1Z86A

Solution structure of the pdz domain of alpha-syntrophin
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
87
structure length
87
Chain Sequence
RRRVTVRKADAGGLGISIKGGRENKMPILISKIFKGLAADQTEALFVGDAILSVNGEDLSSATHDEAVQALKKTGKEVVLEVKYMKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-1-syntrophin
publication title Structure of the split PH domain and distinct lipid-binding properties of the PH-PDZ supramodule of alpha-syntrophin
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
total genus 11
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2005-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 1z86A00
2Q3GA 4K6YA 5HFCA 2Z9IA 5FHTA 4JOGA 1ZUBA 4PQWA 2YUYA 3DIWA 2BYGA 1M5ZA 3OU0A 3HPMA 2KBSA 4NMQA 4JL7A 3K82A 4JOEA 4JORA 4O06A 1L6OA 4MPAA 2KOJA 1ZOKA 1OBXA 3HVQC 3GDUA 2JOAA 1G9OA 3LNXA 2LOBA 2KJDA 3STJA 2JWEA 2PKUA 1W9OA 2IWQA 2GZVA 4Q2QA 3KZEA 2DC2A 2REYA 4JOJA 5EYZA 1N6EA 2KOHA 4L8NA 1VCWA 3QO6A 2I0LA 2OGPA 3GDSA 1WFGA 1WI4A 3GSLA 1FCFA 4Q3HA 2DAZA 4OEOA 5JXBA 4NXRA 3LNYA 2LC6A 5G1EA 3PV2A 4NXQA 4K76A 3GCNA 2DM8A 2V90A 4HOPB 3KZDA 4AMHA 3ID3A 2AWWA 1T2MA 3CBXA 1WHAA 3DJ3A 4NMVA 3TSVA 5HEDA 1U37A 1N6DA 1IU0A 2EEJA 3QDOA 2PA1A 3QJNA 1U3BA 2DJTA 2EV8A 4NMTA 1QAVB 3TSWA 1KWAA 2YT8A 5HFEA 5A2PA 4K72A 4NMRA 2LC7A 1P1DA 2D92A 2Z17A 2OCSA 4UU5A 1RGWA 4YYXA 5D13A 1N99A 1Z87A 2H3MA 2EGOA 5E6PB 2AWXA 1OBYA 3RL8A 5DTHA 3SOEA 1BE9A 3PDVA 3JXTA 5HEBA 3VQFA 1VA8A 2K20A 2IWOA 3CYYA 2VRFA 4K75A 3HPKA 2W7RA 4JOFA 1UFXA 2MX6A 1WHDA 2EDZA 2MHOA 4E34A 1FC9A 1UJDA 1N7EA 1WF7A 4RI0A 1I16A 2O2TA 2EEIA 1UEWA 5GLJA 1WFVA 2PDZA 2KYLA 3ID1A 5G1DA 2I04A 3PDZA 1X45A 3L4FD 5HETA 2DKRA 3EGGC 5H3JA 2PNTA 2P3WA 2V1WA 1UEPA 4LMMA 4E3BA 2DLUA 3QIKA 4GVCA 2D90A 3GDVA 2KG2A 2G5MB 1YBOA 1W9EA 2RCZA 2FCFA 1IU2A 2HE2A 1Y7NA 5HDYA 2EXGA 4H11A 1Z86A 4NMOA 1NTEA 3TMHA 2M0VA 1PDRA 1LCYA 1UF1A 5HEYA 5E22A 1UM1A 5I7ZA 2JILA 3ZRTA 4P0CA 4FGMA 3CBYA 3NGHA 1V1TA 2OZFA 3B76A 2I6VA 2Q9VA 1WH1A 5B6LA 1QAUA 2KOMA 4UU6A 3RLEA 4NMPA 2UZCA 3GJ9A 3SFJA 4P2AB 3CC0A 1N7FA 2KA9A 4Q2NA 1WJLA 1TP5A 5EZ0A 3R68A 2OS6A 4E35A 5FB8C 1IHJA 3QGLA 1VJ6A 3SUZA 1GQ5A 3TSZA 1MFGA 1TE0A 1X5NA 5E21A 2CS5A 3O46A 1UEZA 2L4SA 2OSGA 3DJAA 3E17A 4G69A 3WKLA 4NMSA 4XHVA 4NNMA 2CSSA 5GNDA 2H3LA 2VWRA 2L4TA 2X7ZA 4YDPA 2ZPMA 4Z8JA 2FNEA 3CS0A 4NNLA 1NF3C 1MC7A 3RL7A 2AINA 2QG1A 3R69A 1UM7A 3GGEA 2M0ZA 4KFVA 1GQ4A 2LA8A 3EGHC 4HOPA 1I92A 2D8IA 1RY4A 2EDPA 1XZ9A 1OZIA 2JIKA 2F0AA 1GM1A 2YT7A 1KEFA 1U38A 2FN5A 1KY9A 2LUIA 2KAWA 2EGNA 2M3MA 1RZXA 3I1EA 5HFBA 2QKUA 3KHFA 2F5YA 3MH4A 5HFFA 2PZDA 1QAVA 3DJ1A 2YTWA 4EDJA 3PV4A 1Q3PA 5E1YA 2DMZA 2OPGA 1P1EA 2HGAA 2QBWA 4R2ZA 4REYA 5F67A 3MH7A 2VSPA 1V6BA 1V62A 4GHNA 3DORA 2WL7A 5HJ1A 3K50A 2M0TA 2IWPA 3O5NA 3PV5A 1VAEA 4WYUA 3QJMA 2JREA 4NXPA 2RRMA 3NFLA 3PS4A 2QKVA 2KJPA 5E11A 2ENOA 4JOHA 1UJUA 2IWNA 1K32A 2M0UA 2DB5A 3BPUA 3MH6A 1V5LA 1BFEA 2I4SA 2R3YA 3R0HA 1WI2A 4GVDA 2I1NA 3WKMA 3SHUA 1UHPA 