2RRMA

Interplay between phosphatidyl-inositol-phosphates and claudins upon binding to the 1st pdz domain of zonula occludens 1
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
100
structure length
100
Chain Sequence
b'GPLGSDHIWEQHTVTLHRAPGFGFGIAISGGRDNPHFQSGETSIVISDVLKGGPAEGQLQENDRVAMVNGVSMDNVEHAFAVQQLRKSGKNAKITIRRKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tight junction protein ZO-1
publication title 1H, 13C, and 15N resonance assignment of the first PDZ domain of mouse ZO-1
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
total genus 8
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2011-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 2rrmA00
1FCFA 1Y7NA 2ZPMA 4NMTA 5HFEA 4WYTA 1WFVA 4Z8JA 1GQ4A 4OAJA 1FC6A 2M0ZA 3CYYA 3OU0A 3LNXA 3EGGC 3RL8A 2K1ZA 1OBXA 5I7ZA 1MFGA 4Q2QA 4O06A 2D90A 2EJYA 5E22A 1X5RA 2KOJA 1LCYA 2H3LA 3CS0A 5HEDA 5HEBA 1VB7A 1WFGA 2Z9IA 3GJ9A 1N7TA 4UU6A 2VSVA 3R0HA 3GCNA 1UJDA 4NMPA 3VQGA 2EGKA 3QO6A 4OEOA 3K50A 4K72A 2JXOA 4NXPA 5GNDA 1U37A 3B76A 3DIWA 4E3BA 1W9QA 1X5NA 2EDVA 4JOJA 5F67A 2KA9A 2KJKA 2RCZA 3QIKA 2KV8A 1IHJA 2IWNA 4KFWA 3RLEA 4P0CA 3TMHA 2REYA 4AMHA 1U39A 1I92A 2PKUA 1WHAA 2EEIA 2UZCA 2HE2A 2MX6A 1Z86A 3LNYA 5FB8C 4RI0A 4JOFA 2FE5A 1V5QA 3STJA 3GCOA 1KWAA 2L97A 4KFVA 1U38A 2OPGA 2DLSA 3RL7A 3ZRTA 1SOZA 2PDZA 4JL7A 4NXQA 4OEPA 2JWEA 4Q2PA 2L4TA 4R2ZA 5D13A 2JOAA 5B6LA 2M0TA 4F8KA 3TSVA 3ID4A 2JREA 5E6PB 1N6EA 2DJTA 3SHUA 1K32A 2HE4A 1WJLA 1X5QA 5E1YA 2IWOA 2LUIA 2M0UA 2Q9VA 5H3JA 4NMQA 3R68A 3PS4A 4JOEA 3ID2A 3JXTA 2EHRA 1UEWA 3DJ1A 3WKMA 1OBZA 2IWQA 4NMVA 1N6DA 2EEHA 4GHNA 2VRFA 5HF1A 2OS6A 2KJDA 3HPKA 3KZDA 2CSSA 2D92A 5G1DA 2H2BA 1OZIA 3K1RA 4Q2OA 1IU0A 5HDYA 3CH8A 2P3WA 1RZXA 2DMZA 2OGPA 4JOHA 3NFLA 3QE1A 2YT7A 2H3MA 5HJ1A 1R6JA 2D8IA 2M0VA 2QKUA 1X6DA 2W7RA 1UM7A 2QT5A 2KQFA 4Q3HA 1Q3PA 1UJUA 2L4SA 4NMSA 4NNMA 2I1NA 2ENOA 1SOTA 3SFJA 3GDVA 1NTEA 2JINA 2YT8A 2OQSA 5EYZA 2I0LA 3NFKA 1WF7A 2W4FA 2AINA 3O46A 3DJAA 2KRGA 2DB5A 3GDSA 4HOPA 3QGLA 1W9EA 1NF3C 1N7FA 3K82A 4K76A 2HGAA 2KPLA 1KY9A 4Q6SA 2G5MB 5A2PA 1UHPA 1UJVA 3VQFA 3NGHA 2OCSA 2PKTA 3MH7A 2PZDA 1VJ6A 1QAVA 2YUYA 1VAEA 2CSJA 2KBSA 1N6FA 2JIKA 2KOHA 2O2TA 1PDRA 2OZFA 2PNTA 3DORA 3L4FD 4GVCA 1MFLA 4XHVA 3KHFA 1YBOA 2KG2A 1UFXA 2F5YA 3PDVA 2EDZA 1I16A 3CBZA 5HFBA 1OBYA 4Z33A 4JOPA 3ID3A 3PV4A 2EGNA 5EZ0A 5GLJA 1WG6A 2CS5A 2RRMA 3CBXA 2VWRA 2G2LA 5JXBA 1ZOKA 4LMMA 2E7KA 2PA1A 1BFEA 1V1TA 1N7EA 3WKLA 2YTWA 2AWXA 5FHTA 2DM8A 2LC6A 1GM1A 5HEYA 2GZVA 4JORA 2EGOA 2LA8A 2YUBA 2R4HA 2I0IA 2EV8A 4Q6HA 1TP3A 1FC7A 4JOGA 4E35A 2X7ZA 5G1EA 4REYA 3SOEA 2WL7A 1X8SA 1TP5A 2I4SA 2IWPA 2F0AA 3GDUA 1L6OA 3QJNA 5DTHA 5HETA 1V62A 4EDJA 4IC6A 4NNLA 1G9OA 1IU2A 2BYGA 3MH6A 2H2CA 1UF1A 4G69A 2EAQA 3ID1A 2AWUA 5HFCA 4YYXA 2AWWA 2VSPA 4FGMA 2V90A 3BPUA 1WHDA 2M10A 4GVDA 4K78A 2KOMA 4K75A 4NMOA 3KZEA 1U3BA 1QLCA 1BE9A 2EXGA 4L8NA 3SHWA 3R69A 1UEQA 3TSZA 2R3YA 2Z17A 2JILA 4N6XA 2MHOA 