2AWUA

Synapse associated protein 97 pdz2 domain variant c378g
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
95
structure length
95
Chain Sequence
KIMEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNSVGLEEVTHEEAVTALKNTSDFVYLKVAKPTSMYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Synapse-associated protein 97
publication title Crystal structure of the second PDZ domain of SAP97 in complex with a GluR-A C-terminal peptide
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Membrane protein
total genus 20
structure length 95
sequence length 95
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 2awuA00
2I4SA 4Q2NA 2HE4A 2VRFA 5I7ZA 1RZXA 1OZIA 1VAEA 1L6OA 2L4TA 2H2CA 3QDOA 5HFCA 4NMTA 1BE9A 3SOEA 1V5QA 5F67A 5GNDA 2VPHA 3HPMA 2YT7A 1QAVB 2PA1A 5GLJA 2W7RA 1Z87A 4G69A 5FB8C 4N6XA 2ZPMA 5A2PA 2OQSA 1V62A 3TSWA 2JIKA 2VSPA 4GVDA 3OU0A 1X5NA 2L4SA 3GDVA 2DC2A 2DJTA 2PKUA 4KFVA 4P2AB 4Q6SA 5HDYA 1N6FA 2LA8A 2AWXA 2F5YA 1OBYA 1MFLA 1IHJA 4Q2PA 3SHWA 2KRGA 3TSVA 2P3WA 4Q3HA 2G5MB 2JWEA 1WG6A 2KJPA 2KV8A 4JOKA 2BYGA 4H11A 3NFLA 5H3JA 1KY9A 2H2BA 2EXGA 2FCFA 2I0LA 1Z86A 2UZCA 4GHNA 1GM1A 5FHTA 3RLEA 1N6DA 1VB7A 2K20A 3QJMA 4NNMA 3E17A 4MPAA 2VZ5A 1TP3A 1UEPA 1WHAA 1RGRA 1RY4A 2EAQA 3NGHA 4HOPB 2IWQA 3PDZA 3B76A 4NMOA 3GSLA 4F8KA 1WI4A 2EGKA 3QJNA 4JOFA 1WIFA 3SHUA 2KQFA 4K72A 2O2TA 1MFGA 2KOHA 3PV2A 3HPKA 1XZ9A 2IWNA 2YUYA 1TQ3A 3CBYA 3CS0A 3GCNA 2PKTA 1WI2A 1KWAA 4LMMA 1U3BA 2FN5A 2G2LA 2EDVA 3GDUA 4WYTA 3OTPA 3VQFA 3O5NA 1I16A 2V90A 2IWPA 3R0HA 3QIKA 4JOPA 2KYLA 4OEOA 2V1WA 5EZ0A 1SOZA 1FC6A 1UJDA 1QAUA 3R68A 1GQ5A 2IWOA 4UU6A 3KHFA 1NF3C 2K1ZA 2M0TA 3ID3A 1MC7A 3WKLA 4NMPA 2OS6A 2JILA 5F3XA 4NMRA 1V1TA 2KOJA 1UITA 1IU0A 1N7TA 1W9OA 1N99A 3AXAA 2I0IA 2M0VA 2RCZA 3NFKA 5B6LA 1U37A 1D5GA 4P0CA 2KAWA 1OBZA 2QKVA 1BFEA 4REYA 3BPUA 4GVCA 2OMJA 2X7ZA 1UEWA 3GDSA 2Z17A 2EEIA 1TP5A 1R6JA 3KZEA 4JOEA 3GJ9A 2DLSA 4E35A 2RRMA 3QGLA 4UU5A 1K32A 2FNEA 2KJDA 2JREA 2I04A 3LNYA 5HF4A 5E6PB 4RI0A 2YT8A 3CC0A 3RL8A 3MH4A 2KG2A 1IU2A 2AINA 2JOAA 3I1EA 3L4FD 1B8QA 2QKUA 5JXBA 2M3MA 2EJYA 3PDVA 1GQ4A 4PQWA 3K82A 2GZVA 5HEBA 5HF1A 1W9QA 1W9EA 1UM7A 3ID1A 3DJ3A 3I4WA 2OPGA 4NMSA 4JOHA 4Z33A 2EEGA 1WHDA 3PV4A 1TE0A 1T2MA 3HVQC 1G9OA 2Q3GA 3DJ1A 2EV8A 1UM1A 3EGGC 2CS5A 2EHRA 2CSSA 3GCOA 2QT5A 4EDJA 1UJUA 2YUBA 1QLCA 2H3LA 1Y7NA 2KPLA 2OSGA 2EEHA 3SFJA 4FGMA 2PZDA 4Q2QA 3PV5A 2DLUA 2I6VA 1NTEA 2FE5A 3SUZA 4Z8JA 4KFWA 2M0UA 4NNLA 2KBSA 4JL7A 2QKTA 1VCWA 2QBWA 2JINA 1UEQA 4OEPA 4R2ZA 4NMVA 4K78A 3QE1A 1VA8A 4NXRA 1P1DA 3K1RA 5EYZA 3ID2A 4NXPA 3O46A 3CBZA 2DAZA 1WF7A 5DTHA 5HFEA 2EDPA 1Q3OA 2KOMA 3PS4A 2LUIA 2EGNA 3GGEA 3TMHA 3R69A 4Q2OA 5D13A 2JXOA 2EDZA 1FC7A 3MH7A 4K76A 1FCFA 2MX6A 2HGAA 2D92A 2R3YA 4NXQA 2R4HA 3KZDA 1WFVA 3FY5A 4JORA 4E34A 5E1YA 4K6YA 1U39A 3RL7A 5HETA 1UHPA 2OZFA 1U38A 2DB5A 4E3BA 1WFGA 3DIWA 2KA9A 2AWWA 1UEZA 4JOGA 2KPKA 5E22A 5HFFA 5HEYA 5HEDA 2DMZA 3STJA 4YYXA 3DJAA 