2Q3GA

Structure of the pdz domain of human pdlim7 bound to a c-terminal extension from human beta-tropomyosin
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
89
structure length
89
Chain Sequence
b'SMDSFKVVLEGPAPWGFRLQGGKDFNVPLSISRLTPGGKAAQAGVAVGDWVLSIDGENAGSLTHIEAQNKIRACGERLSLGLSRAITSL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PDZ and LIM domain protein 7
publication title Structure of the PDZ domain of human PDLIM7 bound to a C-terminal extension from human beta-tropomyosin
rcsb
source organism Homo sapiens
molecule tags Structural genomics
total genus 20
structure length 89
sequence length 89
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 2q3gA00
3QJNA 1Z87A 1D5GA 4N6XA 2D92A 4JOEA 2QBWA 2KYLA 1W9OA 2R3YA 1U39A 2MHOA 1V5LA 1VCWA 2BYGA 2JOAA 2LA8A 3RL7A 2KPLA 4Q2NA 4NMPA 2KA9A 3CS0A 2EJYA 4JOPA 4NMTA 1UJUA 3MH6A 5GNDA 3ID4A 3GGEA 1QLCA 3SUZA 2OPGA 3CBXA 2JINA 3FY5A 1OBXA 3QJMA 1N6FA 4JOFA 5HFCA 2QKTA 2EXGA 2LC7A 4Q2OA 1T2MA 3DJ3A 1KWAA 3WKLA 5HF4A 5G1DA 2JILA 2D90A 2X7ZA 1VAEA 2EEIA 1W9EA 4P2AB 3CC0A 3GSLA 4KFVA 1U3BA 2OS6A 2VSVA 2IWPA 3SFJA 1W9QA 4NXPA 3ID1A 4JL7A 2KRGA 4OEPA 4REYA 1N6EA 2PNTA 4MPAA 4UU6A 1GQ4A 2I4SA 1R6JA 2IWOA 1FC9A 1UHPA 1Q3OA 2KQFA 4JORA 1V5QA 4NXQA 3GCNA 2KV8A 3PDZA 4K6YA 3DJAA 2I04A 2KOJA 2YT8A 2Q3GA 1FCFA 1X5RA 3DIWA 3AXAA 2EGNA 2ZPMA 3LNXA 4GVCA 5HF1A 2VSPA 1TP5A 1WHDA 3TMHA 3SHUA 2OSGA 2FCFA 2IWQA 2VZ5A 4K75A 1UEWA 3BPUA 3R0HA 2IWNA 5HFDA 2JWEA 3I18A 2YTWA 2M0TA 1UITA 2F0AA 1IU2A 2FE5A 1UF1A 3O46A 2CSSA 2M0VA 5EYZA 3GDSA 4Q2PA 2EGOA 2M3MA 3ID3A 4HOPA 2H3MA 1RGWA 1WFGA 2EEJA 2QKUA 2VWRA 2DC2A 1GM1A 2V1WA 1IU0A 3I1EA 1VA8A 4YDPA 1GQ5A 2FN5A 4OAJA 5DTHA 2KJDA 1LCYA 2RRMA 1WIFA 5HEBA 2OZFA 4JOKA 3VQFA 2D8IA 5HEDA 1UEZA 1WF8A 2MX6A 2PDZA 3SHWA 3VQGA 2M0ZA 1V1TA 5G1EA 4P0CA 2L4TA 4OEOA 3NFKA 3KHFA 3R68A 4IC6A 3QO6A 5HEYA 1ZOKA 5E11A 2I1NA 2DAZA 1Z86A 2CS5A 2DMZA 1RGRA 1OBZA 1XZ9A 2ZPLA 1OBYA 1X6DA 3K50A 2AWUA 4JOGA 4JOJA 2OMJA 1QAUA 3K1RA 2EEGA 1UEQA 1NTEA 2H2CA 2PA1A 5HFBA 4WYTA 1MFLA 2EDPA 2KJKA 2KJPA 2WL7A 3GJ9A 4K78A 1U38A 1WFVA 2PKUA 3MH4A 2M10A 2DM8A 5E1YA 3RLEA 1K32A 2QT5A 4K76A 2KAWA 3TSZA 4GVDA 3JXTA 2YUYA 1X5QA 3O5NA 5F67A 2G5MB 2YT7A 2AINA 2JREA 2I0LA 2M0UA 1YBOA 2K1ZA 4NMVA 3TSVA 4Q6HA 2YUBA 2AWXA 1RZXA 1TQ3A 3NGHA 2DLUA 4KFWA 2EHRA 1QAVA 2OCSA 1MC7A 3B76A 5A2PA 1NF3C 2EGKA 5E6PB 5HFFA 2F5YA 3STJA 2L97A 2DB5A 2EAQA 3NFLA 4O06A 2R4HA 1WG6A 1M5ZA 1P1DA 2HE2A 2KBSA 3DORA 1WH1A 2EDVA 2LUIA 4K72A 2KOMA 1TP3A 2OGPA 3HVQC 1B8QA 1VB7A 2W7RA 3RL8A 1WHAA 4PQWA 3QE1A 1X45A 2E7KA 2L4SA 2P3WA 2KG2A 2FNEA 1L6OA 2HE4A 4RI0A 2PKTA 4NNLA 2CSJA 1UM7A 1OZIA 1P1EA 2VRFA 3PV4A 3ZRTA 1N6DA 1I16A 1G9OA 5E21A 4UU5A 1IHJA 1Y7NA 2OQSA 1BFEA 4Q2QA 4JOHA 3OU0A 1VJ6A 1WI2A 3PV2A 2G2LA 5HETA 2JXOA 2EDZA 3CYYA 3QDOA 2Q9VA 5GLJA 4Z33A 2KOHA 4XHVA 1FC6A 1Q3PA 1N7TA 5HDYA 4H11A 4NMOA 1WI4A 3OTPA 5I7ZA 3PS4A 5D13A 4NXRA 2I0IA 4R2ZA 4LMMA 1QAVB 1RY4A 1N99A 4E35A 