1SOTA 2AWUA 1UITA 4K78A 1WF8A 1FC7A 3CBZA 4KFWA 1N7TA 2DLSA 1WIFA 2KPKA 2EJYA 2ZPLA 3SHWA 1V5QA 2YUBA 4Q6HA 2G2LA 2PKTA 1UJVA 2FE5A 1QLCA 2VPHA 4WYTA 5HFDA 2VSVA 4Q6SA 4N6XA 2KL1A 4Q2PA 2OQSA 3ID4A 1WG6A 2OMJA 1X5RA 4Q2OA 2QT5A 4JOKA 2HE4A 3NFKA 3QE1A 1X8SA 1N6FA 1W9QA 3OTPA 3K1RA 2EDVA 2K1ZA 2I0IA 1TQ3A 3CH8A 2EHRA 1Y8TA 5HF4A 2VZ5A 4OAJA 1MFLA 2KRGA 2E7KA 2W4FA 1VB7A 1R6JA 2QKTA 4IC6A 2JINA 2JXOA 2KV8A 1B8QA 1Q3OA 1OBZA 3FY5A 1UEQA 2EAQA 1U39A 5F3XA 2CSJA 2EEGA 4OEPA 2H2BA 1X5QA 3AXAA 2L97A 3I4WA 3VQGA 2EGKA 2KPLA 4JOPA 4F8KA 3ID2A 1SOZA 1X6DA 1D5GA 2R4HA 3I18A 1FC6A 1TP3A 2KQFA 2EEHA 2H2CA 2M10A 4Z33A 3GCOA 5HF1A 1RGRA 2KJKA 1Q7XA
chains in the Genus database with same CATH superfamily
2Q3GA 4K6YA 5HFCA 2Z9IA 5FHTA 4JOGA 1ZUBA 4PQWA 2YUYA 3DIWA 2BYGA 1M5ZA 3OU0A 3HPMA 2KBSA 4NMQA 4JL7A 3K82A 4JOEA 4JORA 2JSNA 4O06A 1L6OA 1X9ZA 4MPAA 2KOJA 2GEFA 1ZOKA 1OBXA 3HVQC 3GDUA 2JOAA 1G9OA 3LNXA 2LOBA 2KJDA 3STJA 2JWEA 2PKUA 1W9OA 2IWQA 2GZVA 4Q2QA 3KZEA 2DC2A 2REYA 4JOJA 5EYZA 1N6EA 2KOHA 4L8NA 1VCWA 3QO6A 2I0LA 2OGPA 3GDSA 1WFGA 1WI4A 3GSLA 1FCFA 4Q3HA 2DAZA 4OEOA 5JXBA 4NXRA 3GABA 3LNYA 2LC6A 5G1EA 3PV2A 4NXQA 3KDKA 4K76A 3GCNA 2DM8A 2V90A 4HOPB 3KZDA 4AMHA 3ID3A 2AWWA 1T2MA 3CBXA 1WHAA 3DJ3A 4NMVA 3TSVA 5HEDA 1U37A 1N6DA 1IU0A 2EEJA 3QDOA 2PA1A 3QJNA 1U3BA 2DJTA 2EV8A 4NMTA 1QAVB 3TSWA 1KWAA 2YT8A 5HFEA 5A2PA 4K72A 4NMRA 2LC7A 1P1DA 2D92A 5IL9A 2Z17A 2OCSA 4UU5A 1RGWA 4YYXA 5D13A 1N99A 1Z87A 2H3MA 2EGOA 5E6PB 2AWXA 1OBYA 3RL8A 5DTHA 3SOEA 1BE9A 3PDVA 3JXTA 5HEBA 3VQFA 1VA8A 2K20A 2IWOA 3CYYA 4JJ3A 2VRFA 4K75A 3HPKA 2W7RA 4JOFA 1UFXA 2MX6A 1WHDA 2EDZA 2MHOA 4E34A 1FC9A 1UJDA 1N7EA 1WF7A 4RI0A 1I16A 2O2TA 2EEIA 1UEWA 5GLJA 1WFVA 2PDZA 5ILBA 2KYLA 3ID1A 5G1DA 2I04A 3PDZA 1X45A 3L4FD 5HETA 2DKRA 3EGGC 5H3JA 2PNTA 2P3WA 2V1WA 1UEPA 4LMMA 4E3BA 2DLUA 3QIKA 4GVCA 2D90A 3GDVA 2KG2A 2G5MB 1YBOA 1W9EA 2RCZA 2FCFA 1IU2A 2HE2A 1Y7NA 5HDYA 2EXGA 4H11A 1Z86A 4NMOA 1NTEA 5B42A 3TMHA 2M0VA 1PDRA 1LCYA 1UF1A 5HEYA 5E22A 1UM1A 5I7ZA 3KDGA 2JILA 3ZRTA 4P0CA 4FGMA 3CBYA 3NGHA 1V1TA 2OZFA 3B76A 4FLNA 2I6VA 2Q9VA 1WH1A 5B6LA 4JJ0A 1QAUA 2KOMA 4UU6A 3RLEA 4NMPA 2UZCA 3GJ9A 3SFJA 4P2AB 3CC0A 1N7FA 2KA9A 4Q2NA 1WJLA 1TP5A 5EZ0A 3R68A 2OS6A 4E35A 5FB8C 1IHJA 3QGLA 1VJ6A 3SUZA 1GQ5A 3TSZA 1MFGA 1TE0A 1X5NA 5E21A 2CS5A 3O46A 1UEZA 2L4SA 2OSGA 3DJAA 3E17A 4G69A 3WKLA 4NMSA 4XHVA 4NNMA 2CSSA 5GNDA 2H3LA 2VWRA 2L4TA 2X7ZA 4YDPA 2ZPMA 4Z8JA 2FNEA 3CS0A 4NNLA 1NF3C 1MC7A 3RL7A 2AINA 2QG1A 3R69A 1UM7A 3GGEA 2M0ZA 4KFVA 1GQ4A 2LA8A 3EGHC 3NCVA 4HOPA 1I92A 2D8IA 1RY4A 2EDPA 1XZ9A 1OZIA 2JIKA 2F0AA 1GM1A 2YT7A 1KEFA 1U38A 2FN5A 1KY9A 2LUIA 2KAWA 2EGNA 2M3MA 1RZXA 3I1EA 5HFBA 2QKUA 3KHFA 2F5YA 3MH4A 5HFFA 2PZDA 1QAVA 3DJ1A 2YTWA 4EDJA 3PV4A 1Q3PA 5E1YA 2DMZA 2OPGA 1P1EA 2HGAA 2QBWA 4R2ZA 4REYA 5F67A 3MH7A 2VSPA 1V6BA 1V62A 4GHNA 3DORA 2WL7A 5HJ1A 3K50A 2M0TA 2IWPA 3O5NA 3PV5A 1VAEA 4WYUA 3QJMA 2JREA 4NXPA 2RRMA 3NFLA 