMH A;  4OAJ A;  1Y7N A;  2I4S A;  3QE1 A;  3QJN A;  1SOZ A;  1XZ9 A;  4UU6 A;  2KYL A;  1GM1 A;  1WJL A;  4WYU A;  4JOJ A;  2QKV A;  3ID4 A;  3OU0 A;  1BE9 A;  1RZX A;  2I6V A;  3CH8 A;  2L4S A;  1V62 A;  2OPG A;  2DKR A;  1PDR A;  4NMT A;  2W4F A;  5E22 A;  4NXR A;  5F3X A;  5FHT A;  4K75 A;  5G1E A;  4REY A;  3MH7 A;  3K82 A;  2IWO A;  1IHJ A;  1KEF A;  4NMS A;  2D90 A;  5D13 A;  3R68 A;  3GDS A;  5HFE A;  3CS0 A;  2IWP A;  2KPL A;  4PQW A;  3JXT A;  2EGK A;  4KFW A;  2PDZ A;  2L97 A;  5DTH A;  1X5Q A;  1U38 A;  2YUY A;  2V1W A;  3TMH A;  1U39 A;  3I1E A;  1GQ4 A;  1FC6 A;  2OMJ A;  2AWW A;  4H11 A;  1VA8 A;  2OGP A;  2V90 A;  2Z17 A;  3B76 A;  3NFK A;  1X6D A;  2EXG A;  5HED A;  1N6D A;  3CBY A;  1GQ5 A;  4Q3H A;  2PA1 A;  3L4F D;  2IWQ A;  3RLE A;  2JOA A;  2KPK A;  5HFC A;  4RI0 A;  2REY A;  2CSJ A;  4EDJ A;  5HEY A;  1QAV A;  2DMZ A;  1L6O A;  2OSG A;  2I0L A;  4NXP A;  2QBW A;  3R69 A;  1G9O A;  4Q6S A;  4K78 A;  1WHA A;  2LA8 A;  1WFG A;  3FY5 A;  2I1N A;  2FN5 A;  1UFX A;  1VCW A;  4HOP B;  3CYY A;  2JIK A;  2Z9I A;  1VAE A;  4MPA A;  2PKU A;  3DOR A;  4Q2Q A;  2QKU A;  4NMV A;  1UM7 A;  2FNE A;  4R2Z A;  3QGL A;  1WF8 A;  2BYG A;  3KZD A;  1OZI A;  2DAZ A;  5G1D A;  4XHV A;  1W9O A;  3LNY A;  2OZF A;  1VJ6 A;  2I0I A;  1IU0 A;  3PS4 A;  4Q2P A;  1Q3O A;  4JOF A;  3GSL A;  2GZV A;  2HE2 A;  1X5R A;  5HFF A;  3AXA A;  2QKT A;  5HET A;  3E17 A;  3CBZ A;  2VRF A;  3GCO A;  3GGE A;  1WIF A;  2YUB A;  5HDY A;  2DC2 A;  3MH6 A; 
#chains in the Genus database with same CATH topology
 2MHO A;  4N6X A;  2M0T A;  4IC6 A;  5HFD A;  1M5Z A;  2HE4 A;  1YBO A;  1KWA A;  1TE0 A;  1X5N A;  5E6P B;  2KOJ A;  4O06 A;  2K20 A;  5GLJ A;  1UM1 A;  2M0U A;  3DJ3 A;  1R6J A;  1MFL A;  2AWU A;  4Q6H A;  1ZUB A;  3VQF A;  1FC9 A;  3TSZ A;  2F0A A;  3HVQ C;  2LC7 A;  2D92 A;  2Q9V A;  1P1D A;  2X7Z A;  3QJM A;  5H3J A;  4NMR A;  1BFE A;  3SFJ A;  4Q2N A;  3OTP A;  3VQG A;  3GCN A;  5E1Y A;  1UEZ A;  3SHU A;  2JWE A;  1D5G A;  1X9Z A;  2KRG A;  5A2P A;  1WI4 A;  1UHP A;  5EYZ A;  5I7Z A;  1UEP A;  1TP3 A;  2QG1 A;  2LC6 A;  4JOG A;  5HF1 A;  1SOT A;  1VB7 