4K72A

Cftr associated ligand (cal) pdz domain bound to peptide ical36-vqd (ansrvqdsii)
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
87
structure length
87
Chain Sequence
GPIRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Golgi-associated PDZ and coiled-coil motif-containing protei
publication title Stereochemical Preferences Modulate Affinity and Selectivity among Five PDZ Domains that Bind CFTR: Comparative Structural and Sequence Analyses.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Peptide binding protein/protein binding
total genus 21
structure length 87
sequence length 87
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 4k72A00
1YBOA 2G5MB 5F67A 4NMVA 4NMSA 3JXTA 3DJ3A 4KFWA 4NMRA 1N6FA 2DMZA 2JILA 1V1TA 3PDVA 3GSLA 1KY9A 5HF4A 1T2MA 1QAVA 4Q2OA 2ZPLA 1D5GA 3SUZA 1RGWA 1FC9A 2DKRA 1VAEA 5B6LA 3QO6A 2YT7A 1RGRA 5JXBA 1WI4A 4NMOA 1N6DA 1N6EA 2JREA 4JOFA 3K82A 4G69A 3PDZA 4K78A 1WI2A 4Q6HA 3HPKA 4REYA 2G2LA 3TSZA 3WKMA 1X6DA 2M0TA 4Q3HA 3SFJA 3R68A 2JIKA 1WG6A 4Q6SA 1IU0A 1WJLA 2KPLA 1K32A 3OTPA 3BPUA 2M3MA 2EHRA 4JOHA 1TP3A 2I0LA 2OQSA 2QKVA 2CSJA 2FCFA 1UITA 2EDVA 2KBSA 3OU0A 1FC7A 3MH6A 1N7EA 1OBXA 1WHAA 2K20A 2IWQA 3I4WA 1UJUA 2OGPA 1WFGA 4JOJA 1FC6A 2KG2A 5HJ1A 2CSSA 3QGLA 3K50A 2X7ZA 1KWAA 2EEGA 1BE9A 2I6VA 3HVQC 1N7FA 2W7RA 1Y7NA 2KOHA 5E11A 2AWXA 2PNTA 2YT8A 3CC0A 3KZDA 3GCNA 2PKUA 5E22A 2GZVA 3L4FD 2PA1A 2RRMA 3FY5A 4O06A 3DIWA 3GGEA 1UFXA 4IC6A 2AWUA 2EJYA 1VB7A 2LA8A 2I4SA 1OBZA 2H3MA 1UHPA 3STJA 1TQ3A 4RI0A 2IWNA 1X5QA 2I1NA 3RLEA 1TP5A 1V5LA 3R69A 1QAVB 1WFVA 5E6PB 2M0VA 1KEFA 4N6XA 1WF8A 4AMHA 3HPMA 3ID1A 2DLSA 2EEHA 2OSGA 2M10A 3TSVA 2CS5A 5DTHA 1U37A 2QKTA 2LUIA 1UEPA 1GQ5A 4YYXA 2HGAA 2D90A 5E1YA 4JOPA 3QE1A 1WIFA 2VPHA 2EDPA 2ZPMA 2R3YA 3SOEA 2EDZA 1OBYA 1X5NA 2YUBA 3ID2A 2VSVA 2HE4A 2QG1A 3WKLA 2OS6A 4JL7A 1P1DA 5EZ0A 5HFBA 4OEPA 4JOKA 3I1EA 2DM8A 2AINA 4HOPA 3CBYA 1TE0A 3ID4A 2QKUA 1UJDA 3MH4A 3DORA 1V5QA 4NXPA 2YTWA 3AXAA 5GLJA 2VZ5A 5HEDA 4Q2NA 4K72A 2EV8A 1W9OA 2D92A 2YUYA 3CS0A 1N7TA 1X8SA 4K75A 3DJAA 2Z17A 1RZXA 3EGGC 4NMPA 3PV5A 3O46A 3PV4A 2FNEA 4OEOA 1R6JA 3CH8A 1IHJA 3LNXA 5HEYA 1Q3OA 1LCYA 5A2PA 2KJKA 1V62A 5FB8C 1MFGA 2F0AA 3NFKA 1P1EA 1Y8TA 3QJMA 5HF1A 1SOTA 4GHNA 4JOEA 1UM1A 4LMMA 1W9QA 3LNYA 2JXOA 4H11A 2V90A 3TSWA 1RY4A 1Q3PA 2FN5A 1UM7A 2LC7A 4R2ZA 5E21A 5EYZA 4GVCA 2KJPA 4XHVA 4E3BA 1V6BA 3RL8A 2EXGA 2QT5A 3NFLA 2VSPA 2Q9VA 2EEJA 4JOGA 3ZRTA 4NNMA 3O5NA 1WF7A 1PDRA 2M0ZA 2KPKA 4JORA 2L4SA 1NTEA 4PQWA 3VQGA 1GQ4A 3QIKA 4Z8JA 2H3LA 2DJTA 4E34A 3CBZA 5HFEA 5F3XA 5G1EA 1VA8A 4NMQA 2F5YA 2R4HA 2BYGA 3PS4A 2MX6A 2DC2A 5HFFA 3CYYA 1L6OA 2RCZA 1G9OA 4HOPB 3SHWA 2EGNA 4EDJA 1ZOKA 2IWOA 1GM1A 1XZ9A 5H3JA 5HETA 1B8QA 1UF1A 1IU2A 2P3WA 2D8IA 2I0IA 1NF3C 1U3BA 2H2CA 2DLUA 2EGKA 4FGMA 4Q2QA 1Q7XA 3TMHA 2W4FA 1Z86A 1MFLA 2KYLA 4NMTA 2REYA 1I16A 1UJVA 2JOAA 2I04A 4KFVA 4WYTA 1U38A 3R0HA 4OAJA 4UU6A 2DB5A 4WYUA 2M0UA 1X45A 5I7ZA 1W9EA 