3PS4A 2QKVA 2KJPA 5E11A 2ENOA 4JOHA 1UJUA 2IWNA 1K32A 2M0UA 2DB5A 3BPUA 3MH6A 1V5LA 1BFEA 2I4SA 2R3YA 3R0HA 1WI2A 4GVDA 2I1NA 3WKMA 3SHUA 1UHPA 1SOTA 2AWUA 1UITA 4K78A 1WF8A 1FC7A 3CBZA 4KFWA 1N7TA 2DLSA 1WIFA 2KPKA 2EJYA 2ZPLA 3SHWA 1V5QA 2YUBA 4Q6HA 2G2LA 2PKTA 1UJVA 2FE5A 1QLCA 2VPHA 4WYTA 5HFDA 2VSVA 4Q6SA 4N6XA 2KL1A 4Q2PA 2OQSA 3ID4A 1WG6A 2OMJA 1X5RA 4Q2OA 2QT5A 4JOKA 2HE4A 3NFKA 3QE1A 1X8SA 1N6FA 1W9QA 3OTPA 3K1RA 2EDVA 2K1ZA 2I0IA 1TQ3A 3CH8A 2EHRA 1Y8TA 5HF4A 2VZ5A 4OAJA 1MFLA 2KRGA 2E7KA 2W4FA 1VB7A 1R6JA 2QKTA 4IC6A 2JINA 2JXOA 2KV8A 1B8QA 1Q3OA 1OBZA 3FY5A 1UEQA 2EAQA 1U39A 5F3XA 2CSJA 2EEGA 4OEPA 2H2BA 1X5QA 3AXAA 2L97A 3I4WA 3VQGA 2EGKA 2KPLA 4JOPA 4F8KA 3ID2A 1SOZA 1X6DA 1D5GA 2R4HA 3I18A 1FC6A 1TP3A 2KQFA 2EEHA 2H2CA 2M10A 4Z33A 3GCOA 5HF1A 1RGRA 2KJKA 1Q7XA
chains in the Genus database with same CATH topology
2Q3GA 4K6YA 5HFCA 2Z9IA 5FHTA 4JOGA 1ZUBA 4PQWA 2YUYA 3DIWA 2BYGA 1M5ZA 3OU0A 3HPMA 2KBSA 4NMQA 4JL7A 3K82A 4JOEA 4JORA 2JSNA 4O06A 1L6OA 1X9ZA 4MPAA 2KOJA 2GEFA 1ZOKA 1OBXA 3HVQC 3GDUA 2JOAA 1G9OA 3LNXA 2LOBA 2KJDA 3STJA 2JWEA 2PKUA 1W9OA 2IWQA 2GZVA 4Q2QA 3KZEA 2DC2A 2REYA 4JOJA 5EYZA 1N6EA 2KOHA 4L8NA 1VCWA 3QO6A 2I0LA 2OGPA 3GDSA 1WFGA 1WI4A 3GSLA 1FCFA 4Q3HA 2DAZA 4OEOA 5JXBA 4NXRA 3GABA 3LNYA 2LC6A 5G1EA 3PV2A 4NXQA 3KDKA 4K76A 3GCNA 2DM8A 2V90A 4HOPB 3KZDA 4AMHA 3ID3A 2AWWA 1T2MA 3CBXA 1WHAA 3DJ3A 4NMVA 3TSVA 5HEDA 1U37A 1N6DA 1IU0A 2EEJA 3QDOA 2PA1A 3QJNA 1U3BA 2DJTA 2EV8A 4NMTA 1QAVB 3TSWA 1KWAA 2YT8A 5HFEA 5A2PA 4K72A 4NMRA 2LC7A 1P1DA 2D92A 5IL9A 2Z17A 2OCSA 4UU5A 1RGWA 4YYXA 5D13A 1N99A 1Z87A 2H3MA 2EGOA 5E6PB 2AWXA 1OBYA 3RL8A 5DTHA 3SOEA 1BE9A 3PDVA 3JXTA 5HEBA 3VQFA 1VA8A 2K20A 2IWOA 3CYYA 4JJ3A 2VRFA 4K75A 3HPKA 2W7RA 4JOFA 1UFXA 2MX6A 1WHDA 2EDZA 2MHOA 4E34A 1FC9A 1UJDA 1N7EA 1WF7A 4RI0A 1I16A 2O2TA 2EEIA 1UEWA 5GLJA 1WFVA 2PDZA 5ILBA 2KYLA 3ID1A 5G1DA 2I04A 3PDZA 1X45A 3L4FD 5HETA 2DKRA 3EGGC 5H3JA 2PNTA 2P3WA 2V1WA 1UEPA 4LMMA 4E3BA 2DLUA 3QIKA 4GVCA 2D90A 3GDVA 2KG2A 2G5MB 1YBOA 1W9EA 2RCZA 2FCFA 1IU2A 2HE2A 1Y7NA 5HDYA 2EXGA 4H11A 1Z86A 4NMOA 1NTEA 5B42A 3TMHA 2M0VA 1PDRA 1LCYA 1UF1A 5HEYA 5E22A 1UM1A 5I7ZA 3KDGA 2JILA 3ZRTA 4P0CA 4FGMA 3CBYA 3NGHA 1V1TA 2OZFA 3B76A 4FLNA 2I6VA 2Q9VA 1WH1A 5B6LA 4JJ0A 1QAUA 2KOMA 4UU6A 3RLEA 4NMPA 2UZCA 3GJ9A 3SFJA 4P2AB 3CC0A 1N7FA 2KA9A 4Q2NA 1WJLA 1TP5A 5EZ0A 3R68A 2OS6A 4E35A 5FB8C 1IHJA 3QGLA 1VJ6A 3SUZA 1GQ5A 3TSZA 1MFGA 1TE0A 1X5NA 5E21A 2CS5A 3O46A 1UEZA 2L4SA 2OSGA 3DJAA 3E17A 4G69A 3WKLA 4NMSA 4XHVA 4NNMA 2CSSA 5GNDA 2H3LA 2VWRA 2L4TA 2X7ZA 4YDPA 2ZPMA 4Z8JA 2FNEA 3CS0A 4NNLA 1NF3C 1MC7A 3RL7A 2AINA 2QG1A 3R69A 1UM7A 3GGEA 2M0ZA 4KFVA 1GQ4A 2LA8A 3EGHC 3NCVA 4HOPA 1I92A 2D8IA 1RY4A 2EDPA 1XZ9A 1OZIA 2JIKA 2F0AA 1GM1A 2YT7A 1KEFA 1U38A 2FN5A 1KY9A 2LUIA 2KAWA 2EGNA 2M3MA 1RZXA 3I1EA 5HFBA 2QKUA 3KHFA 2F5YA 3MH4A 5HFFA 2PZDA 1QAVA 3DJ1A 2YTWA 4EDJA 3PV4A 1Q3PA 5E1YA 2DMZA 2OPGA 1P1EA 2HGAA 2QBWA 