4YDPA 1Y8TA 2DM8A 4IC6A 4JOJA 2KJKA 3I18A 3LNXA 3CH8A 2Z9IA 2D90A 4WYUA 3JXTA 1X5RA 2M10A 1QAVA 5G1EA 4L8NA 1WJLA 2LOBA 1PDRA 3WKMA 2DKRA 2F0AA 1P1EA 2LC7A 2EEJA 3EGHC 5E21A 1M5ZA 1N6EA 2MHOA 1ZUBA 2PDZA 3K50A 1UF1A 4NMQA 1Q7XA 3DORA 4XHVA 2VSVA 4OAJA 2E7KA 1I92A 2KL1A 1X6DA 5HFDA 2I1NA 2PNTA 3QO6A 2WL7A 2CSJA 2OCSA 3TSZA 2HE2A 2YTWA 1WH1A 4K75A 4O06A 1WF8A 2H3MA 2AWUA 1KEFA 1ZOKA 2ZPLA 2ENOA 1N7EA 1V6BA 1YBOA 5HJ1A 1V5LA 2D8IA 1OBXA 3CBXA 3ID4A 1FC9A 2LC6A 5HFBA 1SOTA 1UJVA 4AMHA 1Q3PA 4Q6HA 2M0ZA 1X8SA 3ZRTA 3CYYA 2QG1A 1UFXA 1VJ6A 2OGPA 2EGOA 2Q9VA 2W4FA 2L97A 3MH6A 1X5QA 1N7FA 1LCYA 1RGWA 3VQGA 2VWRA 2REYA 4HOPA 1X45A 5G1DA 5E11A
chains in the Genus database with same CATH superfamily
2I4SA 4Q2NA 3GABA 2HE4A 2VRFA 5I7ZA 1RZXA 1OZIA 1VAEA 1L6OA 2L4TA 2H2CA 3QDOA 5HFCA 4NMTA 1BE9A 3SOEA 1V5QA 5F67A 5GNDA 2VPHA 3HPMA 2YT7A 1QAVB 2PA1A 5GLJA 2W7RA 1Z87A 4G69A 5FB8C 4N6XA 2ZPMA 5A2PA 2OQSA 1V62A 3TSWA 2JIKA 2VSPA 4GVDA 5ILBA 3OU0A 1X5NA 2L4SA 3GDVA 2DC2A 2DJTA 2PKUA 4KFVA 4P2AB 4Q6SA 5HDYA 1N6FA 2LA8A 2AWXA 2F5YA 1OBYA 1MFLA 1IHJA 4Q2PA 3SHWA 2KRGA 3TSVA 2P3WA 4Q3HA 2G5MB 2JWEA 1WG6A 2KJPA 2KV8A 4JOKA 2BYGA 4H11A 3NFLA 5H3JA 1KY9A 2H2BA 2EXGA 2FCFA 2I0LA 1Z86A 2UZCA 4GHNA 1GM1A 5FHTA 3RLEA 1N6DA 1VB7A 2K20A 3QJMA 4NNMA 3E17A 4MPAA 2VZ5A 1TP3A 1UEPA 1WHAA 1RGRA 1RY4A 2EAQA 3NGHA 4HOPB 2IWQA 3PDZA 3B76A 4NMOA 3GSLA 4F8KA 1WI4A 2EGKA 3QJNA 4JOFA 1WIFA 3SHUA 2KQFA 4K72A 2O2TA 1MFGA 2KOHA 3PV2A 3HPKA 1XZ9A 2IWNA 2YUYA 1TQ3A 3CBYA 3CS0A 3GCNA 2PKTA 1WI2A 1KWAA 4LMMA 1U3BA 2FN5A 2G2LA 2EDVA 3GDUA 4WYTA 3OTPA 3VQFA 3O5NA 1I16A 2V90A 2IWPA 3R0HA 3QIKA 4JOPA 2KYLA 4OEOA 2V1WA 5EZ0A 1SOZA 1FC6A 1UJDA 4JJ3A 1QAUA 3R68A 1GQ5A 2IWOA 4UU6A 3KHFA 1NF3C 2K1ZA 2M0TA 3ID3A 1MC7A 3WKLA 4NMPA 2OS6A 2JILA 5F3XA 4NMRA 1V1TA 2KOJA 1UITA 1IU0A 1N7TA 1W9OA 1N99A 3AXAA 2I0IA 2M0VA 2RCZA 3NFKA 5B6LA 1U37A 1D5GA 4P0CA 2KAWA 1OBZA 2QKVA 1BFEA 4REYA 3BPUA 4GVCA 2OMJA 2X7ZA 1UEWA 3GDSA 2Z17A 2EEIA 1TP5A 1R6JA 3KZEA 4JOEA 3GJ9A 2DLSA 4E35A 2RRMA 2JSNA 3QGLA 4UU5A 1K32A 2FNEA 2KJDA 2JREA 2I04A 3LNYA 5HF4A 5E6PB 4RI0A 2YT8A 3CC0A 3RL8A 3MH4A 2KG2A 1IU2A 2AINA 2JOAA 3I1EA 3L4FD 1B8QA 2QKUA 5JXBA 2M3MA 2EJYA 3PDVA 1GQ4A 3KDKA 4PQWA 3K82A 2GZVA 5HEBA 5HF1A 1W9QA 1W9EA 1UM7A 3ID1A 3DJ3A 3I4WA 2OPGA 4NMSA 4JOHA 4Z33A 2EEGA 1WHDA 3PV4A 1TE0A 1T2MA 3HVQC 1G9OA 2Q3GA 3DJ1A 2EV8A 1UM1A 3EGGC 2CS5A 2EHRA 2CSSA 2GEFA 3GCOA 2QT5A 4EDJA 1UJUA 2YUBA 1QLCA 2H3LA 1Y7NA 2KPLA 2OSGA 2EEHA 3SFJA 4FGMA 2PZDA 4Q2QA 3PV5A 2DLUA 2I6VA 1NTEA 2FE5A 3SUZA 4Z8JA 4KFWA 2M0UA 4NNLA 2KBSA 4JL7A 2QKTA 1VCWA 2QBWA 2JINA 1UEQA 4OEPA 4R2ZA 4NMVA 4K78A 3QE1A 1VA8A 4NXRA 1P1DA 3K1RA 5EYZA 4FLNA 3ID2A 4NXPA 3O46A 3CBZA 2DAZA 1WF7A 5DTHA 5HFEA 2EDPA 1Q3OA 3KDGA 2KOMA 3PS4A 2LUIA 2EGNA 3GGEA 3TMHA 3R69A 4Q2OA 5D13A 2JXOA 2EDZA 1FC7A 3MH7A 4K76A 1FCFA 2MX6A 2HGAA 1X9ZA 2D92A 2R3YA 4NXQA 2R4HA 3KZDA 1WFVA 3FY5A 4JORA 4E34A 5E1YA 4K6YA 1U39A 3RL7A 5HETA 