1BFEA 1MC7A 1U39A 2KOMA 4NXRA 4UU5A 5HFDA 2PKTA 4MPAA 3DJ1A 4P2AB 3NGHA 2IWPA 2KA9A 2L4TA 3SHUA 4Q2PA 2EGOA 2WL7A 2EEIA 3EGHC 3MH7A 1UEQA 1WHDA 2QBWA 5HDYA 3QDOA 4E35A 2PDZA 5HEBA 4L8NA 2Q3GA 2ENOA 2KOJA 5D13A 1QAUA 3RL7A 2OMJA 3B76A 2JWEA 2KJDA 1QLCA 2LOBA 5FHTA 2FE5A 4K76A 4P0CA 1Z87A 3ID3A 4F8KA 2MHOA 3QJNA 2E7KA 2VWRA 3K1RA 2V1WA 3CBXA 2KV8A 1FCFA 2PZDA 3VQFA 1VCWA 4NNLA 2UZCA 1UEZA 2O2TA 3KZEA 2KAWA 2KQFA 2JINA 3PV2A 2L97A 4YDPA 1VJ6A 2EAQA 1N99A 1ZUBA 1M5ZA 1WH1A 2DAZA 4NXQA 3GDSA 2OPGA 1I92A 5G1DA 2K1ZA 3I18A 1X5RA 1SOZA 4Z33A 2AWWA 3GDVA 3E17A 1UEWA 2HE2A 5GNDA 2LC6A 2OZFA 2OCSA 2KL1A 3KHFA 2KRGA 3GCOA 5HFCA 2H2BA 2VRFA 2Z9IA 3GJ9A 4GVDA 4K6YA 3GDUA 1OZIA
chains in the Genus database with same CATH superfamily
1YBOA 2G5MB 5F67A 4NMVA 4NMSA 3JXTA 3DJ3A 4KFWA 4NMRA 1N6FA 2DMZA 2JILA 1V1TA 2GEFA 3PDVA 3GSLA 1KY9A 5HF4A 1T2MA 1QAVA 4Q2OA 2ZPLA 1D5GA 3SUZA 1RGWA 1FC9A 2DKRA 1VAEA 5B6LA 3QO6A 2YT7A 1RGRA 5JXBA 1WI4A 4NMOA 1N6DA 5IL9A 1N6EA 2JREA 4JOFA 3K82A 4G69A 3PDZA 4K78A 1WI2A 4Q6HA 3HPKA 4REYA 2G2LA 3TSZA 3WKMA 1X6DA 2M0TA 4Q3HA 3SFJA 4JJ0A 3R68A 2JIKA 1WG6A 4Q6SA 1IU0A 1WJLA 2KPLA 1K32A 3OTPA 3BPUA 2M3MA 2EHRA 4JOHA 1TP3A 2I0LA 2OQSA 2QKVA 3KDKA 2CSJA 2FCFA 1UITA 2EDVA 2KBSA 3OU0A 1FC7A 5ILBA 3MH6A 1N7EA 1OBXA 1WHAA 2K20A 2IWQA 3I4WA 1UJUA 2OGPA 1WFGA 4JOJA 1FC6A 2KG2A 5HJ1A 3NCVA 2CSSA 3QGLA 3K50A 2X7ZA 1KWAA 2EEGA 1BE9A 2I6VA 3HVQC 1N7FA 2W7RA 1Y7NA 2KOHA 5E11A 2AWXA 2PNTA 2YT8A 3CC0A 3KZDA 3GCNA 2PKUA 5E22A 2GZVA 3L4FD 2PA1A 2RRMA 3FY5A 4O06A 3DIWA 3GGEA 1UFXA 4IC6A 2AWUA 2EJYA 1VB7A 2LA8A 2I4SA 1OBZA 2H3MA 1UHPA 3STJA 1TQ3A 4RI0A 2IWNA 1X5QA 2JSNA 2I1NA 3RLEA 1TP5A 1V5LA 3R69A 1QAVB 1WFVA 5E6PB 2M0VA 1KEFA 4N6XA 1WF8A 4AMHA 3HPMA 3ID1A 2DLSA 2EEHA 2OSGA 2M10A 3TSVA 2CS5A 5DTHA 1U37A 2QKTA 2LUIA 1UEPA 1GQ5A 4YYXA 2HGAA 2D90A 5E1YA 4JOPA 3QE1A 1WIFA 2VPHA 2EDPA 2ZPMA 2R3YA 3SOEA 2EDZA 1OBYA 1X5NA 2YUBA 3ID2A 2VSVA 2HE4A 2QG1A 3WKLA 2OS6A 4JL7A 1P1DA 5EZ0A 5HFBA 4OEPA 4JOKA 3I1EA 2DM8A 3GABA 2AINA 4HOPA 3CBYA 1TE0A 3ID4A 2QKUA 1UJDA 3MH4A 3DORA 1V5QA 4NXPA 2YTWA 3AXAA 5GLJA 2VZ5A 5HEDA 4Q2NA 4K72A 2EV8A 1W9OA 2D92A 2YUYA 3CS0A 1N7TA 1X8SA 4K75A 3DJAA 2Z17A 1RZXA 3EGGC 4NMPA 3PV5A 3O46A 3PV4A 2FNEA 4OEOA 1R6JA 3CH8A 1IHJA 3LNXA 5HEYA 1Q3OA 1LCYA 5A2PA 2KJKA 1V62A 5FB8C 1MFGA 2F0AA 3NFKA 1P1EA 1Y8TA 3QJMA 5HF1A 1SOTA 4GHNA 4JOEA 1UM1A 4LMMA 1W9QA 3LNYA 2JXOA 4H11A 2V90A 3TSWA 3KDGA 1RY4A 1Q3PA 2FN5A 1UM7A 2LC7A 4R2ZA 5E21A 5EYZA 4GVCA 2KJPA 4XHVA 4E3BA 1V6BA 3RL8A 2EXGA 2QT5A 3NFLA 2VSPA 2Q9VA 2EEJA 4JOGA 3ZRTA 4NNMA 3O5NA 1WF7A 1PDRA 2M0ZA 2KPKA 4JORA 2L4SA 1NTEA 4PQWA 3VQGA 1GQ4A 3QIKA 4Z8JA 2H3LA 2DJTA 4E34A 3CBZA 5HFEA 5F3XA 5G1EA 1VA8A 4NMQA 2F5YA 2R4HA 2BYGA 3PS4A 2MX6A 2DC2A 5HFFA 3CYYA 1L6OA 2RCZA 1G9OA 4HOPB 3SHWA 2EGNA 4EDJA 1ZOKA 2IWOA 1GM1A 1XZ9A 5H3JA 5HETA 4FLNA 1B8QA 1UF1A 1IU2A 2P3WA 2D8IA 2I0IA 1NF3C 1U3BA 2H2CA 2DLUA 2EGKA 4FGMA 4Q2QA 1Q7XA 3TMHA 2W4FA 