4UU5A

Crystal structure of the pdz domain of pals1 in complex with the crb peptide
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
90
structure length
90
Chain Sequence
b'GPLGSGETVKIVRIEKARDIPLGATVRNEMDSVIISRIVKGGAAEKSGLLHEGDEVLEINGIEIRGKDVNEVFDLLSDMHGTLTFVLIPS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords MAGUK P55 SUBFAMILY MEMBER 5
publication title Structures of the human Pals1 PDZ domain with and without ligand suggest gated access of Crb to the PDZ peptide-binding groove.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 24
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2014-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 4uu5A00
3E17A 1BE9A 3I18A 4GVCA 2M0VA 4IC6A 5EYZA 4Z33A 2QG1A 2EGKA 2BYGA 4YYXA 2OMJA 3GCOA 4Q3HA 1VCWA 2I6VA 2M10A 2KG2A 2R3YA 1Q3PA 4E34A 2EEHA 3GGEA 3LNYA 3FY5A 4NNMA 1N6EA 1UM7A 1UEZA 2DJTA 2AWUA 4WYTA 5F67A 3LNXA 1RGWA 2YUYA 1UHPA 3SHWA 4K78A 5EZ0A 3ID2A 2PDZA 1UEWA 2M0TA 5HETA 2FE5A 1WI2A 1UJVA 3OTPA 2JOAA 4H11A 1UEQA 2EEJA 3CBXA 2F5YA 4AMHA 2I04A 2RRMA 2YT8A 2JILA 1B8QA 3GJ9A 2IWQA 2DLUA 1VJ6A 1WFGA 2LC7A 3HPKA 2CS5A 2I1NA 3O5NA 2M0UA 5E1YA 2KBSA 1UJDA 1Z86A 5D13A 2JXOA 1K32A 3QJNA 2PKTA 2EDZA 4NMQA 4NMSA 2MHOA 1UM1A 4NXRA 3NFKA 1N7EA 1P1EA 2QKTA 2LC6A 3AXAA 4Q2NA 3DIWA 4JOKA 2LOBA 5HFBA 2EHRA 4JOJA 2H3LA 4P2AB 5HF1A 2EEGA 3R69A 2E7KA 4UU6A 1X8SA 2PNTA 5G1DA 1ZOKA 4NMRA 2KJPA 2OQSA 1QAUA 3JXTA 2P3WA 1MFLA 3GDSA 3CS0A 4E35A 3EGGC 2IWNA 2DAZA 3B76A 3GCNA 5HEDA 1UF1A 3O46A 4NNLA 2L4TA 1UEPA 5HFFA 1FC7A 2O2TA 1WJLA 3SOEA 2EGNA 4PQWA 4Q2QA 2IWPA 3RL7A 1Q7XA 2LA8A 2MX6A 1QLCA 2D92A 3MH7A 1N7TA 3SUZA 1WI4A 2IWOA 4JL7A 2M3MA 4FGMA 3PDZA 4XHVA 1FC6A 4NXPA 3PV5A 2CSSA 1NTEA 2KQFA 1N99A 1U37A 1WG6A 3CBYA 2KOJA 2OPGA 1V5QA 2YTWA 3CBZA 1WF7A 5E21A 1XZ9A 3DJ1A 3I4WA 2VPHA 3K50A 5FB8C 3QE1A 1X5QA 3TSZA 3TSVA 3GDUA 3NGHA 2AWXA 2UZCA 1GQ4A 3HPMA 1QAVB 1W9QA 3CC0A 2LUIA 2EEIA 3PDVA 3GDVA 2DKRA 2KV8A 4OAJA 2K1ZA 1X6DA 3PS4A 1IHJA 1W9EA 1W9OA 1V1TA 5I7ZA 2OS6A 3EGHC 2KOHA 1GQ5A 4WYUA 2DMZA 3TMHA 2KJKA 4KFWA 1U39A 4HOPA 2JIKA 3I1EA 4NMTA 4K75A 2AWWA 1D5GA 2FN5A 2DM8A 4L8NA 3MH6A 4LMMA 2PA1A 3DORA 5HFDA 2Q3GA 4JOHA 2KYLA 3QDOA 3WKMA 2F0AA 3CH8A 4GVDA 4JORA 1X5NA 4GHNA 2L4SA 3TSWA 1RY4A 1ZUBA 2X7ZA 2EDVA 1V6BA 2I0IA 3NFLA 1V62A 1KEFA 1WIFA 2Q9VA 5FHTA 2DC2A 2K20A 1SOZA 1TP5A 2EXGA 2PKUA 3K1RA 2V1WA 1WFVA 2YT7A 1TE0A 2D90A 2KRGA 4UU5A 2OGPA 1WH1A 5HFEA 5DTHA 1WHDA 2I0LA 1KWAA 3PV4A 2QKVA 4K72A 1UITA 2JINA 2HE2A 2W4FA 1PDRA 4OEPA 5HFCA 4N6XA 1M5ZA 3PV2A 2AINA 3ID4A 4R2ZA 2KL1A 1RGRA 3KHFA 3R68A 3DJAA 2KPKA 4RI0A 4P0CA 1TQ3A 4KFVA 1Q3OA 5JXBA 2KA9A 3MH4A 2V90A 4Q2OA 2G5MB 2EDPA 2PZDA 4JOGA 5HDYA 1FC9A 2DLSA 1OZIA 1IU0A 4Z8JA 2WL7A 4NMOA 1N7FA 3KZEA 4MPAA 1RZXA 2OSGA 2Z9IA 4NXQA 1L6OA 1UFXA 2QBWA 1GM1A 2JWEA 4YDPA 1OBZA 2H2BA 5HEYA 1X45A 3DJ3A 1G9OA 1NF3C 2H2CA 1OBYA 2ZPMA 4REYA 1N6FA 2ZPLA 2OCSA 3VQGA 3L4FD 4K76A 4JOPA 1X5RA 2RCZA 3GSLA 2KJDA 