A;  2KJK A;  4NNL A;  2QT5 A;  3SHW A;  2M0V A;  4JOR A;  5HF4 A;  1Q3P A;  5HEB A;  4OEO A;  2KQF A;  1B8Q A;  3ID3 A;  4OEP A;  2LOB A;  3TSW A;  3QDO A;  1W9Q A;  1UEQ A;  2ENO A;  3HPK A;  5IL9 A;  1WFV A;  2HGA A;  4WYT A;  2R4H A;  5B6L A;  2EDP A;  4NMQ A;  1WG6 A;  2KBS A;  4NNM A;  3CC0 A;  4FLN A;  5B42 A;  1N7E A;  2RRM A;  2KA9 A;  1N99 A;  2O2T A;  2M10 A;  2KG2 A;  1U37 A;  1Z87 A;  1NTE A;  3O5N A;  5JXB A;  3NGH A;  1KY9 A;  2CS5 A;  4YYX A;  2LUI A;  3ID2 A;  4JL7 A;  2H2B A;  2VSP A;  4NXQ A;  2OS6 A;  1K32 A;  5EZ0 A;  4JOH A;  1OBY A;  2IWN A;  3WKL A;  2F5Y A;  1OBX A;  3PV2 A;  1QLC A;  2K1Z A;  2M0Z A;  2VZ5 A;  2AIN A;  1I16 A;  4Z8J A;  2EEH A;  3DJ1 A;  3PV4 A;  1TQ3 A;  3CBX A;  3GDV A;  2Q3G A;  2EJY A;  2E7K A;  5HJ1 A;  1QAV B;  2KL1 A;  3I4W A;  2JIL A;  1OBZ A;  1N7F A;  2AWX A;  3R0H A;  1N6F A;  1NF3 C;  4E3B A;  5F67 A;  3STJ A;  1RGW A;  3DIW A;  3KHF A;  2KAW A;  2DM8 A;  1N7T A;  5E11 A;  2H3M A;  1W9E A;  3WKM A;  1RY4 A;  3O46 A;  2DJT A;  2YT7 A;  3KZE A;  1Z86 A;  2DB5 A;  3K1R A;  1I92 A;  2JXO A;  1LCY A;  3GJ9 A;  4LMM A;  4NMO A;  2L4T A;  1N6E A;  4GHN A;  2CSS A;  2EDV A;  1U3B A;  3BPU A;  1Q7X A;  3SOE A;  2KOM A;  3K50 A;  4F8K A;  4NMP A;  2EGN A;  3GDU A;  4YDP A;  2KV8 A;  1UJU A;  4JJ0 A;  4JOP A;  4UU5 A;  2G5M B;  2DLU A;  1ZOK A;  4JOE A;  3NFL A;  2R3Y A;  3ID1 A;  1QAU A;  1RGR A;  3GAB A;  2UZC A;  1MFG A;  3DJA A;  1UIT A;  4L8N A;  4Q2O A;  4HOP A;  5FB8 C;  1FCF A;  3PDZ A;  2VSV A;  4K72 A;  5E21 A;  2P3W A;  5GND A;  1WF7 A;  2FE5 A;  2YTW A;  4P0C A;  2M3M A;  3EGG C;  4JOK A;  2KJP A;  3QIK A;  1IU2 A;  1T2M A;  4E35 A;  1TP5 A;  2OCS A;  3TSV A;  4KFV A;  1WHD A;  3ZRT A;  3SUZ A;  4G69 A;  1P1E A;  1FC7 A;  4P2A B;  3RL7 A;  2EEJ A;  2H3L A;  1X8S A;  4FGM A;  2EEG A;  4GVD A;  2I04 A;  2EEI A;  3RL8 A;  2JRE A;  4E34 A;  2PNT A;  1WI2 A;  1UEW A;  1Y8T A;  1V6B A;  1UJD A;  2EDZ A;  3I18 A;  4K6Y A;  1X45 A;  4K76 A;  2W7R A;  2DLS A;  2KJD A;  1V5Q A;  2ZPL A;  2JIN A;  5HFB A;  3LNX A;  1WH1 A;  2RCZ A;  2D8I A;  2ZPM A;  2YT8 A;  4GVC A;  3EGH C;  2VPH A;  4Z33 