1Z86A 1MFLA 2KYLA 4NMTA 2REYA 1I16A 1UJVA 2JOAA 2I04A 4KFVA 4WYTA 1U38A 3R0HA 4OAJA 4UU6A 2DB5A 4WYUA 2M0UA 1X45A 5I7ZA 1W9EA 1BFEA 1MC7A 1U39A 2KOMA 4NXRA 4UU5A 5HFDA 2PKTA 4MPAA 3DJ1A 4P2AB 3NGHA 2IWPA 2KA9A 2L4TA 3SHUA 4Q2PA 2EGOA 2WL7A 2EEIA 3EGHC 3MH7A 1UEQA 1WHDA 2QBWA 5HDYA 3QDOA 4E35A 2PDZA 5HEBA 4L8NA 2Q3GA 2ENOA 2KOJA 5D13A 1QAUA 3RL7A 2OMJA 3B76A 2JWEA 2KJDA 1QLCA 2LOBA 5FHTA 5B42A 2FE5A 4K76A 4P0CA 1Z87A 3ID3A 4F8KA 2MHOA 3QJNA 2E7KA 1X9ZA 2VWRA 3K1RA 2V1WA 3CBXA 2KV8A 1FCFA 2PZDA 4JJ3A 3VQFA 1VCWA 4NNLA 2UZCA 1UEZA 2O2TA 3KZEA 2KAWA 2KQFA 2JINA 3PV2A 2L97A 4YDPA 1VJ6A 2EAQA 1N99A 1ZUBA 1M5ZA 1WH1A 2DAZA 4NXQA 3GDSA 2OPGA 1I92A 5G1DA 2K1ZA 3I18A 1X5RA 1SOZA 4Z33A 2AWWA 3GDVA 3E17A 1UEWA 2HE2A 5GNDA 2LC6A 2OZFA 2OCSA 2KL1A 3KHFA 2KRGA 3GCOA 5HFCA 2H2BA 2VRFA 2Z9IA 3GJ9A 4GVDA 4K6YA 3GDUA 1OZIA
chains in the Genus database with same CATH topology
1YBOA 2G5MB 5F67A 4NMVA 4NMSA 3JXTA 3DJ3A 4KFWA 4NMRA 1N6FA 2DMZA 2JILA 1V1TA 2GEFA 3PDVA 3GSLA 1KY9A 5HF4A 1T2MA 1QAVA 4Q2OA 2ZPLA 1D5GA 3SUZA 1RGWA 1FC9A 2DKRA 1VAEA 5B6LA 3QO6A 2YT7A 1RGRA 5JXBA 1WI4A 4NMOA 1N6DA 5IL9A 1N6EA 2JREA 4JOFA 3K82A 4G69A 3PDZA 4K78A 1WI2A 4Q6HA 3HPKA 4REYA 2G2LA 3TSZA 3WKMA 1X6DA 2M0TA 4Q3HA 3SFJA 4JJ0A 3R68A 2JIKA 1WG6A 4Q6SA 1IU0A 1WJLA 2KPLA 1K32A 3OTPA 3BPUA 2M3MA 2EHRA 4JOHA 1TP3A 2I0LA 2OQSA 2QKVA 3KDKA 2CSJA 2FCFA 1UITA 2EDVA 2KBSA 3OU0A 1FC7A 5ILBA 3MH6A 1N7EA 1OBXA 1WHAA 2K20A 2IWQA 3I4WA 1UJUA 2OGPA 1WFGA 4JOJA 1FC6A 2KG2A 5HJ1A 3NCVA 2CSSA 3QGLA 3K50A 2X7ZA 1KWAA 2EEGA 1BE9A 2I6VA 3HVQC 1N7FA 2W7RA 1Y7NA 2KOHA 5E11A 2AWXA 2PNTA 2YT8A 3CC0A 3KZDA 3GCNA 2PKUA 5E22A 2GZVA 3L4FD 2PA1A 2RRMA 3FY5A 4O06A 3DIWA 3GGEA 1UFXA 4IC6A 2AWUA 2EJYA 1VB7A 2LA8A 2I4SA 1OBZA 2H3MA 1UHPA 3STJA 1TQ3A 4RI0A 2IWNA 1X5QA 2JSNA 2I1NA 3RLEA 1TP5A 1V5LA 3R69A 1QAVB 1WFVA 5E6PB 2M0VA 1KEFA 4N6XA 1WF8A 4AMHA 3HPMA 3ID1A 2DLSA 2EEHA 2OSGA 2M10A 3TSVA 2CS5A 5DTHA 1U37A 2QKTA 2LUIA 1UEPA 1GQ5A 4YYXA 2HGAA 2D90A 5E1YA 4JOPA 3QE1A 1WIFA 2VPHA 2EDPA 2ZPMA 2R3YA 3SOEA 2EDZA 1OBYA 1X5NA 2YUBA 3ID2A 2VSVA 2HE4A 2QG1A 3WKLA 2OS6A 4JL7A 1P1DA 5EZ0A 5HFBA 4OEPA 4JOKA 3I1EA 2DM8A 3GABA 2AINA 4HOPA 3CBYA 1TE0A 3ID4A 2QKUA 1UJDA 3MH4A 3DORA 1V5QA 4NXPA 2YTWA 3AXAA 5GLJA 2VZ5A 5HEDA 4Q2NA 4K72A 2EV8A 1W9OA 2D92A 2YUYA 3CS0A 1N7TA 1X8SA 4K75A 3DJAA 2Z17A 1RZXA 3EGGC 4NMPA 3PV5A 3O46A 3PV4A 2FNEA 4OEOA 1R6JA 3CH8A 1IHJA 3LNXA 5HEYA 1Q3OA 1LCYA 5A2PA 2KJKA 1V62A 5FB8C 1MFGA 2F0AA 3NFKA 1P1EA 1Y8TA 3QJMA 5HF1A 1SOTA 4GHNA 4JOEA 1UM1A 4LMMA 1W9QA 3LNYA 2JXOA 4H11A 2V90A 3TSWA 3KDGA 1RY4A 1Q3PA 2FN5A 1UM7A 2LC7A 4R2ZA 5E21A 5EYZA 4GVCA 2KJPA 4XHVA 4E3BA 1V6BA 3RL8A 2EXGA 2QT5A 3NFLA 2VSPA 2Q9VA 2EEJA 4JOGA 3ZRTA 4NNMA 3O5NA 1WF7A 1PDRA 2M0ZA 2KPKA 4JORA 2L4SA 1NTEA 4PQWA 3VQGA 1GQ4A 3QIKA 4Z8JA 2H3LA 2DJTA 4E34A 3CBZA 5HFEA 5F3XA 5G1EA 1VA8A 4NMQA 2F5YA 2R4HA 2BYGA 3PS4A 2MX6A 2DC2A 5HFFA 3CYYA 1L6OA 2RCZA 1G9OA 4HOPB 3SHWA 2EGNA 4EDJA 1ZOKA 