1TP3A 1WF8A 2L97A 2I4SA 5HJ1A 2ENOA 1OBXA 4JOEA 5E11A 2HE4A 3R0HA 2EAQA 2KAWA 2QT5A 4JOFA 4O06A 1U38A 1R6JA 3QO6A 5E22A 1Y8TA 4G69A 2M0ZA 1LCYA 1T2MA 1WHAA 5HEBA 1I16A 3STJA 1P1DA 1YBOA 1U3BA 5E6PB 4F8KA 4EDJA 3CYYA 2W7RA 5B6LA 2KOMA 3QIKA 1MC7A 5HF4A 2VSVA 2VSPA 3QJMA 2G2LA 1N6DA 4Q6HA 1IU2A 5A2PA 2VWRA 1SOTA 4NMPA 3BPUA 2VRFA 2JREA 3OU0A 4K6YA 3K82A 3WKLA 1VB7A 2EV8A 5F3XA 1I92A 3VQFA 2HGAA 5GLJA 3HVQC 2DB5A 2FNEA 3RLEA 2QKUA 4OEOA 2CSJA 3ZRTA 2REYA 4HOPB 3ID3A 1Z87A 1VA8A 1QAVA 2EGOA 2Z17A 1BFEA 2GZVA 3ID1A 2KPLA 4Q2PA 1FCFA 2R4HA 1V5LA 5GNDA 1MFGA 2OZFA 3SHUA 3QGLA 4NMVA 5H3JA 2FCFA 1Y7NA 2D8IA 1KY9A 2YUBA 4E3BA 3KZDA 5G1EA 2H3MA 1UJUA 1VAEA 3SFJA 2VZ5A 4Q6SA 3RL8A 2EJYA
chains in the Genus database with same CATH superfamily
3E17A 1BE9A 3I18A 4GVCA 2M0VA 4IC6A 5EYZA 4Z33A 2QG1A 2EGKA 2BYGA 4YYXA 5B42A 2OMJA 3GCOA 4Q3HA 1VCWA 2I6VA 2M10A 2KG2A 2R3YA 1Q3PA 4E34A 2EEHA 3GGEA 3LNYA 3FY5A 4NNMA 1N6EA 1UM7A 1UEZA 2DJTA 2AWUA 4WYTA 5F67A 3LNXA 1RGWA 2YUYA 1UHPA 3SHWA 4K78A 5EZ0A 3ID2A 2PDZA 1UEWA 2M0TA 4JJ3A 5HETA 2FE5A 1WI2A 1UJVA 3OTPA 2JOAA 4H11A 1UEQA 2EEJA 3CBXA 2F5YA 4AMHA 2I04A 2RRMA 2YT8A 2JILA 3GABA 3GJ9A 1B8QA 2IWQA 2DLUA 1VJ6A 1WFGA 2LC7A 3HPKA 4JJ0A 2CS5A 2I1NA 5ILBA 3O5NA 2M0UA 5E1YA 2KBSA 1UJDA 1Z86A 5D13A 2JXOA 1K32A 3QJNA 2PKTA 2EDZA 4NMQA 4NMSA 2MHOA 1UM1A 4NXRA 3NFKA 1N7EA 1P1EA 2QKTA 2LC6A 3AXAA 4Q2NA 3DIWA 4JOKA 2LOBA 5HFBA 2EHRA 4JOJA 2H3LA 4P2AB 5HF1A 2EEGA 3R69A 2E7KA 4UU6A 1X8SA 2PNTA 5G1DA 1ZOKA 4NMRA 2KJPA 2OQSA 1QAUA 3JXTA 2P3WA 1MFLA 3GDSA 3CS0A 4E35A 3EGGC 2IWNA 2DAZA 3B76A 3GCNA 5HEDA 1UF1A 3O46A 4NNLA 2L4TA 1UEPA 5HFFA 1FC7A 2O2TA 1WJLA 3SOEA 2EGNA 4PQWA 5IL9A 4Q2QA 2IWPA 3RL7A 1Q7XA 2LA8A 2MX6A 1QLCA 2D92A 3MH7A 1N7TA 3SUZA 1WI4A 2IWOA 4JL7A 2M3MA 4FGMA 3PDZA 4XHVA 1FC6A 4NXPA 3PV5A 2CSSA 1NTEA 3NCVA 2KQFA 1N99A 1U37A 1WG6A 3CBYA 2KOJA 2OPGA 1V5QA 2YTWA 3CBZA 1WF7A 5E21A 1XZ9A 3DJ1A 3I4WA 2VPHA 3K50A 5FB8C 3QE1A 1X5QA 3TSZA 3TSVA 3GDUA 3NGHA 2AWXA 2UZCA 1GQ4A 3HPMA 1QAVB 1W9QA 3CC0A 2LUIA 2EEIA 3PDVA 3GDVA 2DKRA 2KV8A 4OAJA 2K1ZA 1X6DA 3PS4A 1IHJA 1W9EA 1W9OA 1V1TA 5I7ZA 2OS6A 3EGHC 2KOHA 1GQ5A 4WYUA 2DMZA 3TMHA 2KJKA 4KFWA 1U39A 4HOPA 2JIKA 3I1EA 4NMTA 4K75A 2AWWA 1D5GA 2FN5A 2DM8A 4L8NA 3MH6A 3KDGA 4LMMA 2PA1A 3DORA 5HFDA 2Q3GA 4JOHA 2KYLA 3QDOA 3WKMA 2F0AA 3CH8A 4GVDA 4JORA 1X5NA 4GHNA 2L4SA 3TSWA 1RY4A 1ZUBA 2X7ZA 2EDVA 1V6BA 2I0IA 3NFLA 1V62A 1KEFA 1WIFA 2Q9VA 5FHTA 2DC2A 2K20A 1SOZA 1TP5A 2EXGA 2PKUA 3K1RA 2V1WA 1WFVA 2YT7A 1TE0A 2D90A 2KRGA 4UU5A 2OGPA 1WH1A 5HFEA 5DTHA 1WHDA 2I0LA 1KWAA 3PV4A 2QKVA 4K72A 1UITA 2JINA 2HE2A 2W4FA 1PDRA 4OEPA 5HFCA 4N6XA 1M5ZA 3PV2A 2AINA 3ID4A 4R2ZA 2KL1A 1RGRA 3KHFA 3R68A 1X9ZA 3DJAA 2KPKA 4RI0A 3KDKA 4P0CA 1TQ3A 4KFVA 1Q3OA 5JXBA 2KA9A 3MH4A 2V90A 4Q2OA 2GEFA 2G5MB 2EDPA 2PZDA 4JOGA 5HDYA 1FC9A 2DLSA 1OZIA 1IU0A 4Z8JA 2WL7A 4NMOA 1N7FA 3KZEA 4MPAA 1RZXA 2OSGA 2Z9IA 4NXQA 1L6OA 1UFXA 2QBWA 1GM1A 2JWEA 4YDPA 1OBZA 