2EV8A 5HJ1A 3QIKA 4NNMA 2VPHA 2K20A 1N7FA 1I92A 3SOEA 1PDRA 5EZ0A 4Q3HA 4WYUA 2H2BA 4NMQA 4EDJA 3PDVA 2V90A 4HOPB 2PZDA 1SOZA 4Z8JA 1X5NA 3ID2A 3HPKA 5JXBA 3EGGC 4NMSA 2LOBA 3KZDA 3GCOA 2KL1A 1V6BA 2Z9IA 3QGLA 3TSWA 4AMHA 4NMRA 2REYA 2LC6A 2RCZA 1UFXA 3E17A 2O2TA 1N7EA 1FC7A 2UZCA 2QG1A 2W4FA 3EGHC 1WJLA 3LNYA 4E34A 4L8NA 3KZEA 5FHTA 4Q6SA 3R69A 3MH7A 5E22A 1SOTA 1UM1A 2QKVA 3CH8A 2GZVA 1UJVA 3K82A 3I4WA 3L4FD 1UJDA 2H3LA 3PV5A 3CBZA 2I6VA 3CBYA 1WF7A 2HGAA 4YYXA 1TE0A 1V62A 5B6LA 3HPMA 2AWWA 1BE9A 3GDUA 3GDVA 5F3XA 1ZUBA 5HFEA 3DJ1A 3WKMA 4FGMA 5H3JA 1MFGA 4F8KA 1Y8TA 4G69A 4GHNA 2DLSA 1UEPA 2KPKA 2DJTA 1KY9A 1KEFA 5FB8C 1X8SA 1U37A 2JIKA 2Z17A 2ENOA 4E3BA 1Q7XA 2DKRA 2EEHA
chains in the Genus database with same CATH superfamily
3QJNA 1Z87A 1D5GA 4N6XA 2D92A 4JOEA 2QBWA 2KYLA 1W9OA 2R3YA 1U39A 2MHOA 1V5LA 1VCWA 2BYGA 2JOAA 2LA8A 3RL7A 2KPLA 4Q2NA 4NMPA 2KA9A 3CS0A 2EJYA 4JOPA 4NMTA 1UJUA 3MH6A 5GNDA 3ID4A 3GGEA 1QLCA 3SUZA 2OPGA 3CBXA 2JINA 3FY5A 1OBXA 5ILBA 3QJMA 1N6FA 4JOFA 5HFCA 2QKTA 2EXGA 2LC7A 4Q2OA 1T2MA 3DJ3A 1KWAA 3WKLA 5HF4A 5G1DA 2JILA 2D90A 2X7ZA 1VAEA 2EEIA 1W9EA 4P2AB 3CC0A 3GSLA 4KFVA 1U3BA 2OS6A 2VSVA 2IWPA 3SFJA 1W9QA 4NXPA 3ID1A 4JL7A 2KRGA 4OEPA 5IL9A 4REYA 1N6EA 2PNTA 4MPAA 4UU6A 1GQ4A 2I4SA 1R6JA 2IWOA 1FC9A 1UHPA 1Q3OA 2KQFA 4JORA 1V5QA 4NXQA 3GCNA 2KV8A 3PDZA 4K6YA 3DJAA 2I04A 2KOJA 3GABA 2YT8A 2Q3GA 1FCFA 1X5RA 3DIWA 3AXAA 2EGNA 2ZPMA 3LNXA 4GVCA 5HF1A 2VSPA 1TP5A 1WHDA 3TMHA 3SHUA 2OSGA 2FCFA 2IWQA 2VZ5A 4K75A 1UEWA 3BPUA 3R0HA 2IWNA 5HFDA 2JWEA 3I18A 2YTWA 4JJ0A 2M0TA 1UITA 2F0AA 1IU2A 2FE5A 1UF1A 3O46A 2CSSA 2M0VA 5EYZA 3GDSA 4Q2PA 2EGOA 2M3MA 3ID3A 4HOPA 2H3MA 1RGWA 1WFGA 2EEJA 2QKUA 2VWRA 2DC2A 1GM1A 2V1WA 1IU0A 3I1EA 1VA8A 4YDPA 1GQ5A 2FN5A 4OAJA 5DTHA 2KJDA 3KDGA 1LCYA 2RRMA 1WIFA 5HEBA 2OZFA 4JOKA 3VQFA 2D8IA 5HEDA 1UEZA 1WF8A 2MX6A 2PDZA 3SHWA 3VQGA 2M0ZA 1V1TA 5G1EA 4P0CA 2L4TA 4OEOA 3NFKA 3KHFA 3R68A 4IC6A 3QO6A 5HEYA 1ZOKA 5E11A 2I1NA 2DAZA 1Z86A 2CS5A 2DMZA 1RGRA 1OBZA 1XZ9A 2ZPLA 1OBYA 1X6DA 3K50A 2AWUA 4JOGA 4JOJA 2OMJA 1QAUA 3K1RA 2EEGA 1UEQA 1NTEA 2H2CA 2PA1A 5HFBA 4WYTA 1MFLA 2EDPA 2KJKA 2KJPA 2WL7A 3GJ9A 4K78A 1U38A 1WFVA 2GEFA 2PKUA 3MH4A 2M10A 2DM8A 5E1YA 3RLEA 1K32A 2QT5A 4K76A 2KAWA 3TSZA 4GVDA 3JXTA 2YUYA 1X5QA 3O5NA 5F67A 2G5MB 2YT7A 2AINA 2JREA 2I0LA 2M0UA 1YBOA 2K1ZA 4NMVA 3TSVA 4Q6HA 2YUBA 2AWXA 1RZXA 1TQ3A 3NGHA 2DLUA 4KFWA 2EHRA 1QAVA 2OCSA 1MC7A 3B76A 3NCVA 5A2PA 1NF3C 2EGKA 5E6PB 5HFFA 2F5YA 3STJA 2L97A 2DB5A 2EAQA 3NFLA 4O06A 2R4HA 1WG6A 1M5ZA 1P1DA 2HE2A 2KBSA 3DORA 1WH1A 2EDVA 2JSNA 2LUIA 4K72A 4JJ3A 2KOMA 1TP3A 2OGPA 3HVQC 1B8QA 1VB7A 2W7RA 3RL8A 1WHAA 4PQWA 3QE1A 1X45A 2E7KA 2L4SA 2P3WA 2KG2A 2FNEA 1L6OA 2HE4A 4RI0A 2PKTA 4NNLA 2CSJA 1UM7A 1OZIA 1P1EA 2VRFA 3PV4A 3ZRTA 1N6DA 1I16A 1G9OA 5E21A 4UU5A 1IHJA 1Y7NA 2OQSA 5B42A 1BFEA 4Q2QA 4JOHA 3OU0A 1VJ6A 1WI2A 3PV2A 2G2LA 5HETA 2JXOA 2EDZA 3CYYA 3QDOA 2Q9VA 5GLJA 4Z33A 2KOHA 