1UHPA 2OZFA 1U38A 2DB5A 4E3BA 1WFGA 3DIWA 2KA9A 4JJ0A 2AWWA 1UEZA 4JOGA 2KPKA 5E22A 5HFFA 5HEYA 5HEDA 2DMZA 3STJA 4YYXA 3DJAA 4YDPA 1Y8TA 2DM8A 4IC6A 4JOJA 2KJKA 3I18A 3LNXA 3CH8A 2Z9IA 5B42A 2D90A 4WYUA 3JXTA 1X5RA 2M10A 1QAVA 5G1EA 4L8NA 1WJLA 2LOBA 1PDRA 3WKMA 2DKRA 2F0AA 1P1EA 2LC7A 2EEJA 3EGHC 5E21A 1M5ZA 1N6EA 2MHOA 1ZUBA 2PDZA 3K50A 1UF1A 4NMQA 1Q7XA 3DORA 4XHVA 2VSVA 4OAJA 2E7KA 1I92A 2KL1A 1X6DA 5HFDA 2I1NA 2PNTA 3QO6A 2WL7A 2CSJA 2OCSA 3TSZA 2HE2A 2YTWA 1WH1A 4K75A 4O06A 1WF8A 2H3MA 2AWUA 1KEFA 1ZOKA 2ZPLA 2ENOA 1N7EA 1V6BA 1YBOA 5HJ1A 1V5LA 2D8IA 1OBXA 3NCVA 3CBXA 3ID4A 1FC9A 2LC6A 5HFBA 1SOTA 1UJVA 4AMHA 1Q3PA 4Q6HA 2M0ZA 1X8SA 3ZRTA 3CYYA 2QG1A 1UFXA 1VJ6A 2OGPA 2EGOA 2Q9VA 2W4FA 2L97A 3MH6A 1X5QA 1N7FA 1LCYA 1RGWA 5IL9A 3VQGA 2VWRA 2REYA 4HOPA 1X45A 5G1DA 5E11A
chains in the Genus database with same CATH topology
2I4SA 4Q2NA 3GABA 2HE4A 2VRFA 5I7ZA 1RZXA 1OZIA 1VAEA 1L6OA 2L4TA 2H2CA 3QDOA 5HFCA 4NMTA 1BE9A 3SOEA 1V5QA 5F67A 5GNDA 2VPHA 3HPMA 2YT7A 1QAVB 2PA1A 5GLJA 2W7RA 1Z87A 4G69A 5FB8C 4N6XA 2ZPMA 5A2PA 2OQSA 1V62A 3TSWA 2JIKA 2VSPA 4GVDA 5ILBA 3OU0A 1X5NA 2L4SA 3GDVA 2DC2A 2DJTA 2PKUA 4KFVA 4P2AB 4Q6SA 5HDYA 1N6FA 2LA8A 2AWXA 2F5YA 1OBYA 1MFLA 1IHJA 4Q2PA 3SHWA 2KRGA 3TSVA 2P3WA 4Q3HA 2G5MB 2JWEA 1WG6A 2KJPA 2KV8A 4JOKA 2BYGA 4H11A 3NFLA 5H3JA 1KY9A 2H2BA 2EXGA 2FCFA 2I0LA 1Z86A 2UZCA 4GHNA 1GM1A 5FHTA 3RLEA 1N6DA 1VB7A 2K20A 3QJMA 4NNMA 3E17A 4MPAA 2VZ5A 1TP3A 1UEPA 1WHAA 1RGRA 1RY4A 2EAQA 3NGHA 4HOPB 2IWQA 3PDZA 3B76A 4NMOA 3GSLA 4F8KA 1WI4A 2EGKA 3QJNA 4JOFA 1WIFA 3SHUA 2KQFA 4K72A 2O2TA 1MFGA 2KOHA 3PV2A 3HPKA 1XZ9A 2IWNA 2YUYA 1TQ3A 3CBYA 3CS0A 3GCNA 2PKTA 1WI2A 1KWAA 4LMMA 1U3BA 2FN5A 2G2LA 2EDVA 3GDUA 4WYTA 3OTPA 3VQFA 3O5NA 1I16A 2V90A 2IWPA 3R0HA 3QIKA 4JOPA 2KYLA 4OEOA 2V1WA 5EZ0A 1SOZA 1FC6A 1UJDA 4JJ3A 1QAUA 3R68A 1GQ5A 2IWOA 4UU6A 3KHFA 1NF3C 2K1ZA 2M0TA 3ID3A 1MC7A 3WKLA 4NMPA 2OS6A 2JILA 5F3XA 4NMRA 1V1TA 2KOJA 1UITA 1IU0A 1N7TA 1W9OA 1N99A 3AXAA 2I0IA 2M0VA 2RCZA 3NFKA 5B6LA 1U37A 1D5GA 4P0CA 2KAWA 1OBZA 2QKVA 1BFEA 4REYA 3BPUA 4GVCA 2OMJA 2X7ZA 1UEWA 3GDSA 2Z17A 2EEIA 1TP5A 1R6JA 3KZEA 4JOEA 3GJ9A 2DLSA 4E35A 2RRMA 2JSNA 3QGLA 4UU5A 1K32A 2FNEA 2KJDA 2JREA 2I04A 3LNYA 5HF4A 5E6PB 4RI0A 2YT8A 3CC0A 3RL8A 3MH4A 2KG2A 1IU2A 2AINA 2JOAA 3I1EA 3L4FD 1B8QA 2QKUA 5JXBA 2M3MA 2EJYA 3PDVA 1GQ4A 3KDKA 4PQWA 3K82A 2GZVA 5HEBA 5HF1A 1W9QA 1W9EA 1UM7A 3ID1A 3DJ3A 3I4WA 2OPGA 4NMSA 4JOHA 4Z33A 2EEGA 1WHDA 3PV4A 1TE0A 1T2MA 3HVQC 1G9OA 2Q3GA 3DJ1A 2EV8A 1UM1A 3EGGC 2CS5A 2EHRA 2CSSA 2GEFA 3GCOA 2QT5A 4EDJA 1UJUA 2YUBA 1QLCA 2H3LA 1Y7NA 2KPLA 2OSGA 2EEHA 3SFJA 4FGMA 2PZDA 4Q2QA 3PV5A 2DLUA 2I6VA 1NTEA 2FE5A 3SUZA 4Z8JA 4KFWA 2M0UA 4NNLA 2KBSA 4JL7A 2QKTA 1VCWA 2QBWA 2JINA 1UEQA 4OEPA 4R2ZA 4NMVA 4K78A 3QE1A 1VA8A 4NXRA 1P1DA 3K1RA 5EYZA 4FLNA 3ID2A 4NXPA 3O46A 3CBZA 2DAZA 1WF7A 5DTHA 5HFEA 2EDPA 1Q3OA 3KDGA 2KOMA 3PS4A 2LUIA 2EGNA 3GGEA 3TMHA 3R69A 4Q2OA 5D13A 