4R2ZA 4REYA 5F67A 3MH7A 2VSPA 1V6BA 1V62A 4GHNA 3DORA 2WL7A 5HJ1A 3K50A 2M0TA 2IWPA 3O5NA 3PV5A 1VAEA 4WYUA 3QJMA 2JREA 4NXPA 2RRMA 3NFLA 3PS4A 2QKVA 2KJPA 5E11A 2ENOA 4JOHA 1UJUA 2IWNA 1K32A 2M0UA 2DB5A 3BPUA 3MH6A 1V5LA 1BFEA 2I4SA 2R3YA 3R0HA 1WI2A 4GVDA 2I1NA 3WKMA 3SHUA 1UHPA 1SOTA 2AWUA 1UITA 4K78A 1WF8A 1FC7A 3CBZA 4KFWA 1N7TA 2DLSA 1WIFA 2KPKA 2EJYA 2ZPLA 3SHWA 1V5QA 2YUBA 4Q6HA 2G2LA 2PKTA 1UJVA 2FE5A 1QLCA 2VPHA 4WYTA 5HFDA 2VSVA 4Q6SA 4N6XA 2KL1A 4Q2PA 2OQSA 3ID4A 1WG6A 2OMJA 1X5RA 4Q2OA 2QT5A 4JOKA 2HE4A 3NFKA 3QE1A 1X8SA 1N6FA 1W9QA 3OTPA 3K1RA 2EDVA 2K1ZA 2I0IA 1TQ3A 3CH8A 2EHRA 1Y8TA 5HF4A 2VZ5A 4OAJA 1MFLA 2KRGA 2E7KA 2W4FA 1VB7A 1R6JA 2QKTA 4IC6A 2JINA 2JXOA 2KV8A 1B8QA 1Q3OA 1OBZA 3FY5A 1UEQA 2EAQA 1U39A 5F3XA 2CSJA 2EEGA 4OEPA 2H2BA 1X5QA 3AXAA 2L97A 3I4WA 3VQGA 2EGKA 2KPLA 4JOPA 4F8KA 3ID2A 1SOZA 1X6DA 1D5GA 2R4HA 3I18A 1FC6A 1TP3A 2KQFA 2EEHA 2H2CA 2M10A 4Z33A 3GCOA 5HF1A 1RGRA 2KJKA 1Q7XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q3G A;  4K6Y A;  5HFC A;  2Z9I A;  5FHT A;  4JOG A;  1ZUB A;  4PQW A;  2YUY A;  3DIW A;  2BYG A;  1M5Z A;  3OU0 A;  3HPM A;  2KBS A;  4NMQ A;  4JL7 A;  3K82 A;  4JOE A;  4JOR A;  4O06 A;  1L6O A;  4MPA A;  2KOJ A;  1ZOK A;  1OBX A;  3HVQ C;  3GDU A;  2JOA A;  1G9O A;  3LNX A;  2LOB A;  2KJD A;  3STJ A;  2JWE A;  2PKU A;  1W9O A;  2IWQ A;  2GZV A;  4Q2Q A;  3KZE A;  2DC2 A;  2REY A;  4JOJ A;  5EYZ A;  1N6E A;  2KOH A;  4L8N A;  1VCW A;  3QO6 A;  2I0L A;  2OGP A;  3GDS A;  1WFG A;  1WI4 A;  3GSL A;  1FCF A;  4Q3H A;  2DAZ A;  4OEO A;  5JXB A;  4NXR A;  3LNY A;  2LC6 A;  5G1E A;  3PV2 A;  4NXQ A;  4K76 A;  3GCN A;  2DM8 A;  2V90 A;  4HOP B;  3KZD A;  4AMH A;  3ID3 A;  2AWW A;  1T2M A;  3CBX A;  1WHA A;  3DJ3 A;  4NMV A;  3TSV A;  5HED A;  1U37 A;  1N6D A;  1IU0 A;  2EEJ A;  3QDO A;  2PA1 A;  3QJN A;  1U3B A;  2DJT A;  2EV8 A;  4NMT A;  1QAV B;  3TSW A;  1KWA A;  2YT8 A;  5HFE A;  5A2P A;  4K72 A;  4NMR A;  2LC7 A;  1P1D A;  2D92 A;  2Z17 A;  2OCS A;  4UU5 A;  1RGW A;  4YYX A;  5D13 A;  1N99 A;  1Z87 A;  2H3M A;  2EGO A;  5E6P B;  2AWX A;  1OBY A;  3RL8 A;  5DTH A;  3SOE A;  1BE9 A;  3PDV A;  3JXT A;  5HEB A;  3VQF A;  1VA8 A;  2K20 A;  2IWO A;  3CYY A;  2VRF A;  4K75 A;  3HPK A;  2W7R A;  4JOF A;  1UFX A;  2MX6 A;  1WHD A;  2EDZ A;  2MHO A;  4E34 A;  1FC9 A;  1UJD A;  1N7E A;  1WF7 A;  4RI0 A;  1I16 A;  2O2T A;  2EEI A;  1UEW A;  5GLJ A;  1WFV A;  2PDZ A;  2KYL A;  3ID1 A;  5G1D A;  2I04 A;  3PDZ A;  1X45 A;  3L4F D;  5HET A;  2DKR A;  3EGG C;  5H3J A;  2PNT A;  2P3W A;  2V1W A;  1UEP A;  4LMM A;  4E3B A;  2DLU A;  3QIK A;  4GVC A;  2D90 A;  3GDV A;  2KG2 A;  2G5M B;  1YBO A;  1W9E A;  2RCZ A;  2FCF A;  1IU2 A;  2HE2 A;  1Y7N A;  5HDY A;  2EXG A;  4H11 A;  1Z86 A;  4NMO A;  1NTE A;  3TMH A;  2M0V A;  1PDR A;  1LCY A;  1UF1 A;  5HEY A;  5E22 A;  1UM1 A;  5I7Z A;  2JIL A;  3ZRT A;  4P0C A;  4FGM A;  3CBY A;  3NGH A;  1V1T