4XHVA 1FC6A 1Q3PA 1N7TA 5HDYA 4H11A 4NMOA 1WI4A 3OTPA 5I7ZA 3PS4A 5D13A 4NXRA 2I0IA 4R2ZA 4LMMA 1QAVB 1RY4A 1N99A 4E35A 2EV8A 5HJ1A 3QIKA 4NNMA 2VPHA 2K20A 1N7FA 1I92A 3SOEA 1PDRA 5EZ0A 4Q3HA 4WYUA 2H2BA 4NMQA 4EDJA 1X9ZA 3PDVA 2V90A 4HOPB 2PZDA 1SOZA 4FLNA 1X5NA 3ID2A 4Z8JA 3HPKA 5JXBA 3KDKA 3EGGC 4NMSA 2LOBA 3KZDA 3GCOA 2KL1A 1V6BA 2Z9IA 3QGLA 3TSWA 4AMHA 4NMRA 2REYA 2LC6A 2RCZA 1UFXA 3E17A 2O2TA 1N7EA 1FC7A 2UZCA 2QG1A 2W4FA 3EGHC 1WJLA 3LNYA 4E34A 4L8NA 3KZEA 5FHTA 4Q6SA 3R69A 3MH7A 5E22A 1SOTA 1UM1A 2QKVA 3CH8A 2GZVA 1UJVA 3K82A 3I4WA 3L4FD 1UJDA 2H3LA 3PV5A 3CBZA 2I6VA 3CBYA 1WF7A 2HGAA 4YYXA 1TE0A 1V62A 5B6LA 3HPMA 2AWWA 1BE9A 3GDUA 3GDVA 5F3XA 1ZUBA 5HFEA 3DJ1A 3WKMA 4FGMA 5H3JA 1MFGA 4F8KA 1Y8TA 4G69A 4GHNA 2DLSA 1UEPA 2KPKA 2DJTA 1KY9A 1KEFA 5FB8C 1X8SA 1U37A 2JIKA 2Z17A 2ENOA 4E3BA 1Q7XA 2DKRA 2EEHA
chains in the Genus database with same CATH topology
3QJNA 1Z87A 1D5GA 4N6XA 2D92A 4JOEA 2QBWA 2KYLA 1W9OA 2R3YA 1U39A 2MHOA 1V5LA 1VCWA 2BYGA 2JOAA 2LA8A 3RL7A 2KPLA 4Q2NA 4NMPA 2KA9A 3CS0A 2EJYA 4JOPA 4NMTA 1UJUA 3MH6A 5GNDA 3ID4A 3GGEA 1QLCA 3SUZA 2OPGA 3CBXA 2JINA 3FY5A 1OBXA 5ILBA 3QJMA 1N6FA 4JOFA 5HFCA 2QKTA 2EXGA 2LC7A 4Q2OA 1T2MA 3DJ3A 1KWAA 3WKLA 5HF4A 5G1DA 2JILA 2D90A 2X7ZA 1VAEA 2EEIA 1W9EA 4P2AB 3CC0A 3GSLA 4KFVA 1U3BA 2OS6A 2VSVA 2IWPA 3SFJA 1W9QA 4NXPA 3ID1A 4JL7A 2KRGA 4OEPA 5IL9A 4REYA 1N6EA 2PNTA 4MPAA 4UU6A 1GQ4A 2I4SA 1R6JA 2IWOA 1FC9A 1UHPA 1Q3OA 2KQFA 4JORA 1V5QA 4NXQA 3GCNA 2KV8A 3PDZA 4K6YA 3DJAA 2I04A 2KOJA 3GABA 2YT8A 2Q3GA 1FCFA 1X5RA 3DIWA 3AXAA 2EGNA 2ZPMA 3LNXA 4GVCA 5HF1A 2VSPA 1TP5A 1WHDA 3TMHA 3SHUA 2OSGA 2FCFA 2IWQA 2VZ5A 4K75A 1UEWA 3BPUA 3R0HA 2IWNA 5HFDA 2JWEA 3I18A 2YTWA 4JJ0A 2M0TA 1UITA 2F0AA 1IU2A 2FE5A 1UF1A 3O46A 2CSSA 2M0VA 5EYZA 3GDSA 4Q2PA 2EGOA 2M3MA 3ID3A 4HOPA 2H3MA 1RGWA 1WFGA 2EEJA 2QKUA 2VWRA 2DC2A 1GM1A 2V1WA 1IU0A 3I1EA 1VA8A 4YDPA 1GQ5A 2FN5A 4OAJA 5DTHA 2KJDA 3KDGA 1LCYA 2RRMA 1WIFA 5HEBA 2OZFA 4JOKA 3VQFA 2D8IA 5HEDA 1UEZA 1WF8A 2MX6A 2PDZA 3SHWA 3VQGA 2M0ZA 1V1TA 5G1EA 4P0CA 2L4TA 4OEOA 3NFKA 3KHFA 3R68A 4IC6A 3QO6A 5HEYA 1ZOKA 5E11A 2I1NA 2DAZA 1Z86A 2CS5A 2DMZA 1RGRA 1OBZA 1XZ9A 2ZPLA 1OBYA 1X6DA 3K50A 2AWUA 4JOGA 4JOJA 2OMJA 1QAUA 3K1RA 2EEGA 1UEQA 1NTEA 2H2CA 2PA1A 5HFBA 4WYTA 1MFLA 2EDPA 2KJKA 2KJPA 2WL7A 3GJ9A 4K78A 1U38A 1WFVA 2GEFA 2PKUA 3MH4A 2M10A 2DM8A 5E1YA 3RLEA 1K32A 2QT5A 4K76A 2KAWA 3TSZA 4GVDA 3JXTA 2YUYA 1X5QA 3O5NA 5F67A 2G5MB 2YT7A 2AINA 2JREA 2I0LA 2M0UA 1YBOA 2K1ZA 4NMVA 3TSVA 4Q6HA 2YUBA 2AWXA 1RZXA 1TQ3A 3NGHA 2DLUA 4KFWA 2EHRA 1QAVA 2OCSA 1MC7A 3B76A 3NCVA 5A2PA 1NF3C 2EGKA 5E6PB 5HFFA 2F5YA 3STJA 2L97A 2DB5A 2EAQA 3NFLA 4O06A 2R4HA 1WG6A 1M5ZA 1P1DA 2HE2A 2KBSA 3DORA 1WH1A 2EDVA 2JSNA 2LUIA 4K72A 4JJ3A 2KOMA 1TP3A 2OGPA 3HVQC 1B8QA 1VB7A 2W7RA 3RL8A 1WHAA 4PQWA 3QE1A 1X45A 2E7KA 2L4SA 2P3WA 2KG2A 2FNEA 1L6OA 2HE4A 4RI0A 2PKTA 4NNLA 2CSJA 1UM7A 1OZIA 1P1EA 2VRFA 3PV4A 3ZRTA 1N6DA 1I16A 1G9OA 