A;  2G2L A;  1UF1 A;  3HPM A;  4JJ3 A;  2KOH A;  2WL7 A;  2PKT A;  2PZD A;  3PV5 A;  2VWR A;  3PDV A;  2EHR A;  3MH4 A;  5ILB A;  1V1T A;  3QO6 A;  2OQS A;  1UJV A;  2EAQ A;  2H2C A;  2EV8 A;  2EGO A;  1MC7 A;  2FCF A;  2MX6 A;  1V5L A;  4AMH A;  4OAJ A;  1Y7N A;  2I4S A;  3QE1 A;  3QJN A;  1SOZ A;  1XZ9 A;  4UU6 A;  2KYL A;  1GM1 A;  1WJL A;  4WYU A;  4JOJ A;  2QKV A;  3ID4 A;  3OU0 A;  1BE9 A;  1RZX A;  2I6V A;  3CH8 A;  2L4S A;  1V62 A;  2OPG A;  2DKR A;  1PDR A;  4NMT A;  2W4F A;  5E22 A;  4NXR A;  5F3X A;  5FHT A;  4K75 A;  5G1E A;  4REY A;  3MH7 A;  3K82 A;  2IWO A;  1IHJ A;  1KEF A;  4NMS A;  2D90 A;  5D13 A;  3R68 A;  2GEF A;  3GDS A;  5HFE A;  3CS0 A;  2IWP A;  2KPL A;  4PQW A;  3KDG A;  3JXT A;  2EGK A;  4KFW A;  2PDZ A;  2L97 A;  5DTH A;  1X5Q A;  1U38 A;  2YUY A;  2V1W A;  3TMH A;  1U39 A;  3I1E A;  1GQ4 A;  1FC6 A;  2OMJ A;  2AWW A;  4H11 A;  1VA8 A;  2OGP A;  2V90 A;  2Z17 A;  3B76 A;  3NFK A;  1X6D A;  2EXG A;  5HED A;  1N6D A;  3CBY A;  1GQ5 A;  4Q3H A;  2PA1 A;  3L4F D;  2IWQ A;  3RLE A;  2JOA A;  2KPK A;  5HFC A;  4RI0 A;  2REY A;  2CSJ A;  4EDJ A;  5HEY A;  1QAV A;  2DMZ A;  1L6O A;  2OSG A;  2I0L A;  4NXP A;  2QBW A;  3R69 A;  1G9O A;  4Q6S A;  4K78 A;  1WHA A;  2LA8 A;  1WFG A;  3FY5 A;  2I1N A;  2FN5 A;  1UFX A;  1VCW A;  4HOP B;  3CYY A;  2JIK A;  2Z9I A;  1VAE A;  4MPA A;  2PKU A;  3DOR A;  4Q2Q A;  2QKU A;  4NMV A;  1UM7 A;  2FNE A;  4R2Z A;  3QGL A;  1WF8 A;  2BYG A;  3KZD A;  1OZI A;  2DAZ A;  5G1D A;  4XHV A;  1W9O A;  3LNY A;  2OZF A;  1VJ6 A;  2I0I A;  1IU0 A;  3PS4 A;  3NCV A;  4Q2P A;  1Q3O A;  3KDK A;  4JOF A;  3GSL A;  2GZV A;  2HE2 A;  1X5R A;  5HFF A;  3AXA A;  2QKT A;  5HET A;  3E17 A;  3CBZ A;  2VRF A;  2JSN A;  3GCO A;  1WIF A;  3GGE A;  2YUB A;  5HDY A;  2DC2 A;  3MH6 A; 
#chains in the Genus database with same CATH homology
