2OZFA

The crystal structure of the 2nd pdz domain of the human nherf-1 (slc9a3r1)
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
92
structure length
92
Chain Sequence
SMLRPRLCTMKKGPSGYGFNLHSDKSKPGQFIRSVDPDSPAEASGLRAQDRIVEVNGVCMEGKQHGDVVSAIRAGGDETKLLVVDRETETSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ezrin-radixin-moesin-binding phosphoprotein 50
publication title The crystal structure of the 2nd PDZ domain of the human NHERF-1 (SLC9A3R1)
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 19
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2007-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17820 PDZ_6 PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 2ozfA00
3ID3A 4R2ZA 2E7KA 2LUIA 4Z8JA 1VB7A 3CBYA 4K72A 4NXQA 4JOPA 3I1EA 2DMZA 3K50A 1X8SA 4WYTA 2M0TA 4XHVA 2HE4A 4KFVA 2M10A 2I4SA 3RL8A 2KL1A 3KHFA 1RY4A 3TSVA 2QKUA 1UJUA 4JOFA 1OZIA 1VA8A 2F0AA 3TSWA 5FHTA 3I18A 1TP5A 3QGLA 1WF8A 1U39A 4Q6HA 5E21A 2PKTA 5HFCA 4REYA 1OBYA 1U3BA 2PDZA 1MFLA 2BYGA 2W4FA 3GSLA 5E22A 1UM1A 1IHJA 1KEFA 2EAQA 3CBZA 4NXPA 2DJTA 4E3BA 4HOPA 3NFKA 1Q3PA 1V6BA 1WF7A 2PZDA 2OS6A 3MH6A 1G9OA 3CS0A 2Z9IA 2EEJA 4LMMA 4Q2NA 2EDVA 2HGAA 5E6PB 5HEDA 3VQFA 2KRGA 2P3WA 2QT5A 4E35A 2CSSA 1QAVB 1FCFA 3ID1A 2OGPA 4GVCA 4F8KA 2IWOA 1MFGA 4NMOA 2W7RA 1NTEA 1WHDA 1P1EA 2EEGA 2K1ZA 3FY5A 2Q3GA 1BFEA 2QKTA 4OEOA 4JOGA 2JXOA 2DLUA 4RI0A 1UFXA 1UITA 3QO6A 3R0HA 3DJ1A 1GQ5A 4NMQA 1N7FA 2I0LA 2FN5A 1TE0A 2YT8A 2FE5A 1WFVA 3NGHA 5HDYA 4NXRA 1M5ZA 2QG1A 4Q2PA 2ENOA 2CS5A 2D90A 1UHPA 2VWRA 2PA1A 1N6FA 1KWAA 2VZ5A 1FC7A 2KAWA 5HFFA 2IWPA 2MX6A 1V5LA 1U38A 2D8IA 2OQSA 4K75A 4O06A 4OAJA 1GQ4A 4NMRA 2KOHA 2M3MA 2KYLA 1WIFA 3TMHA 5GLJA 3ID2A 3E17A 4Z33A 4KFWA 3JXTA 4Q2OA 4K76A 5JXBA 3GDUA 1U37A 3SOEA 3PDZA 3GDVA 2LC6A 2YUYA 2VSVA 1RZXA 2AINA 1Q3OA 1WHAA 3PDVA 2LOBA 3K82A 4FGMA 3DJAA 1FC6A 2OCSA 1I92A 1TP3A 1UEQA 5G1EA 5I7ZA 2JINA 4YDPA 1OBXA 2CSJA 5HF1A 2VPHA 2EDZA 1UEZA 1V5QA 3MH7A 2OPGA 1FC9A 1N99A 3B76A 5F67A 5H3JA 1QAUA 1D5GA 2KA9A 1X5RA 1KY9A 1MC7A 3L4FD 5HF4A 3NFLA 2V90A 4K6YA 1Y8TA 3QE1A 3HVQC 3LNXA 2X7ZA 3GCOA 1I16A 3R69A 4UU6A 2H2BA 3LNYA 1ZUBA 1IU0A 3QJMA 2R3YA 1WI4A 3EGGC 2EGKA 3CYYA 3CBXA 2AWUA 4JL7A 2L4SA 2ZPMA 4EDJA 4OEPA 2L4TA 4JOKA 4G69A 2KJDA 1TQ3A 2PKUA 1BE9A 3DORA 5F3XA 4N6XA 1Z87A 5D13A 2DC2A 2OMJA 2WL7A 1WFGA 2EDPA 3ZRTA 1SOZA 2H3LA 2FNEA 2O2TA 2DLSA 1K32A 4NMTA 3WKLA 3CC0A 2M0ZA 3GGEA 2EEIA 5HFDA 1W9OA 2G5MB 2JWEA 5EYZA 2KG2A 4PQWA 1UJDA 1OBZA 4UU5A 2JILA 4HOPB 3STJA 2KPKA 1UF1A 4NMPA 4JOJA 3AXAA 1Z86A 2Z17A 3GCNA 2UZCA 4MPAA 1X6DA 2JIKA 5EZ0A 1YBOA 5G1DA 1N6DA 5FB8C 1VCWA 1QLCA 1W9EA 1LCYA 2KBSA 1WI2A 3BPUA 3PS4A 2K20A 2EEHA 2RRMA 1UEWA 1WH1A 1N7TA 2KQFA 2KPLA 4E34A 5DTHA 