1UM1A 3OTPA 3PV5A 3TSWA 3DJ3A 1Y8TA 4MPAA 3CC0A 1T2MA 1TE0A 1RY4A 2QBWA 2QKTA 1UEZA 3GSLA 2LOBA 4NXRA 2K20A 1V6BA 4Q2NA 4UU5A 3EGHC 2KAWA 2I6VA 2KYLA 2VPHA 1WIFA 1V5LA 1GQ5A 4HOPB 4JOKA 2V1WA 3HPMA 1QAUA 2KPKA 1RGWA 4K6YA 3O5NA 2KJPA 1WF8A 3AXAA 1RGRA 1N99A 2I04A 2QKVA 3QDOA 3QJMA 3FY5A 2EEGA 2QG1A 4YDPA 4WYUA 1QAVB 1W9OA 4NMRA 1P1DA 1TQ3A 5E11A 1VCWA 2DAZA 1XZ9A 1UEPA 2LC7A 5F3XA 2M3MA 1WI4A 1D5GA 1WI2A 4E34A 1VA8A 5HF4A 1UITA 4H11A 2EEJA 2Q3GA 2DKRA 1Q7XA 3CBYA 3E17A 1ZUBA 5HFFA 2OMJA 3I4WA 2EDPA 4PQWA 3MH4A 2DLUA 1X45A 2ZPLA 1WH1A 4P2AB 2OSGA 2VZ5A 3I18A 1MC7A 3I1EA 1FC9A 5HFDA 5E21A 1P1EA 1KEFA 3GGEA 2FCFA 3HVQC 3SUZA 2FNEA 2KL1A 1B8QA 1Q3OA 2FN5A 1M5ZA 2DC2A 3PV2A 3PDZA 1Z87A
chains in the Genus database with same CATH superfamily
1FCFA 1Y7NA 2ZPMA 4NMTA 5HFEA 4WYTA 1WFVA 4Z8JA 1GQ4A 4OAJA 1FC6A 2M0ZA 3CYYA 3OU0A 3LNXA 3EGGC 3RL8A 2K1ZA 1OBXA 5I7ZA 1MFGA 4Q2QA 4O06A 2D90A 2EJYA 5E22A 1X5RA 2KOJA 1LCYA 2H3LA 3CS0A 5HEDA 5HEBA 1VB7A 1WFGA 2Z9IA 3GJ9A 1N7TA 4UU6A 2VSVA 3R0HA 3GCNA 1UJDA 4NMPA 3VQGA 2EGKA 3QO6A 4OEOA 3K50A 4K72A 2JXOA 4NXPA 5GNDA 1U37A 3B76A 3DIWA 4E3BA 1W9QA 1X5NA 2EDVA 4JOJA 5F67A 2KA9A 2KJKA 2RCZA 3QIKA 2KV8A 1IHJA 2IWNA 4KFWA 3RLEA 4P0CA 3TMHA 2REYA 4AMHA 1U39A 1I92A 2PKUA 1WHAA 2EEIA 2UZCA 2HE2A 2MX6A 1Z86A 3LNYA 5FB8C 4RI0A 4JOFA 2FE5A 1V5QA 3STJA 3GCOA 1KWAA 2L97A 4KFVA 1U38A 2OPGA 2DLSA 3RL7A 3KDKA 3ZRTA 1SOZA 2PDZA 4JL7A 4NXQA 4OEPA 2JWEA 4Q2PA 2L4TA 4R2ZA 5D13A 5B42A 2JOAA 5B6LA 2M0TA 4F8KA 3TSVA 3ID4A 2JREA 5E6PB 1N6EA 2DJTA 3SHUA 1K32A 2HE4A 1WJLA 5ILBA 1X5QA 5E1YA 2IWOA 2LUIA 2M0UA 2Q9VA 5H3JA 4NMQA 3R68A 3PS4A 4JOEA 3ID2A 3JXTA 2EHRA 1UEWA 3DJ1A 3WKMA 1OBZA 2IWQA 4NMVA 3GABA 1N6DA 2EEHA 4GHNA 2VRFA 5HF1A 2OS6A 2KJDA 3HPKA 3KZDA 2CSSA 2D92A 5G1DA 2H2BA 1OZIA 3K1RA 4Q2OA 1IU0A 5HDYA 3CH8A 2P3WA 1RZXA 2DMZA 2OGPA 4JOHA 3NFLA 3QE1A 2YT7A 2H3MA 5HJ1A 1R6JA 2D8IA 2M0VA 2QKUA 1X6DA 2W7RA 1UM7A 2QT5A 2KQFA 4Q3HA 1Q3PA 1UJUA 2L4SA 4NMSA 4NNMA 2I1NA 2ENOA 1SOTA 3SFJA 3GDVA 1NTEA 2JINA 2YT8A 2OQSA 5EYZA 2I0LA 3NFKA 1WF7A 2W4FA 2AINA 3O46A 3DJAA 2KRGA 2DB5A 3GDSA 4HOPA 3QGLA 1W9EA 1NF3C 1N7FA 3K82A 4K76A 2HGAA 2KPLA 1KY9A 4Q6SA 2G5MB 5A2PA 1UHPA 1UJVA 3VQFA 3NGHA 2OCSA 2PKTA 3MH7A 2PZDA 1VJ6A 1QAVA 2YUYA 1VAEA 4FLNA 2CSJA 2KBSA 1N6FA 2JIKA 2KOHA 2O2TA 1PDRA 2OZFA 2PNTA 3DORA 3L4FD 4GVCA 1MFLA 4XHVA 3KHFA 1YBOA 2KG2A 1UFXA 2F5YA 3PDVA 2EDZA 1I16A 3CBZA 5HFBA 1OBYA 4Z33A 4JOPA 3ID3A 3PV4A 2EGNA 3KDGA 5EZ0A 5GLJA 1WG6A 2CS5A 2RRMA 3CBXA 2VWRA 2G2LA 5JXBA 1ZOKA 4LMMA 2E7KA 2PA1A 1BFEA 1V1TA 1N7EA 3WKLA 2YTWA 2AWXA 5FHTA 2GEFA 2DM8A 2LC6A 1GM1A 5HEYA 2GZVA 4JORA 2EGOA 2LA8A 2YUBA 2R4HA 2I0IA 2EV8A 4Q6HA 1TP3A 1FC7A 4JOGA 4E35A 2X7ZA 5G1EA 4REYA 3SOEA 2WL7A 1X8SA 1TP5A 2I4SA 2IWPA 2F0AA 3GDUA 1L6OA 3QJNA 5DTHA 5HETA 1V62A 2JSNA 4EDJA 4IC6A 4NNLA 1G9OA 1IU2A 2BYGA 3MH6A 2H2CA 1UF1A 4G69A 2EAQA 3ID1A 2AWUA 5HFCA 4YYXA 2AWWA 2VSPA 4FGMA 2V90A 3BPUA 1WHDA 2M10A 4GVDA 4K78A 