2H2BA 5HEYA 1X45A 3DJ3A 1G9OA 1NF3C 2H2CA 1OBYA 4FLNA 2ZPMA 4REYA 1N6FA 2ZPLA 2OCSA 3VQGA 3L4FD 4K76A 4JOPA 1X5RA 2RCZA 3GSLA 2KJDA 1TP3A 1WF8A 2L97A 2I4SA 5HJ1A 2ENOA 1OBXA 4JOEA 5E11A 2HE4A 3R0HA 2EAQA 2KAWA 2QT5A 4JOFA 4O06A 1U38A 1R6JA 3QO6A 5E22A 1Y8TA 4G69A 2M0ZA 1LCYA 1T2MA 1WHAA 5HEBA 1I16A 2JSNA 3STJA 1P1DA 1YBOA 1U3BA 5E6PB 4F8KA 4EDJA 3CYYA 2W7RA 5B6LA 2KOMA 3QIKA 1MC7A 5HF4A 2VSVA 2VSPA 3QJMA 2G2LA 1N6DA 4Q6HA 1IU2A 5A2PA 2VWRA 1SOTA 4NMPA 3BPUA 2VRFA 2JREA 3OU0A 4K6YA 3K82A 3WKLA 1VB7A 2EV8A 5F3XA 1I92A 3VQFA 2HGAA 5GLJA 3HVQC 2DB5A 2FNEA 3RLEA 2QKUA 4OEOA 2CSJA 3ZRTA 2REYA 4HOPB 3ID3A 1Z87A 1VA8A 1QAVA 2EGOA 2Z17A 1BFEA 2GZVA 3ID1A 2KPLA 4Q2PA 1FCFA 2R4HA 1V5LA 5GNDA 1MFGA 2OZFA 3SHUA 3QGLA 4NMVA 5H3JA 2FCFA 1Y7NA 2D8IA 1KY9A 2YUBA 4E3BA 3KZDA 5G1EA 2H3MA 1UJUA 1VAEA 3SFJA 2VZ5A 4Q6SA 3RL8A 2EJYA
chains in the Genus database with same CATH topology
3E17A 1BE9A 3I18A 4GVCA 2M0VA 4IC6A 5EYZA 4Z33A 2QG1A 2EGKA 2BYGA 4YYXA 5B42A 2OMJA 3GCOA 4Q3HA 1VCWA 2I6VA 2M10A 2KG2A 2R3YA 1Q3PA 4E34A 2EEHA 3GGEA 3LNYA 3FY5A 4NNMA 1N6EA 1UM7A 1UEZA 2DJTA 2AWUA 4WYTA 5F67A 3LNXA 1RGWA 2YUYA 1UHPA 3SHWA 4K78A 5EZ0A 3ID2A 2PDZA 1UEWA 2M0TA 4JJ3A 5HETA 2FE5A 1WI2A 1UJVA 3OTPA 2JOAA 4H11A 1UEQA 2EEJA 3CBXA 2F5YA 4AMHA 2I04A 2RRMA 2YT8A 2JILA 3GABA 3GJ9A 1B8QA 2IWQA 2DLUA 1VJ6A 1WFGA 2LC7A 3HPKA 4JJ0A 2CS5A 2I1NA 5ILBA 3O5NA 2M0UA 5E1YA 2KBSA 1UJDA 1Z86A 5D13A 2JXOA 1K32A 3QJNA 2PKTA 2EDZA 4NMQA 4NMSA 2MHOA 1UM1A 4NXRA 3NFKA 1N7EA 1P1EA 2QKTA 2LC6A 3AXAA 4Q2NA 3DIWA 4JOKA 2LOBA 5HFBA 2EHRA 4JOJA 2H3LA 4P2AB 5HF1A 2EEGA 3R69A 2E7KA 4UU6A 1X8SA 2PNTA 5G1DA 1ZOKA 4NMRA 2KJPA 2OQSA 1QAUA 3JXTA 2P3WA 1MFLA 3GDSA 3CS0A 4E35A 3EGGC 2IWNA 2DAZA 3B76A 3GCNA 5HEDA 1UF1A 3O46A 4NNLA 2L4TA 1UEPA 5HFFA 1FC7A 2O2TA 1WJLA 3SOEA 2EGNA 4PQWA 5IL9A 4Q2QA 2IWPA 3RL7A 1Q7XA 2LA8A 2MX6A 1QLCA 2D92A 3MH7A 1N7TA 3SUZA 1WI4A 2IWOA 4JL7A 2M3MA 4FGMA 3PDZA 4XHVA 1FC6A 4NXPA 3PV5A 2CSSA 1NTEA 3NCVA 2KQFA 1N99A 1U37A 1WG6A 3CBYA 2KOJA 2OPGA 1V5QA 2YTWA 3CBZA 1WF7A 5E21A 1XZ9A 3DJ1A 3I4WA 2VPHA 3K50A 5FB8C 3QE1A 1X5QA 3TSZA 3TSVA 3GDUA 3NGHA 2AWXA 2UZCA 1GQ4A 3HPMA 1QAVB 1W9QA 3CC0A 2LUIA 2EEIA 3PDVA 3GDVA 2DKRA 2KV8A 4OAJA 2K1ZA 1X6DA 3PS4A 1IHJA 1W9EA 1W9OA 1V1TA 5I7ZA 2OS6A 3EGHC 2KOHA 1GQ5A 4WYUA 2DMZA 3TMHA 2KJKA 4KFWA 1U39A 4HOPA 2JIKA 3I1EA 4NMTA 4K75A 2AWWA 1D5GA 2FN5A 2DM8A 4L8NA 3MH6A 3KDGA 4LMMA 2PA1A 3DORA 5HFDA 2Q3GA 4JOHA 2KYLA 3QDOA 3WKMA 2F0AA 3CH8A 4GVDA 4JORA 1X5NA 4GHNA 2L4SA 3TSWA 1RY4A 1ZUBA 2X7ZA 2EDVA 1V6BA 2I0IA 3NFLA 1V62A 1KEFA 1WIFA 2Q9VA 5FHTA 2DC2A 2K20A 1SOZA 1TP5A 2EXGA 2PKUA 3K1RA 2V1WA 1WFVA 2YT7A 1TE0A 2D90A 2KRGA 4UU5A 2OGPA 1WH1A 5HFEA 5DTHA 1WHDA 2I0LA 1KWAA 3PV4A 2QKVA 4K72A 1UITA 2JINA 2HE2A 2W4FA 1PDRA 4OEPA 5HFCA 4N6XA 1M5ZA 3PV2A 2AINA 3ID4A 4R2ZA 2KL1A 1RGRA 3KHFA 3R68A 1X9ZA 3DJAA 2KPKA 4RI0A 3KDKA 4P0CA 1TQ3A 4KFVA 1Q3OA 5JXBA 2KA9A 3MH4A 2V90A 4Q2OA 2GEFA 2G5MB 2EDPA 2PZDA 4JOGA 