2AWUA

Synapse associated protein 97 pdz2 domain variant c378g
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
95
structure length
95
Chain Sequence
KIMEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNSVGLEEVTHEEAVTALKNTSDFVYLKVAKPTSMYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Synapse-associated protein 97
publication title Crystal structure of the second PDZ domain of SAP97 in complex with a GluR-A C-terminal peptide
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Membrane protein
total genus 20
structure length 95
sequence length 95
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 2awuA00
4JOKA 2I0LA 4RI0A 4AMHA 1TP5A 2PDZA 4OEOA 3MH6A 2BYGA 1RGWA 5GLJA 1QAUA 2VPHA 3STJA 2JOAA 2H2CA 3R68A 1WHAA 3KHFA 1N99A 2D92A 1MC7A 2O2TA 1VAEA 2H2BA 4JOJA 2ENOA 4NXQA 2H3MA 1MFGA 2QG1A 2DAZA 4OEPA 4Q6SA 3SOEA 1WI4A 5HF4A 2EDZA 3PV4A 5HFFA 2Z9IA 1TE0A 1UJVA 4PQWA 4IC6A 2M0UA 2VRFA 3CC0A 1KEFA 2LC7A 2LOBA 3RLEA 1SOTA 1UJDA 2L97A 2KL1A 4XHVA 2CS5A 2I0IA 5FB8C 2F0AA 2JINA 2M3MA 2QT5A 1WF8A 1N6EA 1FCFA 2KPKA 3OTPA 1NTEA 1ZOKA 2L4TA 2OCSA 1I92A 1P1DA 3QJMA 5HFCA 3SHUA 5EYZA 3E17A 5HEBA 1U3BA 2I6VA 1SOZA 1UEZA 1WF7A 2ZPMA 3SUZA 1T2MA 1N6FA 3CS0A 4HOPA 4JOEA 2EAQA 2I04A 2I1NA 1TP3A 3SHWA 5HJ1A 2EXGA 5E1YA 2EEIA 1G9OA 3FY5A 3HVQC 5EZ0A 4JOHA 3GCOA 4H11A 3GDVA 5HEDA 1B8QA 1UEWA 1WH1A 2OSGA 2EJYA 1N7FA 4GVCA 3MH7A 1Y8TA 2DM8A 2YUBA 1WFVA 2EGOA 2R3YA 1Q3OA 1R6JA 3JXTA 5DTHA 3KZDA 4JL7A 5GNDA 5I7ZA 4R2ZA 1V62A 4NNMA 4Q2OA 2Q3GA 3QO6A 2W7RA 1V5QA 3ID4A 5HFEA 4L8NA 4NMSA 4G69A 1N7EA 4K76A 1Q3PA 2YT7A 4KFWA 4Q2QA 4E34A 4NMTA 2EDPA 2KAWA 3TSWA 1GQ4A 2QKVA 3DIWA 1X5QA 1UHPA 2KA9A 3PS4A 3QIKA 3GJ9A 2OS6A 3KZEA 1YBOA 2KJDA 2R4HA 3WKMA 4P2AB 2AWWA 1XZ9A 2PKUA 3CBZA 5E21A 1WFGA 5E11A 4K78A 3K50A 3QJNA 1W9EA 2M0VA 2YUYA 3RL7A 3K82A 5HFDA 2JIKA 2KBSA 1UITA 2HGAA 1UEPA 1IU2A 5F3XA 4N6XA 5HETA 2G2LA 2CSSA 4YDPA 2KJKA 3CYYA 3QE1A 2EEHA 4WYTA 3NFLA 3NFKA 3SFJA 2K20A 2Q9VA 2UZCA 4NXRA 1X45A 2KOMA 5A2PA 3I4WA 3ID3A 1RGRA 5H3JA 4Z8JA 2KJPA 2V1WA 2WL7A 4NNLA 1UFXA 5FHTA 2RCZA 3PDZA 1VCWA 2KRGA 4MPAA 3PV2A 3GDUA 2RRMA 1FC9A 1BFEA 1GM1A 4Q3HA 1UM7A 4O06A 3EGGC 1W9OA 4OAJA 5G1EA 1Z87A 3HPMA 2JWEA 4UU5A 2LA8A 3MH4A 3WKLA 1RZXA 2CSJA 2PNTA 4JOGA 1IU0A 1P1EA 2HE4A 2ZPLA 5HFBA 3CBYA 2PZDA 3PDVA 3R69A 1I16A 2EDVA 1FC7A 4NXPA 2FCFA 3TMHA 1VJ6A 2OGPA 2QKUA 1U39A 2KQFA 3NGHA 4LMMA 5G1DA 1L6OA 2OPGA 2YTWA 1IHJA 4K75A 2EV8A 1V6BA 1Z86A 1V5LA 2KV8A 2V90A 1MFLA 2AWUA 1Q7XA 3ZRTA 2G5MB 3I1EA 4K6YA 2F5YA 3LNYA 2OZFA 2DJTA 1UM1A 2KG2A 3GGEA 1UJUA 2LUIA 3DJ1A 2DB5A 2I4SA 1KWAA 1X6DA 3K1RA 3QDOA 1ZUBA 4JOPA 5JXBA 2AWXA 2K1ZA 1TQ3A 2JXOA 1OBXA 2VSPA 4Q6HA 1WHDA 3O5NA 1X5NA 2LC6A 3QGLA 4NMRA 2PA1A 1QAVB 4YYXA 4NMOA 4NMQA 2L4SA 3EGHC 3TSVA 1OBZA 4UU6A 2GZVA 4NMVA 1PDRA 4JORA 3PV5A 1FC6A 1LCYA 3CBXA 3L4FD 1GQ5A 2D8IA 4GHNA 5E6PB 3VQGA 1WI2A 1X8SA 2W4FA 2VSVA 3BPUA 4Q2NA 2VZ5A 5HF1A 1OBYA 3OU0A 2DLSA 3RL8A 2EEJA 