3NCVA 2KOMA 4K75A 4NMOA 3KZEA 1U3BA 1QLCA 1BE9A 2EXGA 4L8NA 3SHWA 3R69A 1UEQA 3TSZA 2R3YA 2Z17A 2JILA 4JJ0A 4N6XA 2MHOA 1UM1A 3OTPA 3PV5A 3TSWA 3DJ3A 1Y8TA 4MPAA 3CC0A 1T2MA 1TE0A 1RY4A 2QBWA 2QKTA 1UEZA 3GSLA 2LOBA 4NXRA 2K20A 1V6BA 4Q2NA 4UU5A 3EGHC 2KAWA 2I6VA 2KYLA 2VPHA 1WIFA 1V5LA 1GQ5A 4HOPB 4JOKA 2V1WA 3HPMA 1QAUA 2KPKA 1RGWA 4K6YA 3O5NA 2KJPA 1WF8A 3AXAA 1X9ZA 1RGRA 1N99A 2I04A 2QKVA 3QDOA 3QJMA 3FY5A 2EEGA 2QG1A 4YDPA 5IL9A 4WYUA 1QAVB 1W9OA 4NMRA 1P1DA 1TQ3A 5E11A 1VCWA 2DAZA 1XZ9A 1UEPA 2LC7A 5F3XA 2M3MA 1WI4A 1D5GA 1WI2A 4E34A 1VA8A 5HF4A 1UITA 4H11A 2EEJA 2Q3GA 2DKRA 1Q7XA 3CBYA 3E17A 1ZUBA 5HFFA 2OMJA 3I4WA 2EDPA 4PQWA 3MH4A 2DLUA 1X45A 2ZPLA 1WH1A 4P2AB 2OSGA 2VZ5A 3I18A 1MC7A 3I1EA 1FC9A 5HFDA 4JJ3A 5E21A 1P1EA 1KEFA 3GGEA 2FCFA 3HVQC 3SUZA 2FNEA 2KL1A 1B8QA 1Q3OA 2FN5A 1M5ZA 2DC2A 3PV2A 3PDZA 1Z87A
chains in the Genus database with same CATH topology
1FCFA 1Y7NA 2ZPMA 4NMTA 5HFEA 4WYTA 1WFVA 4Z8JA 1GQ4A 4OAJA 1FC6A 2M0ZA 3CYYA 3OU0A 3LNXA 3EGGC 3RL8A 2K1ZA 1OBXA 5I7ZA 1MFGA 4Q2QA 4O06A 2D90A 2EJYA 5E22A 1X5RA 2KOJA 1LCYA 2H3LA 3CS0A 5HEDA 5HEBA 1VB7A 1WFGA 2Z9IA 3GJ9A 1N7TA 4UU6A 2VSVA 3R0HA 3GCNA 1UJDA 4NMPA 3VQGA 2EGKA 3QO6A 4OEOA 3K50A 4K72A 2JXOA 4NXPA 5GNDA 1U37A 3B76A 3DIWA 4E3BA 1W9QA 1X5NA 2EDVA 4JOJA 5F67A 2KA9A 2KJKA 2RCZA 3QIKA 2KV8A 1IHJA 2IWNA 4KFWA 3RLEA 4P0CA 3TMHA 2REYA 4AMHA 1U39A 1I92A 2PKUA 1WHAA 2EEIA 2UZCA 2HE2A 2MX6A 1Z86A 3LNYA 5FB8C 4RI0A 4JOFA 2FE5A 1V5QA 3STJA 3GCOA 1KWAA 2L97A 4KFVA 1U38A 2OPGA 2DLSA 3RL7A 3KDKA 3ZRTA 1SOZA 2PDZA 4JL7A 4NXQA 4OEPA 2JWEA 4Q2PA 2L4TA 4R2ZA 5D13A 5B42A 2JOAA 5B6LA 2M0TA 4F8KA 3TSVA 3ID4A 2JREA 5E6PB 1N6EA 2DJTA 3SHUA 1K32A 2HE4A 1WJLA 5ILBA 1X5QA 5E1YA 2IWOA 2LUIA 2M0UA 2Q9VA 5H3JA 4NMQA 3R68A 3PS4A 4JOEA 3ID2A 3JXTA 2EHRA 1UEWA 3DJ1A 3WKMA 1OBZA 2IWQA 4NMVA 3GABA 1N6DA 2EEHA 4GHNA 2VRFA 5HF1A 2OS6A 2KJDA 3HPKA 3KZDA 2CSSA 2D92A 5G1DA 2H2BA 1OZIA 3K1RA 4Q2OA 1IU0A 5HDYA 3CH8A 2P3WA 1RZXA 2DMZA 2OGPA 4JOHA 3NFLA 3QE1A 2YT7A 2H3MA 5HJ1A 1R6JA 2D8IA 2M0VA 2QKUA 1X6DA 2W7RA 1UM7A 2QT5A 2KQFA 4Q3HA 1Q3PA 1UJUA 2L4SA 4NMSA 4NNMA 2I1NA 2ENOA 1SOTA 3SFJA 3GDVA 1NTEA 2JINA 2YT8A 2OQSA 5EYZA 2I0LA 3NFKA 1WF7A 2W4FA 2AINA 3O46A 3DJAA 2KRGA 2DB5A 3GDSA 4HOPA 3QGLA 1W9EA 1NF3C 1N7FA 3K82A 4K76A 2HGAA 2KPLA 1KY9A 4Q6SA 2G5MB 5A2PA 1UHPA 1UJVA 3VQFA 3NGHA 2OCSA 2PKTA 3MH7A 2PZDA 1VJ6A 1QAVA 2YUYA 1VAEA 4FLNA 2CSJA 2KBSA 1N6FA 2JIKA 2KOHA 2O2TA 1PDRA 2OZFA 2PNTA 3DORA 3L4FD 4GVCA 1MFLA 4XHVA 3KHFA 1YBOA 2KG2A 1UFXA 2F5YA 3PDVA 2EDZA 1I16A 3CBZA 5HFBA 1OBYA 4Z33A 4JOPA 3ID3A 3PV4A 2EGNA 3KDGA 5EZ0A 5GLJA 1WG6A 2CS5A 2RRMA 3CBXA 2VWRA 2G2LA 5JXBA 1ZOKA 4LMMA 2E7KA 2PA1A 1BFEA 1V1TA 1N7EA 3WKLA 2YTWA 2AWXA 5FHTA 2GEFA 2DM8A 2LC6A 1GM1A 5HEYA 2GZVA 4JORA 2EGOA 2LA8A 2YUBA 2R4HA 2I0IA 2EV8A 4Q6HA 1TP3A 1FC7A 4JOGA 4E35A 2X7ZA 5G1EA 4REYA 3SOEA 2WL7A 1X8SA 1TP5A 2I4SA 2IWPA 2F0AA 3GDUA 1L6OA 3QJNA 5DTHA 5HETA 1V62A 2JSNA 4EDJA 4IC6A 