5HDYA 1FC9A 2DLSA 1OZIA 1IU0A 4Z8JA 2WL7A 4NMOA 1N7FA 3KZEA 4MPAA 1RZXA 2OSGA 2Z9IA 4NXQA 1L6OA 1UFXA 2QBWA 1GM1A 2JWEA 4YDPA 1OBZA 2H2BA 5HEYA 1X45A 3DJ3A 1G9OA 1NF3C 2H2CA 1OBYA 4FLNA 2ZPMA 4REYA 1N6FA 2ZPLA 2OCSA 3VQGA 3L4FD 4K76A 4JOPA 1X5RA 2RCZA 3GSLA 2KJDA 1TP3A 1WF8A 2L97A 2I4SA 5HJ1A 2ENOA 1OBXA 4JOEA 5E11A 2HE4A 3R0HA 2EAQA 2KAWA 2QT5A 4JOFA 4O06A 1U38A 1R6JA 3QO6A 5E22A 1Y8TA 4G69A 2M0ZA 1LCYA 1T2MA 1WHAA 5HEBA 1I16A 2JSNA 3STJA 1P1DA 1YBOA 1U3BA 5E6PB 4F8KA 4EDJA 3CYYA 2W7RA 5B6LA 2KOMA 3QIKA 1MC7A 5HF4A 2VSVA 2VSPA 3QJMA 2G2LA 1N6DA 4Q6HA 1IU2A 5A2PA 2VWRA 1SOTA 4NMPA 3BPUA 2VRFA 2JREA 3OU0A 4K6YA 3K82A 3WKLA 1VB7A 2EV8A 5F3XA 1I92A 3VQFA 2HGAA 5GLJA 3HVQC 2DB5A 2FNEA 3RLEA 2QKUA 4OEOA 2CSJA 3ZRTA 2REYA 4HOPB 3ID3A 1Z87A 1VA8A 1QAVA 2EGOA 2Z17A 1BFEA 2GZVA 3ID1A 2KPLA 4Q2PA 1FCFA 2R4HA 1V5LA 5GNDA 1MFGA 2OZFA 3SHUA 3QGLA 4NMVA 5H3JA 2FCFA 1Y7NA 2D8IA 1KY9A 2YUBA 4E3BA 3KZDA 5G1EA 2H3MA 1UJUA 1VAEA 3SFJA 2VZ5A 4Q6SA 3RL8A 2EJYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E17 A;  1BE9 A;  3I18 A;  4GVC A;  2M0V A;  4IC6 A;  5EYZ A;  4Z33 A;  2QG1 A;  2EGK A;  2BYG A;  4YYX A;  2OMJ A;  3GCO A;  4Q3H A;  1VCW A;  2I6V A;  2M10 A;  2KG2 A;  2R3Y A;  1Q3P A;  4E34 A;  2EEH A;  3GGE A;  3LNY A;  3FY5 A;  4NNM A;  1N6E A;  1UM7 A;  1UEZ A;  2DJT A;  2AWU A;  4WYT A;  5F67 A;  3LNX A;  1RGW A;  2YUY A;  1UHP A;  3SHW A;  4K78 A;  5EZ0 A;  3ID2 A;  2PDZ A;  1UEW A;  2M0T A;  5HET A;  2FE5 A;  1WI2 A;  1UJV A;  3OTP A;  2JOA A;  4H11 A;  1UEQ A;  2EEJ A;  3CBX A;  2F5Y A;  4AMH A;  2I04 A;  2RRM A;  2YT8 A;  2JIL A;  1B8Q A;  3GJ9 A;  2IWQ A;  2DLU A;  1VJ6 A;  1WFG A;  2LC7 A;  3HPK A;  2CS5 A;  2I1N A;  3O5N A;  2M0U A;  5E1Y A;  2KBS A;  1UJD A;  1Z86 A;  5D13 A;  2JXO A;  1K32 A;  3QJN A;  2PKT A;  2EDZ A;  4NMQ A;  4NMS A;  2MHO A;  1UM1 A;  4NXR A;  3NFK A;  1N7E A;  1P1E A;  2QKT A;  2LC6 A;  3AXA A;  4Q2N A;  3DIW A;  4JOK A;  2LOB A;  5HFB A;  2EHR A;  4JOJ A;  2H3L A;  4P2A B;  5HF1 A;  2EEG A;  3R69 A;  2E7K A;  4UU6 A;  1X8S A;  2PNT A;  5G1D A;  1ZOK A;  4NMR A;  2KJP A;  2OQS A;  1QAU A;  3JXT A;  2P3W A;  1MFL A;  3GDS A;  3CS0 A;  4E35 A;  3EGG C;  2IWN A;  2DAZ A;  3B76 A;  3GCN A;  5HED A;  1UF1 A;  3O46 A;  4NNL A;  2L4T A;  1UEP A;  5HFF A;  1FC7 A;  2O2T A;  1WJL A;  3SOE A;  2EGN A;  4PQW A;  4Q2Q A;  2IWP A;  3RL7 A;  1Q7X A;  2LA8 A;  2MX6 A;  1QLC A;  2D92 A;  3MH7 A;  1N7T A;  3SUZ A;  1WI4 A;  2IWO A;  4JL7 A;  2M3M A;  4FGM A;  3PDZ A;  4XHV A;  1FC6 A;  4NXP A;  3PV5 A;  2CSS A;  1NTE A;  2KQF A;  1N99 A;  1U37 A;  1WG6 A;  3CBY A;  2KOJ A;  2OPG A;  1V5Q A;  2YTW A;  3CBZ A;  1WF7 A;  5E21 A;  1XZ9 A;  3DJ1 A;  3I4W A;  2VPH A;  3K50 A;  5FB8 C;  3QE1 A;  1X5Q A;  3TSZ A;  3TSV A;  3GDU A;  3NGH A;  2AWX A;  2UZC A;  1GQ4 A;  3HPM A;  1QAV B;  1W9Q A;  3CC0 A;  2LUI A;  2EEI A;  3PDV A;  3GDV A;  2DKR A;  2KV8 A;  4OAJ A;  2K1Z A;  1X6D A;  3PS4 