 2MHO A;  4N6X A;  2M0T A;  4IC6 A;  5HFD A;  1M5Z A;  2HE4 A;  1YBO A;  1KWA A;  1TE0 A;  1X5N A;  5E6P B;  2KOJ A;  4O06 A;  2K20 A;  5GLJ A;  1UM1 A;  2M0U A;  3DJ3 A;  1R6J A;  1MFL A;  2AWU A;  4Q6H A;  1ZUB A;  3VQF A;  1FC9 A;  3TSZ A;  2F0A A;  3HVQ C;  2LC7 A;  2D92 A;  2Q9V A;  1P1D A;  2X7Z A;  3QJM A;  5H3J A;  4NMR A;  1BFE A;  3SFJ A;  4Q2N A;  3OTP A;  3VQG A;  3GCN A;  5E1Y A;  1UEZ A;  3SHU A;  2JWE A;  1D5G A;  1X9Z A;  2KRG A;  5A2P A;  1WI4 A;  1UHP A;  5EYZ A;  5I7Z A;  1UEP A;  1TP3 A;  2QG1 A;  2LC6 A;  4JOG A;  5HF1 A;  1SOT A;  1VB7 A;  2KJK A;  4NNL A;  2QT5 A;  3SHW A;  2M0V A;  4JOR A;  5HF4 A;  1Q3P A;  5HEB A;  4OEO A;  2KQF A;  1B8Q A;  3ID3 A;  4OEP A;  2LOB A;  3TSW A;  3QDO A;  1W9Q A;  1UEQ A;  2ENO A;  3HPK A;  5IL9 A;  1WFV A;  2HGA A;  4WYT A;  2R4H A;  5B6L A;  2EDP A;  4NMQ A;  1WG6 A;  2KBS A;  4NNM A;  3CC0 A;  4FLN A;  5B42 A;  1N7E A;  2RRM A;  2KA9 A;  1N99 A;  2O2T A;  2M10 A;  2KG2 A;  1U37 A;  1Z87 A;  1NTE A;  3O5N A;  5JXB A;  3NGH A;  1KY9 A;  2CS5 A;  4YYX A;  2LUI A;  3ID2 A;  4JL7 A;  2H2B A;  2VSP A;  4NXQ A;  2OS6 A;  1K32 A;  5EZ0 A;  4JOH A;  1OBY A;  2IWN A;  3WKL A;  2F5Y A;  1OBX A;  3PV2 A;  1QLC A;  2K1Z A;  2M0Z A;  2VZ5 A;  2AIN A;  1I16 A;  4Z8J A;  2EEH A;  3DJ1 A;  3PV4 A;  1TQ3 A;  3CBX A;  3GDV A;  2Q3G A;  2EJY A;  2E7K A;  5HJ1 A;  1QAV B;  2KL1 A;  3I4W A;  2JIL A;  1OBZ A;  1N7F A;  2AWX A;  3R0H A;  1N6F A;  1NF3 C;  4E3B A;  5F67 A;  3STJ A;  1RGW A;  3DIW A;  3KHF A;  2KAW A;  2DM8 A;  1N7T A;  5E11 A;  2H3M A;  1W9E A;  3WKM A;  1RY4 A;  3O46 A;  2DJT A;  2YT7 A;  3KZE A;  1Z86 A;  2DB5 A;  3K1R A;  1I92 A;  2JXO A;  1LCY A;  3GJ9 A;  4LMM A;  4NMO A;  2L4T A;  1N6E A;  4GHN A;  2CSS A;  2EDV A;  1U3B A;  3BPU A;  1Q7X A;  3SOE A;  2KOM A;  3K50 A;  4F8K A;  4NMP A;  2EGN A;  3GDU A;  4YDP A;  2KV8 A;  1UJU A;  4JJ0 A;  4JOP A;  4UU5 A;  2G5M B;  2DLU A;  1ZOK A;  4JOE A;  3NFL A;  2R3Y A;  3ID1 A;  1QAU A;  1RGR A;  3GAB A;  2UZC A;  1MFG A;  3DJA A;  1UIT A;  4L8N A;  4Q2O A;  4HOP A;  5FB8 C;  1FCF A;  3PDZ A;  2VSV A;  4K72 A;  5E21 A;  2P3W A;  5GND A;  1WF7 A;  2FE5 A;  2YTW A;  4P0C A;  2M3M A;  3EGG C;  4JOK A;  2KJP A;  3QIK A;  1IU2 A;  1T2M A;  4E35 A;  1TP5 A;  2OCS A;  3TSV A;  4KFV A;  1WHD A;  3ZRT A;  3SUZ A;  4G69 A;  1P1E A;  1FC7 A;  4P2A B;  3RL7 A;  2EEJ A;  2H3L A;  1X8S A;  4FGM A;  2EEG A;  4GVD A;  2I04 A;  2EEI