2YUBA 1L6OA 1N6EA 1QAVA 2I0IA 3PV5A 4WYUA 3HPKA 1WG6A 2EGNA 2QBWA 2EV8A 1VAEA 2H2CA 3SUZA 1Y7NA 2KOMA 1X45A 2RCZA 2KJKA 3QJNA 2F5YA 2GZVA 2IWNA 1Q7XA 3O5NA 2L97A 3SFJA 2HE2A 2YT7A 2QKVA 4NNLA 2KOJA 3CH8A 3R68A 1ZOKA 4NMVA 1V62A 2I6VA 1UEPA 1XZ9A 4AMHA 4Q3HA 3KZEA 1V1TA 2PNTA 1PDRA 1UJVA 5A2PA 3PV4A 2G2LA 1X5QA 2H3MA 2DB5A 1RGWA 2OSGA 3OU0A 4L8NA 1VJ6A 3DJ3A 3SHUA 2I04A 2DKRA 4K78A 1P1DA 3RLEA 1B8QA 4P2AB 3DIWA 3EGHC 3K1RA 5B6LA 2MHOA 5GNDA 3RL7A 2OZFA 4P0CA 3PV2A 4Q6SA 4YYXA 4GHNA 2EXGA 2Q9VA 5E1YA 2ZPLA 2VSPA 2VRFA 2JOAA 1UM7A 3GJ9A 1WJLA 2V1WA 5HFBA 2KJPA 2LA8A 1T2MA 4JOHA 2EGOA 2EHRA 2EJYA 2IWQA 5HFEA 3KZDA 3HPMA 2LC7A 2DAZA 5HETA 3O46A 2M0UA 1IU2A 3QIKA 2REYA 1GM1A 4NMSA 2M0VA 4H11A 2I1NA 4Q2QA 4NNMA 4IC6A 5HEYA 1NF3C 3QDOA 4JOEA 3SHWA 3GDSA 4GVDA 3I4WA 2FCFA 2AWXA 1RGRA 1X5NA 5HJ1A 2R4HA 1R6JA 2YTWA 3VQGA 2JREA 1W9QA 2KV8A 3WKMA 1SOTA 2D92A 5HEBA 2AWWA 3TSZA 3OTPA 3MH4A 1N7EA 3ID4A 5E11A 2DM8A 4JORA
chains in the Genus database with same CATH superfamily
3ID3A 4R2ZA 2E7KA 2LUIA 4Z8JA 1VB7A 3CBYA 4K72A 4NXQA 4JOPA 3I1EA 2DMZA 3K50A 1X8SA 4WYTA 2M0TA 4XHVA 2HE4A 4KFVA 2M10A 2I4SA 3RL8A 2KL1A 3KHFA 1RY4A 3TSVA 2QKUA 1UJUA 4JOFA 1OZIA 1VA8A 2F0AA 3TSWA 5FHTA 3I18A 1TP5A 3QGLA 1WF8A 1U39A 4Q6HA 5E21A 2PKTA 5HFCA 4REYA 1OBYA 1U3BA 2PDZA 1MFLA 2BYGA 2W4FA 3GSLA 5E22A 1UM1A 1IHJA 1KEFA 2EAQA 3CBZA 4NXPA 2DJTA 4E3BA 4HOPA 3NFKA 1Q3PA 1V6BA 1WF7A 2PZDA 2OS6A 3MH6A 1G9OA 3CS0A 2Z9IA 2EEJA 4LMMA 4Q2NA 2EDVA 2GEFA 2HGAA 5E6PB 5HEDA 3VQFA 2KRGA 2P3WA 2QT5A 4E35A 2CSSA 1QAVB 1FCFA 3ID1A 2OGPA 4GVCA 4F8KA 2IWOA 1MFGA 4NMOA 2W7RA 1NTEA 1WHDA 1P1EA 2EEGA 2K1ZA 3FY5A 2Q3GA 1BFEA 2QKTA 4OEOA 4JOGA 2JXOA 2DLUA 3KDKA 4RI0A 1UFXA 1UITA 3QO6A 3R0HA 3DJ1A 1GQ5A 4NMQA 1N7FA 2I0LA 3GABA 2FN5A 1TE0A 2YT8A 2FE5A 1WFVA 3NGHA 5HDYA 4NXRA 1M5ZA 2QG1A 4Q2PA 2ENOA 2CS5A 2D90A 1UHPA 2VWRA 2PA1A 1N6FA 1KWAA 2VZ5A 1FC7A 2KAWA 4JJ0A 5HFFA 2IWPA 2MX6A 1V5LA 1U38A 2D8IA 2OQSA 4K75A 4O06A 4OAJA 1GQ4A 4NMRA 2KOHA 2M3MA 2KYLA 1WIFA 3TMHA 5GLJA 3ID2A 3E17A 4Z33A 4KFWA 3JXTA 4Q2OA 4K76A 5JXBA 3GDUA 1U37A 3SOEA 3PDZA 3GDVA 2LC6A 2YUYA 2VSVA 1RZXA 2AINA 5IL9A 1Q3OA 1WHAA 3PDVA 2LOBA 3K82A 4FGMA 3DJAA 1FC6A 2OCSA 1I92A 1TP3A 1UEQA 5G1EA 5I7ZA 2JINA 4YDPA 1OBXA 2CSJA 5HF1A 2VPHA 2EDZA 1UEZA 1V5QA 3KDGA 2OPGA 3MH7A 1FC9A 1N99A 3B76A 5F67A 5H3JA 1QAUA 1D5GA 2KA9A 1X5RA 1KY9A 1MC7A 3L4FD 5HF4A 3NFLA 2V90A 4K6YA 1Y8TA 3QE1A 3HVQC 3LNXA 2X7ZA 3GCOA 1I16A 3R69A 4UU6A 2H2BA 3LNYA 1ZUBA 1IU0A 3QJMA 2R3YA 1WI4A 3EGGC 2EGKA 3CYYA 3CBXA 2AWUA 4JL7A 2L4SA 2ZPMA 4EDJA 4OEPA 2L4TA 4JOKA 4G69A 2KJDA 1TQ3A 2PKUA 1BE9A 3DORA 5F3XA 4N6XA 1Z87A 5D13A 2DC2A 2OMJA 2WL7A 4FLNA 1WFGA 2EDPA 3ZRTA 1SOZA 2H3LA 2FNEA 2O2TA 2DLSA 1K32A 4NMTA 3WKLA 