4NNLA 1G9OA 1IU2A 2BYGA 3MH6A 2H2CA 1UF1A 4G69A 2EAQA 3ID1A 2AWUA 5HFCA 4YYXA 2AWWA 2VSPA 4FGMA 2V90A 3BPUA 1WHDA 2M10A 4GVDA 4K78A 3NCVA 2KOMA 4K75A 4NMOA 3KZEA 1U3BA 1QLCA 1BE9A 2EXGA 4L8NA 3SHWA 3R69A 1UEQA 3TSZA 2R3YA 2Z17A 2JILA 4JJ0A 4N6XA 2MHOA 1UM1A 3OTPA 3PV5A 3TSWA 3DJ3A 1Y8TA 4MPAA 3CC0A 1T2MA 1TE0A 1RY4A 2QBWA 2QKTA 1UEZA 3GSLA 2LOBA 4NXRA 2K20A 1V6BA 4Q2NA 4UU5A 3EGHC 2KAWA 2I6VA 2KYLA 2VPHA 1WIFA 1V5LA 1GQ5A 4HOPB 4JOKA 2V1WA 3HPMA 1QAUA 2KPKA 1RGWA 4K6YA 3O5NA 2KJPA 1WF8A 3AXAA 1X9ZA 1RGRA 1N99A 2I04A 2QKVA 3QDOA 3QJMA 3FY5A 2EEGA 2QG1A 4YDPA 5IL9A 4WYUA 1QAVB 1W9OA 4NMRA 1P1DA 1TQ3A 5E11A 1VCWA 2DAZA 1XZ9A 1UEPA 2LC7A 5F3XA 2M3MA 1WI4A 1D5GA 1WI2A 4E34A 1VA8A 5HF4A 1UITA 4H11A 2EEJA 2Q3GA 2DKRA 1Q7XA 3CBYA 3E17A 1ZUBA 5HFFA 2OMJA 3I4WA 2EDPA 4PQWA 3MH4A 2DLUA 1X45A 2ZPLA 1WH1A 4P2AB 2OSGA 2VZ5A 3I18A 1MC7A 3I1EA 1FC9A 5HFDA 4JJ3A 5E21A 1P1EA 1KEFA 3GGEA 2FCFA 3HVQC 3SUZA 2FNEA 2KL1A 1B8QA 1Q3OA 2FN5A 1M5ZA 2DC2A 3PV2A 3PDZA 1Z87A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FCF A;  1Y7N A;  2ZPM A;  4NMT A;  5HFE A;  4WYT A;  1WFV A;  4Z8J A;  1GQ4 A;  4OAJ A;  1FC6 A;  2M0Z A;  3CYY A;  3OU0 A;  3LNX A;  3EGG C;  3RL8 A;  2K1Z A;  1OBX A;  5I7Z A;  1MFG A;  4Q2Q A;  4O06 A;  2D90 A;  2EJY A;  5E22 A;  1X5R A;  2KOJ A;  1LCY A;  2H3L A;  3CS0 A;  5HED A;  5HEB A;  1VB7 A;  1WFG A;  2Z9I A;  3GJ9 A;  1N7T A;  4UU6 A;  2VSV A;  3R0H A;  3GCN A;  1UJD A;  4NMP A;  3VQG A;  2EGK A;  3QO6 A;  4OEO A;  3K50 A;  4K72 A;  2JXO A;  4NXP A;  5GND A;  1U37 A;  3B76 A;  3DIW A;  4E3B A;  1W9Q A;  1X5N A;  2EDV A;  4JOJ A;  5F67 A;  2KA9 A;  2KJK A;  2RCZ A;  3QIK A;  2KV8 A;  1IHJ A;  2IWN A;  4KFW A;  3RLE A;  4P0C A;  3TMH A;  2REY A;  4AMH A;  1U39 A;  1I92 A;  2PKU A;  1WHA A;  2EEI A;  2UZC A;  2HE2 A;  2MX6 A;  1Z86 A;  3LNY A;  5FB8 C;  4RI0 A;  4JOF A;  2FE5 A;  1V5Q A;  3STJ A;  3GCO A;  1KWA A;  2L97 A;  4KFV A;  1U38 A;  2OPG A;  2DLS A;  3RL7 A;  3ZRT A;  1SOZ A;  2PDZ A;  4JL7 A;  4NXQ A;  4OEP A;  2JWE A;  4Q2P A;  2L4T A;  4R2Z A;  5D13 A;  2JOA A;  5B6L A;  2M0T A;  4F8K A;  3TSV A;  3ID4 A;  2JRE A;  5E6P B;  1N6E A;  2DJT A;  3SHU A;  1K32 A;  2HE4 A;  1WJL A;  1X5Q A;  5E1Y A;  2IWO A;  2LUI A;  2M0U A;  2Q9V A;  5H3J A;  4NMQ A;  3R68 A;  3PS4 A;  4JOE A;  3ID2 A;  3JXT A;  2EHR A;  1UEW A;  3DJ1 A;  3WKM A;  1OBZ A;  2IWQ A;  4NMV A;  1N6D A;  2EEH A;  4GHN A;  2VRF A;  5HF1 A;  2OS6 A;  2KJD A;  3HPK A;  3KZD A;  2CSS A;  2D92 A;  5G1D A;  2H2B A;  1OZI A;  3K1R A;  4Q2O A;  1IU0 A;  5HDY A;  3CH8 A;  2P3W A;  1RZX A;  2DMZ A;  2OGP A;  4JOH A;  3NFL A;  3QE1 A;  2YT7 A;  2H3M A;  5HJ1 A;  1R6J A;  2D8I A;  2M0V A;  2QKU A;  1X6D A;  2W7R A;  1UM7 A;  2QT5 A;  2KQF A;  4Q3H A;  1Q3P A;  1UJU A;  2L4S A;  4NMS A;  4NNM A;  2I1N A;  2ENO A;  1SOT A;  3SFJ A;  3GDV A;  1NTE A;  2JIN A;  2YT8 A;  2OQS A;  5EYZ A;  2I0L A;  3NFK A;  1WF7 A;  2W4F A;  2AIN A;  