5E21A 4UU5A 1IHJA 1Y7NA 2OQSA 5B42A 1BFEA 4Q2QA 4JOHA 3OU0A 1VJ6A 1WI2A 3PV2A 2G2LA 5HETA 2JXOA 2EDZA 3CYYA 3QDOA 2Q9VA 5GLJA 4Z33A 2KOHA 4XHVA 1FC6A 1Q3PA 1N7TA 5HDYA 4H11A 4NMOA 1WI4A 3OTPA 5I7ZA 3PS4A 5D13A 4NXRA 2I0IA 4R2ZA 4LMMA 1QAVB 1RY4A 1N99A 4E35A 2EV8A 5HJ1A 3QIKA 4NNMA 2VPHA 2K20A 1N7FA 1I92A 3SOEA 1PDRA 5EZ0A 4Q3HA 4WYUA 2H2BA 4NMQA 4EDJA 1X9ZA 3PDVA 2V90A 4HOPB 2PZDA 1SOZA 4FLNA 1X5NA 3ID2A 4Z8JA 3HPKA 5JXBA 3KDKA 3EGGC 4NMSA 2LOBA 3KZDA 3GCOA 2KL1A 1V6BA 2Z9IA 3QGLA 3TSWA 4AMHA 4NMRA 2REYA 2LC6A 2RCZA 1UFXA 3E17A 2O2TA 1N7EA 1FC7A 2UZCA 2QG1A 2W4FA 3EGHC 1WJLA 3LNYA 4E34A 4L8NA 3KZEA 5FHTA 4Q6SA 3R69A 3MH7A 5E22A 1SOTA 1UM1A 2QKVA 3CH8A 2GZVA 1UJVA 3K82A 3I4WA 3L4FD 1UJDA 2H3LA 3PV5A 3CBZA 2I6VA 3CBYA 1WF7A 2HGAA 4YYXA 1TE0A 1V62A 5B6LA 3HPMA 2AWWA 1BE9A 3GDUA 3GDVA 5F3XA 1ZUBA 5HFEA 3DJ1A 3WKMA 4FGMA 5H3JA 1MFGA 4F8KA 1Y8TA 4G69A 4GHNA 2DLSA 1UEPA 2KPKA 2DJTA 1KY9A 1KEFA 5FB8C 1X8SA 1U37A 2JIKA 2Z17A 2ENOA 4E3BA 1Q7XA 2DKRA 2EEHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QJN A;  1Z87 A;  1D5G A;  4N6X A;  2D92 A;  4JOE A;  2QBW A;  2KYL A;  1W9O A;  2R3Y A;  1U39 A;  2MHO A;  1V5L A;  1VCW A;  2BYG A;  2JOA A;  2LA8 A;  3RL7 A;  2KPL A;  4Q2N A;  4NMP A;  2KA9 A;  3CS0 A;  2EJY A;  4JOP A;  4NMT A;  1UJU A;  3MH6 A;  5GND A;  3ID4 A;  3GGE A;  1QLC A;  3SUZ A;  2OPG A;  3CBX A;  2JIN A;  3FY5 A;  1OBX A;  3QJM A;  1N6F A;  4JOF A;  5HFC A;  2QKT A;  2EXG A;  2LC7 A;  4Q2O A;  1T2M A;  3DJ3 A;  1KWA A;  3WKL A;  5HF4 A;  5G1D A;  2JIL A;  2D90 A;  2X7Z A;  1VAE A;  2EEI A;  1W9E A;  4P2A B;  3CC0 A;  3GSL A;  4KFV A;  1U3B A;  2OS6 A;  2VSV A;  2IWP A;  3SFJ A;  1W9Q A;  4NXP A;  3ID1 A;  4JL7 A;  2KRG A;  4OEP A;  4REY A;  1N6E A;  2PNT A;  4MPA A;  4UU6 A;  1GQ4 A;  2I4S A;  1R6J A;  2IWO A;  1FC9 A;  1UHP A;  1Q3O A;  2KQF A;  4JOR A;  1V5Q A;  4NXQ A;  3GCN A;  2KV8 A;  3PDZ A;  4K6Y A;  3DJA A;  2I04 A;  2KOJ A;  2YT8 A;  2Q3G A;  1FCF A;  1X5R A;  3DIW A;  3AXA A;  2EGN A;  2ZPM A;  3LNX A;  4GVC A;  5HF1 A;  2VSP A;  1TP5 A;  1WHD A;  3TMH A;  3SHU A;  2OSG A;  2FCF A;  2IWQ A;  2VZ5 A;  4K75 A;  1UEW A;  3BPU A;  3R0H A;  2IWN A;  5HFD A;  2JWE A;  3I18 A;  2YTW A;  2M0T A;  1UIT A;  2F0A A;  1IU2 A;  2FE5 A;  1UF1 A;  3O46 A;  2CSS A;  2M0V A;  5EYZ A;  3GDS A;  4Q2P A;  2EGO A;  2M3M A;  3ID3 A;  4HOP A;  2H3M A;  1RGW A;  1WFG A;  2EEJ A;  2QKU A;  2VWR A;  2DC2 A;  1GM1 A;  2V1W A;  1IU0 A;  3I1E A;  1VA8 A;  4YDP A;  1GQ5 A;  2FN5 A;  4OAJ A;  5DTH A;  2KJD A;  1LCY A;  2RRM A;  1WIF A;  5HEB A;  2OZF A;  4JOK A;  3VQF A;  2D8I A;  5HED A;  1UEZ A;  1WF8 A;  2MX6 A;  2PDZ A;  3SHW A;  3VQG A;  2M0Z A;  1V1T A;  5G1E A;  4P0C A;  2L4T A;  4OEO A;  3NFK A;  3KHF A;  3R68 A;  4IC6 A;  3QO6 A;  5HEY A;  1ZOK A;  5E11 A;  2I1N A;  2DAZ A;  1Z86 A;  2CS5 A;  2DMZ A;  1RGR A;  1OBZ A;  1XZ9 A;  2ZPL A;  1OBY A;  1X6D A;  3K50 A;  2AWU A;  4JOG A;  4JOJ A;  