A;  1IHJ A;  1W9E A;  1W9O A;  1V1T A;  5I7Z A;  2OS6 A;  3EGH C;  2KOH A;  1GQ5 A;  4WYU A;  2DMZ A;  3TMH A;  2KJK A;  4KFW A;  1U39 A;  4HOP A;  2JIK A;  3I1E A;  4NMT A;  4K75 A;  2AWW A;  1D5G A;  2FN5 A;  2DM8 A;  4L8N A;  3MH6 A;  4LMM A;  2PA1 A;  3DOR A;  5HFD A;  2Q3G A;  4JOH A;  2KYL A;  3QDO A;  3WKM A;  2F0A A;  3CH8 A;  4GVD A;  4JOR A;  1X5N A;  4GHN A;  2L4S A;  3TSW A;  1RY4 A;  1ZUB A;  2X7Z A;  2EDV A;  1V6B A;  2I0I A;  3NFL A;  1V62 A;  1KEF A;  1WIF A;  2Q9V A;  5FHT A;  2DC2 A;  2K20 A;  1SOZ A;  1TP5 A;  2EXG A;  2PKU A;  3K1R A;  2V1W A;  1WFV A;  2YT7 A;  1TE0 A;  2D90 A;  2KRG A;  4UU5 A;  2OGP A;  1WH1 A;  5HFE A;  5DTH A;  1WHD A;  2I0L A;  1KWA A;  3PV4 A;  2QKV A;  4K72 A;  1UIT A;  2JIN A;  2HE2 A;  2W4F A;  1PDR A;  4OEP A;  5HFC A;  4N6X A;  1M5Z A;  3PV2 A;  2AIN A;  3ID4 A;  4R2Z A;  2KL1 A;  1RGR A;  3KHF A;  3R68 A;  3DJA A;  2KPK A;  4RI0 A;  4P0C A;  1TQ3 A;  4KFV A;  1Q3O A;  5JXB A;  2KA9 A;  3MH4 A;  2V90 A;  4Q2O A;  2G5M B;  2EDP A;  2PZD A;  4JOG A;  5HDY A;  1FC9 A;  2DLS A;  1OZI A;  1IU0 A;  4Z8J A;  2WL7 A;  4NMO A;  1N7F A;  3KZE A;  4MPA A;  1RZX A;  2OSG A;  2Z9I A;  4NXQ A;  1L6O A;  1UFX A;  2QBW A;  1GM1 A;  2JWE A;  4YDP A;  1OBZ A;  2H2B A;  5HEY A;  1X45 A;  3DJ3 A;  1G9O A;  1NF3 C;  2H2C A;  1OBY A;  2ZPM A;  4REY A;  1N6F A;  2ZPL A;  2OCS A;  3VQG A;  3L4F D;  4K76 A;  4JOP A;  1X5R A;  2RCZ A;  3GSL A;  2KJD A;  1TP3 A;  1WF8 A;  2L97 A;  2I4S A;  5HJ1 A;  2ENO A;  1OBX A;  4JOE A;  5E11 A;  2HE4 A;  3R0H A;  2EAQ A;  2KAW A;  2QT5 A;  4JOF A;  4O06 A;  1U38 A;  1R6J A;  3QO6 A;  5E22 A;  1Y8T A;  4G69 A;  2M0Z A;  1LCY A;  1T2M A;  1WHA A;  5HEB A;  1I16 A;  3STJ A;  1P1D A;  1YBO A;  1U3B A;  5E6P B;  4F8K A;  4EDJ A;  3CYY A;  2W7R A;  5B6L A;  2KOM A;  3QIK A;  1MC7 A;  5HF4 A;  2VSV A;  2VSP A;  3QJM A;  2G2L A;  1N6D A;  4Q6H A;  1IU2 A;  5A2P A;  2VWR A;  1SOT A;  4NMP A;  3BPU A;  2VRF A;  2JRE A;  3OU0 A;  4K6Y A;  3K82 A;  3WKL A;  1VB7 A;  2EV8 A;  5F3X A;  1I92 A;  3VQF A;  2HGA A;  5GLJ A;  3HVQ C;  2DB5 A;  2FNE A;  3RLE A;  2QKU A;  4OEO A;  2CSJ A;  3ZRT A;  2REY A;  4HOP B;  3ID3 A;  1Z87 A;  1VA8 A;  1QAV A;  2EGO A;  2Z17 A;  1BFE A;  2GZV A;  3ID1 A;  2KPL A;  4Q2P A;  1FCF A;  2R4H A;  1V5L A;  5GND A;  1MFG A;  2OZF A;  3SHU A;  3QGL A;  4NMV A;  5H3J A;  2FCF A;  1Y7N A;  2D8I A;  1KY9 A;  2YUB A;  4E3B A;  3KZD A;  5G1E A;  2H3M A;  1UJU A;  1VAE A;  3SFJ A;  2VZ5 A;  4Q6S A;  3RL8 A;  2EJY A; 
#chains in the Genus database with same CATH topology