1BE9A 3DJAA 2DLUA 3CH8A 3TSZA 3HPKA 2DMZA 3GCNA 4REYA 2AINA 4JOFA 5E22A 2YT8A 1K32A 2QBWA 4K72A 3B76A 1WG6A 2D90A 2EGNA 3AXAA 2KPLA 1U37A 1U38A 1WIFA 1D5GA 2Z17A 1W9QA 5HEYA 1KY9A 2KOJA 5HDYA 2JREA 5F67A 1RY4A 2MX6A 1UEQA 2IWNA 4E3BA 3GSLA 2MHOA 2EGKA 2M0TA 5B6LA 3DORA 2JILA 3R0HA 3ID2A 2IWOA 2P3WA 4EDJA 3DJ3A 1V1TA 3O46A 4E35A 2DKRA 2FNEA 2REYA 1QLCA 1Y7NA 2EEGA 2IWQA 4NMPA 3I18A 2E7KA 4P0CA 2HE2A 4FGMA 2X7ZA 2FN5A 2DC2A 1OZIA 3ID1A 1WJLA 3LNXA 2KYLA 1QAVA 2H3LA 5D13A 4Z33A 2KOHA 2PKTA 2FE5A 1N7TA 2EHRA 1N6DA 4KFVA 1M5ZA 4HOPB 2OMJA 2OQSA 3GDSA 3VQFA 4GVDA 1UF1A 2IWPA 4Q2PA 2M10A 2QKTA 1NF3C 2VWRA 4F8KA 4WYUA 1VA8A 2M0ZA 1VB7A 1X5RA
chains in the Genus database with same CATH superfamily
4JOKA 2I0LA 4RI0A 4AMHA 1TP5A 2PDZA 4OEOA 3MH6A 2BYGA 1RGWA 5GLJA 1QAUA 2VPHA 3STJA 2JOAA 2H2CA 3R68A 1WHAA 3KHFA 1N99A 2D92A 1MC7A 2O2TA 1VAEA 2H2BA 4JOJA 2ENOA 4NXQA 2H3MA 1MFGA 2QG1A 2DAZA 4OEPA 4Q6SA 3SOEA 1WI4A 5HF4A 2EDZA 3PV4A 5HFFA 2Z9IA 1TE0A 1UJVA 4PQWA 4IC6A 2M0UA 2VRFA 3CC0A 1KEFA 2LC7A 2LOBA 3RLEA 1SOTA 1UJDA 2L97A 2KL1A 4XHVA 2CS5A 2I0IA 5FB8C 2F0AA 2JINA 2GEFA 2M3MA 2QT5A 2JSNA 1WF8A 1N6EA 1FCFA 2KPKA 3OTPA 1NTEA 1ZOKA 2L4TA 2OCSA 1I92A 1P1DA 3QJMA 5HFCA 3SHUA 5EYZA 3E17A 5HEBA 1U3BA 2I6VA 1SOZA 1UEZA 1WF7A 2ZPMA 3SUZA 1T2MA 1N6FA 3CS0A 4HOPA 4JOEA 2EAQA 2I04A 2I1NA 1TP3A 3SHWA 5HJ1A 2EXGA 5E1YA 2EEIA 1G9OA 3FY5A 3HVQC 5EZ0A 4JOHA 3GCOA 4H11A 3GDVA 5HEDA 1B8QA 1UEWA 1WH1A 2OSGA 2EJYA 1N7FA 4GVCA 3MH7A 1Y8TA 2DM8A 2YUBA 1WFVA 2EGOA 2R3YA 1Q3OA 1R6JA 3JXTA 5DTHA 3KZDA 4JL7A 5GNDA 5I7ZA 4R2ZA 1V62A 4NNMA 4Q2OA 2Q3GA 3QO6A 2W7RA 1V5QA 3ID4A 5HFEA 4L8NA 4NMSA 4G69A 1N7EA 4K76A 5B42A 1Q3PA 2YT7A 4KFWA 4Q2QA 4E34A 4NMTA 2EDPA 2KAWA 3TSWA 1GQ4A 2QKVA 3DIWA 1X5QA 1UHPA 2KA9A 3PS4A 3QIKA 3GJ9A 2OS6A 3KZEA 1YBOA 2KJDA 2R4HA 3WKMA 4P2AB 2AWWA 1XZ9A 3CBZA 2PKUA 5E21A 5IL9A 1WFGA 5E11A 4K78A 3K50A 3QJNA 1W9EA 2M0VA 2YUYA 3RL7A 3K82A 5HFDA 2JIKA 2KBSA 1UITA 2HGAA 1UEPA 1IU2A 5F3XA 4N6XA 5HETA 2G2LA 2CSSA 4FLNA 4YDPA 2KJKA 3CYYA 3QE1A 2EEHA 4WYTA 3NFLA 3NFKA 3SFJA 2K20A 2Q9VA 2UZCA 4NXRA 1X45A 2KOMA 5A2PA 3I4WA 3ID3A 1RGRA 1X9ZA 5H3JA 4Z8JA 2KJPA 2V1WA 2WL7A 4NNLA 1UFXA 5FHTA 2RCZA 3PDZA 1VCWA 2KRGA 4MPAA 3PV2A 3GDUA 2RRMA 1FC9A 1BFEA 1GM1A 4Q3HA 1UM7A 4O06A 3EGGC 1W9OA 4OAJA 5G1EA 1Z87A 3HPMA 2JWEA 4UU5A 2LA8A 3KDKA 3MH4A 3WKLA 1RZXA 2CSJA 2PNTA 4JOGA 1IU0A 1P1EA 2HE4A 2ZPLA 5HFBA 3CBYA 2PZDA 3PDVA 3R69A 1I16A 2EDVA 1FC7A 4NXPA 2FCFA 3TMHA 1VJ6A 2OGPA 2QKUA 1U39A 2KQFA 3NGHA 4LMMA 5G1DA 1L6OA 2OPGA 2YTWA 1IHJA 4K75A 2EV8A 1V6BA 1Z86A 1V5LA 2KV8A 2V90A 1MFLA 2AWUA 1Q7XA 3GABA 3ZRTA 4JJ3A 2G5MB 3I1EA 4K6YA 2F5YA 3LNYA 2OZFA 2DJTA 1UM1A 2KG2A 3GGEA 1UJUA 2LUIA 3DJ1A 2DB5A 2I4SA 1KWAA 1X6DA 3K1RA 3QDOA 1ZUBA 4JOPA 5JXBA 2AWXA 2K1ZA 1TQ3A 2JXOA 1OBXA 2VSPA 4Q6HA 1WHDA 3O5NA 1X5NA 2LC6A 3QGLA 4NMRA 2PA1A 1QAVB 4YYXA 4NMOA 4NMQA 3NCVA 2L4SA 3EGHC 3TSVA 1OBZA 4UU6A 2GZVA 4NMVA 1PDRA 4JORA 3PV5A 1FC6A 