3O46 A;  3DJA A;  2KRG A;  2DB5 A;  3GDS A;  4HOP A;  3QGL A;  1W9E A;  1NF3 C;  1N7F A;  3K82 A;  4K76 A;  2HGA A;  2KPL A;  1KY9 A;  4Q6S A;  2G5M B;  5A2P A;  1UHP A;  1UJV A;  3VQF A;  3NGH A;  2OCS A;  2PKT A;  3MH7 A;  2PZD A;  1VJ6 A;  1QAV A;  2YUY A;  1VAE A;  2CSJ A;  2KBS A;  1N6F A;  2JIK A;  2KOH A;  2O2T A;  1PDR A;  2OZF A;  2PNT A;  3DOR A;  3L4F D;  4GVC A;  1MFL A;  4XHV A;  3KHF A;  1YBO A;  2KG2 A;  1UFX A;  2F5Y A;  3PDV A;  2EDZ A;  1I16 A;  3CBZ A;  5HFB A;  1OBY A;  4Z33 A;  4JOP A;  3ID3 A;  3PV4 A;  2EGN A;  5EZ0 A;  5GLJ A;  1WG6 A;  2CS5 A;  2RRM A;  3CBX A;  2VWR A;  2G2L A;  5JXB A;  1ZOK A;  4LMM A;  2E7K A;  2PA1 A;  1BFE A;  1V1T A;  1N7E A;  3WKL A;  2YTW A;  2AWX A;  5FHT A;  2DM8 A;  2LC6 A;  1GM1 A;  5HEY A;  2GZV A;  4JOR A;  2EGO A;  2LA8 A;  2YUB A;  2R4H A;  2I0I A;  2EV8 A;  4Q6H A;  1TP3 A;  1FC7 A;  4JOG A;  4E35 A;  2X7Z A;  5G1E A;  4REY A;  3SOE A;  2WL7 A;  1X8S A;  1TP5 A;  2I4S A;  2IWP A;  2F0A A;  3GDU A;  1L6O A;  3QJN A;  5DTH A;  5HET A;  1V62 A;  4EDJ A;  4IC6 A;  4NNL A;  1G9O A;  1IU2 A;  2BYG A;  3MH6 A;  2H2C A;  1UF1 A;  4G69 A;  2EAQ A;  3ID1 A;  2AWU A;  5HFC A;  4YYX A;  2AWW A;  2VSP A;  4FGM A;  2V90 A;  3BPU A;  1WHD A;  2M10 A;  4GVD A;  4K78 A;  2KOM A;  4K75 A;  4NMO A;  3KZE A;  1U3B A;  1QLC A;  1BE9 A;  2EXG A;  4L8N A;  3SHW A;  3R69 A;  1UEQ A;  3TSZ A;  2R3Y A;  2Z17 A;  2JIL A;  4N6X A;  2MHO A;  1UM1 A;  3OTP A;  3PV5 A;  3TSW A;  3DJ3 A;  1Y8T A;  4MPA A;  3CC0 A;  1T2M A;  1TE0 A;  1RY4 A;  2QBW A;  2QKT A;  1UEZ A;  3GSL A;  2LOB A;  4NXR A;  2K20 A;  1V6B A;  4Q2N A;  4UU5 A;  3EGH C;  2KAW A;  2I6V A;  2KYL A;  2VPH A;  1WIF A;  1V5L A;  1GQ5 A;  4HOP B;  4JOK A;  2V1W A;  3HPM A;  1QAU A;  2KPK A;  1RGW A;  4K6Y A;  3O5N A;  2KJP A;  1WF8 A;  3AXA A;  1RGR A;  1N99 A;  2I04 A;  2QKV A;  3QDO A;  3QJM A;  3FY5 A;  2EEG A;  2QG1 A;  4YDP A;  4WYU A;  1QAV B;  1W9O A;  4NMR A;  1P1D A;  1TQ3 A;  5E11 A;  1VCW A;  2DAZ A;  1XZ9 A;  1UEP A;  2LC7 A;  5F3X A;  2M3M A;  1WI4 A;  1D5G A;  1WI2 A;  4E34 A;  1VA8 A;  5HF4 A;  1UIT A;  4H11 A;  2EEJ A;  2Q3G A;  2DKR A;  1Q7X A;  3CBY A;  3E17 A;  1ZUB A;  5HFF A;  2OMJ A;  3I4W A;  2EDP A;  4PQW A;  3MH4 A;  2DLU A;  1X45 A;  2ZPL A;  1WH1 A;  4P2A B;  2OSG A;  2VZ5 A;  3I18 A;  1MC7 A;  3I1E A;  1FC9 A;  5HFD A;  5E21 A;  1P1E A;  1KEF A;  3GGE A;  2FCF A;  3HVQ C;  3SUZ A;  2FNE A;  2KL1 A;  1B8Q A;  1Q3O A;  2FN5 A;  1M5Z A;  2DC2 A;  3PV2 A;  3PDZ A;  1Z87 A; 
#chains in the Genus database with same CATH topology