2OMJ A;  1QAU A;  3K1R A;  2EEG A;  1UEQ A;  1NTE A;  2H2C A;  2PA1 A;  5HFB A;  4WYT A;  1MFL A;  2EDP A;  2KJK A;  2KJP A;  2WL7 A;  3GJ9 A;  4K78 A;  1U38 A;  1WFV A;  2PKU A;  3MH4 A;  2M10 A;  2DM8 A;  5E1Y A;  3RLE A;  1K32 A;  2QT5 A;  4K76 A;  2KAW A;  3TSZ A;  4GVD A;  3JXT A;  2YUY A;  1X5Q A;  3O5N A;  5F67 A;  2G5M B;  2YT7 A;  2AIN A;  2JRE A;  2I0L A;  2M0U A;  1YBO A;  2K1Z A;  4NMV A;  3TSV A;  4Q6H A;  2YUB A;  2AWX A;  1RZX A;  1TQ3 A;  3NGH A;  2DLU A;  4KFW A;  2EHR A;  1QAV A;  2OCS A;  1MC7 A;  3B76 A;  5A2P A;  1NF3 C;  2EGK A;  5E6P B;  5HFF A;  2F5Y A;  3STJ A;  2L97 A;  2DB5 A;  2EAQ A;  3NFL A;  4O06 A;  2R4H A;  1WG6 A;  1M5Z A;  1P1D A;  2HE2 A;  2KBS A;  3DOR A;  1WH1 A;  2EDV A;  2LUI A;  4K72 A;  2KOM A;  1TP3 A;  2OGP A;  3HVQ C;  1B8Q A;  1VB7 A;  2W7R A;  3RL8 A;  1WHA A;  4PQW A;  3QE1 A;  1X45 A;  2E7K A;  2L4S A;  2P3W A;  2KG2 A;  2FNE A;  1L6O A;  2HE4 A;  4RI0 A;  2PKT A;  4NNL A;  2CSJ A;  1UM7 A;  1OZI A;  1P1E A;  2VRF A;  3PV4 A;  3ZRT A;  1N6D A;  1I16 A;  1G9O A;  5E21 A;  4UU5 A;  1IHJ A;  1Y7N A;  2OQS A;  1BFE A;  4Q2Q A;  4JOH A;  3OU0 A;  1VJ6 A;  1WI2 A;  3PV2 A;  2G2L A;  5HET A;  2JXO A;  2EDZ A;  3CYY A;  3QDO A;  2Q9V A;  5GLJ A;  4Z33 A;  2KOH A;  4XHV A;  1FC6 A;  1Q3P A;  1N7T A;  5HDY A;  4H11 A;  4NMO A;  1WI4 A;  3OTP A;  5I7Z A;  3PS4 A;  5D13 A;  4NXR A;  2I0I A;  4R2Z A;  4LMM A;  1QAV B;  1RY4 A;  1N99 A;  4E35 A;  2EV8 A;  5HJ1 A;  3QIK A;  4NNM A;  2VPH A;  2K20 A;  1N7F A;  1I92 A;  3SOE A;  1PDR A;  5EZ0 A;  4Q3H A;  4WYU A;  2H2B A;  4NMQ A;  4EDJ A;  3PDV A;  2V90 A;  4HOP B;  2PZD A;  1SOZ A;  4Z8J A;  1X5N A;  3ID2 A;  3HPK A;  5JXB A;  3EGG C;  4NMS A;  2LOB A;  3KZD A;  3GCO A;  2KL1 A;  1V6B A;  2Z9I A;  3QGL A;  3TSW A;  4AMH A;  4NMR A;  2REY A;  2LC6 A;  2RCZ A;  1UFX A;  3E17 A;  2O2T A;  1N7E A;  1FC7 A;  2UZC A;  2QG1 A;  2W4F A;  3EGH C;  1WJL A;  3LNY A;  4E34 A;  4L8N A;  3KZE A;  5FHT A;  4Q6S A;  3R69 A;  3MH7 A;  5E22 A;  1SOT A;  1UM1 A;  2QKV A;  3CH8 A;  2GZV A;  1UJV A;  3K82 A;  3I4W A;  3L4F D;  1UJD A;  2H3L A;  3PV5 A;  3CBZ A;  2I6V A;  3CBY A;  1WF7 A;  2HGA A;  4YYX A;  1TE0 A;  1V62 A;  5B6L A;  3HPM A;  2AWW A;  1BE9 A;  3GDU A;  3GDV A;  5F3X A;  1ZUB A;  5HFE A;  3DJ1 A;  3WKM A;  4FGM A;  5H3J A;  1MFG A;  4F8K A;  1Y8T A;  4G69 A;  4GHN A;  2DLS A;  1UEP A;  2KPK A;  2DJT A;  1KY9 A;  1KEF A;  5FB8 C;  1X8S A;  1U37 A;  2JIK A;  2Z17 A;  2ENO A;  4E3B A;  1Q7X A;  2DKR A;  2EEH A; 
#chains in the Genus database with same CATH topology