1LCYA 3CBXA 3L4FD 1GQ5A 2D8IA 4GHNA 5E6PB 3VQGA 1WI2A 1X8SA 2W4FA 2VSVA 3BPUA 4Q2NA 2VZ5A 5HF1A 1OBYA 3OU0A 2DLSA 3RL8A 2EEJA 1BE9A 3DJAA 2DLUA 3CH8A 3TSZA 3HPKA 2DMZA 3GCNA 4REYA 2AINA 4JOFA 5E22A 2YT8A 1K32A 2QBWA 4K72A 3B76A 1WG6A 2D90A 2EGNA 3AXAA 2KPLA 1U37A 1U38A 1WIFA 1D5GA 2Z17A 1W9QA 5HEYA 1KY9A 2KOJA 5HDYA 2JREA 5F67A 1RY4A 2MX6A 1UEQA 2IWNA 4E3BA 3GSLA 2MHOA 2EGKA 2M0TA 5B6LA 3DORA 2JILA 3R0HA 3ID2A 2IWOA 2P3WA 4EDJA 3DJ3A 1V1TA 3O46A 4E35A 2DKRA 2FNEA 2REYA 1QLCA 1Y7NA 2EEGA 2IWQA 4NMPA 3I18A 2E7KA 4P0CA 3KDGA 2HE2A 4FGMA 2X7ZA 2FN5A 2DC2A 1OZIA 3ID1A 1WJLA 3LNXA 4JJ0A 5ILBA 2KYLA 1QAVA 2H3LA 5D13A 4Z33A 2KOHA 2PKTA 2FE5A 1N7TA 2EHRA 1N6DA 4KFVA 1M5ZA 4HOPB 2OMJA 2OQSA 3GDSA 3VQFA 4GVDA 1UF1A 2IWPA 4Q2PA 2M10A 2QKTA 1NF3C 2VWRA 4F8KA 4WYUA 1VA8A 2M0ZA 1VB7A 1X5RA
chains in the Genus database with same CATH topology
4JOKA 2I0LA 4RI0A 4AMHA 1TP5A 2PDZA 4OEOA 3MH6A 2BYGA 1RGWA 5GLJA 1QAUA 2VPHA 3STJA 2JOAA 2H2CA 3R68A 1WHAA 3KHFA 1N99A 2D92A 1MC7A 2O2TA 1VAEA 2H2BA 4JOJA 2ENOA 4NXQA 2H3MA 1MFGA 2QG1A 2DAZA 4OEPA 4Q6SA 3SOEA 1WI4A 5HF4A 2EDZA 3PV4A 5HFFA 2Z9IA 1TE0A 1UJVA 4PQWA 4IC6A 2M0UA 2VRFA 3CC0A 1KEFA 2LC7A 2LOBA 3RLEA 1SOTA 1UJDA 2L97A 2KL1A 4XHVA 2CS5A 2I0IA 5FB8C 2F0AA 2JINA 2GEFA 2M3MA 2QT5A 2JSNA 1WF8A 1N6EA 1FCFA 2KPKA 3OTPA 1NTEA 1ZOKA 2L4TA 2OCSA 1I92A 1P1DA 3QJMA 5HFCA 3SHUA 5EYZA 3E17A 5HEBA 1U3BA 2I6VA 1SOZA 1UEZA 1WF7A 2ZPMA 3SUZA 1T2MA 1N6FA 3CS0A 4HOPA 4JOEA 2EAQA 2I04A 2I1NA 1TP3A 3SHWA 5HJ1A 2EXGA 5E1YA 2EEIA 1G9OA 3FY5A 3HVQC 5EZ0A 4JOHA 3GCOA 4H11A 3GDVA 5HEDA 1B8QA 1UEWA 1WH1A 2OSGA 2EJYA 1N7FA 4GVCA 3MH7A 1Y8TA 2DM8A 2YUBA 1WFVA 2EGOA 2R3YA 1Q3OA 1R6JA 3JXTA 5DTHA 3KZDA 4JL7A 5GNDA 5I7ZA 4R2ZA 1V62A 4NNMA 4Q2OA 2Q3GA 3QO6A 2W7RA 1V5QA 3ID4A 5HFEA 4L8NA 4NMSA 4G69A 1N7EA 4K76A 5B42A 1Q3PA 2YT7A 4KFWA 4Q2QA 4E34A 4NMTA 2EDPA 2KAWA 3TSWA 1GQ4A 2QKVA 3DIWA 1X5QA 1UHPA 2KA9A 3PS4A 3QIKA 3GJ9A 2OS6A 3KZEA 1YBOA 2KJDA 2R4HA 3WKMA 4P2AB 2AWWA 1XZ9A 3CBZA 2PKUA 5E21A 5IL9A 1WFGA 5E11A 4K78A 3K50A 3QJNA 1W9EA 2M0VA 2YUYA 3RL7A 3K82A 5HFDA 2JIKA 2KBSA 1UITA 2HGAA 1UEPA 1IU2A 5F3XA 4N6XA 5HETA 2G2LA 2CSSA 4FLNA 4YDPA 2KJKA 3CYYA 3QE1A 2EEHA 4WYTA 3NFLA 3NFKA 3SFJA 2K20A 2Q9VA 2UZCA 4NXRA 1X45A 2KOMA 5A2PA 3I4WA 3ID3A 1RGRA 1X9ZA 5H3JA 4Z8JA 2KJPA 2V1WA 2WL7A 4NNLA 1UFXA 5FHTA 2RCZA 3PDZA 1VCWA 2KRGA 4MPAA 3PV2A 3GDUA 2RRMA 1FC9A 1BFEA 1GM1A 4Q3HA 1UM7A 4O06A 3EGGC 1W9OA 4OAJA 5G1EA 1Z87A 3HPMA 2JWEA 4UU5A 2LA8A 3KDKA 3MH4A 3WKLA 1RZXA 2CSJA 2PNTA 4JOGA 1IU0A 1P1EA 2HE4A 2ZPLA 5HFBA 3CBYA 2PZDA 3PDVA 3R69A 1I16A 2EDVA 1FC7A 4NXPA 2FCFA 3TMHA 1VJ6A 2OGPA 2QKUA 1U39A 2KQFA 3NGHA 4LMMA 5G1DA 1L6OA 2OPGA 2YTWA 1IHJA 4K75A 2EV8A 1V6BA 1Z86A 1V5LA 2KV8A 2V90A 1MFLA 2AWUA 1Q7XA 3GABA 3ZRTA 4JJ3A 2G5MB 3I1EA 4K6YA 2F5YA 3LNYA 2OZFA 2DJTA 1UM1A 2KG2A 3GGEA 1UJUA 2LUIA 3DJ1A 2DB5A 2I4SA 1KWAA 1X6DA 3K1RA 3QDOA 1ZUBA 4JOPA 5JXBA 2AWXA 2K1ZA 1TQ3A 2JXOA 1OBXA 2VSPA 4Q6HA 