 1FCF A;  1Y7N A;  2ZPM A;  4NMT A;  5HFE A;  4WYT A;  1WFV A;  4Z8J A;  1GQ4 A;  4OAJ A;  1FC6 A;  2M0Z A;  3CYY A;  3OU0 A;  3LNX A;  3EGG C;  3RL8 A;  2K1Z A;  1OBX A;  5I7Z A;  1MFG A;  4Q2Q A;  4O06 A;  2D90 A;  2EJY A;  5E22 A;  1X5R A;  2KOJ A;  1LCY A;  2H3L A;  3CS0 A;  5HED A;  5HEB A;  1VB7 A;  1WFG A;  2Z9I A;  3GJ9 A;  1N7T A;  4UU6 A;  2VSV A;  3R0H A;  3GCN A;  1UJD A;  4NMP A;  3VQG A;  2EGK A;  3QO6 A;  4OEO A;  3K50 A;  4K72 A;  2JXO A;  4NXP A;  5GND A;  1U37 A;  3B76 A;  3DIW A;  4E3B A;  1W9Q A;  1X5N A;  2EDV A;  4JOJ A;  5F67 A;  2KA9 A;  2KJK A;  2RCZ A;  3QIK A;  2KV8 A;  1IHJ A;  2IWN A;  4KFW A;  3RLE A;  4P0C A;  3TMH A;  2REY A;  4AMH A;  1U39 A;  1I92 A;  2PKU A;  1WHA A;  2EEI A;  2UZC A;  2HE2 A;  2MX6 A;  1Z86 A;  3LNY A;  5FB8 C;  4RI0 A;  4JOF A;  2FE5 A;  1V5Q A;  3STJ A;  3GCO A;  1KWA A;  2L97 A;  4KFV A;  1U38 A;  2OPG A;  2DLS A;  3RL7 A;  3KDK A;  3ZRT A;  1SOZ A;  2PDZ A;  4JL7 A;  4NXQ A;  4OEP A;  2JWE A;  4Q2P A;  2L4T A;  4R2Z A;  5D13 A;  5B42 A;  2JOA A;  5B6L A;  2M0T A;  4F8K A;  3TSV A;  3ID4 A;  2JRE A;  5E6P B;  1N6E A;  2DJT A;  3SHU A;  1K32 A;  2HE4 A;  1WJL A;  5ILB A;  1X5Q A;  5E1Y A;  2IWO A;  2LUI A;  2M0U A;  2Q9V A;  5H3J A;  4NMQ A;  3R68 A;  3PS4 A;  4JOE A;  3ID2 A;  3JXT A;  2EHR A;  1UEW A;  3DJ1 A;  3WKM A;  1OBZ A;  2IWQ A;  4NMV A;  3GAB A;  1N6D A;  2EEH A;  4GHN A;  2VRF A;  5HF1 A;  2OS6 A;  2KJD A;  3HPK A;  3KZD A;  2CSS A;  2D92 A;  5G1D A;  2H2B A;  1OZI A;  3K1R A;  4Q2O A;  1IU0 A;  5HDY A;  3CH8 A;  2P3W A;  1RZX A;  2DMZ A;  2OGP A;  4JOH A;  3NFL A;  3QE1 A;  2YT7 A;  2H3M A;  5HJ1 A;  1R6J A;  2D8I A;  2M0V A;  2QKU A;  1X6D A;  2W7R A;  1UM7 A;  2QT5 A;  2KQF A;  4Q3H A;  1Q3P A;  1UJU A;  2L4S A;  4NMS A;  4NNM A;  2I1N A;  2ENO A;  1SOT A;  3SFJ A;  3GDV A;  1NTE A;  2JIN A;  2YT8 A;  2OQS A;  5EYZ A;  2I0L A;  3NFK A;  1WF7 A;  2W4F A;  2AIN A;  3O46 A;  3DJA A;  2KRG A;  2DB5 A;  3GDS A;  4HOP A;  3QGL A;  1W9E A;  1NF3 C;  1N7F A;  3K82 A;  4K76 A;  2HGA A;  2KPL A;  1KY9 A;  4Q6S A;  2G5M B;  5A2P A;  1UHP A;  1UJV A;  3VQF A;  3NGH A;  2OCS A;  2PKT A;  3MH7 A;  2PZD A;  1VJ6 A;  1QAV A;  2YUY A;  1VAE A;  4FLN A;  2CSJ A;  2KBS A;  1N6F A;  2JIK A;  2KOH A;  2O2T A;  1PDR A;  2OZF A;  2PNT A;  3DOR A;  3L4F D;  4GVC A;  1MFL A;  4XHV A;  3KHF A;  1YBO A;  2KG2 A;  1UFX A;  2F5Y A;  3PDV A;  2EDZ A;  1I16 A;  3CBZ A;  5HFB A;  1OBY A;  4Z33 A;  4JOP A;  3ID3 A;  3PV4 A;  2EGN A;  3KDG A;  5EZ0 A;  5GLJ A;  1WG6 A;  2CS5 A;  2RRM A;  3CBX A;  2VWR A;  2G2L A;  5JXB A;  1ZOK A;  4LMM A;  2E7K A;  2PA1 A;  1BFE A;  1V1T A;  1N7E A;  3WKL A;  2YTW A;  2AWX A;  5FHT A;  2GEF A;  2DM8 A;  2LC6 A;  1GM1 A;  5HEY A;  2GZV A;  4JOR A;  2EGO A;  2LA8 A;  2YUB A;  2R4H A;  2I0I A;  2EV8 A;  4Q6H A;  1TP3 A;  1FC7 A;  4JOG A;  4E35 A;  2X7Z A;  5G1E A;  4REY A;  3SOE A;  2WL7 A;  1X8S A;  1TP5 A;  2I4S A;  2IWP A;  2F0A A;  3GDU A;  1L6O A;  3QJN A;  5DTH A;  5HET A;  1V62 A;  2JSN A;  4EDJ A;  4IC6 A;  4NNL A;  1G9O A;  1IU2 A;  2BYG A;  3MH6 A;  2H2C A;  1UF1 A;  4G69 A;  2EAQ A;  3ID1 A;  2AWU A;  5HFC A;  4YYX A;  2AWW A;  2VSP A;  4FGM A;  2V90 A;  3BPU A;  1WHD A;  2M10 A;  4GVD A;  4K78 A;  3NCV A;  2KOM A;  4K75 A;  4NMO A;  3KZE A;  1U3B A;  