3CC0A 2M0ZA 3GGEA 2EEIA 5HFDA 1W9OA 2G5MB 2JWEA 5EYZA 2KG2A 4PQWA 1UJDA 1OBZA 4UU5A 2JILA 4HOPB 3STJA 2KPKA 1UF1A 4NMPA 4JOJA 3AXAA 3NCVA 1Z86A 2Z17A 3GCNA 2UZCA 4MPAA 1X6DA 2JIKA 5EZ0A 1YBOA 5G1DA 1N6DA 5FB8C 1VCWA 1QLCA 1W9EA 1LCYA 2KBSA 1WI2A 3BPUA 3PS4A 2K20A 2EEHA 2RRMA 1UEWA 1WH1A 1N7TA 2KQFA 2KPLA 4E34A 5DTHA 2YUBA 1L6OA 1N6EA 1QAVA 2I0IA 3PV5A 4WYUA 3HPKA 1WG6A 2EGNA 2QBWA 2EV8A 1VAEA 4JJ3A 2H2CA 3SUZA 1Y7NA 2KOMA 1X45A 2RCZA 2KJKA 3QJNA 2F5YA 2GZVA 2IWNA 1Q7XA 3O5NA 2L97A 2JSNA 3SFJA 2HE2A 2YT7A 2QKVA 4NNLA 2KOJA 3CH8A 3R68A 1ZOKA 4NMVA 1V62A 2I6VA 1UEPA 1XZ9A 4AMHA 4Q3HA 3KZEA 1V1TA 2PNTA 1PDRA 1UJVA 5A2PA 3PV4A 2G2LA 1X5QA 2H3MA 2DB5A 1RGWA 2OSGA 3OU0A 4L8NA 1VJ6A 1X9ZA 3DJ3A 3SHUA 2I04A 2DKRA 4K78A 1P1DA 3RLEA 1B8QA 4P2AB 3DIWA 3EGHC 3K1RA 5B6LA 2MHOA 5GNDA 3RL7A 2OZFA 4P0CA 3PV2A 4Q6SA 4YYXA 4GHNA 2EXGA 2Q9VA 5E1YA 2ZPLA 2VSPA 2VRFA 2JOAA 1UM7A 3GJ9A 1WJLA 2V1WA 5HFBA 2KJPA 2LA8A 1T2MA 4JOHA 2EGOA 2EHRA 2EJYA 2IWQA 5HFEA 3KZDA 3HPMA 5ILBA 2LC7A 2DAZA 5HETA 3O46A 2M0UA 1IU2A 3QIKA 2REYA 1GM1A 4NMSA 2M0VA 4H11A 2I1NA 4Q2QA 4NNMA 4IC6A 5HEYA 1NF3C 3QDOA 4JOEA 3SHWA 3GDSA 4GVDA 3I4WA 2FCFA 2AWXA 1RGRA 1X5NA 5HJ1A 2R4HA 1R6JA 2YTWA 3VQGA 5B42A 2JREA 1W9QA 2KV8A 3WKMA 1SOTA 2D92A 5HEBA 2AWWA 3TSZA 3OTPA 3MH4A 1N7EA 3ID4A 5E11A 2DM8A 4JORA
chains in the Genus database with same CATH topology
3ID3A 4R2ZA 2E7KA 2LUIA 4Z8JA 1VB7A 3CBYA 4K72A 4NXQA 4JOPA 3I1EA 2DMZA 3K50A 1X8SA 4WYTA 2M0TA 4XHVA 2HE4A 4KFVA 2M10A 2I4SA 3RL8A 2KL1A 3KHFA 1RY4A 3TSVA 2QKUA 1UJUA 4JOFA 1OZIA 1VA8A 2F0AA 3TSWA 5FHTA 3I18A 1TP5A 3QGLA 1WF8A 1U39A 4Q6HA 5E21A 2PKTA 5HFCA 4REYA 1OBYA 1U3BA 2PDZA 1MFLA 2BYGA 2W4FA 3GSLA 5E22A 1UM1A 1IHJA 1KEFA 2EAQA 3CBZA 4NXPA 2DJTA 4E3BA 4HOPA 3NFKA 1Q3PA 1V6BA 1WF7A 2PZDA 2OS6A 3MH6A 1G9OA 3CS0A 2Z9IA 2EEJA 4LMMA 4Q2NA 2EDVA 2GEFA 2HGAA 5E6PB 5HEDA 3VQFA 2KRGA 2P3WA 2QT5A 4E35A 2CSSA 1QAVB 1FCFA 3ID1A 2OGPA 4GVCA 4F8KA 2IWOA 1MFGA 4NMOA 2W7RA 1NTEA 1WHDA 1P1EA 2EEGA 2K1ZA 3FY5A 2Q3GA 1BFEA 2QKTA 4OEOA 4JOGA 2JXOA 2DLUA 3KDKA 4RI0A 1UFXA 1UITA 3QO6A 3R0HA 3DJ1A 1GQ5A 4NMQA 1N7FA 2I0LA 3GABA 2FN5A 1TE0A 2YT8A 2FE5A 1WFVA 3NGHA 5HDYA 4NXRA 1M5ZA 2QG1A 4Q2PA 2ENOA 2CS5A 2D90A 1UHPA 2VWRA 2PA1A 1N6FA 1KWAA 2VZ5A 1FC7A 2KAWA 4JJ0A 5HFFA 2IWPA 2MX6A 1V5LA 1U38A 2D8IA 2OQSA 4K75A 4O06A 4OAJA 1GQ4A 4NMRA 2KOHA 2M3MA 2KYLA 1WIFA 3TMHA 5GLJA 3ID2A 3E17A 4Z33A 4KFWA 3JXTA 4Q2OA 4K76A 5JXBA 3GDUA 1U37A 3SOEA 3PDZA 3GDVA 2LC6A 2YUYA 2VSVA 1RZXA 2AINA 5IL9A 1Q3OA 1WHAA 3PDVA 2LOBA 3K82A 4FGMA 3DJAA 1FC6A 2OCSA 1I92A 1TP3A 1UEQA 5G1EA 5I7ZA 2JINA 4YDPA 1OBXA 2CSJA 5HF1A 2VPHA 2EDZA 1UEZA 1V5QA 3KDGA 2OPGA 3MH7A 1FC9A 1N99A 3B76A 5F67A 5H3JA 1QAUA 1D5GA 2KA9A 1X5RA 1KY9A 1MC7A 3L4FD 