1WHDA 3O5NA 1X5NA 2LC6A 3QGLA 4NMRA 2PA1A 1QAVB 4YYXA 4NMOA 4NMQA 3NCVA 2L4SA 3EGHC 3TSVA 1OBZA 4UU6A 2GZVA 4NMVA 1PDRA 4JORA 3PV5A 1FC6A 1LCYA 3CBXA 3L4FD 1GQ5A 2D8IA 4GHNA 5E6PB 3VQGA 1WI2A 1X8SA 2W4FA 2VSVA 3BPUA 4Q2NA 2VZ5A 5HF1A 1OBYA 3OU0A 2DLSA 3RL8A 2EEJA 1BE9A 3DJAA 2DLUA 3CH8A 3TSZA 3HPKA 2DMZA 3GCNA 4REYA 2AINA 4JOFA 5E22A 2YT8A 1K32A 2QBWA 4K72A 3B76A 1WG6A 2D90A 2EGNA 3AXAA 2KPLA 1U37A 1U38A 1WIFA 1D5GA 2Z17A 1W9QA 5HEYA 1KY9A 2KOJA 5HDYA 2JREA 5F67A 1RY4A 2MX6A 1UEQA 2IWNA 4E3BA 3GSLA 2MHOA 2EGKA 2M0TA 5B6LA 3DORA 2JILA 3R0HA 3ID2A 2IWOA 2P3WA 4EDJA 3DJ3A 1V1TA 3O46A 4E35A 2DKRA 2FNEA 2REYA 1QLCA 1Y7NA 2EEGA 2IWQA 4NMPA 3I18A 2E7KA 4P0CA 3KDGA 2HE2A 4FGMA 2X7ZA 2FN5A 2DC2A 1OZIA 3ID1A 1WJLA 3LNXA 4JJ0A 5ILBA 2KYLA 1QAVA 2H3LA 5D13A 4Z33A 2KOHA 2PKTA 2FE5A 1N7TA 2EHRA 1N6DA 4KFVA 1M5ZA 4HOPB 2OMJA 2OQSA 3GDSA 3VQFA 4GVDA 1UF1A 2IWPA 4Q2PA 2M10A 2QKTA 1NF3C 2VWRA 4F8KA 4WYUA 1VA8A 2M0ZA 1VB7A 1X5RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JOK A;  2I0L A;  4RI0 A;  4AMH A;  1TP5 A;  2PDZ A;  4OEO A;  3MH6 A;  2BYG A;  1RGW A;  5GLJ A;  1QAU A;  2VPH A;  3STJ A;  2JOA A;  2H2C A;  3R68 A;  1WHA A;  3KHF A;  1N99 A;  2D92 A;  1MC7 A;  2O2T A;  1VAE A;  2H2B A;  4JOJ A;  2ENO A;  4NXQ A;  2H3M A;  1MFG A;  2QG1 A;  2DAZ A;  4OEP A;  4Q6S A;  3SOE A;  1WI4 A;  5HF4 A;  2EDZ A;  3PV4 A;  5HFF A;  2Z9I A;  1TE0 A;  1UJV A;  4PQW A;  4IC6 A;  2M0U A;  2VRF A;  3CC0 A;  1KEF A;  2LC7 A;  2LOB A;  3RLE A;  1SOT A;  1UJD A;  2L97 A;  2KL1 A;  4XHV A;  2CS5 A;  2I0I A;  5FB8 C;  2F0A A;  2JIN A;  2M3M A;  2QT5 A;  1WF8 A;  1N6E A;  1FCF A;  2KPK A;  3OTP A;  1NTE A;  1ZOK A;  2L4T A;  2OCS A;  1I92 A;  1P1D A;  3QJM A;  5HFC A;  3SHU A;  5EYZ A;  3E17 A;  5HEB A;  1U3B A;  2I6V A;  1SOZ A;  1UEZ A;  1WF7 A;  2ZPM A;  3SUZ A;  1T2M A;  1N6F A;  3CS0 A;  4HOP A;  4JOE A;  2EAQ A;  2I04 A;  2I1N A;  1TP3 A;  3SHW A;  5HJ1 A;  2EXG A;  5E1Y A;  2EEI A;  1G9O A;  3FY5 A;  3HVQ C;  5EZ0 A;  4JOH A;  3GCO A;  4H11 A;  3GDV A;  5HED A;  1B8Q A;  1UEW A;  1WH1 A;  2OSG A;  2EJY A;  1N7F A;  4GVC A;  3MH7 A;  1Y8T A;  2DM8 A;  2YUB A;  1WFV A;  2EGO A;  2R3Y A;  1Q3O A;  1R6J A;  3JXT A;  5DTH A;  3KZD A;  4JL7 A;  5GND A;  5I7Z A;  4R2Z A;  1V62 A;  4NNM A;  4Q2O A;  2Q3G A;  3QO6 A;  2W7R A;  1V5Q A;  3ID4 A;  5HFE A;  4L8N A;  4NMS A;  4G69 A;  1N7E A;  4K76 A;  1Q3P A;  2YT7 A;  4KFW A;  4Q2Q A;  4E34 A;  4NMT A;  2EDP A;  2KAW A;  3TSW A;  1GQ4 A;  2QKV A;  3DIW A;  1X5Q A;  1UHP A;  2KA9 A;  3PS4 A;  3QIK A;  3GJ9 A;  2OS6 A;  3KZE A;  1YBO A;  2KJD A;  2R4H A;  3WKM A;  4P2A B;  2AWW A;  1XZ9 A;  2PKU A;  3CBZ A;  5E21 A;  1WFG A;  5E11 A;  4K78 A;  3K50 A;  3QJN A;  1W9E A;  2M0V A;  2YUY A;  3RL7 A;  3K82 A;  5HFD A;  2JIK A;  2KBS A;  1UIT A;  2HGA A;  1UEP A;  1IU2 A;  5F3X A;  4N6X A;  5HET A;  2G2L A;  2CSS A;  4YDP A;  2KJK A;  3CYY A;  3QE1 A;  2EEH A;  4WYT A;  