2JXOA 2EDZA 1FC7A 3MH7A 4K76A 1FCFA 2MX6A 2HGAA 1X9ZA 2D92A 2R3YA 4NXQA 2R4HA 3KZDA 1WFVA 3FY5A 4JORA 4E34A 5E1YA 4K6YA 1U39A 3RL7A 5HETA 1UHPA 2OZFA 1U38A 2DB5A 4E3BA 1WFGA 3DIWA 2KA9A 4JJ0A 2AWWA 1UEZA 4JOGA 2KPKA 5E22A 5HFFA 5HEYA 5HEDA 2DMZA 3STJA 4YYXA 3DJAA 4YDPA 1Y8TA 2DM8A 4IC6A 4JOJA 2KJKA 3I18A 3LNXA 3CH8A 2Z9IA 5B42A 2D90A 4WYUA 3JXTA 1X5RA 2M10A 1QAVA 5G1EA 4L8NA 1WJLA 2LOBA 1PDRA 3WKMA 2DKRA 2F0AA 1P1EA 2LC7A 2EEJA 3EGHC 5E21A 1M5ZA 1N6EA 2MHOA 1ZUBA 2PDZA 3K50A 1UF1A 4NMQA 1Q7XA 3DORA 4XHVA 2VSVA 4OAJA 2E7KA 1I92A 2KL1A 1X6DA 5HFDA 2I1NA 2PNTA 3QO6A 2WL7A 2CSJA 2OCSA 3TSZA 2HE2A 2YTWA 1WH1A 4K75A 4O06A 1WF8A 2H3MA 2AWUA 1KEFA 1ZOKA 2ZPLA 2ENOA 1N7EA 1V6BA 1YBOA 5HJ1A 1V5LA 2D8IA 1OBXA 3NCVA 3CBXA 3ID4A 1FC9A 2LC6A 5HFBA 1SOTA 1UJVA 4AMHA 1Q3PA 4Q6HA 2M0ZA 1X8SA 3ZRTA 3CYYA 2QG1A 1UFXA 1VJ6A 2OGPA 2EGOA 2Q9VA 2W4FA 2L97A 3MH6A 1X5QA 1N7FA 1LCYA 1RGWA 5IL9A 3VQGA 2VWRA 2REYA 4HOPA 1X45A 5G1DA 5E11A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I4S A;  4Q2N A;  2HE4 A;  2VRF A;  5I7Z A;  1RZX A;  1OZI A;  1VAE A;  1L6O A;  2L4T A;  2H2C A;  3QDO A;  5HFC A;  4NMT A;  1BE9 A;  3SOE A;  1V5Q A;  5F67 A;  5GND A;  2VPH A;  3HPM A;  2YT7 A;  1QAV B;  2PA1 A;  5GLJ A;  2W7R A;  1Z87 A;  4G69 A;  5FB8 C;  4N6X A;  2ZPM A;  5A2P A;  2OQS A;  1V62 A;  3TSW A;  2JIK A;  2VSP A;  4GVD A;  3OU0 A;  1X5N A;  2L4S A;  3GDV A;  2DC2 A;  2DJT A;  2PKU A;  4KFV A;  4P2A B;  4Q6S A;  5HDY A;  1N6F A;  2LA8 A;  2AWX A;  2F5Y A;  1OBY A;  1MFL A;  1IHJ A;  4Q2P A;  3SHW A;  2KRG A;  3TSV A;  2P3W A;  4Q3H A;  2G5M B;  2JWE A;  1WG6 A;  2KJP A;  2KV8 A;  4JOK A;  2BYG A;  4H11 A;  3NFL A;  5H3J A;  1KY9 A;  2H2B A;  2EXG A;  2FCF A;  2I0L A;  1Z86 A;  2UZC A;  4GHN A;  1GM1 A;  5FHT A;  3RLE A;  1N6D A;  1VB7 A;  2K20 A;  3QJM A;  4NNM A;  3E17 A;  4MPA A;  2VZ5 A;  1TP3 A;  1UEP A;  1WHA A;  1RGR A;  1RY4 A;  2EAQ A;  3NGH A;  4HOP B;  2IWQ A;  3PDZ A;  3B76 A;  4NMO A;  3GSL A;  4F8K A;  1WI4 A;  2EGK A;  3QJN A;  4JOF A;  1WIF A;  3SHU A;  2KQF A;  4K72 A;  2O2T A;  1MFG A;  2KOH A;  3PV2 A;  3HPK A;  1XZ9 A;  2IWN A;  2YUY A;  1TQ3 A;  3CBY A;  3CS0 A;  3GCN A;  2PKT A;  1WI2 A;  1KWA A;  4LMM A;  1U3B A;  2FN5 A;  2G2L A;  2EDV A;  3GDU A;  4WYT A;  3OTP A;  3VQF A;  3O5N A;  1I16 A;  2V90 A;  2IWP A;  3R0H A;  3QIK A;  4JOP A;  2KYL A;  4OEO A;  2V1W A;  5EZ0 A;  1SOZ A;  1FC6 A;  1UJD A;  1QAU A;  3R68 A;  1GQ5 A;  2IWO A;  4UU6 A;  3KHF A;  1NF3 C;  2K1Z A;  2M0T A;  3ID3 A;  1MC7 A;  3WKL A;  4NMP A;  2OS6 A;  2JIL A;  5F3X A;  4NMR A;  1V1T A;  2KOJ A;  1UIT A;  1IU0 A;  1N7T A;  1W9O A;  1N99 A;  3AXA A;  2I0I A;  2M0V A;  2RCZ A;  3NFK A;  5B6L A;  1U37 A;  1D5G A;  4P0C A;  2KAW A;  1OBZ A;  2QKV A;  1BFE A;  4REY A;  3BPU A;  4GVC A;  2OMJ A;  2X7Z A;  1UEW A;  3GDS A;  2Z17 A;  2EEI A;  1TP5 A;  1R6J A;  3KZE A;  4JOE A;  3GJ9 A;  2DLS A;  4E35 A;  2RRM A;  3QGL A;  