5HF4A 3NFLA 2V90A 4K6YA 1Y8TA 3QE1A 3HVQC 3LNXA 2X7ZA 3GCOA 1I16A 3R69A 4UU6A 2H2BA 3LNYA 1ZUBA 1IU0A 3QJMA 2R3YA 1WI4A 3EGGC 2EGKA 3CYYA 3CBXA 2AWUA 4JL7A 2L4SA 2ZPMA 4EDJA 4OEPA 2L4TA 4JOKA 4G69A 2KJDA 1TQ3A 2PKUA 1BE9A 3DORA 5F3XA 4N6XA 1Z87A 5D13A 2DC2A 2OMJA 2WL7A 4FLNA 1WFGA 2EDPA 3ZRTA 1SOZA 2H3LA 2FNEA 2O2TA 2DLSA 1K32A 4NMTA 3WKLA 3CC0A 2M0ZA 3GGEA 2EEIA 5HFDA 1W9OA 2G5MB 2JWEA 5EYZA 2KG2A 4PQWA 1UJDA 1OBZA 4UU5A 2JILA 4HOPB 3STJA 2KPKA 1UF1A 4NMPA 4JOJA 3AXAA 3NCVA 1Z86A 2Z17A 3GCNA 2UZCA 4MPAA 1X6DA 2JIKA 5EZ0A 1YBOA 5G1DA 1N6DA 5FB8C 1VCWA 1QLCA 1W9EA 1LCYA 2KBSA 1WI2A 3BPUA 3PS4A 2K20A 2EEHA 2RRMA 1UEWA 1WH1A 1N7TA 2KQFA 2KPLA 4E34A 5DTHA 2YUBA 1L6OA 1N6EA 1QAVA 2I0IA 3PV5A 4WYUA 3HPKA 1WG6A 2EGNA 2QBWA 2EV8A 1VAEA 4JJ3A 2H2CA 3SUZA 1Y7NA 2KOMA 1X45A 2RCZA 2KJKA 3QJNA 2F5YA 2GZVA 2IWNA 1Q7XA 3O5NA 2L97A 2JSNA 3SFJA 2HE2A 2YT7A 2QKVA 4NNLA 2KOJA 3CH8A 3R68A 1ZOKA 4NMVA 1V62A 2I6VA 1UEPA 1XZ9A 4AMHA 4Q3HA 3KZEA 1V1TA 2PNTA 1PDRA 1UJVA 5A2PA 3PV4A 2G2LA 1X5QA 2H3MA 2DB5A 1RGWA 2OSGA 3OU0A 4L8NA 1VJ6A 1X9ZA 3DJ3A 3SHUA 2I04A 2DKRA 4K78A 1P1DA 3RLEA 1B8QA 4P2AB 3DIWA 3EGHC 3K1RA 5B6LA 2MHOA 5GNDA 3RL7A 2OZFA 4P0CA 3PV2A 4Q6SA 4YYXA 4GHNA 2EXGA 2Q9VA 5E1YA 2ZPLA 2VSPA 2VRFA 2JOAA 1UM7A 3GJ9A 1WJLA 2V1WA 5HFBA 2KJPA 2LA8A 1T2MA 4JOHA 2EGOA 2EHRA 2EJYA 2IWQA 5HFEA 3KZDA 3HPMA 5ILBA 2LC7A 2DAZA 5HETA 3O46A 2M0UA 1IU2A 3QIKA 2REYA 1GM1A 4NMSA 2M0VA 4H11A 2I1NA 4Q2QA 4NNMA 4IC6A 5HEYA 1NF3C 3QDOA 4JOEA 3SHWA 3GDSA 4GVDA 3I4WA 2FCFA 2AWXA 1RGRA 1X5NA 5HJ1A 2R4HA 1R6JA 2YTWA 3VQGA 5B42A 2JREA 1W9QA 2KV8A 3WKMA 1SOTA 2D92A 5HEBA 2AWWA 3TSZA 3OTPA 3MH4A 1N7EA 3ID4A 5E11A 2DM8A 4JORA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ID3 A;  4R2Z A;  2E7K A;  2LUI A;  4Z8J A;  1VB7 A;  3CBY A;  4K72 A;  4NXQ A;  4JOP A;  3I1E A;  2DMZ A;  3K50 A;  1X8S A;  4WYT A;  2M0T A;  4XHV A;  2HE4 A;  4KFV A;  2M10 A;  2I4S A;  3RL8 A;  2KL1 A;  3KHF A;  1RY4 A;  3TSV A;  2QKU A;  1UJU A;  4JOF A;  1OZI A;  1VA8 A;  2F0A A;  3TSW A;  5FHT A;  3I18 A;  1TP5 A;  3QGL A;  1WF8 A;  1U39 A;  4Q6H A;  5E21 A;  2PKT A;  5HFC A;  4REY A;  1OBY A;  1U3B A;  2PDZ A;  1MFL A;  2BYG A;  2W4F A;  3GSL A;  5E22 A;  1UM1 A;  1IHJ A;  1KEF A;  2EAQ A;  3CBZ A;  4NXP A;  2DJT A;  4E3B A;  4HOP A;  3NFK A;  1Q3P A;  1V6B A;  1WF7 A;  2PZD A;  2OS6 A;  3MH6 A;  1G9O A;  3CS0 A;  2Z9I A;  2EEJ A;  4LMM A;  4Q2N A;  2EDV A;  2HGA A;  5E6P B;  5HED A;  3VQF A;  2KRG A;  2P3W A;  2QT5 A;  4E35 A;  2CSS A;  1QAV B;  1FCF A;  3ID1 A;  2OGP A;  4GVC A;  4F8K A;  2IWO A;  1MFG A;  4NMO A;  2W7R A;  1NTE A;  1WHD A;  1P1E A;  2EEG A;  2K1Z A;  3FY5 A;  2Q3G A;  1BFE A;  2QKT A;  4OEO A;  4JOG A;  2JXO A;  2DLU A;  