3NFL A;  3NFK A;  3SFJ A;  2K20 A;  2Q9V A;  2UZC A;  4NXR A;  1X45 A;  2KOM A;  5A2P A;  3I4W A;  3ID3 A;  1RGR A;  5H3J A;  4Z8J A;  2KJP A;  2V1W A;  2WL7 A;  4NNL A;  1UFX A;  5FHT A;  2RCZ A;  3PDZ A;  1VCW A;  2KRG A;  4MPA A;  3PV2 A;  3GDU A;  2RRM A;  1FC9 A;  1BFE A;  1GM1 A;  4Q3H A;  1UM7 A;  4O06 A;  3EGG C;  1W9O A;  4OAJ A;  5G1E A;  1Z87 A;  3HPM A;  2JWE A;  4UU5 A;  2LA8 A;  3MH4 A;  3WKL A;  1RZX A;  2CSJ A;  2PNT A;  4JOG A;  1IU0 A;  1P1E A;  2HE4 A;  2ZPL A;  5HFB A;  3CBY A;  2PZD A;  3PDV A;  3R69 A;  1I16 A;  2EDV A;  1FC7 A;  4NXP A;  2FCF A;  3TMH A;  1VJ6 A;  2OGP A;  2QKU A;  1U39 A;  2KQF A;  3NGH A;  4LMM A;  5G1D A;  1L6O A;  2OPG A;  2YTW A;  1IHJ A;  4K75 A;  2EV8 A;  1V6B A;  1Z86 A;  1V5L A;  2KV8 A;  2V90 A;  1MFL A;  2AWU A;  1Q7X A;  3ZRT A;  2G5M B;  3I1E A;  4K6Y A;  2F5Y A;  3LNY A;  2OZF A;  2DJT A;  1UM1 A;  2KG2 A;  3GGE A;  1UJU A;  2LUI A;  3DJ1 A;  2DB5 A;  2I4S A;  1KWA A;  1X6D A;  3K1R A;  3QDO A;  1ZUB A;  4JOP A;  5JXB A;  2AWX A;  2K1Z A;  1TQ3 A;  2JXO A;  1OBX A;  2VSP A;  4Q6H A;  1WHD A;  3O5N A;  1X5N A;  2LC6 A;  3QGL A;  4NMR A;  2PA1 A;  1QAV B;  4YYX A;  4NMO A;  4NMQ A;  2L4S A;  3EGH C;  3TSV A;  1OBZ A;  4UU6 A;  2GZV A;  4NMV A;  1PDR A;  4JOR A;  3PV5 A;  1FC6 A;  1LCY A;  3CBX A;  3L4F D;  1GQ5 A;  2D8I A;  4GHN A;  5E6P B;  3VQG A;  1WI2 A;  1X8S A;  2W4F A;  2VSV A;  3BPU A;  4Q2N A;  2VZ5 A;  5HF1 A;  1OBY A;  3OU0 A;  2DLS A;  3RL8 A;  2EEJ A;  1BE9 A;  3DJA A;  2DLU A;  3CH8 A;  3TSZ A;  3HPK A;  2DMZ A;  3GCN A;  4REY A;  2AIN A;  4JOF A;  5E22 A;  2YT8 A;  1K32 A;  2QBW A;  4K72 A;  3B76 A;  1WG6 A;  2D90 A;  2EGN A;  3AXA A;  2KPL A;  1U37 A;  1U38 A;  1WIF A;  1D5G A;  2Z17 A;  1W9Q A;  5HEY A;  1KY9 A;  2KOJ A;  5HDY A;  2JRE A;  5F67 A;  1RY4 A;  2MX6 A;  1UEQ A;  2IWN A;  4E3B A;  3GSL A;  2MHO A;  2EGK A;  2M0T A;  5B6L A;  3DOR A;  2JIL A;  3R0H A;  3ID2 A;  2IWO A;  2P3W A;  4EDJ A;  3DJ3 A;  1V1T A;  3O46 A;  4E35 A;  2DKR A;  2FNE A;  2REY A;  1QLC A;  1Y7N A;  2EEG A;  2IWQ A;  4NMP A;  3I18 A;  2E7K A;  4P0C A;  2HE2 A;  4FGM A;  2X7Z A;  2FN5 A;  2DC2 A;  1OZI A;  3ID1 A;  1WJL A;  3LNX A;  2KYL A;  1QAV A;  2H3L A;  5D13 A;  4Z33 A;  2KOH A;  2PKT A;  2FE5 A;  1N7T A;  2EHR A;  1N6D A;  4KFV A;  1M5Z A;  4HOP B;  2OMJ A;  2OQS A;  3GDS A;  3VQF A;  4GVD A;  1UF1 A;  2IWP A;  4Q2P A;  2M10 A;  2QKT A;  1NF3 C;  2VWR A;  4F8K A;  4WYU A;  1VA8 A;  2M0Z A;  1VB7 A;  1X5R A; 
#chains in the Genus database with same CATH topology