4UU5 A;  1K32 A;  2FNE A;  2KJD A;  2JRE A;  2I04 A;  3LNY A;  5HF4 A;  5E6P B;  4RI0 A;  2YT8 A;  3CC0 A;  3RL8 A;  3MH4 A;  2KG2 A;  1IU2 A;  2AIN A;  2JOA A;  3I1E A;  3L4F D;  1B8Q A;  2QKU A;  5JXB A;  2M3M A;  2EJY A;  3PDV A;  1GQ4 A;  4PQW A;  3K82 A;  2GZV A;  5HEB A;  5HF1 A;  1W9Q A;  1W9E A;  1UM7 A;  3ID1 A;  3DJ3 A;  3I4W A;  2OPG A;  4NMS A;  4JOH A;  4Z33 A;  2EEG A;  1WHD A;  3PV4 A;  1TE0 A;  1T2M A;  3HVQ C;  1G9O A;  2Q3G A;  3DJ1 A;  2EV8 A;  1UM1 A;  3EGG C;  2CS5 A;  2EHR A;  2CSS A;  3GCO A;  2QT5 A;  4EDJ A;  1UJU A;  2YUB A;  1QLC A;  2H3L A;  1Y7N A;  2KPL A;  2OSG A;  2EEH A;  3SFJ A;  4FGM A;  2PZD A;  4Q2Q A;  3PV5 A;  2DLU A;  2I6V A;  1NTE A;  2FE5 A;  3SUZ A;  4Z8J A;  4KFW A;  2M0U A;  4NNL A;  2KBS A;  4JL7 A;  2QKT A;  1VCW A;  2QBW A;  2JIN A;  1UEQ A;  4OEP A;  4R2Z A;  4NMV A;  4K78 A;  3QE1 A;  1VA8 A;  4NXR A;  1P1D A;  3K1R A;  5EYZ A;  3ID2 A;  4NXP A;  3O46 A;  3CBZ A;  2DAZ A;  1WF7 A;  5DTH A;  5HFE A;  2EDP A;  1Q3O A;  2KOM A;  3PS4 A;  2LUI A;  2EGN A;  3GGE A;  3TMH A;  3R69 A;  4Q2O A;  5D13 A;  2JXO A;  2EDZ A;  1FC7 A;  3MH7 A;  4K76 A;  1FCF A;  2MX6 A;  2HGA A;  2D92 A;  2R3Y A;  4NXQ A;  2R4H A;  3KZD A;  1WFV A;  3FY5 A;  4JOR A;  4E34 A;  5E1Y A;  4K6Y A;  1U39 A;  3RL7 A;  5HET A;  1UHP A;  2OZF A;  1U38 A;  2DB5 A;  4E3B A;  1WFG A;  3DIW A;  2KA9 A;  2AWW A;  1UEZ A;  4JOG A;  2KPK A;  5E22 A;  5HFF A;  5HEY A;  5HED A;  2DMZ A;  3STJ A;  4YYX A;  3DJA A;  4YDP A;  1Y8T A;  2DM8 A;  4IC6 A;  4JOJ A;  2KJK A;  3I18 A;  3LNX A;  3CH8 A;  2Z9I A;  2D90 A;  4WYU A;  3JXT A;  1X5R A;  2M10 A;  1QAV A;  5G1E A;  4L8N A;  1WJL A;  2LOB A;  1PDR A;  3WKM A;  2DKR A;  2F0A A;  1P1E A;  2LC7 A;  2EEJ A;  3EGH C;  5E21 A;  1M5Z A;  1N6E A;  2MHO A;  1ZUB A;  2PDZ A;  3K50 A;  1UF1 A;  4NMQ A;  1Q7X A;  3DOR A;  4XHV A;  2VSV A;  4OAJ A;  2E7K A;  1I92 A;  2KL1 A;  1X6D A;  5HFD A;  2I1N A;  2PNT A;  3QO6 A;  2WL7 A;  2CSJ A;  2OCS A;  3TSZ A;  2HE2 A;  2YTW A;  1WH1 A;  4K75 A;  4O06 A;  1WF8 A;  2H3M A;  2AWU A;  1KEF A;  1ZOK A;  2ZPL A;  2ENO A;  1N7E A;  1V6B A;  1YBO A;  5HJ1 A;  1V5L A;  2D8I A;  1OBX A;  3CBX A;  3ID4 A;  1FC9 A;  2LC6 A;  5HFB A;  1SOT A;  1UJV A;  4AMH A;  1Q3P A;  4Q6H A;  2M0Z A;  1X8S A;  3ZRT A;  3CYY A;  2QG1 A;  1UFX A;  1VJ6 A;  2OGP A;  2EGO A;  2Q9V A;  2W4F A;  2L97 A;  3MH6 A;  1X5Q A;  1N7F A;  1LCY A;  1RGW A;  3VQG A;  2VWR A;  2REY A;  4HOP A;  1X45 A;  5G1D A;  5E11 A; 
#chains in the Genus database with same CATH topology