4RI0 A;  1UFX A;  1UIT A;  3QO6 A;  3R0H A;  3DJ1 A;  1GQ5 A;  4NMQ A;  1N7F A;  2I0L A;  2FN5 A;  1TE0 A;  2YT8 A;  2FE5 A;  1WFV A;  3NGH A;  5HDY A;  4NXR A;  1M5Z A;  2QG1 A;  4Q2P A;  2ENO A;  2CS5 A;  2D90 A;  1UHP A;  2VWR A;  2PA1 A;  1N6F A;  1KWA A;  2VZ5 A;  1FC7 A;  2KAW A;  5HFF A;  2IWP A;  2MX6 A;  1V5L A;  1U38 A;  2D8I A;  2OQS A;  4K75 A;  4O06 A;  4OAJ A;  1GQ4 A;  4NMR A;  2KOH A;  2M3M A;  2KYL A;  1WIF A;  3TMH A;  5GLJ A;  3ID2 A;  3E17 A;  4Z33 A;  4KFW A;  3JXT A;  4Q2O A;  4K76 A;  5JXB A;  3GDU A;  1U37 A;  3SOE A;  3PDZ A;  3GDV A;  2LC6 A;  2YUY A;  2VSV A;  1RZX A;  2AIN A;  1Q3O A;  1WHA A;  3PDV A;  2LOB A;  3K82 A;  4FGM A;  3DJA A;  1FC6 A;  2OCS A;  1I92 A;  1TP3 A;  1UEQ A;  5G1E A;  5I7Z A;  2JIN A;  4YDP A;  1OBX A;  2CSJ A;  5HF1 A;  2VPH A;  2EDZ A;  1UEZ A;  1V5Q A;  3MH7 A;  2OPG A;  1FC9 A;  1N99 A;  3B76 A;  5F67 A;  5H3J A;  1QAU A;  1D5G A;  2KA9 A;  1X5R A;  1KY9 A;  1MC7 A;  3L4F D;  5HF4 A;  3NFL A;  2V90 A;  4K6Y A;  1Y8T A;  3QE1 A;  3HVQ C;  3LNX A;  2X7Z A;  3GCO A;  1I16 A;  3R69 A;  4UU6 A;  2H2B A;  3LNY A;  1ZUB A;  1IU0 A;  3QJM A;  2R3Y A;  1WI4 A;  3EGG C;  2EGK A;  3CYY A;  3CBX A;  2AWU A;  4JL7 A;  2L4S A;  2ZPM A;  4EDJ A;  4OEP A;  2L4T A;  4JOK A;  4G69 A;  2KJD A;  1TQ3 A;  2PKU A;  1BE9 A;  3DOR A;  5F3X A;  4N6X A;  1Z87 A;  5D13 A;  2DC2 A;  2OMJ A;  2WL7 A;  1WFG A;  2EDP A;  3ZRT A;  1SOZ A;  2H3L A;  2FNE A;  2O2T A;  2DLS A;  1K32 A;  4NMT A;  3WKL A;  3CC0 A;  2M0Z A;  3GGE A;  2EEI A;  5HFD A;  1W9O A;  2G5M B;  2JWE A;  5EYZ A;  2KG2 A;  4PQW A;  1UJD A;  1OBZ A;  4UU5 A;  2JIL A;  4HOP B;  3STJ A;  2KPK A;  1UF1 A;  4NMP A;  4JOJ A;  3AXA A;  1Z86 A;  2Z17 A;  3GCN A;  2UZC A;  4MPA A;  1X6D A;  2JIK A;  5EZ0 A;  1YBO A;  5G1D A;  1N6D A;  5FB8 C;  1VCW A;  1QLC A;  1W9E A;  1LCY A;  2KBS A;  1WI2 A;  3BPU A;  3PS4 A;  2K20 A;  2EEH A;  2RRM A;  1UEW A;  1WH1 A;  1N7T A;  2KQF A;  2KPL A;  4E34 A;  5DTH A;  2YUB A;  1L6O A;  1N6E A;  1QAV A;  2I0I A;  3PV5 A;  4WYU A;  3HPK A;  1WG6 A;  2EGN A;  2QBW A;  2EV8 A;  1VAE A;  2H2C A;  3SUZ A;  1Y7N A;  2KOM A;  1X45 A;  2RCZ A;  2KJK A;  3QJN A;  2F5Y A;  2GZV A;  2IWN A;  1Q7X A;  3O5N A;  2L97 A;  3SFJ A;  2HE2 A;  2YT7 A;  2QKV A;  4NNL A;  2KOJ A;  3CH8 A;  3R68 A;  1ZOK A;  4NMV A;  1V62 A;  2I6V A;  1UEP A;  1XZ9 A;  4AMH A;  4Q3H A;  3KZE A;  1V1T A;  2PNT A;  1PDR A;  1UJV A;  5A2P A;  3PV4 A;  2G2L A;  1X5Q A;  2H3M A;  2DB5 A;  1RGW A;  2OSG A;  3OU0 A;  4L8N A;  1VJ6 A;  3DJ3 A;  3SHU A;  2I04 A;  2DKR A;  4K78 A;  1P1D A;  3RLE A;  1B8Q A;  4P2A B;  3DIW A;  3EGH C;  3K1R A;  5B6L A;  2MHO A;  5GND A;  3RL7 A;  2OZF A;  4P0C A;  3PV2 A;  4Q6S