 4JOK A;  2I0L A;  4RI0 A;  4AMH A;  1TP5 A;  2PDZ A;  4OEO A;  3MH6 A;  2BYG A;  1RGW A;  5GLJ A;  1QAU A;  2VPH A;  3STJ A;  2JOA A;  2H2C A;  3R68 A;  1WHA A;  3KHF A;  1N99 A;  2D92 A;  1MC7 A;  2O2T A;  1VAE A;  2H2B A;  4JOJ A;  2ENO A;  4NXQ A;  2H3M A;  1MFG A;  2QG1 A;  2DAZ A;  4OEP A;  4Q6S A;  3SOE A;  1WI4 A;  5HF4 A;  2EDZ A;  3PV4 A;  5HFF A;  2Z9I A;  1TE0 A;  1UJV A;  4PQW A;  4IC6 A;  2M0U A;  2VRF A;  3CC0 A;  1KEF A;  2LC7 A;  2LOB A;  3RLE A;  1SOT A;  1UJD A;  2L97 A;  2KL1 A;  4XHV A;  2CS5 A;  2I0I A;  5FB8 C;  2F0A A;  2JIN A;  2GEF A;  2M3M A;  2QT5 A;  2JSN A;  1WF8 A;  1N6E A;  1FCF A;  2KPK A;  3OTP A;  1NTE A;  1ZOK A;  2L4T A;  2OCS A;  1I92 A;  1P1D A;  3QJM A;  5HFC A;  3SHU A;  5EYZ A;  3E17 A;  5HEB A;  1U3B A;  2I6V A;  1SOZ A;  1UEZ A;  1WF7 A;  2ZPM A;  3SUZ A;  1T2M A;  1N6F A;  3CS0 A;  4HOP A;  4JOE A;  2EAQ A;  2I04 A;  2I1N A;  1TP3 A;  3SHW A;  5HJ1 A;  2EXG A;  5E1Y A;  2EEI A;  1G9O A;  3FY5 A;  3HVQ C;  5EZ0 A;  4JOH A;  3GCO A;  4H11 A;  3GDV A;  5HED A;  1B8Q A;  1UEW A;  1WH1 A;  2OSG A;  2EJY A;  1N7F A;  4GVC A;  3MH7 A;  1Y8T A;  2DM8 A;  2YUB A;  1WFV A;  2EGO A;  2R3Y A;  1Q3O A;  1R6J A;  3JXT A;  5DTH A;  3KZD A;  4JL7 A;  5GND A;  5I7Z A;  4R2Z A;  1V62 A;  4NNM A;  4Q2O A;  2Q3G A;  3QO6 A;  2W7R A;  1V5Q A;  3ID4 A;  5HFE A;  4L8N A;  4NMS A;  4G69 A;  1N7E A;  4K76 A;  5B42 A;  1Q3P A;  2YT7 A;  4KFW A;  4Q2Q A;  4E34 A;  4NMT A;  2EDP A;  2KAW A;  3TSW A;  1GQ4 A;  2QKV A;  3DIW A;  1X5Q A;  1UHP A;  2KA9 A;  3PS4 A;  3QIK A;  3GJ9 A;  2OS6 A;  3KZE A;  1YBO A;  2KJD A;  2R4H A;  3WKM A;  4P2A B;  2AWW A;  1XZ9 A;  3CBZ A;  2PKU A;  5E21 A;  5IL9 A;  1WFG A;  5E11 A;  4K78 A;  3K50 A;  3QJN A;  1W9E A;  2M0V A;  2YUY A;  3RL7 A;  3K82 A;  5HFD A;  2JIK A;  2KBS A;  1UIT A;  2HGA A;  1UEP A;  1IU2 A;  5F3X A;  4N6X A;  5HET A;  2G2L A;  2CSS A;  4FLN A;  4YDP A;  2KJK A;  3CYY A;  3QE1 A;  2EEH A;  4WYT A;  3NFL A;  3NFK A;  3SFJ A;  2K20 A;  2Q9V A;  2UZC A;  4NXR A;  1X45 A;  2KOM A;  5A2P A;  3I4W A;  3ID3 A;  1RGR A;  1X9Z A;  5H3J A;  4Z8J A;  2KJP A;  2V1W A;  2WL7 A;  4NNL A;  1UFX A;  5FHT A;  2RCZ A;  3PDZ A;  1VCW A;  2KRG A;  4MPA A;  3PV2 A;  3GDU A;  2RRM A;  1FC9 A;  1BFE A;  1GM1 A;  4Q3H A;  1UM7 A;  4O06 A;  3EGG C;  1W9O A;  4OAJ A;  5G1E A;  1Z87 A;  3HPM A;  2JWE A;  4UU5 A;  2LA8 A;  3KDK A;  3MH4 A;  3WKL A;  1RZX A;  2CSJ A;  2PNT A;  4JOG A;  1IU0 A;  1P1E A;  2HE4 A;  2ZPL A;  5HFB A;  3CBY A;  2PZD A;  3PDV A;  3R69 A;  1I16 A;  2EDV A;  1FC7 A;  4NXP A;  2FCF A;  3TMH A;  1VJ6 A;  2OGP A;  2QKU A;  1U39 A;  2KQF A;  3NGH A;  4LMM A;  5G1D A;  1L6O A;  2OPG A;  2YTW A;  1IHJ A;  4K75 A;  2EV8 A;  1V6B A;  1Z86 A;  1V5L A;  2KV8 A;  2V90 A;  1MFL A;  2AWU A;  1Q7X A;  3GAB A;  3ZRT A;  4JJ3 A;  2G5M B;  3I1E A;  4K6Y A;  2F5Y A;  3LNY A;  2OZF A;  2DJT A;  1UM1 A;  2KG2 A;  3GGE A;  1UJU A;  2LUI A;  3DJ1 A;  2DB5 A;  2I4S A;  1KWA A;  1X6D A;  3K1R A;  3QDO A;  1ZUB A;  4JOP A;  5JXB A;  2AWX A;  2K1Z A;  1TQ3 A;  2JXO A;  1OBX A;  2VSP A;  4Q6H A;  1WHD A;  3O5N A;  1X5N A;  2LC6 A;  3QGL A;  4NMR A;  2PA1 A;  1QAV B;  4YYX A;  4NMO A;  4NMQ A;  3NCV A;  2L4S A;  3EGH C;  3TSV A;  1OBZ A;  4UU6 A;  2GZV A;  4NMV A;  1PDR A;  4JOR A;  3PV5 A;  1FC6 A;  1LCY