 2I4S A;  4Q2N A;  3GAB A;  2HE4 A;  2VRF A;  5I7Z A;  1RZX A;  1OZI A;  1VAE A;  1L6O A;  2L4T A;  2H2C A;  3QDO A;  5HFC A;  4NMT A;  1BE9 A;  3SOE A;  1V5Q A;  5F67 A;  5GND A;  2VPH A;  3HPM A;  2YT7 A;  1QAV B;  2PA1 A;  5GLJ A;  2W7R A;  1Z87 A;  4G69 A;  5FB8 C;  4N6X A;  2ZPM A;  5A2P A;  2OQS A;  1V62 A;  3TSW A;  2JIK A;  2VSP A;  4GVD A;  5ILB A;  3OU0 A;  1X5N A;  2L4S A;  3GDV A;  2DC2 A;  2DJT A;  2PKU A;  4KFV A;  4P2A B;  4Q6S A;  5HDY A;  1N6F A;  2LA8 A;  2AWX A;  2F5Y A;  1OBY A;  1MFL A;  1IHJ A;  4Q2P A;  3SHW A;  2KRG A;  3TSV A;  2P3W A;  4Q3H A;  2G5M B;  2JWE A;  1WG6 A;  2KJP A;  2KV8 A;  4JOK A;  2BYG A;  4H11 A;  3NFL A;  5H3J A;  1KY9 A;  2H2B A;  2EXG A;  2FCF A;  2I0L A;  1Z86 A;  2UZC A;  4GHN A;  1GM1 A;  5FHT A;  3RLE A;  1N6D A;  1VB7 A;  2K20 A;  3QJM A;  4NNM A;  3E17 A;  4MPA A;  2VZ5 A;  1TP3 A;  1UEP A;  1WHA A;  1RGR A;  1RY4 A;  2EAQ A;  3NGH A;  4HOP B;  2IWQ A;  3PDZ A;  3B76 A;  4NMO A;  3GSL A;  4F8K A;  1WI4 A;  2EGK A;  3QJN A;  4JOF A;  1WIF A;  3SHU A;  2KQF A;  4K72 A;  2O2T A;  1MFG A;  2KOH A;  3PV2 A;  3HPK A;  1XZ9 A;  2IWN A;  2YUY A;  1TQ3 A;  3CBY A;  3CS0 A;  3GCN A;  2PKT A;  1WI2 A;  1KWA A;  4LMM A;  1U3B A;  2FN5 A;  2G2L A;  2EDV A;  3GDU A;  4WYT A;  3OTP A;  3VQF A;  3O5N A;  1I16 A;  2V90 A;  2IWP A;  3R0H A;  3QIK A;  4JOP A;  2KYL A;  4OEO A;  2V1W A;  5EZ0 A;  1SOZ A;  1FC6 A;  1UJD A;  4JJ3 A;  1QAU A;  3R68 A;  1GQ5 A;  2IWO A;  4UU6 A;  3KHF A;  1NF3 C;  2K1Z A;  2M0T A;  3ID3 A;  1MC7 A;  3WKL A;  4NMP A;  2OS6 A;  2JIL A;  5F3X A;  4NMR A;  1V1T A;  2KOJ A;  1UIT A;  1IU0 A;  1N7T A;  1W9O A;  1N99 A;  3AXA A;  2I0I A;  2M0V A;  2RCZ A;  3NFK A;  5B6L A;  1U37 A;  1D5G A;  4P0C A;  2KAW A;  1OBZ A;  2QKV A;  1BFE A;  4REY A;  3BPU A;  4GVC A;  2OMJ A;  2X7Z A;  1UEW A;  3GDS A;  2Z17 A;  2EEI A;  1TP5 A;  1R6J A;  3KZE A;  4JOE A;  3GJ9 A;  2DLS A;  4E35 A;  2RRM A;  2JSN A;  3QGL A;  4UU5 A;  1K32 A;  2FNE A;  2KJD A;  2JRE A;  2I04 A;  3LNY A;  5HF4 A;  5E6P B;  4RI0 A;  2YT8 A;  3CC0 A;  3RL8 A;  3MH4 A;  2KG2 A;  1IU2 A;  2AIN A;  2JOA A;  3I1E A;  3L4F D;  1B8Q A;  2QKU A;  5JXB A;  2M3M A;  2EJY A;  3PDV A;  1GQ4 A;  3KDK A;  4PQW A;  3K82 A;  2GZV A;  5HEB A;  5HF1 A;  1W9Q A;  1W9E A;  1UM7 A;  3ID1 A;  3DJ3 A;  3I4W A;  2OPG A;  4NMS A;  4JOH A;  4Z33 A;  2EEG A;  1WHD A;  3PV4 A;  1TE0 A;  1T2M A;  3HVQ C;  1G9O A;  2Q3G A;  3DJ1 A;  2EV8 A;  1UM1 A;  3EGG C;  2CS5 A;  2EHR A;  2CSS A;  2GEF A;  3GCO A;  2QT5 A;  4EDJ A;  1UJU A;  2YUB A;  1QLC A;  2H3L A;  1Y7N A;  2KPL A;  2OSG A;  2EEH A;  3SFJ A;  4FGM A;  2PZD A;  4Q2Q A;  3PV5 A;  2DLU A;  2I6V A;  1NTE A;  2FE5 A;  3SUZ A;  4Z8J A;  4KFW A;  2M0U A;  4NNL A;  2KBS A;  4JL7 A;  2QKT A;  1VCW A;  2QBW A;  2JIN A;  1UEQ A;  4OEP A;  4R2Z A;  4NMV A;  4K78 A;  3QE1 A;  1VA8 A;  4NXR A;  1P1D A;  3K1R A;  5EYZ A;  4FLN A;  3ID2 A;  4NXP A;  3O46 A;  3CBZ A;  2DAZ A;  1WF7 A;  5DTH A;  5HFE A;  2EDP A;  1Q3O A;  3KDG A;  2KOM A;  3PS4 A;  2LUI A;  2EGN A;  3GGE A;  3TMH A;  3R69 A;  4Q2O A;  5D13 A;  2JXO A;  2EDZ A;  1FC7 A;  3MH7 A;  4K76 A;  1FCF A;  2MX6 A;  2HGA A;  1X9Z A;  2D92 A;  2R3Y A;  4NXQ A;  2R4H A;  3KZD A;  1WFV A;  3FY5 A;  4JOR A;  4E34 A;  5E1Y A;  4K6Y A;  1U39 A;  3RL7 A;  5HET A;  1UHP