A;  3RL8 A;  2JRE A;  4E34 A;  2PNT A;  1WI2 A;  1UEW A;  1Y8T A;  1V6B A;  1UJD A;  2EDZ A;  3I18 A;  4K6Y A;  1X45 A;  4K76 A;  2W7R A;  2DLS A;  2KJD A;  1V5Q A;  2ZPL A;  2JIN A;  5HFB A;  3LNX A;  1WH1 A;  2RCZ A;  2D8I A;  2ZPM A;  2YT8 A;  4GVC A;  3EGH C;  2VPH A;  4Z33 A;  2G2L A;  1UF1 A;  3HPM A;  4JJ3 A;  2KOH A;  2WL7 A;  2PKT A;  2PZD A;  3PV5 A;  2VWR A;  3PDV A;  2EHR A;  3MH4 A;  5ILB A;  1V1T A;  3QO6 A;  2OQS A;  1UJV A;  2EAQ A;  2H2C A;  2EV8 A;  2EGO A;  1MC7 A;  2FCF A;  2MX6 A;  1V5L A;  4AMH A;  4OAJ A;  1Y7N A;  2I4S A;  3QE1 A;  3QJN A;  1SOZ A;  1XZ9 A;  4UU6 A;  2KYL A;  1GM1 A;  1WJL A;  4WYU A;  4JOJ A;  2QKV A;  3ID4 A;  3OU0 A;  1BE9 A;  1RZX A;  2I6V A;  3CH8 A;  2L4S A;  1V62 A;  2OPG A;  2DKR A;  1PDR A;  4NMT A;  2W4F A;  5E22 A;  4NXR A;  5F3X A;  5FHT A;  4K75 A;  5G1E A;  4REY A;  3MH7 A;  3K82 A;  2IWO A;  1IHJ A;  1KEF A;  4NMS A;  2D90 A;  5D13 A;  3R68 A;  2GEF A;  3GDS A;  5HFE A;  3CS0 A;  2IWP A;  2KPL A;  4PQW A;  3KDG A;  3JXT A;  2EGK A;  4KFW A;  2PDZ A;  2L97 A;  5DTH A;  1X5Q A;  1U38 A;  2YUY A;  2V1W A;  3TMH A;  1U39 A;  3I1E A;  1GQ4 A;  1FC6 A;  2OMJ A;  2AWW A;  4H11 A;  1VA8 A;  2OGP A;  2V90 A;  2Z17 A;  3B76 A;  3NFK A;  1X6D A;  2EXG A;  5HED A;  1N6D A;  3CBY A;  1GQ5 A;  4Q3H A;  2PA1 A;  3L4F D;  2IWQ A;  3RLE A;  2JOA A;  2KPK A;  5HFC A;  4RI0 A;  2REY A;  2CSJ A;  4EDJ A;  5HEY A;  1QAV A;  2DMZ A;  1L6O A;  2OSG A;  2I0L A;  4NXP A;  2QBW A;  3R69 A;  1G9O A;  4Q6S A;  4K78 A;  1WHA A;  2LA8 A;  1WFG A;  3FY5 A;  2I1N A;  2FN5 A;  1UFX A;  1VCW A;  4HOP B;  3CYY A;  2JIK A;  2Z9I A;  1VAE A;  4MPA A;  2PKU A;  3DOR A;  4Q2Q A;  2QKU A;  4NMV A;  1UM7 A;  2FNE A;  4R2Z A;  3QGL A;  1WF8 A;  2BYG A;  3KZD A;  1OZI A;  2DAZ A;  5G1D A;  4XHV A;  1W9O A;  3LNY A;  2OZF A;  1VJ6 A;  2I0I A;  1IU0 A;  3PS4 A;  3NCV A;  4Q2P A;  1Q3O A;  3KDK A;  4JOF A;  3GSL A;  2GZV A;  2HE2 A;  1X5R A;  5HFF A;  3AXA A;  2QKT A;  5HET A;  3E17 A;  3CBZ A;  2VRF A;  2JSN A;  3GCO A;  1WIF A;  3GGE A;  2YUB A;  5HDY A;  2DC2 A;  3MH6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...