2IWOA 1GM1A 1XZ9A 5H3JA 5HETA 4FLNA 1B8QA 1UF1A 1IU2A 2P3WA 2D8IA 2I0IA 1NF3C 1U3BA 2H2CA 2DLUA 2EGKA 4FGMA 4Q2QA 1Q7XA 3TMHA 2W4FA 1Z86A 1MFLA 2KYLA 4NMTA 2REYA 1I16A 1UJVA 2JOAA 2I04A 4KFVA 4WYTA 1U38A 3R0HA 4OAJA 4UU6A 2DB5A 4WYUA 2M0UA 1X45A 5I7ZA 1W9EA 1BFEA 1MC7A 1U39A 2KOMA 4NXRA 4UU5A 5HFDA 2PKTA 4MPAA 3DJ1A 4P2AB 3NGHA 2IWPA 2KA9A 2L4TA 3SHUA 4Q2PA 2EGOA 2WL7A 2EEIA 3EGHC 3MH7A 1UEQA 1WHDA 2QBWA 5HDYA 3QDOA 4E35A 2PDZA 5HEBA 4L8NA 2Q3GA 2ENOA 2KOJA 5D13A 1QAUA 3RL7A 2OMJA 3B76A 2JWEA 2KJDA 1QLCA 2LOBA 5FHTA 5B42A 2FE5A 4K76A 4P0CA 1Z87A 3ID3A 4F8KA 2MHOA 3QJNA 2E7KA 1X9ZA 2VWRA 3K1RA 2V1WA 3CBXA 2KV8A 1FCFA 2PZDA 4JJ3A 3VQFA 1VCWA 4NNLA 2UZCA 1UEZA 2O2TA 3KZEA 2KAWA 2KQFA 2JINA 3PV2A 2L97A 4YDPA 1VJ6A 2EAQA 1N99A 1ZUBA 1M5ZA 1WH1A 2DAZA 4NXQA 3GDSA 2OPGA 1I92A 5G1DA 2K1ZA 3I18A 1X5RA 1SOZA 4Z33A 2AWWA 3GDVA 3E17A 1UEWA 2HE2A 5GNDA 2LC6A 2OZFA 2OCSA 2KL1A 3KHFA 2KRGA 3GCOA 5HFCA 2H2BA 2VRFA 2Z9IA 3GJ9A 4GVDA 4K6YA 3GDUA 1OZIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YBO A;  2G5M B;  5F67 A;  4NMV A;  4NMS A;  3JXT A;  3DJ3 A;  4KFW A;  4NMR A;  1N6F A;  2DMZ A;  2JIL A;  1V1T A;  3PDV A;  3GSL A;  1KY9 A;  5HF4 A;  1T2M A;  1QAV A;  4Q2O A;  2ZPL A;  1D5G A;  3SUZ A;  1RGW A;  1FC9 A;  2DKR A;  1VAE A;  5B6L A;  3QO6 A;  2YT7 A;  1RGR A;  5JXB A;  1WI4 A;  4NMO A;  1N6D A;  1N6E A;  2JRE A;  4JOF A;  3K82 A;  4G69 A;  3PDZ A;  4K78 A;  1WI2 A;  4Q6H A;  3HPK A;  4REY A;  2G2L A;  3TSZ A;  3WKM A;  1X6D A;  2M0T A;  4Q3H A;  3SFJ A;  3R68 A;  2JIK A;  1WG6 A;  4Q6S A;  1IU0 A;  1WJL A;  2KPL A;  1K32 A;  3OTP A;  3BPU A;  2M3M A;  2EHR A;  4JOH A;  1TP3 A;  2I0L A;  2OQS A;  2QKV A;  2CSJ A;  2FCF A;  1UIT A;  2EDV A;  2KBS A;  3OU0 A;  1FC7 A;  3MH6 A;  1N7E A;  1OBX A;  1WHA A;  2K20 A;  2IWQ A;  3I4W A;  1UJU A;  2OGP A;  1WFG A;  4JOJ A;  1FC6 A;  2KG2 A;  5HJ1 A;  2CSS A;  3QGL A;  3K50 A;  2X7Z A;  1KWA A;  2EEG A;  1BE9 A;  2I6V A;  3HVQ C;  1N7F A;  2W7R A;  1Y7N A;  2KOH A;  5E11 A;  2AWX A;  2PNT A;  2YT8 A;  3CC0 A;  3KZD A;  3GCN A;  2PKU A;  5E22 A;  2GZV A;  3L4F D;  2PA1 A;  2RRM A;  3FY5 A;  4O06 A;  3DIW A;  3GGE A;  1UFX A;  4IC6 A;  2AWU A;  2EJY A;  1VB7 A;  2LA8 A;  2I4S A;  1OBZ A;  2H3M A;  1UHP A;  3STJ A;  1TQ3 A;  4RI0 A;  2IWN A;  1X5Q A;  2I1N A;  3RLE A;  1TP5 A;  1V5L A;  3R69 A;  1QAV B;  1WFV A;  5E6P B;  2M0V A;  1KEF A;  4N6X A;  1WF8 A;  4AMH A;  3HPM A;  3ID1 A;  2DLS A;  2EEH A;  2OSG A;  2M10 A;  3TSV A;  2CS5 A;  5DTH A;  1U37 A;  2QKT A;  2LUI A;  1UEP A;  1GQ5 A;  4YYX A;  2HGA A;  2D90 A;  5E1Y A;  4JOP A;  3QE1 A;  1WIF A;  2VPH A;  2EDP A;  2ZPM A;  2R3Y A;  3SOE A;  2EDZ A;  1OBY A;  1X5N A;  2YUB A;  3ID2 A;  2VSV A;  2HE4 A;  2QG1 A;  3WKL A;  2OS6 A;  4JL7 A;  1P1D A;  5EZ0 A;  5HFB A;  4OEP A;  4JOK A;  3I1E A;  2DM8 A;  2AIN A;  4HOP A;  3CBY A;  1TE0 A;  3ID4 A;  2QKU A;  1UJD A;  3MH4 A;  3DOR A;  1V5Q A;  4NXP