A;  2OZF A;  3B76 A;  2I6V A;  2Q9V A;  1WH1 A;  5B6L A;  1QAU A;  2KOM A;  4UU6 A;  3RLE A;  4NMP A;  2UZC A;  3GJ9 A;  3SFJ A;  4P2A B;  3CC0 A;  1N7F A;  2KA9 A;  4Q2N A;  1WJL A;  1TP5 A;  5EZ0 A;  3R68 A;  2OS6 A;  4E35 A;  5FB8 C;  1IHJ A;  3QGL A;  1VJ6 A;  3SUZ A;  1GQ5 A;  3TSZ A;  1MFG A;  1TE0 A;  1X5N A;  5E21 A;  2CS5 A;  3O46 A;  1UEZ A;  2L4S A;  2OSG A;  3DJA A;  3E17 A;  4G69 A;  3WKL A;  4NMS A;  4XHV A;  4NNM A;  2CSS A;  5GND A;  2H3L A;  2VWR A;  2L4T A;  2X7Z A;  4YDP A;  2ZPM A;  4Z8J A;  2FNE A;  3CS0 A;  4NNL A;  1NF3 C;  1MC7 A;  3RL7 A;  2AIN A;  2QG1 A;  3R69 A;  1UM7 A;  3GGE A;  2M0Z A;  4KFV A;  1GQ4 A;  2LA8 A;  3EGH C;  4HOP A;  1I92 A;  2D8I A;  1RY4 A;  2EDP A;  1XZ9 A;  1OZI A;  2JIK A;  2F0A A;  1GM1 A;  2YT7 A;  1KEF A;  1U38 A;  2FN5 A;  1KY9 A;  2LUI A;  2KAW A;  2EGN A;  2M3M A;  1RZX A;  3I1E A;  5HFB A;  2QKU A;  3KHF A;  2F5Y A;  3MH4 A;  5HFF A;  2PZD A;  1QAV A;  3DJ1 A;  2YTW A;  4EDJ A;  3PV4 A;  1Q3P A;  5E1Y A;  2DMZ A;  2OPG A;  1P1E A;  2HGA A;  2QBW A;  4R2Z A;  4REY A;  5F67 A;  3MH7 A;  2VSP A;  1V6B A;  1V62 A;  4GHN A;  3DOR A;  2WL7 A;  5HJ1 A;  3K50 A;  2M0T A;  2IWP A;  3O5N A;  3PV5 A;  1VAE A;  4WYU A;  3QJM A;  2JRE A;  4NXP A;  2RRM A;  3NFL A;  3PS4 A;  2QKV A;  2KJP A;  5E11 A;  2ENO A;  4JOH A;  1UJU A;  2IWN A;  1K32 A;  2M0U A;  2DB5 A;  3BPU A;  3MH6 A;  1V5L A;  1BFE A;  2I4S A;  2R3Y A;  3R0H A;  1WI2 A;  4GVD A;  2I1N A;  3WKM A;  3SHU A;  1UHP A;  1SOT A;  2AWU A;  1UIT A;  4K78 A;  1WF8 A;  1FC7 A;  3CBZ A;  4KFW A;  1N7T A;  2DLS A;  1WIF A;  2KPK A;  2EJY A;  2ZPL A;  3SHW A;  1V5Q A;  2YUB A;  4Q6H A;  2G2L A;  2PKT A;  1UJV A;  2FE5 A;  1QLC A;  2VPH A;  4WYT A;  5HFD A;  2VSV A;  4Q6S A;  4N6X A;  2KL1 A;  4Q2P A;  2OQS A;  3ID4 A;  1WG6 A;  2OMJ A;  1X5R A;  4Q2O A;  2QT5 A;  4JOK A;  2HE4 A;  3NFK A;  3QE1 A;  1X8S A;  1N6F A;  1W9Q A;  3OTP A;  3K1R A;  2EDV A;  2K1Z A;  2I0I A;  1TQ3 A;  3CH8 A;  2EHR A;  1Y8T A;  5HF4 A;  2VZ5 A;  4OAJ A;  1MFL A;  2KRG A;  2E7K A;  2W4F A;  1VB7 A;  1R6J A;  2QKT A;  4IC6 A;  2JIN A;  2JXO A;  2KV8 A;  1B8Q A;  1Q3O A;  1OBZ A;  3FY5 A;  1UEQ A;  2EAQ A;  1U39 A;  5F3X A;  2CSJ A;  2EEG A;  4OEP A;  2H2B A;  1X5Q A;  3AXA A;  2L97 A;  3I4W A;  3VQG A;  2EGK A;  2KPL A;  4JOP A;  4F8K A;  3ID2 A;  1SOZ A;  1X6D A;  1D5G A;  2R4H A;  3I18 A;  1FC6 A;  1TP3 A;  2KQF A;  2EEH A;  2H2C A;  2M10 A;  4Z33 A;  3GCO A;  5HF1 A;  1RGR A;  2KJK A;  1Q7X A; 
#chains in the Genus database with same CATH topology