A;  4YYX A;  4GHN A;  2EXG A;  2Q9V A;  5E1Y A;  2ZPL A;  2VSP A;  2VRF A;  2JOA A;  1UM7 A;  3GJ9 A;  1WJL A;  2V1W A;  5HFB A;  2KJP A;  2LA8 A;  1T2M A;  4JOH A;  2EGO A;  2EHR A;  2EJY A;  2IWQ A;  5HFE A;  3KZD A;  3HPM A;  2LC7 A;  2DAZ A;  5HET A;  3O46 A;  2M0U A;  1IU2 A;  3QIK A;  2REY A;  1GM1 A;  4NMS A;  2M0V A;  4H11 A;  2I1N A;  4Q2Q A;  4NNM A;  4IC6 A;  5HEY A;  1NF3 C;  3QDO A;  4JOE A;  3SHW A;  3GDS A;  4GVD A;  3I4W A;  2FCF A;  2AWX A;  1RGR A;  1X5N A;  5HJ1 A;  2R4H A;  1R6J A;  2YTW A;  3VQG A;  2JRE A;  1W9Q A;  2KV8 A;  3WKM A;  1SOT A;  2D92 A;  5HEB A;  2AWW A;  3TSZ A;  3OTP A;  3MH4 A;  1N7E A;  3ID4 A;  5E11 A;  2DM8 A;  4JOR A; 
#chains in the Genus database with same CATH topology
 3ID3 A;  4R2Z A;  2E7K A;  2LUI A;  4Z8J A;  1VB7 A;  3CBY A;  4K72 A;  4NXQ A;  4JOP A;  3I1E A;  2DMZ A;  3K50 A;  1X8S A;  4WYT A;  2M0T A;  4XHV A;  2HE4 A;  4KFV A;  2M10 A;  2I4S A;  3RL8 A;  2KL1 A;  3KHF A;  1RY4 A;  3TSV A;  2QKU A;  1UJU A;  4JOF A;  1OZI A;  1VA8 A;  2F0A A;  3TSW A;  5FHT A;  3I18 A;  1TP5 A;  3QGL A;  1WF8 A;  1U39 A;  4Q6H A;  5E21 A;  2PKT A;  5HFC A;  4REY A;  1OBY A;  1U3B A;  2PDZ A;  1MFL A;  2BYG A;  2W4F A;  3GSL A;  5E22 A;  1UM1 A;  1IHJ A;  1KEF A;  2EAQ A;  3CBZ A;  4NXP A;  2DJT A;  4E3B A;  4HOP A;  3NFK A;  1Q3P A;  1V6B A;  1WF7 A;  2PZD A;  2OS6 A;  3MH6 A;  1G9O A;  3CS0 A;  2Z9I A;  2EEJ A;  4LMM A;  4Q2N A;  2EDV A;  2GEF A;  2HGA A;  5E6P B;  5HED A;  3VQF A;  2KRG A;  2P3W A;  2QT5 A;  4E35 A;  2CSS A;  1QAV B;  1FCF A;  3ID1 A;  2OGP A;  4GVC A;  4F8K A;  2IWO A;  1MFG A;  4NMO A;  2W7R A;  1NTE A;  1WHD A;  1P1E A;  2EEG A;  2K1Z A;  3FY5 A;  2Q3G A;  1BFE A;  2QKT A;  4OEO A;  4JOG A;  2JXO A;  2DLU A;  3KDK A;  4RI0 A;  1UFX A;  1UIT A;  3QO6 A;  3R0H A;  3DJ1 A;  1GQ5 A;  4NMQ A;  1N7F A;  2I0L A;  3GAB A;  2FN5 A;  1TE0 A;  2YT8 A;  2FE5 A;  1WFV A;  3NGH A;  5HDY A;  4NXR A;  1M5Z A;  2QG1 A;  4Q2P A;  2ENO A;  2CS5 A;  2D90 A;  1UHP A;  2VWR A;  2PA1 A;  1N6F A;  1KWA A;  2VZ5 A;  1FC7 A;  2KAW A;  4JJ0 A;  5HFF A;  2IWP A;  2MX6 A;  1V5L A;  1U38 A;  2D8I A;  2OQS A;  4K75 A;  4O06 A;  4OAJ A;  1GQ4 A;  4NMR A;  2KOH A;  2M3M A;  2KYL A;  1WIF A;  3TMH A;  5GLJ A;  3ID2 A;  3E17 A;  4Z33 A;  4KFW A;  3JXT A;  4Q2O A;  4K76 A;  5JXB A;  3GDU A;  1U37 A;  3SOE A;  3PDZ A;  3GDV A;  2LC6 A;  2YUY A;  2VSV A;  1RZX A;  2AIN A;  5IL9 A;  1Q3O A;  1WHA A;  3PDV A;  2LOB A;  3K82 A;  4FGM A;  3DJA A;  1FC6 A;  2OCS A;  1I92 A;  1TP3 A;  1UEQ A;  5G1E A;  5I7Z A;  2JIN A;  4YDP A;  1OBX A;  2CSJ A;  5HF1 A;  2VPH A;  2EDZ A;  1UEZ A;  1V5Q A;  3KDG A;  2OPG A;  3MH7 A;  1FC9 A;  1N99 A;  3B76 A;  5F67 A;  5H3J A;  