1QLC A;  1BE9 A;  2EXG A;  4L8N A;  3SHW A;  3R69 A;  1UEQ A;  3TSZ A;  2R3Y A;  2Z17 A;  2JIL A;  4JJ0 A;  4N6X A;  2MHO A;  1UM1 A;  3OTP A;  3PV5 A;  3TSW A;  3DJ3 A;  1Y8T A;  4MPA A;  3CC0 A;  1T2M A;  1TE0 A;  1RY4 A;  2QBW A;  2QKT A;  1UEZ A;  3GSL A;  2LOB A;  4NXR A;  2K20 A;  1V6B A;  4Q2N A;  4UU5 A;  3EGH C;  2KAW A;  2I6V A;  2KYL A;  2VPH A;  1WIF A;  1V5L A;  1GQ5 A;  4HOP B;  4JOK A;  2V1W A;  3HPM A;  1QAU A;  2KPK A;  1RGW A;  4K6Y A;  3O5N A;  2KJP A;  1WF8 A;  3AXA A;  1X9Z A;  1RGR A;  1N99 A;  2I04 A;  2QKV A;  3QDO A;  3QJM A;  3FY5 A;  2EEG A;  2QG1 A;  4YDP A;  5IL9 A;  4WYU A;  1QAV B;  1W9O A;  4NMR A;  1P1D A;  1TQ3 A;  5E11 A;  1VCW A;  2DAZ A;  1XZ9 A;  1UEP A;  2LC7 A;  5F3X A;  2M3M A;  1WI4 A;  1D5G A;  1WI2 A;  4E34 A;  1VA8 A;  5HF4 A;  1UIT A;  4H11 A;  2EEJ A;  2Q3G A;  2DKR A;  1Q7X A;  3CBY A;  3E17 A;  1ZUB A;  5HFF A;  2OMJ A;  3I4W A;  2EDP A;  4PQW A;  3MH4 A;  2DLU A;  1X45 A;  2ZPL A;  1WH1 A;  4P2A B;  2OSG A;  2VZ5 A;  3I18 A;  1MC7 A;  3I1E A;  1FC9 A;  5HFD A;  4JJ3 A;  5E21 A;  1P1E A;  1KEF A;  3GGE A;  2FCF A;  3HVQ C;  3SUZ A;  2FNE A;  2KL1 A;  1B8Q A;  1Q3O A;  2FN5 A;  1M5Z A;  2DC2 A;  3PV2 A;  3PDZ A;  1Z87 A; 
#chains in the Genus database with same CATH homology
 1FCF A;  1Y7N A;  2ZPM A;  4NMT A;  5HFE A;  4WYT A;  1WFV A;  4Z8J A;  1GQ4 A;  4OAJ A;  1FC6 A;  2M0Z A;  3CYY A;  3OU0 A;  3LNX A;  3EGG C;  3RL8 A;  2K1Z A;  1OBX A;  5I7Z A;  1MFG A;  4Q2Q A;  4O06 A;  2D90 A;  2EJY A;  5E22 A;  1X5R A;  2KOJ A;  1LCY A;  2H3L A;  3CS0 A;  5HED A;  5HEB A;  1VB7 A;  1WFG A;  2Z9I A;  3GJ9 A;  1N7T A;  4UU6 A;  2VSV A;  3R0H A;  3GCN A;  1UJD A;  4NMP A;  3VQG A;  2EGK A;  3QO6 A;  4OEO A;  3K50 A;  4K72 A;  2JXO A;  4NXP A;  5GND A;  1U37 A;  3B76 A;  3DIW A;  4E3B A;  1W9Q A;  1X5N A;  2EDV A;  4JOJ A;  5F67 A;  2KA9 A;  2KJK A;  2RCZ A;  3QIK A;  2KV8 A;  1IHJ A;  2IWN A;  4KFW A;  3RLE A;  4P0C A;  3TMH A;  2REY A;  4AMH A;  1U39 A;  1I92 A;  2PKU A;  1WHA A;  2EEI A;  2UZC A;  2HE2 A;  2MX6 A;  1Z86 A;  3LNY A;  5FB8 C;  4RI0 A;  4JOF A;  2FE5 A;  1V5Q A;  3STJ A;  3GCO A;  1KWA A;  2L97 A;  4KFV A;  1U38 A;  2OPG A;  2DLS A;  3RL7 A;  3KDK A;  3ZRT A;  1SOZ A;  2PDZ A;  4JL7 A;  4NXQ A;  4OEP A;  2JWE A;  4Q2P A;  2L4T A;  4R2Z A;  5D13 A;  5B42 A;  2JOA A;  5B6L A;  2M0T A;  4F8K A;  3TSV A;  3ID4 A;  2JRE A;  5E6P B;  1N6E A;  2DJT A;  3SHU A;  1K32 A;  2HE4 A;  1WJL A;  5ILB A;  1X5Q A;  5E1Y A;  2IWO A;  2LUI A;  2M0U A;  2Q9V A;  5H3J A;  4NMQ A;  3R68 A;  3PS4 A;  4JOE A;  3ID2 A;  3JXT A;  2EHR A;  1UEW A;  3DJ1 A;  3WKM A;  1OBZ A;  2IWQ A;  4NMV A;  3GAB A;  1N6D A;  2EEH A;  4GHN A;  2VRF A;  5HF1 A;  2OS6 A;  2KJD A;  3HPK A;  3KZD A;  2CSS A;  2D92 A;  5G1D A;  2H2B A;  1OZI A;  3K1R A;  4Q2O A;  1IU0 A;  5HDY A;  3CH8 A;  2P3W A;  1RZX A;  2DMZ A;  2OGP A;  4JOH A;  3NFL A;  3QE1 A;  2YT7 A;  2H3M A;  5HJ1 A;  1R6J A;  2D8I A;  2M0V A;  2QKU A;  1X6D A;  2W7R A;  1UM7 A;  2QT5 A;  2KQF A;  4Q3H A;  1Q3P A;  1UJU A;  2L4S A;  4NMS A;  4NNM A;  2I1N A;  2ENO A;  1SOT A;  3SFJ A;  3GDV A;  1NTE A;  2JIN A;  2YT8 A;  2OQS A;  5EYZ A;  2I0L A;  3NFK A;  1WF7 A;  2W4F A;  2AIN A;  3O46 A;  3DJA A;  2KRG A;  2DB5 A;  3GDS A;  4HOP A;  3QGL A;  1W9E A;  1NF3 C;  1N7F A;  3K82 A;  4K76 A;  2HGA A;  2KPL A;  1KY9 A;  4Q6S A;  2G5M B;  5A2P A;  1UHP A;  1UJV A;  3VQF A;  3NGH A;  2OCS A;  2PKT A;  3MH7 A;  2PZD A;  1VJ6 A;  1QAV A;  2YUY A;  1VAE A;  4FLN A;  2CSJ A;  2KBS A;  1N6F A;  2JIK A;  2KOH A;  2O2T A;  1PDR A;  2OZF A;  2PNT A;  3DOR A;  3L4F D;  4GVC A;  1MFL A;  4XHV A;  3KHF A;  1YBO A;  2KG2 A;  1UFX A;  2F5Y A;  3PDV A;  2EDZ A;  1I16 A;  3CBZ A;  5HFB A;  1OBY A;  4Z33 A;  4JOP A;  3ID3 A;  3PV4 A;  2EGN A;  3KDG A;  5EZ0 A;  5GLJ A;  1WG6 A;  2CS5 A;  2RRM A;  3CBX A;  2VWR A;  2G2L A;  5JXB A;  1ZOK A;  4LMM A;  2E7K A;  2PA1 A;  1BFE A;  1V1T A;  1N7E A;  3WKL A;  2YTW A;  2AWX A;  5FHT A;  2GEF A;  2DM8 A;  2LC6 A;  1GM1 A;  5HEY A;  2GZV A;  4JOR A;  2EGO A;  2LA8 A;  2YUB A;  2R4H A;  2I0I A;  2EV8 A;  4Q6H A;  1TP3 A;  1FC7 A;  4JOG A;  4E35 A;  2X7Z A;  5G1E A;  4REY A;  3SOE A;  2WL7 A;  1X8S A;  1TP5 A;  2I4S A;  2IWP A;  2F0A A;  3GDU A;  1L6O A;  3QJN A;  5DTH A;  5HET A;  1V62 A;  2JSN A;  4EDJ A;  4IC6 A;  4NNL A;  1G9O A;  1IU2 A;  2BYG A;  3MH6 A;  2H2C A;  1UF1 A;  4G69 A;  2EAQ A;  3ID1 A;  2AWU A;  5HFC A;  4YYX A;  2AWW A;  2VSP A;  4FGM A;  2V90 A;  3BPU A;  1WHD A;  2M10 A;  4GVD A;  4K78 A;  3NCV A;  2KOM A;  4K75 A;  4NMO A;  3KZE A;  1U3B A;  1QLC A;  1BE9 A;  2EXG A;  4L8N A;  3SHW A;  3R69 A;  1UEQ A;  3TSZ A;  2R3Y A;  2Z17 A;  2JIL A;  4JJ0 A;  4N6X A;  2MHO A;  1UM1 A;  3OTP A;  3PV5 A;  3TSW A;  3DJ3 A;  1Y8T A;  4MPA A;  3CC0 A;  1T2M A;  1TE0 A;  1RY4 A;  2QBW A;  2QKT A;  1UEZ A;  3GSL A;  2LOB A;  4NXR A;  2K20 A;  1V6B A;  4Q2N A;  4UU5 A;  3EGH C;  2KAW A;  2I6V A;  2KYL A;  2VPH A;  1WIF A;  1V5L A;  1GQ5 A;  4HOP B;  4JOK A;  2V1W A;  3HPM A;  1QAU A;  2KPK A;  1RGW A;  4K6Y A;  3O5N A;  2KJP A;  1WF8 A;  3AXA A;  1X9Z A;  1RGR A;  1N99 A;  2I04 A;  2QKV A;  3QDO A;  3QJM A;  3FY5 A;  2EEG A;  2QG1 A;  4YDP A;  5IL9 A;  4WYU A;  1QAV B;  1W9O A;  4NMR A;  1P1D A;  1TQ3 A;  5E11 A;  1VCW A;  2DAZ A;  1XZ9 A;  1UEP A;  2LC7 A;  5F3X A;  2M3M A;  1WI4 A;  1D5G A;  1WI2 A;  4E34 A;  1VA8 A;  5HF4 A;  1UIT A;  4H11 A;  2EEJ A;  2Q3G A;  2DKR A;  1Q7X A;  3CBY A;  3E17 A;  1ZUB A;  5HFF A;  2OMJ A;  3I4W A;  2EDP A;  4PQW A;  3MH4 A;  2DLU A;  1X45 A;  2ZPL A;  1WH1 A;  4P2A B;  2OSG A;  2VZ5 A;  3I18 A;  1MC7 A;  3I1E A;  1FC9 A;  5HFD A;  4JJ3 A;  5E21 A;  1P1E A;  1KEF A;  3GGE A;  2FCF A;  3HVQ C;  3SUZ A;  2FNE A;  2KL1 A;  1B8Q A;  1Q3O A;  2FN5 A;  1M5Z A;  2DC2 A;  3PV2 A;  3PDZ A;  1Z87 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...