A;  2YTW A;  3AXA A;  5GLJ A;  2VZ5 A;  5HED A;  4Q2N A;  4K72 A;  2EV8 A;  1W9O A;  2D92 A;  2YUY A;  3CS0 A;  1N7T A;  1X8S A;  4K75 A;  3DJA A;  2Z17 A;  1RZX A;  3EGG C;  4NMP A;  3PV5 A;  3O46 A;  3PV4 A;  2FNE A;  4OEO A;  1R6J A;  3CH8 A;  1IHJ A;  3LNX A;  5HEY A;  1Q3O A;  1LCY A;  5A2P A;  2KJK A;  1V62 A;  5FB8 C;  1MFG A;  2F0A A;  3NFK A;  1P1E A;  1Y8T A;  3QJM A;  5HF1 A;  1SOT A;  4GHN A;  4JOE A;  1UM1 A;  4LMM A;  1W9Q A;  3LNY A;  2JXO A;  4H11 A;  2V90 A;  3TSW A;  1RY4 A;  1Q3P A;  2FN5 A;  1UM7 A;  2LC7 A;  4R2Z A;  5E21 A;  5EYZ A;  4GVC A;  2KJP A;  4XHV A;  4E3B A;  1V6B A;  3RL8 A;  2EXG A;  2QT5 A;  3NFL A;  2VSP A;  2Q9V A;  2EEJ A;  4JOG A;  3ZRT A;  4NNM A;  3O5N A;  1WF7 A;  1PDR A;  2M0Z A;  2KPK A;  4JOR A;  2L4S A;  1NTE A;  4PQW A;  3VQG A;  1GQ4 A;  3QIK A;  4Z8J A;  2H3L A;  2DJT A;  4E34 A;  3CBZ A;  5HFE A;  5F3X A;  5G1E A;  1VA8 A;  4NMQ A;  2F5Y A;  2R4H A;  2BYG A;  3PS4 A;  2MX6 A;  2DC2 A;  5HFF A;  3CYY A;  1L6O A;  2RCZ A;  1G9O A;  4HOP B;  3SHW A;  2EGN A;  4EDJ A;  1ZOK A;  2IWO A;  1GM1 A;  1XZ9 A;  5H3J A;  5HET A;  1B8Q A;  1UF1 A;  1IU2 A;  2P3W A;  2D8I A;  2I0I A;  1NF3 C;  1U3B A;  2H2C A;  2DLU A;  2EGK A;  4FGM A;  4Q2Q A;  1Q7X A;  3TMH A;  2W4F A;  1Z86 A;  1MFL A;  2KYL A;  4NMT A;  2REY A;  1I16 A;  1UJV A;  2JOA A;  2I04 A;  4KFV A;  4WYT A;  1U38 A;  3R0H A;  4OAJ A;  4UU6 A;  2DB5 A;  4WYU A;  2M0U A;  1X45 A;  5I7Z A;  1W9E A;  1BFE A;  1MC7 A;  1U39 A;  2KOM A;  4NXR A;  4UU5 A;  5HFD A;  2PKT A;  4MPA A;  3DJ1 A;  4P2A B;  3NGH A;  2IWP A;  2KA9 A;  2L4T A;  3SHU A;  4Q2P A;  2EGO A;  2WL7 A;  2EEI A;  3EGH C;  3MH7 A;  1UEQ A;  1WHD A;  2QBW A;  5HDY A;  3QDO A;  4E35 A;  2PDZ A;  5HEB A;  4L8N A;  2Q3G A;  2ENO A;  2KOJ A;  5D13 A;  1QAU A;  3RL7 A;  2OMJ A;  3B76 A;  2JWE A;  2KJD A;  1QLC A;  2LOB A;  5FHT A;  2FE5 A;  4K76 A;  4P0C A;  1Z87 A;  3ID3 A;  4F8K A;  2MHO A;  3QJN A;  2E7K A;  2VWR A;  3K1R A;  2V1W A;  3CBX A;  2KV8 A;  1FCF A;  2PZD A;  3VQF A;  1VCW A;  4NNL A;  2UZC A;  1UEZ A;  2O2T A;  3KZE A;  2KAW A;  2KQF A;  2JIN A;  3PV2 A;  2L97 A;  4YDP A;  1VJ6 A;  2EAQ A;  1N99 A;  1ZUB A;  1M5Z A;  1WH1 A;  2DAZ A;  4NXQ A;  3GDS A;  2OPG A;  1I92 A;  5G1D A;  2K1Z A;  3I18 A;  1X5R A;  1SOZ A;  4Z33 A;  2AWW A;  3GDV A;  3E17 A;  1UEW A;  2HE2 A;  5GND A;  2LC6 A;  2OZF A;  2OCS A;  2KL1 A;  3KHF A;  2KRG A;  3GCO A;  5HFC A;  2H2B A;  2VRF A;  2Z9I A;  3GJ9 A;  4GVD A;  4K6Y A;  3GDU A;  1OZI A; 
#chains in the Genus database with same CATH topology