1QAU A;  1D5G A;  2KA9 A;  1X5R A;  1KY9 A;  1MC7 A;  3L4F D;  5HF4 A;  3NFL A;  2V90 A;  4K6Y A;  1Y8T A;  3QE1 A;  3HVQ C;  3LNX A;  2X7Z A;  3GCO A;  1I16 A;  3R69 A;  4UU6 A;  2H2B A;  3LNY A;  1ZUB A;  1IU0 A;  3QJM A;  2R3Y A;  1WI4 A;  3EGG C;  2EGK A;  3CYY A;  3CBX A;  2AWU A;  4JL7 A;  2L4S A;  2ZPM A;  4EDJ A;  4OEP A;  2L4T A;  4JOK A;  4G69 A;  2KJD A;  1TQ3 A;  2PKU A;  1BE9 A;  3DOR A;  5F3X A;  4N6X A;  1Z87 A;  5D13 A;  2DC2 A;  2OMJ A;  2WL7 A;  4FLN A;  1WFG A;  2EDP A;  3ZRT A;  1SOZ A;  2H3L A;  2FNE A;  2O2T A;  2DLS A;  1K32 A;  4NMT A;  3WKL A;  3CC0 A;  2M0Z A;  3GGE A;  2EEI A;  5HFD A;  1W9O A;  2G5M B;  2JWE A;  5EYZ A;  2KG2 A;  4PQW A;  1UJD A;  1OBZ A;  4UU5 A;  2JIL A;  4HOP B;  3STJ A;  2KPK A;  1UF1 A;  4NMP A;  4JOJ A;  3AXA A;  3NCV A;  1Z86 A;  2Z17 A;  3GCN A;  2UZC A;  4MPA A;  1X6D A;  2JIK A;  5EZ0 A;  1YBO A;  5G1D A;  1N6D A;  5FB8 C;  1VCW A;  1QLC A;  1W9E A;  1LCY A;  2KBS A;  1WI2 A;  3BPU A;  3PS4 A;  2K20 A;  2EEH A;  2RRM A;  1UEW A;  1WH1 A;  1N7T A;  2KQF A;  2KPL A;  4E34 A;  5DTH A;  2YUB A;  1L6O A;  1N6E A;  1QAV A;  2I0I A;  3PV5 A;  4WYU A;  3HPK A;  1WG6 A;  2EGN A;  2QBW A;  2EV8 A;  1VAE A;  4JJ3 A;  2H2C A;  3SUZ A;  1Y7N A;  2KOM A;  1X45 A;  2RCZ A;  2KJK A;  3QJN A;  2F5Y A;  2GZV A;  2IWN A;  1Q7X A;  3O5N A;  2L97 A;  2JSN A;  3SFJ A;  2HE2 A;  2YT7 A;  2QKV A;  4NNL A;  2KOJ A;  3CH8 A;  3R68 A;  1ZOK A;  4NMV A;  1V62 A;  2I6V A;  1UEP A;  1XZ9 A;  4AMH A;  4Q3H A;  3KZE A;  1V1T A;  2PNT A;  1PDR A;  1UJV A;  5A2P A;  3PV4 A;  2G2L A;  1X5Q A;  2H3M A;  2DB5 A;  1RGW A;  2OSG A;  3OU0 A;  4L8N A;  1VJ6 A;  1X9Z A;  3DJ3 A;  3SHU A;  2I04 A;  2DKR A;  4K78 A;  1P1D A;  3RLE A;  1B8Q A;  4P2A B;  3DIW A;  3EGH C;  3K1R A;  5B6L A;  2MHO A;  5GND A;  3RL7 A;  2OZF A;  4P0C A;  3PV2 A;  4Q6S A;  4YYX A;  4GHN A;  2EXG A;  2Q9V A;  5E1Y A;  2ZPL A;  2VSP A;  2VRF A;  2JOA A;  1UM7 A;  3GJ9 A;  1WJL A;  2V1W A;  5HFB A;  2KJP A;  2LA8 A;  1T2M A;  4JOH A;  2EGO A;  2EHR A;  2EJY A;  2IWQ A;  5HFE A;  3KZD A;  3HPM A;  5ILB A;  2LC7 A;  2DAZ A;  5HET A;  3O46 A;  2M0U A;  1IU2 A;  3QIK A;  2REY A;  1GM1 A;  4NMS A;  2M0V A;  4H11 A;  2I1N A;  4Q2Q A;  4NNM A;  4IC6 A;  5HEY A;  1NF3 C;  3QDO A;  4JOE A;  3SHW A;  3GDS A;  4GVD A;  3I4W A;  2FCF A;  2AWX A;  1RGR A;  1X5N A;  5HJ1 A;  2R4H A;  1R6J A;  2YTW A;  3VQG A;  5B42 A;  2JRE A;  1W9Q A;  2KV8 A;  3WKM A;  1SOT A;  2D92 A;  5HEB A;  2AWW A;  3TSZ A;  3OTP A;  3MH4 A;  1N7E A;  3ID4 A;  5E11 A;  2DM8 A;  4JOR A; 
#chains in the Genus database with same CATH homology