 2Q3G A;  4K6Y A;  5HFC A;  2Z9I A;  5FHT A;  4JOG A;  1ZUB A;  4PQW A;  2YUY A;  3DIW A;  2BYG A;  1M5Z A;  3OU0 A;  3HPM A;  2KBS A;  4NMQ A;  4JL7 A;  3K82 A;  4JOE A;  4JOR A;  2JSN A;  4O06 A;  1L6O A;  1X9Z A;  4MPA A;  2KOJ A;  2GEF A;  1ZOK A;  1OBX A;  3HVQ C;  3GDU A;  2JOA A;  1G9O A;  3LNX A;  2LOB A;  2KJD A;  3STJ A;  2JWE A;  2PKU A;  1W9O A;  2IWQ A;  2GZV A;  4Q2Q A;  3KZE A;  2DC2 A;  2REY A;  4JOJ A;  5EYZ A;  1N6E A;  2KOH A;  4L8N A;  1VCW A;  3QO6 A;  2I0L A;  2OGP A;  3GDS A;  1WFG A;  1WI4 A;  3GSL A;  1FCF A;  4Q3H A;  2DAZ A;  4OEO A;  5JXB A;  4NXR A;  3GAB A;  3LNY A;  2LC6 A;  5G1E A;  3PV2 A;  4NXQ A;  3KDK A;  4K76 A;  3GCN A;  2DM8 A;  2V90 A;  4HOP B;  3KZD A;  4AMH A;  3ID3 A;  2AWW A;  1T2M A;  3CBX A;  1WHA A;  3DJ3 A;  4NMV A;  3TSV A;  5HED A;  1U37 A;  1N6D A;  1IU0 A;  2EEJ A;  3QDO A;  2PA1 A;  3QJN A;  1U3B A;  2DJT A;  2EV8 A;  4NMT A;  1QAV B;  3TSW A;  1KWA A;  2YT8 A;  5HFE A;  5A2P A;  4K72 A;  4NMR A;  2LC7 A;  1P1D A;  2D92 A;  5IL9 A;  2Z17 A;  2OCS A;  4UU5 A;  1RGW A;  4YYX A;  5D13 A;  1N99 A;  1Z87 A;  2H3M A;  2EGO A;  5E6P B;  2AWX A;  1OBY A;  3RL8 A;  5DTH A;  3SOE A;  1BE9 A;  3PDV A;  3JXT A;  5HEB A;  3VQF A;  1VA8 A;  2K20 A;  2IWO A;  3CYY A;  4JJ3 A;  2VRF A;  4K75 A;  3HPK A;  2W7R A;  4JOF A;  1UFX A;  2MX6 A;  1WHD A;  2EDZ A;  2MHO A;  4E34 A;  1FC9 A;  1UJD A;  1N7E A;  1WF7 A;  4RI0 A;  1I16 A;  2O2T A;  2EEI A;  1UEW A;  5GLJ A;  1WFV A;  2PDZ A;  5ILB A;  2KYL A;  3ID1 A;  5G1D A;  2I04 A;  3PDZ A;  1X45 A;  3L4F D;  5HET A;  2DKR A;  3EGG C;  5H3J A;  2PNT A;  2P3W A;  2V1W A;  1UEP A;  4LMM A;  4E3B A;  2DLU A;  3QIK A;  4GVC A;  2D90 A;  3GDV A;  2KG2 A;  2G5M B;  1YBO A;  1W9E A;  2RCZ A;  2FCF A;  1IU2 A;  2HE2 A;  1Y7N A;  5HDY A;  2EXG A;  4H11 A;  1Z86 A;  4NMO A;  1NTE A;  5B42 A;  3TMH A;  2M0V A;  1PDR A;  1LCY A;  1UF1 A;  5HEY A;  5E22 A;  1UM1 A;  5I7Z A;  3KDG A;  2JIL A;  3ZRT A;  4P0C A;  4FGM A;  3CBY A;  3NGH A;  1V1T A;  2OZF A;  3B76 A;  4FLN A;  2I6V A;  2Q9V A;  1WH1 A;  5B6L A;  4JJ0 A;  1QAU A;  2KOM A;  4UU6 A;  3RLE A;  4NMP A;  2UZC A;  3GJ9 A;  3SFJ A;  4P2A B;  3CC0 A;  1N7F A;  2KA9 A;  4Q2N A;  1WJL A;  1TP5 A;  5EZ0 A;  3R68 A;  2OS6 A;  4E35 A;  5FB8 C;  1IHJ A;  3QGL A;  1VJ6 A;  3SUZ A;  1GQ5 A;  3TSZ A;  1MFG A;  1TE0 A;  1X5N A;  5E21 A;  2CS5 A;  3O46 A;  1UEZ A;  2L4S A;  2OSG A;  3DJA A;  3E17 A;  4G69 A;  3WKL A;  4NMS A;  4XHV A;  4NNM A;  2CSS A;  5GND A;  2H3L A;  2VWR A;  2L4T A;  2X7Z A;  4YDP A;  2ZPM A;  4Z8J A;  2FNE A;  3CS0 A;  4NNL A;  1NF3 C;  1MC7 A;  3RL7 A;  2AIN A;  2QG1 A;  3R69 A;  1UM7 A;  3GGE A;  2M0Z A;  4KFV A;  1GQ4 A;  2LA8 A;  3EGH C;  3NCV A;  4HOP A;  1I92 A;  2D8I A;  1RY4 A;  2EDP A;  1XZ9 A;  1OZI A;  2JIK A;  2F0A A;  1GM1 A;  2YT7 A;  1KEF A;  1U38 A;  2FN5 A;  1KY9 A;  2LUI A;  2KAW A;  2EGN A;  2M3M A;  1RZX A;  3I1E A;  5HFB A;  2QKU A;  3KHF A;  2F5Y A;  3MH4 A;  5HFF A;  2PZD A;  1QAV A;  3DJ1 A;  2YTW A;  4EDJ A;  3PV4 A;  1Q3P A;  5E1Y A;  2DMZ A;  2OPG A;  1P1E A;  2HGA A;  2QBW A;  4R2Z A;  4REY A;  5F67 A;  3MH7 A;  2VSP A;  1V6B A;  1V62 A;  4GHN A;  3DOR A;  2WL7 A;  5HJ1 A;  3K50 A;  2M0T A;  2IWP A;  3O5N A;  3PV5 A;  1VAE A;  4WYU A;  3QJM A;  2JRE A;  4NXP A;  2RRM A;  3NFL A;  