 1YBO A;  2G5M B;  5F67 A;  4NMV A;  4NMS A;  3JXT A;  3DJ3 A;  4KFW A;  4NMR A;  1N6F A;  2DMZ A;  2JIL A;  1V1T A;  2GEF A;  3PDV A;  3GSL A;  1KY9 A;  5HF4 A;  1T2M A;  1QAV A;  4Q2O A;  2ZPL A;  1D5G A;  3SUZ A;  1RGW A;  1FC9 A;  2DKR A;  1VAE A;  5B6L A;  3QO6 A;  2YT7 A;  1RGR A;  5JXB A;  1WI4 A;  4NMO A;  1N6D A;  5IL9 A;  1N6E A;  2JRE A;  4JOF A;  3K82 A;  4G69 A;  3PDZ A;  4K78 A;  1WI2 A;  4Q6H A;  3HPK A;  4REY A;  2G2L A;  3TSZ A;  3WKM A;  1X6D A;  2M0T A;  4Q3H A;  3SFJ A;  4JJ0 A;  3R68 A;  2JIK A;  1WG6 A;  4Q6S A;  1IU0 A;  1WJL A;  2KPL A;  1K32 A;  3OTP A;  3BPU A;  2M3M A;  2EHR A;  4JOH A;  1TP3 A;  2I0L A;  2OQS A;  2QKV A;  3KDK A;  2CSJ A;  2FCF A;  1UIT A;  2EDV A;  2KBS A;  3OU0 A;  1FC7 A;  5ILB A;  3MH6 A;  1N7E A;  1OBX A;  1WHA A;  2K20 A;  2IWQ A;  3I4W A;  1UJU A;  2OGP A;  1WFG A;  4JOJ A;  1FC6 A;  2KG2 A;  5HJ1 A;  3NCV A;  2CSS A;  3QGL A;  3K50 A;  2X7Z A;  1KWA A;  2EEG A;  1BE9 A;  2I6V A;  3HVQ C;  1N7F A;  2W7R A;  1Y7N A;  2KOH A;  5E11 A;  2AWX A;  2PNT A;  2YT8 A;  3CC0 A;  3KZD A;  3GCN A;  2PKU A;  5E22 A;  2GZV A;  3L4F D;  2PA1 A;  2RRM A;  3FY5 A;  4O06 A;  3DIW A;  3GGE A;  1UFX A;  4IC6 A;  2AWU A;  2EJY A;  1VB7 A;  2LA8 A;  2I4S A;  1OBZ A;  2H3M A;  1UHP A;  3STJ A;  1TQ3 A;  4RI0 A;  2IWN A;  1X5Q A;  2JSN A;  2I1N A;  3RLE A;  1TP5 A;  1V5L A;  3R69 A;  1QAV B;  1WFV A;  5E6P B;  2M0V A;  1KEF A;  4N6X A;  1WF8 A;  4AMH A;  3HPM A;  3ID1 A;  2DLS A;  2EEH A;  2OSG A;  2M10 A;  3TSV A;  2CS5 A;  5DTH A;  1U37 A;  2QKT A;  2LUI A;  1UEP A;  1GQ5 A;  4YYX A;  2HGA A;  2D90 A;  5E1Y A;  4JOP A;  3QE1 A;  1WIF A;  2VPH A;  2EDP A;  2ZPM A;  2R3Y A;  3SOE A;  2EDZ A;  1OBY A;  1X5N A;  2YUB A;  3ID2 A;  2VSV A;  2HE4 A;  2QG1 A;  3WKL A;  2OS6 A;  4JL7 A;  1P1D A;  5EZ0 A;  5HFB A;  4OEP A;  4JOK A;  3I1E A;  2DM8 A;  3GAB A;  2AIN A;  4HOP A;  3CBY A;  1TE0 A;  3ID4 A;  2QKU A;  1UJD A;  3MH4 A;  3DOR A;  1V5Q A;  4NXP A;  2YTW A;  3AXA A;  5GLJ A;  2VZ5 A;  5HED A;  4Q2N A;  4K72 A;  2EV8 A;  1W9O A;  2D92 A;  2YUY A;  3CS0 A;  1N7T A;  1X8S A;  4K75 A;  3DJA A;  2Z17 A;  1RZX A;  3EGG C;  4NMP A;  3PV5 A;  3O46 A;  3PV4 A;  2FNE A;  4OEO A;  1R6J A;  3CH8 A;  1IHJ A;  3LNX A;  5HEY A;  1Q3O A;  1LCY A;  5A2P A;  2KJK A;  1V62 A;  5FB8 C;  1MFG A;  2F0A A;  3NFK A;  1P1E A;  1Y8T A;  3QJM A;  5HF1 A;  1SOT A;  4GHN A;  4JOE A;  1UM1 A;  4LMM A;  1W9Q A;  3LNY A;  2JXO A;  4H11 A;  2V90 A;  3TSW A;  3KDG A;  1RY4 A;  1Q3P A;  2FN5 A;  1UM7 A;  2LC7 A;  4R2Z A;  5E21 A;  5EYZ A;  4GVC A;  2KJP A;  4XHV A;  4E3B A;  1V6B A;  3RL8 A;  2EXG A;  2QT5 A;  3NFL A;  2VSP A;  2Q9V A;  2EEJ A;  4JOG A;  3ZRT A;  4NNM A;  3O5N A;  1WF7 A;  1PDR A;  2M0Z A;  2KPK A;  4JOR A;  2L4S A;  1NTE A;  4PQW A;  3VQG A;  1GQ4 A;  3QIK A;  4Z8J A;  2H3L A;  2DJT A;  4E34 A;  3CBZ A;  5HFE A;  5F3X A;  5G1E A;  1VA8 A;  4NMQ A;  2F5Y A;  2R4H A;  2BYG A;  3PS4 A;  2MX6 A;  2DC2 A;  5HFF A;  3CYY A;  1L6O A;  2RCZ A;  1G9O A;  4HOP B;  3SHW A;  2EGN A;  4EDJ A;  1ZOK A;  2IWO A;  1GM1 A;  1XZ9 A;  5H3J A;  5HET A;  4FLN A;  1B8Q A;  1UF1 A;  1IU2 A;  2P3W A;  2D8I A;  2I0I A;  1NF3 C;  1U3B A;  2H2C A;  2DLU A;  2EGK A;  4FGM A;  4Q2Q A;  1Q7X A;  3TMH A;  2W4F A;  1Z86 A;  1MFL A;  2KYL A;  4NMT A;  