A;  2OZF A;  1U38 A;  2DB5 A;  4E3B A;  1WFG A;  3DIW A;  2KA9 A;  4JJ0 A;  2AWW A;  1UEZ A;  4JOG A;  2KPK A;  5E22 A;  5HFF A;  5HEY A;  5HED A;  2DMZ A;  3STJ A;  4YYX A;  3DJA A;  4YDP A;  1Y8T A;  2DM8 A;  4IC6 A;  4JOJ A;  2KJK A;  3I18 A;  3LNX A;  3CH8 A;  2Z9I A;  5B42 A;  2D90 A;  4WYU A;  3JXT A;  1X5R A;  2M10 A;  1QAV A;  5G1E A;  4L8N A;  1WJL A;  2LOB A;  1PDR A;  3WKM A;  2DKR A;  2F0A A;  1P1E A;  2LC7 A;  2EEJ A;  3EGH C;  5E21 A;  1M5Z A;  1N6E A;  2MHO A;  1ZUB A;  2PDZ A;  3K50 A;  1UF1 A;  4NMQ A;  1Q7X A;  3DOR A;  4XHV A;  2VSV A;  4OAJ A;  2E7K A;  1I92 A;  2KL1 A;  1X6D A;  5HFD A;  2I1N A;  2PNT A;  3QO6 A;  2WL7 A;  2CSJ A;  2OCS A;  3TSZ A;  2HE2 A;  2YTW A;  1WH1 A;  4K75 A;  4O06 A;  1WF8 A;  2H3M A;  2AWU A;  1KEF A;  1ZOK A;  2ZPL A;  2ENO A;  1N7E A;  1V6B A;  1YBO A;  5HJ1 A;  1V5L A;  2D8I A;  1OBX A;  3NCV A;  3CBX A;  3ID4 A;  1FC9 A;  2LC6 A;  5HFB A;  1SOT A;  1UJV A;  4AMH A;  1Q3P A;  4Q6H A;  2M0Z A;  1X8S A;  3ZRT A;  3CYY A;  2QG1 A;  1UFX A;  1VJ6 A;  2OGP A;  2EGO A;  2Q9V A;  2W4F A;  2L97 A;  3MH6 A;  1X5Q A;  1N7F A;  1LCY A;  1RGW A;  5IL9 A;  3VQG A;  2VWR A;  2REY A;  4HOP A;  1X45 A;  5G1D A;  5E11 A; 
#chains in the Genus database with same CATH homology
 2I4S A;  4Q2N A;  3GAB A;  2HE4 A;  2VRF A;  5I7Z A;  1RZX A;  1OZI A;  1VAE A;  1L6O A;  2L4T A;  2H2C A;  3QDO A;  5HFC A;  4NMT A;  1BE9 A;  3SOE A;  1V5Q A;  5F67 A;  5GND A;  2VPH A;  3HPM A;  2YT7 A;  1QAV B;  2PA1 A;  5GLJ A;  2W7R A;  1Z87 A;  4G69 A;  5FB8 C;  4N6X A;  2ZPM A;  5A2P A;  2OQS A;  1V62 A;  3TSW A;  2JIK A;  2VSP A;  4GVD A;  5ILB A;  3OU0 A;  1X5N A;  2L4S A;  3GDV A;  2DC2 A;  2DJT A;  2PKU A;  4KFV A;  4P2A B;  4Q6S A;  5HDY A;  1N6F A;  2LA8 A;  2AWX A;  2F5Y A;  1OBY A;  1MFL A;  1IHJ A;  4Q2P A;  3SHW A;  2KRG A;  3TSV A;  2P3W A;  4Q3H A;  2G5M B;  2JWE A;  1WG6 A;  2KJP A;  2KV8 A;  4JOK A;  2BYG A;  4H11 A;  3NFL A;  5H3J A;  1KY9 A;  2H2B A;  2EXG A;  2FCF A;  2I0L A;  1Z86 A;  2UZC A;  4GHN A;  1GM1 A;  5FHT A;  3RLE A;  1N6D A;  1VB7 A;  2K20 A;  3QJM A;  4NNM A;  3E17 A;  4MPA A;  2VZ5 A;  1TP3 A;  1UEP A;  1WHA A;  1RGR A;  1RY4 A;  2EAQ A;  3NGH A;  4HOP B;  2IWQ A;  3PDZ A;  3B76 A;  4NMO A;  3GSL A;  4F8K A;  1WI4 A;  2EGK A;  3QJN A;  4JOF A;  1WIF A;  3SHU A;  2KQF A;  4K72 A;  2O2T A;  1MFG A;  2KOH A;  3PV2 A;  3HPK A;  1XZ9 A;  2IWN A;  2YUY A;  1TQ3 A;  3CBY A;  3CS0 A;  3GCN A;  2PKT A;  1WI2 A;  1KWA A;  4LMM A;  1U3B A;  2FN5 A;  2G2L A;  2EDV A;  3GDU A;  4WYT A;  3OTP A;  3VQF A;  3O5N A;  1I16 A;  2V90 A;  2IWP A;  3R0H A;  3QIK A;  4JOP A;  2KYL A;  4OEO A;  2V1W A;  5EZ0 A;  1SOZ A;  1FC6 A;  1UJD A;  4JJ3 A;  1QAU A;  3R68 A;  1GQ5 A;  2IWO A;  4UU6 A;  3KHF A;  1NF3 C;  2K1Z A;  2M0T A;  3ID3 A;  1MC7 A;  3WKL A;  4NMP A;  2OS6 A;  2JIL A;  5F3X A;  4NMR A;  1V1T A;  2KOJ A;  1UIT A;  1IU0 A;  1N7T A;  1W9O A;  1N99 