A;  3CBX A;  3L4F D;  1GQ5 A;  2D8I A;  4GHN A;  5E6P B;  3VQG A;  1WI2 A;  1X8S A;  2W4F A;  2VSV A;  3BPU A;  4Q2N A;  2VZ5 A;  5HF1 A;  1OBY A;  3OU0 A;  2DLS A;  3RL8 A;  2EEJ A;  1BE9 A;  3DJA A;  2DLU A;  3CH8 A;  3TSZ A;  3HPK A;  2DMZ A;  3GCN A;  4REY A;  2AIN A;  4JOF A;  5E22 A;  2YT8 A;  1K32 A;  2QBW A;  4K72 A;  3B76 A;  1WG6 A;  2D90 A;  2EGN A;  3AXA A;  2KPL A;  1U37 A;  1U38 A;  1WIF A;  1D5G A;  2Z17 A;  1W9Q A;  5HEY A;  1KY9 A;  2KOJ A;  5HDY A;  2JRE A;  5F67 A;  1RY4 A;  2MX6 A;  1UEQ A;  2IWN A;  4E3B A;  3GSL A;  2MHO A;  2EGK A;  2M0T A;  5B6L A;  3DOR A;  2JIL A;  3R0H A;  3ID2 A;  2IWO A;  2P3W A;  4EDJ A;  3DJ3 A;  1V1T A;  3O46 A;  4E35 A;  2DKR A;  2FNE A;  2REY A;  1QLC A;  1Y7N A;  2EEG A;  2IWQ A;  4NMP A;  3I18 A;  2E7K A;  4P0C A;  3KDG A;  2HE2 A;  4FGM A;  2X7Z A;  2FN5 A;  2DC2 A;  1OZI A;  3ID1 A;  1WJL A;  3LNX A;  4JJ0 A;  5ILB A;  2KYL A;  1QAV A;  2H3L A;  5D13 A;  4Z33 A;  2KOH A;  2PKT A;  2FE5 A;  1N7T A;  2EHR A;  1N6D A;  4KFV A;  1M5Z A;  4HOP B;  2OMJ A;  2OQS A;  3GDS A;  3VQF A;  4GVD A;  1UF1 A;  2IWP A;  4Q2P A;  2M10 A;  2QKT A;  1NF3 C;  2VWR A;  4F8K A;  4WYU A;  1VA8 A;  2M0Z A;  1VB7 A;  1X5R A; 
#chains in the Genus database with same CATH homology
 4JOK A;  2I0L A;  4RI0 A;  4AMH A;  1TP5 A;  2PDZ A;  4OEO A;  3MH6 A;  2BYG A;  1RGW A;  5GLJ A;  1QAU A;  2VPH A;  3STJ A;  2JOA A;  2H2C A;  3R68 A;  1WHA A;  3KHF A;  1N99 A;  2D92 A;  1MC7 A;  2O2T A;  1VAE A;  2H2B A;  4JOJ A;  2ENO A;  4NXQ A;  2H3M A;  1MFG A;  2QG1 A;  2DAZ A;  4OEP A;  4Q6S A;  3SOE A;  1WI4 A;  5HF4 A;  2EDZ A;  3PV4 A;  5HFF A;  2Z9I A;  1TE0 A;  1UJV A;  4PQW A;  4IC6 A;  2M0U A;  2VRF A;  3CC0 A;  1KEF A;  2LC7 A;  2LOB A;  3RLE A;  1SOT A;  1UJD A;  2L97 A;  2KL1 A;  4XHV A;  2CS5 A;  2I0I A;  5FB8 C;  2F0A A;  2JIN A;  2GEF A;  2M3M A;  2QT5 A;  2JSN A;  1WF8 A;  1N6E A;  1FCF A;  2KPK A;  3OTP A;  1NTE A;  1ZOK A;  2L4T A;  2OCS A;  1I92 A;  1P1D A;  3QJM A;  5HFC A;  3SHU A;  5EYZ A;  3E17 A;  5HEB A;  1U3B A;  2I6V A;  1SOZ A;  1UEZ A;  1WF7 A;  2ZPM A;  3SUZ A;  1T2M A;  1N6F A;  3CS0 A;  4HOP A;  4JOE A;  2EAQ A;  2I04 A;  2I1N A;  1TP3 A;  3SHW A;  5HJ1 A;  2EXG A;  5E1Y A;  2EEI A;  1G9O A;  3FY5 A;  3HVQ C;  5EZ0 A;  4JOH A;  3GCO A;  4H11 A;  3GDV A;  5HED A;  1B8Q A;  1UEW A;  1WH1 A;  2OSG A;  2EJY A;  1N7F A;  4GVC A;  3MH7 A;  1Y8T A;  2DM8 A;  2YUB A;  1WFV A;  2EGO A;  2R3Y A;  1Q3O A;  1R6J A;  3JXT A;  5DTH A;  3KZD A;  4JL7 A;  5GND A;  5I7Z A;  4R2Z A;  1V62 A;  4NNM A;  4Q2O A;  2Q3G A;  3QO6 A;  2W7R A;  1V5Q A;  3ID4 A;  5HFE A;  4L8N A;  4NMS A;  4G69 A;  1N7E A;  4K76 A;  5B42 A;  1Q3P A;  2YT7 A;  4KFW A;  4Q2Q A;  4E34 A;  4NMT A;  2EDP A;  2KAW A;  3TSW A;  1GQ4 A;  2QKV A;  3DIW A;  1X5Q A;  1UHP A;  2KA9 A;  3PS4 A;  3QIK A;  3GJ9 A;  2OS6 A;  3KZE A;  1YBO A;  2KJD A;  2R4H A;  3WKM A;  4P2A B;  2AWW A;  1XZ9 