 3QJN A;  1Z87 A;  1D5G A;  4N6X A;  2D92 A;  4JOE A;  2QBW A;  2KYL A;  1W9O A;  2R3Y A;  1U39 A;  2MHO A;  1V5L A;  1VCW A;  2BYG A;  2JOA A;  2LA8 A;  3RL7 A;  2KPL A;  4Q2N A;  4NMP A;  2KA9 A;  3CS0 A;  2EJY A;  4JOP A;  4NMT A;  1UJU A;  3MH6 A;  5GND A;  3ID4 A;  3GGE A;  1QLC A;  3SUZ A;  2OPG A;  3CBX A;  2JIN A;  3FY5 A;  1OBX A;  5ILB A;  3QJM A;  1N6F A;  4JOF A;  5HFC A;  2QKT A;  2EXG A;  2LC7 A;  4Q2O A;  1T2M A;  3DJ3 A;  1KWA A;  3WKL A;  5HF4 A;  5G1D A;  2JIL A;  2D90 A;  2X7Z A;  1VAE A;  2EEI A;  1W9E A;  4P2A B;  3CC0 A;  3GSL A;  4KFV A;  1U3B A;  2OS6 A;  2VSV A;  2IWP A;  3SFJ A;  1W9Q A;  4NXP A;  3ID1 A;  4JL7 A;  2KRG A;  4OEP A;  5IL9 A;  4REY A;  1N6E A;  2PNT A;  4MPA A;  4UU6 A;  1GQ4 A;  2I4S A;  1R6J A;  2IWO A;  1FC9 A;  1UHP A;  1Q3O A;  2KQF A;  4JOR A;  1V5Q A;  4NXQ A;  3GCN A;  2KV8 A;  3PDZ A;  4K6Y A;  3DJA A;  2I04 A;  2KOJ A;  3GAB A;  2YT8 A;  2Q3G A;  1FCF A;  1X5R A;  3DIW A;  3AXA A;  2EGN A;  2ZPM A;  3LNX A;  4GVC A;  5HF1 A;  2VSP A;  1TP5 A;  1WHD A;  3TMH A;  3SHU A;  2OSG A;  2FCF A;  2IWQ A;  2VZ5 A;  4K75 A;  1UEW A;  3BPU A;  3R0H A;  2IWN A;  5HFD A;  2JWE A;  3I18 A;  2YTW A;  4JJ0 A;  2M0T A;  1UIT A;  2F0A A;  1IU2 A;  2FE5 A;  1UF1 A;  3O46 A;  2CSS A;  2M0V A;  5EYZ A;  3GDS A;  4Q2P A;  2EGO A;  2M3M A;  3ID3 A;  4HOP A;  2H3M A;  1RGW A;  1WFG A;  2EEJ A;  2QKU A;  2VWR A;  2DC2 A;  1GM1 A;  2V1W A;  1IU0 A;  3I1E A;  1VA8 A;  4YDP A;  1GQ5 A;  2FN5 A;  4OAJ A;  5DTH A;  2KJD A;  3KDG A;  1LCY A;  2RRM A;  1WIF A;  5HEB A;  2OZF A;  4JOK A;  3VQF A;  2D8I A;  5HED A;  1UEZ A;  1WF8 A;  2MX6 A;  2PDZ A;  3SHW A;  3VQG A;  2M0Z A;  1V1T A;  5G1E A;  4P0C A;  2L4T A;  4OEO A;  3NFK A;  3KHF A;  3R68 A;  4IC6 A;  3QO6 A;  5HEY A;  1ZOK A;  5E11 A;  2I1N A;  2DAZ A;  1Z86 A;  2CS5 A;  2DMZ A;  1RGR A;  1OBZ A;  1XZ9 A;  2ZPL A;  1OBY A;  1X6D A;  3K50 A;  2AWU A;  4JOG A;  4JOJ A;  2OMJ A;  1QAU A;  3K1R A;  2EEG A;  1UEQ A;  1NTE A;  2H2C A;  2PA1 A;  5HFB A;  4WYT A;  1MFL A;  2EDP A;  2KJK A;  2KJP A;  2WL7 A;  3GJ9 A;  4K78 A;  1U38 A;  1WFV A;  2GEF A;  2PKU A;  3MH4 A;  2M10 A;  2DM8 A;  5E1Y A;  3RLE A;  1K32 A;  2QT5 A;  4K76 A;  2KAW A;  3TSZ A;  4GVD A;  3JXT A;  2YUY A;  1X5Q A;  3O5N A;  5F67 A;  2G5M B;  2YT7 A;  2AIN A;  2JRE A;  2I0L A;  2M0U A;  1YBO A;  2K1Z A;  4NMV A;  3TSV A;  4Q6H A;  2YUB A;  2AWX A;  1RZX A;  1TQ3 A;  3NGH A;  2DLU A;  4KFW A;  2EHR A;  1QAV A;  2OCS A;  1MC7 A;  3B76 A;  3NCV A;  5A2P A;  1NF3 C;  2EGK A;  5E6P B;  5HFF A;  2F5Y A;  3STJ A;  2L97 A;  2DB5 A;  2EAQ A;  3NFL A;  4O06 A;  2R4H A;  1WG6 A;  1M5Z A;  1P1D A;  2HE2 A;  2KBS A;  3DOR A;  1WH1 A;  2EDV A;  2JSN A;  2LUI A;  4K72 A;  4JJ3 A;  2KOM A;  1TP3 A;  2OGP A;  3HVQ C;  1B8Q A;  1VB7 A;  2W7R A;  3RL8 A;  1WHA A;  4PQW A;  3QE1 A;  1X45 A;  2E7K A;  2L4S A;  2P3W A;  2KG2 A;  2FNE A;  1L6O A;  2HE4 A;  4RI0 A;  2PKT A;  4NNL A;  2CSJ A;  1UM7 A;  1OZI A;  1P1E A;  2VRF A;  3PV4 A;  3ZRT A;  1N6D A;  1I16 A;  1G9O A;  5E21 A;  4UU5 A;  1IHJ A;  1Y7N A;  2OQS A;  5B42 A;  1BFE A;  4Q2Q A;  4JOH A;  3OU0 A;  1VJ6 A;  1WI2 A;  3PV2 A;  2G2L A;  5HET A;  2JXO A;  2EDZ A;  3CYY A;  3QDO A;  2Q9V A;  5GLJ A;  4Z33 A;  2KOH A;  4XHV A;  1FC6 A;  1Q3P A;  1N7T A;  5HDY A;  