2REY A;  1I16 A;  1UJV A;  2JOA A;  2I04 A;  4KFV A;  4WYT A;  1U38 A;  3R0H A;  4OAJ A;  4UU6 A;  2DB5 A;  4WYU A;  2M0U A;  1X45 A;  5I7Z A;  1W9E A;  1BFE A;  1MC7 A;  1U39 A;  2KOM A;  4NXR A;  4UU5 A;  5HFD A;  2PKT A;  4MPA A;  3DJ1 A;  4P2A B;  3NGH A;  2IWP A;  2KA9 A;  2L4T A;  3SHU A;  4Q2P A;  2EGO A;  2WL7 A;  2EEI A;  3EGH C;  3MH7 A;  1UEQ A;  1WHD A;  2QBW A;  5HDY A;  3QDO A;  4E35 A;  2PDZ A;  5HEB A;  4L8N A;  2Q3G A;  2ENO A;  2KOJ A;  5D13 A;  1QAU A;  3RL7 A;  2OMJ A;  3B76 A;  2JWE A;  2KJD A;  1QLC A;  2LOB A;  5FHT A;  5B42 A;  2FE5 A;  4K76 A;  4P0C A;  1Z87 A;  3ID3 A;  4F8K A;  2MHO A;  3QJN A;  2E7K A;  1X9Z A;  2VWR A;  3K1R A;  2V1W A;  3CBX A;  2KV8 A;  1FCF A;  2PZD A;  4JJ3 A;  3VQF A;  1VCW A;  4NNL A;  2UZC A;  1UEZ A;  2O2T A;  3KZE A;  2KAW A;  2KQF A;  2JIN A;  3PV2 A;  2L97 A;  4YDP A;  1VJ6 A;  2EAQ A;  1N99 A;  1ZUB A;  1M5Z A;  1WH1 A;  2DAZ A;  4NXQ A;  3GDS A;  2OPG A;  1I92 A;  5G1D A;  2K1Z A;  3I18 A;  1X5R A;  1SOZ A;  4Z33 A;  2AWW A;  3GDV A;  3E17 A;  1UEW A;  2HE2 A;  5GND A;  2LC6 A;  2OZF A;  2OCS A;  2KL1 A;  3KHF A;  2KRG A;  3GCO A;  5HFC A;  2H2B A;  2VRF A;  2Z9I A;  3GJ9 A;  4GVD A;  4K6Y A;  3GDU A;  1OZI A; 
#chains in the Genus database with same CATH homology
 1YBO A;  2G5M B;  5F67 A;  4NMV A;  4NMS A;  3JXT A;  3DJ3 A;  4KFW A;  4NMR A;  1N6F A;  2DMZ A;  2JIL A;  1V1T A;  2GEF A;  3PDV A;  3GSL A;  1KY9 A;  5HF4 A;  1T2M A;  1QAV A;  4Q2O A;  2ZPL A;  1D5G A;  3SUZ A;  1RGW A;  1FC9 A;  2DKR A;  1VAE A;  5B6L A;  3QO6 A;  2YT7 A;  1RGR A;  5JXB A;  1WI4 A;  4NMO A;  1N6D A;  5IL9 A;  1N6E A;  2JRE A;  4JOF A;  3K82 A;  4G69 A;  3PDZ A;  4K78 A;  1WI2 A;  4Q6H A;  3HPK A;  4REY A;  2G2L A;  3TSZ A;  3WKM A;  1X6D A;  2M0T A;  4Q3H A;  3SFJ A;  4JJ0 A;  3R68 A;  2JIK A;  1WG6 A;  4Q6S A;  1IU0 A;  1WJL A;  2KPL A;  1K32 A;  3OTP A;  3BPU A;  2M3M A;  2EHR A;  4JOH A;  1TP3 A;  2I0L A;  2OQS A;  2QKV A;  3KDK A;  2CSJ A;  2FCF A;  1UIT A;  2EDV A;  2KBS A;  3OU0 A;  1FC7 A;  5ILB A;  3MH6 A;  1N7E A;  1OBX A;  1WHA A;  2K20 A;  2IWQ A;  3I4W A;  1UJU A;  2OGP A;  1WFG A;  4JOJ A;  1FC6 A;  2KG2 A;  5HJ1 A;  3NCV A;  2CSS A;  3QGL A;  3K50 A;  2X7Z A;  1KWA A;  2EEG A;  1BE9 A;  2I6V A;  3HVQ C;  1N7F A;  2W7R A;  1Y7N A;  2KOH A;  5E11 A;  2AWX A;  2PNT A;  2YT8 A;  3CC0 A;  3KZD A;  3GCN A;  2PKU A;  5E22 A;  2GZV A;  3L4F D;  2PA1 A;  2RRM A;  3FY5 A;  4O06 A;  3DIW A;  3GGE A;  1UFX A;  4IC6 A;  2AWU A;  2EJY A;  1VB7 A;  2LA8 A;  2I4S A;  1OBZ A;  2H3M A;  1UHP A;  3STJ A;  1TQ3 A;  4RI0 A;  2IWN A;  1X5Q A;  2JSN A;  2I1N A;  3RLE A;  1TP5 A;  1V5L A;  3R69 A;  1QAV B;  1WFV A;  5E6P B;  2M0V A;  1KEF A;  4N6X A;  1WF8 A;  4AMH A;  3HPM A;  3ID1 A;  2DLS A;  2EEH A;  2OSG A;  2M10 A;  3TSV A;  2CS5 A;  5DTH A;  1U37 A;  2QKT A;  2LUI A;  1UEP A;  1GQ5 A;  4YYX A;  2HGA A;  2D90 A;  5E1Y A;  4JOP A;  3QE1 A;  1WIF A;  