3PS4 A;  2QKV A;  2KJP A;  5E11 A;  2ENO A;  4JOH A;  1UJU A;  2IWN A;  1K32 A;  2M0U A;  2DB5 A;  3BPU A;  3MH6 A;  1V5L A;  1BFE A;  2I4S A;  2R3Y A;  3R0H A;  1WI2 A;  4GVD A;  2I1N A;  3WKM A;  3SHU A;  1UHP A;  1SOT A;  2AWU A;  1UIT A;  4K78 A;  1WF8 A;  1FC7 A;  3CBZ A;  4KFW A;  1N7T A;  2DLS A;  1WIF A;  2KPK A;  2EJY A;  2ZPL A;  3SHW A;  1V5Q A;  2YUB A;  4Q6H A;  2G2L A;  2PKT A;  1UJV A;  2FE5 A;  1QLC A;  2VPH A;  4WYT A;  5HFD A;  2VSV A;  4Q6S A;  4N6X A;  2KL1 A;  4Q2P A;  2OQS A;  3ID4 A;  1WG6 A;  2OMJ A;  1X5R A;  4Q2O A;  2QT5 A;  4JOK A;  2HE4 A;  3NFK A;  3QE1 A;  1X8S A;  1N6F A;  1W9Q A;  3OTP A;  3K1R A;  2EDV A;  2K1Z A;  2I0I A;  1TQ3 A;  3CH8 A;  2EHR A;  1Y8T A;  5HF4 A;  2VZ5 A;  4OAJ A;  1MFL A;  2KRG A;  2E7K A;  2W4F A;  1VB7 A;  1R6J A;  2QKT A;  4IC6 A;  2JIN A;  2JXO A;  2KV8 A;  1B8Q A;  1Q3O A;  1OBZ A;  3FY5 A;  1UEQ A;  2EAQ A;  1U39 A;  5F3X A;  2CSJ A;  2EEG A;  4OEP A;  2H2B A;  1X5Q A;  3AXA A;  2L97 A;  3I4W A;  3VQG A;  2EGK A;  2KPL A;  4JOP A;  4F8K A;  3ID2 A;  1SOZ A;  1X6D A;  1D5G A;  2R4H A;  3I18 A;  1FC6 A;  1TP3 A;  2KQF A;  2EEH A;  2H2C A;  2M10 A;  4Z33 A;  3GCO A;  5HF1 A;  1RGR A;  2KJK A;  1Q7X A; 
#chains in the Genus database with same CATH homology
 2Q3G A;  4K6Y A;  5HFC A;  2Z9I A;  5FHT A;  4JOG A;  1ZUB A;  4PQW A;  2YUY A;  3DIW A;  2BYG A;  1M5Z A;  3OU0 A;  3HPM A;  2KBS A;  4NMQ A;  4JL7 A;  3K82 A;  4JOE A;  4JOR A;  2JSN A;  4O06 A;  1L6O A;  1X9Z A;  4MPA A;  2KOJ A;  2GEF A;  1ZOK A;  1OBX A;  3HVQ C;  3GDU A;  2JOA A;  1G9O A;  3LNX A;  2LOB A;  2KJD A;  3STJ A;  2JWE A;  2PKU A;  1W9O A;  2IWQ A;  2GZV A;  4Q2Q A;  3KZE A;  2DC2 A;  2REY A;  4JOJ A;  5EYZ A;  1N6E A;  2KOH A;  4L8N A;  1VCW A;  3QO6 A;  2I0L A;  2OGP A;  3GDS A;  1WFG A;  1WI4 A;  3GSL A;  1FCF A;  4Q3H A;  2DAZ A;  4OEO A;  5JXB A;  4NXR A;  3GAB A;  3LNY A;  2LC6 A;  5G1E A;  3PV2 A;  4NXQ A;  3KDK A;  4K76 A;  3GCN A;  2DM8 A;  2V90 A;  4HOP B;  3KZD A;  4AMH A;  3ID3 A;  2AWW A;  1T2M A;  3CBX A;  1WHA A;  3DJ3 A;  4NMV A;  3TSV A;  5HED A;  1U37 A;  1N6D A;  1IU0 A;  2EEJ A;  3QDO A;  2PA1 A;  3QJN A;  1U3B A;  2DJT A;  2EV8 A;  4NMT A;  1QAV B;  3TSW A;  1KWA A;  2YT8 A;  5HFE A;  5A2P A;  4K72 A;  4NMR A;  2LC7 A;  1P1D A;  2D92 A;  5IL9 A;  2Z17 A;  2OCS A;  4UU5 A;  1RGW A;  4YYX A;  5D13 A;  1N99 A;  1Z87 A;  2H3M A;  2EGO A;  5E6P B;  2AWX A;  1OBY A;  3RL8 A;  5DTH A;  3SOE A;  1BE9 A;  3PDV A;  3JXT A;  5HEB A;  3VQF A;  1VA8 A;  2K20 A;  2IWO A;  3CYY A;  4JJ3 A;  2VRF A;  4K75 A;  3HPK A;  2W7R A;  4JOF A;  1UFX A;  2MX6 A;  1WHD A;  2EDZ A;  2MHO A;  4E34 A;  1FC9 A;  1UJD A;  1N7E A;  1WF7 A;  4RI0 A;  1I16 A;  2O2T A;  2EEI A;  1UEW A;  5GLJ A;  1WFV A;  2PDZ A;  5ILB A;  2KYL A;  3ID1 A;  5G1D A;  2I04 A;  3PDZ A;  1X45 A;  3L4F D;  5HET A;  2DKR A;  3EGG C;  5H3J A;  2PNT A;  2P3W A;  2V1W A;  1UEP A;  4LMM A;  4E3B