4H11 A;  4NMO A;  1WI4 A;  3OTP A;  5I7Z A;  3PS4 A;  5D13 A;  4NXR A;  2I0I A;  4R2Z A;  4LMM A;  1QAV B;  1RY4 A;  1N99 A;  4E35 A;  2EV8 A;  5HJ1 A;  3QIK A;  4NNM A;  2VPH A;  2K20 A;  1N7F A;  1I92 A;  3SOE A;  1PDR A;  5EZ0 A;  4Q3H A;  4WYU A;  2H2B A;  4NMQ A;  4EDJ A;  1X9Z A;  3PDV A;  2V90 A;  4HOP B;  2PZD A;  1SOZ A;  4FLN A;  1X5N A;  3ID2 A;  4Z8J A;  3HPK A;  5JXB A;  3KDK A;  3EGG C;  4NMS A;  2LOB A;  3KZD A;  3GCO A;  2KL1 A;  1V6B A;  2Z9I A;  3QGL A;  3TSW A;  4AMH A;  4NMR A;  2REY A;  2LC6 A;  2RCZ A;  1UFX A;  3E17 A;  2O2T A;  1N7E A;  1FC7 A;  2UZC A;  2QG1 A;  2W4F A;  3EGH C;  1WJL A;  3LNY A;  4E34 A;  4L8N A;  3KZE A;  5FHT A;  4Q6S A;  3R69 A;  3MH7 A;  5E22 A;  1SOT A;  1UM1 A;  2QKV A;  3CH8 A;  2GZV A;  1UJV A;  3K82 A;  3I4W A;  3L4F D;  1UJD A;  2H3L A;  3PV5 A;  3CBZ A;  2I6V A;  3CBY A;  1WF7 A;  2HGA A;  4YYX A;  1TE0 A;  1V62 A;  5B6L A;  3HPM A;  2AWW A;  1BE9 A;  3GDU A;  3GDV A;  5F3X A;  1ZUB A;  5HFE A;  3DJ1 A;  3WKM A;  4FGM A;  5H3J A;  1MFG A;  4F8K A;  1Y8T A;  4G69 A;  4GHN A;  2DLS A;  1UEP A;  2KPK A;  2DJT A;  1KY9 A;  1KEF A;  5FB8 C;  1X8S A;  1U37 A;  2JIK A;  2Z17 A;  2ENO A;  4E3B A;  1Q7X A;  2DKR A;  2EEH A; 
#chains in the Genus database with same CATH homology
 3QJN A;  1Z87 A;  1D5G A;  4N6X A;  2D92 A;  4JOE A;  2QBW A;  2KYL A;  1W9O A;  2R3Y A;  1U39 A;  2MHO A;  1V5L A;  1VCW A;  2BYG A;  2JOA A;  2LA8 A;  3RL7 A;  2KPL A;  4Q2N A;  4NMP A;  2KA9 A;  3CS0 A;  2EJY A;  4JOP A;  4NMT A;  1UJU A;  3MH6 A;  5GND A;  3ID4 A;  3GGE A;  1QLC A;  3SUZ A;  2OPG A;  3CBX A;  2JIN A;  3FY5 A;  1OBX A;  5ILB A;  3QJM A;  1N6F A;  4JOF A;  5HFC A;  2QKT A;  2EXG A;  2LC7 A;  4Q2O A;  1T2M A;  3DJ3 A;  1KWA A;  3WKL A;  5HF4 A;  5G1D A;  2JIL A;  2D90 A;  2X7Z A;  1VAE A;  2EEI A;  1W9E A;  4P2A B;  3CC0 A;  3GSL A;  4KFV A;  1U3B A;  2OS6 A;  2VSV A;  2IWP A;  3SFJ A;  1W9Q A;  4NXP A;  3ID1 A;  4JL7 A;  2KRG A;  4OEP A;  5IL9 A;  4REY A;  1N6E A;  2PNT A;  4MPA A;  4UU6 A;  1GQ4 A;  2I4S A;  1R6J A;  2IWO A;  1FC9 A;  1UHP A;  1Q3O A;  2KQF A;  4JOR A;  1V5Q A;  4NXQ A;  3GCN A;  2KV8 A;  3PDZ A;  4K6Y A;  3DJA A;  2I04 A;  2KOJ A;  3GAB A;  2YT8 A;  2Q3G A;  1FCF A;  1X5R A;  3DIW A;  3AXA A;  2EGN A;  2ZPM A;  3LNX A;  4GVC A;  5HF1 A;  2VSP A;  1TP5 A;  1WHD A;  3TMH A;  3SHU A;  2OSG A;  2FCF A;  2IWQ A;  2VZ5 A;  4K75 A;  1UEW A;  3BPU A;  3R0H A;  2IWN A;  5HFD A;  2JWE A;  3I18 A;  2YTW A;  4JJ0 A;  2M0T A;  1UIT A;  2F0A A;  1IU2 A;  2FE5 A;  1UF1 A;  3O46 A;  2CSS A;  2M0V A;  5EYZ A;  3GDS A;  4Q2P A;  2EGO A;  2M3M A;  3ID3 A;  4HOP A;  2H3M A;  1RGW A;  1WFG A;  2EEJ A;  2QKU A;  2VWR A;  2DC2 A;  1GM1 A;  2V1W A;  1IU0 A;  3I1E A;  1VA8 A;  4YDP A;  1GQ5 A;  2FN5 A;  4OAJ A;  5DTH A;  2KJD A;  3KDG A;  1LCY A;  2RRM A;  1WIF A;  5HEB A;  2OZF A;  4JOK A;  3VQF A;  2D8I A;  5HED A;  1UEZ A;  1WF8 A;  2MX6 A;  2PDZ A;  3SHW A;  3VQG A;  2M0Z A;  1V1T A;  5G1E A;  4P0C A;  2L4T A;  4OEO A;  3NFK A;  3KHF A;  3R68 A;  4IC6 A;  3QO6 A;  5HEY A;  1ZOK A;  5E11 A;  2I1N A;  2DAZ A;  1Z86 A;  2CS5 A;  2DMZ A;  1RGR A;  1OBZ A;  1XZ9 A;  2ZPL A;  1OBY A;  1X6D A;  3K50 A;  2AWU A;  4JOG A;  4JOJ A;  2OMJ A;  1QAU A;  3K1R A;  2EEG A;  1UEQ A;  1NTE A;  2H2C A;  2PA1 A;  5HFB A;  4WYT A;  1MFL A;  2EDP A;  2KJK A;  2KJP A;  2WL7 A;  3GJ9 A;  4K78 A;  1U38 A;  1WFV A;  2GEF A;  2PKU A;  3MH4 A;  2M10 A;  2DM8 A;  5E1Y A;  3RLE A;  1K32 A;  2QT5 A;  4K76 A;  2KAW A;  3TSZ A;  4GVD A;  3JXT A;  2YUY A;  1X5Q A;  3O5N A;  5F67 A;  2G5M B;  2YT7 A;  2AIN A;  2JRE A;  2I0L A;  2M0U A;  1YBO A;  2K1Z A;  4NMV A;  3TSV A;  4Q6H A;  2YUB A;  2AWX A;  1RZX A;  1TQ3 A;  3NGH A;  2DLU A;  4KFW A;  2EHR A;  1QAV A;  2OCS A;  1MC7 A;  3B76 A;  3NCV A;  5A2P A;  1NF3 C;  2EGK A;  5E6P B;  5HFF A;  2F5Y A;  3STJ A;  2L97 A;  2DB5 A;  2EAQ A;  3NFL A;  4O06 A;  2R4H A;  1WG6 A;  1M5Z A;  1P1D A;  2HE2 A;  2KBS A;  3DOR A;  1WH1 A;  2EDV A;  2JSN A;  2LUI A;  4K72 A;  4JJ3 A;  2KOM A;  1TP3 A;  2OGP A;  3HVQ C;  1B8Q A;  1VB7 A;  2W7R A;  3RL8 A;  1WHA A;  4PQW A;  3QE1 A;  1X45 A;  2E7K A;  2L4S A;  2P3W A;  2KG2 A;  2FNE A;  1L6O A;  2HE4 A;  4RI0 A;  2PKT A;  4NNL A;  2CSJ A;  1UM7 A;  1OZI A;  1P1E A;  2VRF A;  3PV4 A;  3ZRT A;  1N6D A;  1I16 A;  1G9O A;  5E21 A;  4UU5 A;  1IHJ A;  1Y7N A;  2OQS A;  5B42 A;  1BFE A;  4Q2Q A;  4JOH A;  3OU0 A;  1VJ6 A;  1WI2 A;  3PV2 A;  2G2L A;  5HET A;  2JXO A;  2EDZ A;  3CYY A;  3QDO A;  2Q9V A;  5GLJ A;  4Z33 A;  2KOH A;  4XHV A;  1FC6 A;  1Q3P A;  1N7T A;  5HDY A;  4H11 A;  4NMO A;  1WI4 A;  3OTP A;  5I7Z A;  3PS4 A;  5D13 A;  4NXR A;  2I0I A;  4R2Z A;  4LMM A;  1QAV B;  1RY4 A;  1N99 A;  4E35 A;  2EV8 A;  5HJ1 A;  3QIK A;  4NNM A;  2VPH A;  2K20 A;  1N7F A;  1I92 A;  3SOE A;  1PDR A;  5EZ0 A;  4Q3H A;  4WYU A;  2H2B A;  4NMQ A;  4EDJ A;  1X9Z A;  3PDV A;  2V90 A;  4HOP B;  2PZD A;  1SOZ A;  4FLN A;  1X5N A;  3ID2 A;  4Z8J A;  3HPK A;  5JXB A;  3KDK A;  3EGG C;  4NMS A;  2LOB A;  3KZD A;  3GCO A;  2KL1 A;  1V6B A;  2Z9I A;  3QGL A;  3TSW A;  4AMH A;  4NMR A;  2REY A;  2LC6 A;  2RCZ A;  1UFX A;  3E17 A;  2O2T A;  1N7E A;  1FC7 A;  2UZC A;  2QG1 A;  2W4F A;  3EGH C;  1WJL A;  3LNY A;  4E34 A;  4L8N A;  3KZE A;  5FHT A;  4Q6S A;  3R69 A;  3MH7 A;  5E22 A;  1SOT A;  1UM1 A;  2QKV A;  3CH8 A;  2GZV A;  1UJV A;  3K82 A;  3I4W A;  3L4F D;  1UJD A;  2H3L A;  3PV5 A;  3CBZ A;  2I6V A;  3CBY A;  1WF7 A;  2HGA A;  4YYX A;  1TE0 A;  1V62 A;  5B6L A;  3HPM A;  2AWW A;  1BE9 A;  3GDU A;  3GDV A;  5F3X A;  1ZUB A;  5HFE A;  3DJ1 A;  3WKM A;  4FGM A;  5H3J A;  1MFG A;  4F8K A;  1Y8T A;  4G69 A;  4GHN A;  2DLS A;  1UEP A;  2KPK A;  2DJT A;  1KY9 A;  1KEF A;  5FB8 C;  1X8S A;  1U37 A;  2JIK A;  2Z17 A;  2ENO A;  4E3B A;  1Q7X A;  2DKR A;  2EEH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...