 3E17 A;  1BE9 A;  3I18 A;  4GVC A;  2M0V A;  4IC6 A;  5EYZ A;  4Z33 A;  2QG1 A;  2EGK A;  2BYG A;  4YYX A;  5B42 A;  2OMJ A;  3GCO A;  4Q3H A;  1VCW A;  2I6V A;  2M10 A;  2KG2 A;  2R3Y A;  1Q3P A;  4E34 A;  2EEH A;  3GGE A;  3LNY A;  3FY5 A;  4NNM A;  1N6E A;  1UM7 A;  1UEZ A;  2DJT A;  2AWU A;  4WYT A;  5F67 A;  3LNX A;  1RGW A;  2YUY A;  1UHP A;  3SHW A;  4K78 A;  5EZ0 A;  3ID2 A;  2PDZ A;  1UEW A;  2M0T A;  4JJ3 A;  5HET A;  2FE5 A;  1WI2 A;  1UJV A;  3OTP A;  2JOA A;  4H11 A;  1UEQ A;  2EEJ A;  3CBX A;  2F5Y A;  4AMH A;  2I04 A;  2RRM A;  2YT8 A;  2JIL A;  3GAB A;  3GJ9 A;  1B8Q A;  2IWQ A;  2DLU A;  1VJ6 A;  1WFG A;  2LC7 A;  3HPK A;  4JJ0 A;  2CS5 A;  2I1N A;  5ILB A;  3O5N A;  2M0U A;  5E1Y A;  2KBS A;  1UJD A;  1Z86 A;  5D13 A;  2JXO A;  1K32 A;  3QJN A;  2PKT A;  2EDZ A;  4NMQ A;  4NMS A;  2MHO A;  1UM1 A;  4NXR A;  3NFK A;  1N7E A;  1P1E A;  2QKT A;  2LC6 A;  3AXA A;  4Q2N A;  3DIW A;  4JOK A;  2LOB A;  5HFB A;  2EHR A;  4JOJ A;  2H3L A;  4P2A B;  5HF1 A;  2EEG A;  3R69 A;  2E7K A;  4UU6 A;  1X8S A;  2PNT A;  5G1D A;  1ZOK A;  4NMR A;  2KJP A;  2OQS A;  1QAU A;  3JXT A;  2P3W A;  1MFL A;  3GDS A;  3CS0 A;  4E35 A;  3EGG C;  2IWN A;  2DAZ A;  3B76 A;  3GCN A;  5HED A;  1UF1 A;  3O46 A;  4NNL A;  2L4T A;  1UEP A;  5HFF A;  1FC7 A;  2O2T A;  1WJL A;  3SOE A;  2EGN A;  4PQW A;  5IL9 A;  4Q2Q A;  2IWP A;  3RL7 A;  1Q7X A;  2LA8 A;  2MX6 A;  1QLC A;  2D92 A;  3MH7 A;  1N7T A;  3SUZ A;  1WI4 A;  2IWO A;  4JL7 A;  2M3M A;  4FGM A;  3PDZ A;  4XHV A;  1FC6 A;  4NXP A;  3PV5 A;  2CSS A;  1NTE A;  3NCV A;  2KQF A;  1N99 A;  1U37 A;  1WG6 A;  3CBY A;  2KOJ A;  2OPG A;  1V5Q A;  2YTW A;  3CBZ A;  1WF7 A;  5E21 A;  1XZ9 A;  3DJ1 A;  3I4W A;  2VPH A;  3K50 A;  5FB8 C;  3QE1 A;  1X5Q A;  3TSZ A;  3TSV A;  3GDU A;  3NGH A;  2AWX A;  2UZC A;  1GQ4 A;  3HPM A;  1QAV B;  1W9Q A;  3CC0 A;  2LUI A;  2EEI A;  3PDV A;  3GDV A;  2DKR A;  2KV8 A;  4OAJ A;  2K1Z A;  1X6D A;  3PS4 A;  1IHJ A;  1W9E A;  1W9O A;  1V1T A;  5I7Z A;  2OS6 A;  3EGH C;  2KOH A;  1GQ5 A;  4WYU A;  2DMZ A;  3TMH A;  2KJK A;  4KFW A;  1U39 A;  4HOP A;  2JIK A;  3I1E A;  4NMT A;  4K75 A;  2AWW A;  1D5G A;  2FN5 A;  2DM8 A;  4L8N A;  3MH6 A;  3KDG A;  4LMM A;  2PA1 A;  3DOR A;  5HFD A;  2Q3G A;  4JOH A;  2KYL A;  3QDO A;  3WKM A;  2F0A A;  3CH8 A;  4GVD A;  4JOR A;  1X5N A;  4GHN A;  2L4S A;  3TSW A;  1RY4 A;  1ZUB A;  2X7Z A;  2EDV A;  1V6B A;  2I0I A;  3NFL A;  1V62 A;  1KEF A;  1WIF A;  2Q9V A;  5FHT A;  2DC2 A;  2K20 A;  1SOZ A;  1TP5 A;  2EXG A;  2PKU A;  3K1R A;  2V1W A;  1WFV A;  2YT7 A;  1TE0 A;  2D90 A;  2KRG A;  4UU5 A;  2OGP A;  1WH1 A;  5HFE A;  5DTH A;  1WHD A;  2I0L A;  1KWA A;  3PV4 A;  2QKV A;  4K72 A;  1UIT A;  2JIN A;  2HE2 A;  2W4F A;  1PDR A;  4OEP A;  5HFC A;  4N6X A;  1M5Z A;  3PV2 A;  2AIN A;  3ID4 A;  4R2Z A;  2KL1 A;  1RGR A;  3KHF A;  3R68 A;  1X9Z A;  3DJA A;  2KPK A;  4RI0 A;  3KDK A;  4P0C A;  1TQ3 A;  4KFV A;  1Q3O A;  5JXB A;  2KA9 A;  3MH4 A;  2V90 A;  4Q2O A;  2GEF A;  2G5M B;  2EDP A;  2PZD A;  4JOG A;  5HDY A;  1FC9 A;  2DLS A;  1OZI A;  1IU0 A;  4Z8J A;  2WL7 A;  4NMO A;  1N7F A;  3KZE A;  4MPA A;  1RZX A;  2OSG A;  2Z9I A;  4NXQ A;  1L6O A;  1UFX A;  2QBW A;  1GM1 A;  2JWE A;  4YDP A;  1OBZ A;  2H2B A;  5HEY A;  1X45 A;  3DJ3 A;  1G9O A;  