A;  2DLU A;  3QIK A;  4GVC A;  2D90 A;  3GDV A;  2KG2 A;  2G5M B;  1YBO A;  1W9E A;  2RCZ A;  2FCF A;  1IU2 A;  2HE2 A;  1Y7N A;  5HDY A;  2EXG A;  4H11 A;  1Z86 A;  4NMO A;  1NTE A;  5B42 A;  3TMH A;  2M0V A;  1PDR A;  1LCY A;  1UF1 A;  5HEY A;  5E22 A;  1UM1 A;  5I7Z A;  3KDG A;  2JIL A;  3ZRT A;  4P0C A;  4FGM A;  3CBY A;  3NGH A;  1V1T A;  2OZF A;  3B76 A;  4FLN A;  2I6V A;  2Q9V A;  1WH1 A;  5B6L A;  4JJ0 A;  1QAU A;  2KOM A;  4UU6 A;  3RLE A;  4NMP A;  2UZC A;  3GJ9 A;  3SFJ A;  4P2A B;  3CC0 A;  1N7F A;  2KA9 A;  4Q2N A;  1WJL A;  1TP5 A;  5EZ0 A;  3R68 A;  2OS6 A;  4E35 A;  5FB8 C;  1IHJ A;  3QGL A;  1VJ6 A;  3SUZ A;  1GQ5 A;  3TSZ A;  1MFG A;  1TE0 A;  1X5N A;  5E21 A;  2CS5 A;  3O46 A;  1UEZ A;  2L4S A;  2OSG A;  3DJA A;  3E17 A;  4G69 A;  3WKL A;  4NMS A;  4XHV A;  4NNM A;  2CSS A;  5GND A;  2H3L A;  2VWR A;  2L4T A;  2X7Z A;  4YDP A;  2ZPM A;  4Z8J A;  2FNE A;  3CS0 A;  4NNL A;  1NF3 C;  1MC7 A;  3RL7 A;  2AIN A;  2QG1 A;  3R69 A;  1UM7 A;  3GGE A;  2M0Z A;  4KFV A;  1GQ4 A;  2LA8 A;  3EGH C;  3NCV A;  4HOP A;  1I92 A;  2D8I A;  1RY4 A;  2EDP A;  1XZ9 A;  1OZI A;  2JIK A;  2F0A A;  1GM1 A;  2YT7 A;  1KEF A;  1U38 A;  2FN5 A;  1KY9 A;  2LUI A;  2KAW A;  2EGN A;  2M3M A;  1RZX A;  3I1E A;  5HFB A;  2QKU A;  3KHF A;  2F5Y A;  3MH4 A;  5HFF A;  2PZD A;  1QAV A;  3DJ1 A;  2YTW A;  4EDJ A;  3PV4 A;  1Q3P A;  5E1Y A;  2DMZ A;  2OPG A;  1P1E A;  2HGA A;  2QBW A;  4R2Z A;  4REY A;  5F67 A;  3MH7 A;  2VSP A;  1V6B A;  1V62 A;  4GHN A;  3DOR A;  2WL7 A;  5HJ1 A;  3K50 A;  2M0T A;  2IWP A;  3O5N A;  3PV5 A;  1VAE A;  4WYU A;  3QJM A;  2JRE A;  4NXP A;  2RRM A;  3NFL A;  3PS4 A;  2QKV A;  2KJP A;  5E11 A;  2ENO A;  4JOH A;  1UJU A;  2IWN A;  1K32 A;  2M0U A;  2DB5 A;  3BPU A;  3MH6 A;  1V5L A;  1BFE A;  2I4S A;  2R3Y A;  3R0H A;  1WI2 A;  4GVD A;  2I1N A;  3WKM A;  3SHU A;  1UHP A;  1SOT A;  2AWU A;  1UIT A;  4K78 A;  1WF8 A;  1FC7 A;  3CBZ A;  4KFW A;  1N7T A;  2DLS A;  1WIF A;  2KPK A;  2EJY A;  2ZPL A;  3SHW A;  1V5Q A;  2YUB A;  4Q6H A;  2G2L A;  2PKT A;  1UJV A;  2FE5 A;  1QLC A;  2VPH A;  4WYT A;  5HFD A;  2VSV A;  4Q6S A;  4N6X A;  2KL1 A;  4Q2P A;  2OQS A;  3ID4 A;  1WG6 A;  2OMJ A;  1X5R A;  4Q2O A;  2QT5 A;  4JOK A;  2HE4 A;  3NFK A;  3QE1 A;  1X8S A;  1N6F A;  1W9Q A;  3OTP A;  3K1R A;  2EDV A;  2K1Z A;  2I0I A;  1TQ3 A;  3CH8 A;  2EHR A;  1Y8T A;  5HF4 A;  2VZ5 A;  4OAJ A;  1MFL A;  2KRG A;  2E7K A;  2W4F A;  1VB7 A;  1R6J A;  2QKT A;  4IC6 A;  2JIN A;  2JXO A;  2KV8 A;  1B8Q A;  1Q3O A;  1OBZ A;  3FY5 A;  1UEQ A;  2EAQ A;  1U39 A;  5F3X A;  2CSJ A;  2EEG A;  4OEP A;  2H2B A;  1X5Q A;  3AXA A;  2L97 A;  3I4W A;  3VQG A;  2EGK A;  2KPL A;  4JOP A;  4F8K A;  3ID2 A;  1SOZ A;  1X6D A;  1D5G A;  2R4H A;  3I18 A;  1FC6 A;  1TP3 A;  2KQF A;  2EEH A;  2H2C A;  2M10 A;  4Z33 A;  3GCO A;  5HF1 A;  1RGR A;  2KJK A;  1Q7X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...