A;  3AXA A;  2I0I A;  2M0V A;  2RCZ A;  3NFK A;  5B6L A;  1U37 A;  1D5G A;  4P0C A;  2KAW A;  1OBZ A;  2QKV A;  1BFE A;  4REY A;  3BPU A;  4GVC A;  2OMJ A;  2X7Z A;  1UEW A;  3GDS A;  2Z17 A;  2EEI A;  1TP5 A;  1R6J A;  3KZE A;  4JOE A;  3GJ9 A;  2DLS A;  4E35 A;  2RRM A;  2JSN A;  3QGL A;  4UU5 A;  1K32 A;  2FNE A;  2KJD A;  2JRE A;  2I04 A;  3LNY A;  5HF4 A;  5E6P B;  4RI0 A;  2YT8 A;  3CC0 A;  3RL8 A;  3MH4 A;  2KG2 A;  1IU2 A;  2AIN A;  2JOA A;  3I1E A;  3L4F D;  1B8Q A;  2QKU A;  5JXB A;  2M3M A;  2EJY A;  3PDV A;  1GQ4 A;  3KDK A;  4PQW A;  3K82 A;  2GZV A;  5HEB A;  5HF1 A;  1W9Q A;  1W9E A;  1UM7 A;  3ID1 A;  3DJ3 A;  3I4W A;  2OPG A;  4NMS A;  4JOH A;  4Z33 A;  2EEG A;  1WHD A;  3PV4 A;  1TE0 A;  1T2M A;  3HVQ C;  1G9O A;  2Q3G A;  3DJ1 A;  2EV8 A;  1UM1 A;  3EGG C;  2CS5 A;  2EHR A;  2CSS A;  2GEF A;  3GCO A;  2QT5 A;  4EDJ A;  1UJU A;  2YUB A;  1QLC A;  2H3L A;  1Y7N A;  2KPL A;  2OSG A;  2EEH A;  3SFJ A;  4FGM A;  2PZD A;  4Q2Q A;  3PV5 A;  2DLU A;  2I6V A;  1NTE A;  2FE5 A;  3SUZ A;  4Z8J A;  4KFW A;  2M0U A;  4NNL A;  2KBS A;  4JL7 A;  2QKT A;  1VCW A;  2QBW A;  2JIN A;  1UEQ A;  4OEP A;  4R2Z A;  4NMV A;  4K78 A;  3QE1 A;  1VA8 A;  4NXR A;  1P1D A;  3K1R A;  5EYZ A;  4FLN A;  3ID2 A;  4NXP A;  3O46 A;  3CBZ A;  2DAZ A;  1WF7 A;  5DTH A;  5HFE A;  2EDP A;  1Q3O A;  3KDG A;  2KOM A;  3PS4 A;  2LUI A;  2EGN A;  3GGE A;  3TMH A;  3R69 A;  4Q2O A;  5D13 A;  2JXO A;  2EDZ A;  1FC7 A;  3MH7 A;  4K76 A;  1FCF A;  2MX6 A;  2HGA A;  1X9Z A;  2D92 A;  2R3Y A;  4NXQ A;  2R4H A;  3KZD A;  1WFV A;  3FY5 A;  4JOR A;  4E34 A;  5E1Y A;  4K6Y A;  1U39 A;  3RL7 A;  5HET A;  1UHP A;  2OZF A;  1U38 A;  2DB5 A;  4E3B A;  1WFG A;  3DIW A;  2KA9 A;  4JJ0 A;  2AWW A;  1UEZ A;  4JOG A;  2KPK A;  5E22 A;  5HFF A;  5HEY A;  5HED A;  2DMZ A;  3STJ A;  4YYX A;  3DJA A;  4YDP A;  1Y8T A;  2DM8 A;  4IC6 A;  4JOJ A;  2KJK A;  3I18 A;  3LNX A;  3CH8 A;  2Z9I A;  5B42 A;  2D90 A;  4WYU A;  3JXT A;  1X5R A;  2M10 A;  1QAV A;  5G1E A;  4L8N A;  1WJL A;  2LOB A;  1PDR A;  3WKM A;  2DKR A;  2F0A A;  1P1E A;  2LC7 A;  2EEJ A;  3EGH C;  5E21 A;  1M5Z A;  1N6E A;  2MHO A;  1ZUB A;  2PDZ A;  3K50 A;  1UF1 A;  4NMQ A;  1Q7X A;  3DOR A;  4XHV A;  2VSV A;  4OAJ A;  2E7K A;  1I92 A;  2KL1 A;  1X6D A;  5HFD A;  2I1N A;  2PNT A;  3QO6 A;  2WL7 A;  2CSJ A;  2OCS A;  3TSZ A;  2HE2 A;  2YTW A;  1WH1 A;  4K75 A;  4O06 A;  1WF8 A;  2H3M A;  2AWU A;  1KEF A;  1ZOK A;  2ZPL A;  2ENO A;  1N7E A;  1V6B A;  1YBO A;  5HJ1 A;  1V5L A;  2D8I A;  1OBX A;  3NCV A;  3CBX A;  3ID4 A;  1FC9 A;  2LC6 A;  5HFB A;  1SOT A;  1UJV A;  4AMH A;  1Q3P A;  4Q6H A;  2M0Z A;  1X8S A;  3ZRT A;  3CYY A;  2QG1 A;  1UFX A;  1VJ6 A;  2OGP A;  2EGO A;  2Q9V A;  2W4F A;  2L97 A;  3MH6 A;  1X5Q A;  1N7F A;  1LCY A;  1RGW A;  5IL9 A;  3VQG A;  2VWR A;  2REY A;  4HOP A;  1X45 A;  5G1D A;  5E11 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...