1NF3 C;  2H2C A;  1OBY A;  4FLN A;  2ZPM A;  4REY A;  1N6F A;  2ZPL A;  2OCS A;  3VQG A;  3L4F D;  4K76 A;  4JOP A;  1X5R A;  2RCZ A;  3GSL A;  2KJD A;  1TP3 A;  1WF8 A;  2L97 A;  2I4S A;  5HJ1 A;  2ENO A;  1OBX A;  4JOE A;  5E11 A;  2HE4 A;  3R0H A;  2EAQ A;  2KAW A;  2QT5 A;  4JOF A;  4O06 A;  1U38 A;  1R6J A;  3QO6 A;  5E22 A;  1Y8T A;  4G69 A;  2M0Z A;  1LCY A;  1T2M A;  1WHA A;  5HEB A;  1I16 A;  2JSN A;  3STJ A;  1P1D A;  1YBO A;  1U3B A;  5E6P B;  4F8K A;  4EDJ A;  3CYY A;  2W7R A;  5B6L A;  2KOM A;  3QIK A;  1MC7 A;  5HF4 A;  2VSV A;  2VSP A;  3QJM A;  2G2L A;  1N6D A;  4Q6H A;  1IU2 A;  5A2P A;  2VWR A;  1SOT A;  4NMP A;  3BPU A;  2VRF A;  2JRE A;  3OU0 A;  4K6Y A;  3K82 A;  3WKL A;  1VB7 A;  2EV8 A;  5F3X A;  1I92 A;  3VQF A;  2HGA A;  5GLJ A;  3HVQ C;  2DB5 A;  2FNE A;  3RLE A;  2QKU A;  4OEO A;  2CSJ A;  3ZRT A;  2REY A;  4HOP B;  3ID3 A;  1Z87 A;  1VA8 A;  1QAV A;  2EGO A;  2Z17 A;  1BFE A;  2GZV A;  3ID1 A;  2KPL A;  4Q2P A;  1FCF A;  2R4H A;  1V5L A;  5GND A;  1MFG A;  2OZF A;  3SHU A;  3QGL A;  4NMV A;  5H3J A;  2FCF A;  1Y7N A;  2D8I A;  1KY9 A;  2YUB A;  4E3B A;  3KZD A;  5G1E A;  2H3M A;  1UJU A;  1VAE A;  3SFJ A;  2VZ5 A;  4Q6S A;  3RL8 A;  2EJY A; 
#chains in the Genus database with same CATH homology
 3E17 A;  1BE9 A;  3I18 A;  4GVC A;  2M0V A;  4IC6 A;  5EYZ A;  4Z33 A;  2QG1 A;  2EGK A;  2BYG A;  4YYX A;  5B42 A;  2OMJ A;  3GCO A;  4Q3H A;  1VCW A;  2I6V A;  2M10 A;  2KG2 A;  2R3Y A;  1Q3P A;  4E34 A;  2EEH A;  3GGE A;  3LNY A;  3FY5 A;  4NNM A;  1N6E A;  1UM7 A;  1UEZ A;  2DJT A;  2AWU A;  4WYT A;  5F67 A;  3LNX A;  1RGW A;  2YUY A;  1UHP A;  3SHW A;  4K78 A;  5EZ0 A;  3ID2 A;  2PDZ A;  1UEW A;  2M0T A;  4JJ3 A;  5HET A;  2FE5 A;  1WI2 A;  1UJV A;  3OTP A;  2JOA A;  4H11 A;  1UEQ A;  2EEJ A;  3CBX A;  2F5Y A;  4AMH A;  2I04 A;  2RRM A;  2YT8 A;  2JIL A;  3GAB A;  3GJ9 A;  1B8Q A;  2IWQ A;  2DLU A;  1VJ6 A;  1WFG A;  2LC7 A;  3HPK A;  4JJ0 A;  2CS5 A;  2I1N A;  5ILB A;  3O5N A;  2M0U A;  5E1Y A;  2KBS A;  1UJD A;  1Z86 A;  5D13 A;  2JXO A;  1K32 A;  3QJN A;  2PKT A;  2EDZ A;  4NMQ A;  4NMS A;  2MHO A;  1UM1 A;  4NXR A;  3NFK A;  1N7E A;  1P1E A;  2QKT A;  2LC6 A;  3AXA A;  4Q2N A;  3DIW A;  4JOK A;  2LOB A;  5HFB A;  2EHR A;  4JOJ A;  2H3L A;  4P2A B;  5HF1 A;  2EEG A;  3R69 A;  2E7K A;  4UU6 A;  1X8S A;  2PNT A;  5G1D A;  1ZOK A;  4NMR A;  2KJP A;  2OQS A;  1QAU A;  3JXT A;  2P3W A;  1MFL A;  3GDS A;  3CS0 A;  4E35 A;  3EGG C;  2IWN A;  2DAZ A;  3B76 A;  3GCN A;  5HED A;  1UF1 A;  3O46 A;  4NNL A;  2L4T A;  1UEP A;  5HFF A;  1FC7 A;  2O2T A;  1WJL A;  3SOE A;  2EGN A;  4PQW A;  5IL9 A;  4Q2Q A;  2IWP A;  3RL7 A;  1Q7X A;  2LA8 A;  2MX6 A;  1QLC A;  2D92 A;  3MH7 A;  1N7T A;  3SUZ A;  1WI4 A;  2IWO A;  4JL7 A;  2M3M A;  4FGM A;  3PDZ A;  4XHV A;  1FC6 A;  4NXP A;  3PV5 A;  2CSS A;  1NTE A;  3NCV A;  2KQF A;  1N99 A;  1U37 A;  1WG6 A;  3CBY A;  2KOJ A;  2OPG