A;  3CBZ A;  2PKU A;  5E21 A;  5IL9 A;  1WFG A;  5E11 A;  4K78 A;  3K50 A;  3QJN A;  1W9E A;  2M0V A;  2YUY A;  3RL7 A;  3K82 A;  5HFD A;  2JIK A;  2KBS A;  1UIT A;  2HGA A;  1UEP A;  1IU2 A;  5F3X A;  4N6X A;  5HET A;  2G2L A;  2CSS A;  4FLN A;  4YDP A;  2KJK A;  3CYY A;  3QE1 A;  2EEH A;  4WYT A;  3NFL A;  3NFK A;  3SFJ A;  2K20 A;  2Q9V A;  2UZC A;  4NXR A;  1X45 A;  2KOM A;  5A2P A;  3I4W A;  3ID3 A;  1RGR A;  1X9Z A;  5H3J A;  4Z8J A;  2KJP A;  2V1W A;  2WL7 A;  4NNL A;  1UFX A;  5FHT A;  2RCZ A;  3PDZ A;  1VCW A;  2KRG A;  4MPA A;  3PV2 A;  3GDU A;  2RRM A;  1FC9 A;  1BFE A;  1GM1 A;  4Q3H A;  1UM7 A;  4O06 A;  3EGG C;  1W9O A;  4OAJ A;  5G1E A;  1Z87 A;  3HPM A;  2JWE A;  4UU5 A;  2LA8 A;  3KDK A;  3MH4 A;  3WKL A;  1RZX A;  2CSJ A;  2PNT A;  4JOG A;  1IU0 A;  1P1E A;  2HE4 A;  2ZPL A;  5HFB A;  3CBY A;  2PZD A;  3PDV A;  3R69 A;  1I16 A;  2EDV A;  1FC7 A;  4NXP A;  2FCF A;  3TMH A;  1VJ6 A;  2OGP A;  2QKU A;  1U39 A;  2KQF A;  3NGH A;  4LMM A;  5G1D A;  1L6O A;  2OPG A;  2YTW A;  1IHJ A;  4K75 A;  2EV8 A;  1V6B A;  1Z86 A;  1V5L A;  2KV8 A;  2V90 A;  1MFL A;  2AWU A;  1Q7X A;  3GAB A;  3ZRT A;  4JJ3 A;  2G5M B;  3I1E A;  4K6Y A;  2F5Y A;  3LNY A;  2OZF A;  2DJT A;  1UM1 A;  2KG2 A;  3GGE A;  1UJU A;  2LUI A;  3DJ1 A;  2DB5 A;  2I4S A;  1KWA A;  1X6D A;  3K1R A;  3QDO A;  1ZUB A;  4JOP A;  5JXB A;  2AWX A;  2K1Z A;  1TQ3 A;  2JXO A;  1OBX A;  2VSP A;  4Q6H A;  1WHD A;  3O5N A;  1X5N A;  2LC6 A;  3QGL A;  4NMR A;  2PA1 A;  1QAV B;  4YYX A;  4NMO A;  4NMQ A;  3NCV A;  2L4S A;  3EGH C;  3TSV A;  1OBZ A;  4UU6 A;  2GZV A;  4NMV A;  1PDR A;  4JOR A;  3PV5 A;  1FC6 A;  1LCY A;  3CBX A;  3L4F D;  1GQ5 A;  2D8I A;  4GHN A;  5E6P B;  3VQG A;  1WI2 A;  1X8S A;  2W4F A;  2VSV A;  3BPU A;  4Q2N A;  2VZ5 A;  5HF1 A;  1OBY A;  3OU0 A;  2DLS A;  3RL8 A;  2EEJ A;  1BE9 A;  3DJA A;  2DLU A;  3CH8 A;  3TSZ A;  3HPK A;  2DMZ A;  3GCN A;  4REY A;  2AIN A;  4JOF A;  5E22 A;  2YT8 A;  1K32 A;  2QBW A;  4K72 A;  3B76 A;  1WG6 A;  2D90 A;  2EGN A;  3AXA A;  2KPL A;  1U37 A;  1U38 A;  1WIF A;  1D5G A;  2Z17 A;  1W9Q A;  5HEY A;  1KY9 A;  2KOJ A;  5HDY A;  2JRE A;  5F67 A;  1RY4 A;  2MX6 A;  1UEQ A;  2IWN A;  4E3B A;  3GSL A;  2MHO A;  2EGK A;  2M0T A;  5B6L A;  3DOR A;  2JIL A;  3R0H A;  3ID2 A;  2IWO A;  2P3W A;  4EDJ A;  3DJ3 A;  1V1T A;  3O46 A;  4E35 A;  2DKR A;  2FNE A;  2REY A;  1QLC A;  1Y7N A;  2EEG A;  2IWQ A;  4NMP A;  3I18 A;  2E7K A;  4P0C A;  3KDG A;  2HE2 A;  4FGM A;  2X7Z A;  2FN5 A;  2DC2 A;  1OZI A;  3ID1 A;  1WJL A;  3LNX A;  4JJ0 A;  5ILB A;  2KYL A;  1QAV A;  2H3L A;  5D13 A;  4Z33 A;  2KOH A;  2PKT A;  2FE5 A;  1N7T A;  2EHR A;  1N6D A;  4KFV A;  1M5Z A;  4HOP B;  2OMJ A;  2OQS A;  3GDS A;  3VQF A;  4GVD A;  1UF1 A;  2IWP A;  4Q2P A;  2M10 A;  2QKT A;  1NF3 C;  2VWR A;  4F8K A;  4WYU A;  1VA8 A;  2M0Z A;  1VB7 A;  1X5R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...