2VPH A;  2EDP A;  2ZPM A;  2R3Y A;  3SOE A;  2EDZ A;  1OBY A;  1X5N A;  2YUB A;  3ID2 A;  2VSV A;  2HE4 A;  2QG1 A;  3WKL A;  2OS6 A;  4JL7 A;  1P1D A;  5EZ0 A;  5HFB A;  4OEP A;  4JOK A;  3I1E A;  2DM8 A;  3GAB A;  2AIN A;  4HOP A;  3CBY A;  1TE0 A;  3ID4 A;  2QKU A;  1UJD A;  3MH4 A;  3DOR A;  1V5Q A;  4NXP A;  2YTW A;  3AXA A;  5GLJ A;  2VZ5 A;  5HED A;  4Q2N A;  4K72 A;  2EV8 A;  1W9O A;  2D92 A;  2YUY A;  3CS0 A;  1N7T A;  1X8S A;  4K75 A;  3DJA A;  2Z17 A;  1RZX A;  3EGG C;  4NMP A;  3PV5 A;  3O46 A;  3PV4 A;  2FNE A;  4OEO A;  1R6J A;  3CH8 A;  1IHJ A;  3LNX A;  5HEY A;  1Q3O A;  1LCY A;  5A2P A;  2KJK A;  1V62 A;  5FB8 C;  1MFG A;  2F0A A;  3NFK A;  1P1E A;  1Y8T A;  3QJM A;  5HF1 A;  1SOT A;  4GHN A;  4JOE A;  1UM1 A;  4LMM A;  1W9Q A;  3LNY A;  2JXO A;  4H11 A;  2V90 A;  3TSW A;  3KDG A;  1RY4 A;  1Q3P A;  2FN5 A;  1UM7 A;  2LC7 A;  4R2Z A;  5E21 A;  5EYZ A;  4GVC A;  2KJP A;  4XHV A;  4E3B A;  1V6B A;  3RL8 A;  2EXG A;  2QT5 A;  3NFL A;  2VSP A;  2Q9V A;  2EEJ A;  4JOG A;  3ZRT A;  4NNM A;  3O5N A;  1WF7 A;  1PDR A;  2M0Z A;  2KPK A;  4JOR A;  2L4S A;  1NTE A;  4PQW A;  3VQG A;  1GQ4 A;  3QIK A;  4Z8J A;  2H3L A;  2DJT A;  4E34 A;  3CBZ A;  5HFE A;  5F3X A;  5G1E A;  1VA8 A;  4NMQ A;  2F5Y A;  2R4H A;  2BYG A;  3PS4 A;  2MX6 A;  2DC2 A;  5HFF A;  3CYY A;  1L6O A;  2RCZ A;  1G9O A;  4HOP B;  3SHW A;  2EGN A;  4EDJ A;  1ZOK A;  2IWO A;  1GM1 A;  1XZ9 A;  5H3J A;  5HET A;  4FLN A;  1B8Q A;  1UF1 A;  1IU2 A;  2P3W A;  2D8I A;  2I0I A;  1NF3 C;  1U3B A;  2H2C A;  2DLU A;  2EGK A;  4FGM A;  4Q2Q A;  1Q7X A;  3TMH A;  2W4F A;  1Z86 A;  1MFL A;  2KYL A;  4NMT A;  2REY A;  1I16 A;  1UJV A;  2JOA A;  2I04 A;  4KFV A;  4WYT A;  1U38 A;  3R0H A;  4OAJ A;  4UU6 A;  2DB5 A;  4WYU A;  2M0U A;  1X45 A;  5I7Z A;  1W9E A;  1BFE A;  1MC7 A;  1U39 A;  2KOM A;  4NXR A;  4UU5 A;  5HFD A;  2PKT A;  4MPA A;  3DJ1 A;  4P2A B;  3NGH A;  2IWP A;  2KA9 A;  2L4T A;  3SHU A;  4Q2P A;  2EGO A;  2WL7 A;  2EEI A;  3EGH C;  3MH7 A;  1UEQ A;  1WHD A;  2QBW A;  5HDY A;  3QDO A;  4E35 A;  2PDZ A;  5HEB A;  4L8N A;  2Q3G A;  2ENO A;  2KOJ A;  5D13 A;  1QAU A;  3RL7 A;  2OMJ A;  3B76 A;  2JWE A;  2KJD A;  1QLC A;  2LOB A;  5FHT A;  5B42 A;  2FE5 A;  4K76 A;  4P0C A;  1Z87 A;  3ID3 A;  4F8K A;  2MHO A;  3QJN A;  2E7K A;  1X9Z A;  2VWR A;  3K1R A;  2V1W A;  3CBX A;  2KV8 A;  1FCF A;  2PZD A;  4JJ3 A;  3VQF A;  1VCW A;  4NNL A;  2UZC A;  1UEZ A;  2O2T A;  3KZE A;  2KAW A;  2KQF A;  2JIN A;  3PV2 A;  2L97 A;  4YDP A;  1VJ6 A;  2EAQ A;  1N99 A;  1ZUB A;  1M5Z A;  1WH1 A;  2DAZ A;  4NXQ A;  3GDS A;  2OPG A;  1I92 A;  5G1D A;  2K1Z A;  3I18 A;  1X5R A;  1SOZ A;  4Z33 A;  2AWW A;  3GDV A;  3E17 A;  1UEW A;  2HE2 A;  5GND A;  2LC6 A;  2OZF A;  2OCS A;  2KL1 A;  3KHF A;  2KRG A;  3GCO A;  5HFC A;  2H2B A;  2VRF A;  2Z9I A;  3GJ9 A;  4GVD A;  4K6Y A;  3GDU A;  1OZI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...