A;  1V5Q A;  2YTW A;  3CBZ A;  1WF7 A;  5E21 A;  1XZ9 A;  3DJ1 A;  3I4W A;  2VPH A;  3K50 A;  5FB8 C;  3QE1 A;  1X5Q A;  3TSZ A;  3TSV A;  3GDU A;  3NGH A;  2AWX A;  2UZC A;  1GQ4 A;  3HPM A;  1QAV B;  1W9Q A;  3CC0 A;  2LUI A;  2EEI A;  3PDV A;  3GDV A;  2DKR A;  2KV8 A;  4OAJ A;  2K1Z A;  1X6D A;  3PS4 A;  1IHJ A;  1W9E A;  1W9O A;  1V1T A;  5I7Z A;  2OS6 A;  3EGH C;  2KOH A;  1GQ5 A;  4WYU A;  2DMZ A;  3TMH A;  2KJK A;  4KFW A;  1U39 A;  4HOP A;  2JIK A;  3I1E A;  4NMT A;  4K75 A;  2AWW A;  1D5G A;  2FN5 A;  2DM8 A;  4L8N A;  3MH6 A;  3KDG A;  4LMM A;  2PA1 A;  3DOR A;  5HFD A;  2Q3G A;  4JOH A;  2KYL A;  3QDO A;  3WKM A;  2F0A A;  3CH8 A;  4GVD A;  4JOR A;  1X5N A;  4GHN A;  2L4S A;  3TSW A;  1RY4 A;  1ZUB A;  2X7Z A;  2EDV A;  1V6B A;  2I0I A;  3NFL A;  1V62 A;  1KEF A;  1WIF A;  2Q9V A;  5FHT A;  2DC2 A;  2K20 A;  1SOZ A;  1TP5 A;  2EXG A;  2PKU A;  3K1R A;  2V1W A;  1WFV A;  2YT7 A;  1TE0 A;  2D90 A;  2KRG A;  4UU5 A;  2OGP A;  1WH1 A;  5HFE A;  5DTH A;  1WHD A;  2I0L A;  1KWA A;  3PV4 A;  2QKV A;  4K72 A;  1UIT A;  2JIN A;  2HE2 A;  2W4F A;  1PDR A;  4OEP A;  5HFC A;  4N6X A;  1M5Z A;  3PV2 A;  2AIN A;  3ID4 A;  4R2Z A;  2KL1 A;  1RGR A;  3KHF A;  3R68 A;  1X9Z A;  3DJA A;  2KPK A;  4RI0 A;  3KDK A;  4P0C A;  1TQ3 A;  4KFV A;  1Q3O A;  5JXB A;  2KA9 A;  3MH4 A;  2V90 A;  4Q2O A;  2GEF A;  2G5M B;  2EDP A;  2PZD A;  4JOG A;  5HDY A;  1FC9 A;  2DLS A;  1OZI A;  1IU0 A;  4Z8J A;  2WL7 A;  4NMO A;  1N7F A;  3KZE A;  4MPA A;  1RZX A;  2OSG A;  2Z9I A;  4NXQ A;  1L6O A;  1UFX A;  2QBW A;  1GM1 A;  2JWE A;  4YDP A;  1OBZ A;  2H2B A;  5HEY A;  1X45 A;  3DJ3 A;  1G9O A;  1NF3 C;  2H2C A;  1OBY A;  4FLN A;  2ZPM A;  4REY A;  1N6F A;  2ZPL A;  2OCS A;  3VQG A;  3L4F D;  4K76 A;  4JOP A;  1X5R A;  2RCZ A;  3GSL A;  2KJD A;  1TP3 A;  1WF8 A;  2L97 A;  2I4S A;  5HJ1 A;  2ENO A;  1OBX A;  4JOE A;  5E11 A;  2HE4 A;  3R0H A;  2EAQ A;  2KAW A;  2QT5 A;  4JOF A;  4O06 A;  1U38 A;  1R6J A;  3QO6 A;  5E22 A;  1Y8T A;  4G69 A;  2M0Z A;  1LCY A;  1T2M A;  1WHA A;  5HEB A;  1I16 A;  2JSN A;  3STJ A;  1P1D A;  1YBO A;  1U3B A;  5E6P B;  4F8K A;  4EDJ A;  3CYY A;  2W7R A;  5B6L A;  2KOM A;  3QIK A;  1MC7 A;  5HF4 A;  2VSV A;  2VSP A;  3QJM A;  2G2L A;  1N6D A;  4Q6H A;  1IU2 A;  5A2P A;  2VWR A;  1SOT A;  4NMP A;  3BPU A;  2VRF A;  2JRE A;  3OU0 A;  4K6Y A;  3K82 A;  3WKL A;  1VB7 A;  2EV8 A;  5F3X A;  1I92 A;  3VQF A;  2HGA A;  5GLJ A;  3HVQ C;  2DB5 A;  2FNE A;  3RLE A;  2QKU A;  4OEO A;  2CSJ A;  3ZRT A;  2REY A;  4HOP B;  3ID3 A;  1Z87 A;  1VA8 A;  1QAV A;  2EGO A;  2Z17 A;  1BFE A;  2GZV A;  3ID1 A;  2KPL A;  4Q2P A;  1FCF A;  2R4H A;  1V5L A;  5GND A;  1MFG A;  2OZF A;  3SHU A;  3QGL A;  4NMV A;  5H3J A;  2FCF A;  1Y7N A;  2D8I A;  1KY9 A;  2YUB A;  4E3B A;  3KZD A;  5G1E A;  2H3M A;  1UJU A;  1VAE A;  3SFJ A;  2VZ5 A;  4Q6S A;  3RL8 A;  2EJY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...