 3ID3 A;  4R2Z A;  2E7K A;  2LUI A;  4Z8J A;  1VB7 A;  3CBY A;  4K72 A;  4NXQ A;  4JOP A;  3I1E A;  2DMZ A;  3K50 A;  1X8S A;  4WYT A;  2M0T A;  4XHV A;  2HE4 A;  4KFV A;  2M10 A;  2I4S A;  3RL8 A;  2KL1 A;  3KHF A;  1RY4 A;  3TSV A;  2QKU A;  1UJU A;  4JOF A;  1OZI A;  1VA8 A;  2F0A A;  3TSW A;  5FHT A;  3I18 A;  1TP5 A;  3QGL A;  1WF8 A;  1U39 A;  4Q6H A;  5E21 A;  2PKT A;  5HFC A;  4REY A;  1OBY A;  1U3B A;  2PDZ A;  1MFL A;  2BYG A;  2W4F A;  3GSL A;  5E22 A;  1UM1 A;  1IHJ A;  1KEF A;  2EAQ A;  3CBZ A;  4NXP A;  2DJT A;  4E3B A;  4HOP A;  3NFK A;  1Q3P A;  1V6B A;  1WF7 A;  2PZD A;  2OS6 A;  3MH6 A;  1G9O A;  3CS0 A;  2Z9I A;  2EEJ A;  4LMM A;  4Q2N A;  2EDV A;  2GEF A;  2HGA A;  5E6P B;  5HED A;  3VQF A;  2KRG A;  2P3W A;  2QT5 A;  4E35 A;  2CSS A;  1QAV B;  1FCF A;  3ID1 A;  2OGP A;  4GVC A;  4F8K A;  2IWO A;  1MFG A;  4NMO A;  2W7R A;  1NTE A;  1WHD A;  1P1E A;  2EEG A;  2K1Z A;  3FY5 A;  2Q3G A;  1BFE A;  2QKT A;  4OEO A;  4JOG A;  2JXO A;  2DLU A;  3KDK A;  4RI0 A;  1UFX A;  1UIT A;  3QO6 A;  3R0H A;  3DJ1 A;  1GQ5 A;  4NMQ A;  1N7F A;  2I0L A;  3GAB A;  2FN5 A;  1TE0 A;  2YT8 A;  2FE5 A;  1WFV A;  3NGH A;  5HDY A;  4NXR A;  1M5Z A;  2QG1 A;  4Q2P A;  2ENO A;  2CS5 A;  2D90 A;  1UHP A;  2VWR A;  2PA1 A;  1N6F A;  1KWA A;  2VZ5 A;  1FC7 A;  2KAW A;  4JJ0 A;  5HFF A;  2IWP A;  2MX6 A;  1V5L A;  1U38 A;  2D8I A;  2OQS A;  4K75 A;  4O06 A;  4OAJ A;  1GQ4 A;  4NMR A;  2KOH A;  2M3M A;  2KYL A;  1WIF A;  3TMH A;  5GLJ A;  3ID2 A;  3E17 A;  4Z33 A;  4KFW A;  3JXT A;  4Q2O A;  4K76 A;  5JXB A;  3GDU A;  1U37 A;  3SOE A;  3PDZ A;  3GDV A;  2LC6 A;  2YUY A;  2VSV A;  1RZX A;  2AIN A;  5IL9 A;  1Q3O A;  1WHA A;  3PDV A;  2LOB A;  3K82 A;  4FGM A;  3DJA A;  1FC6 A;  2OCS A;  1I92 A;  1TP3 A;  1UEQ A;  5G1E A;  5I7Z A;  2JIN A;  4YDP A;  1OBX A;  2CSJ A;  5HF1 A;  2VPH A;  2EDZ A;  1UEZ A;  1V5Q A;  3KDG A;  2OPG A;  3MH7 A;  1FC9 A;  1N99 A;  3B76 A;  5F67 A;  5H3J A;  1QAU A;  1D5G A;  2KA9 A;  1X5R A;  1KY9 A;  1MC7 A;  3L4F D;  5HF4 A;  3NFL A;  2V90 A;  4K6Y A;  1Y8T A;  3QE1 A;  3HVQ C;  3LNX A;  2X7Z A;  3GCO A;  1I16 A;  3R69 A;  4UU6 A;  2H2B A;  3LNY A;  1ZUB A;  1IU0 A;  3QJM A;  2R3Y A;  1WI4 A;  3EGG C;  2EGK A;  3CYY A;  3CBX A;  2AWU A;  4JL7 A;  2L4S A;  2ZPM A;  4EDJ A;  4OEP A;  2L4T A;  4JOK A;  4G69 A;  2KJD A;  1TQ3 A;  2PKU A;  1BE9 A;  3DOR A;  5F3X A;  4N6X A;  1Z87 A;  5D13 A;  2DC2 A;  2OMJ A;  2WL7 A;  4FLN A;  1WFG A;  2EDP A;  3ZRT A;  1SOZ A;  2H3L A;  2FNE A;  2O2T A;  2DLS A;  1K32 A;  4NMT A;  3WKL A;  3CC0 A;  2M0Z A;  3GGE A;  2EEI A;  5HFD A;  1W9O A;  2G5M B;  2JWE A;  5EYZ A;  2KG2 A;  4PQW A;  1UJD A;  1OBZ A;  4UU5 A;  2JIL A;  4HOP B;  3STJ A;  2KPK A;  1UF1 A;  4NMP A;  4JOJ A;  3AXA A;  3NCV A;  1Z86 A;  2Z17 A;  3GCN A;  2UZC A;  4MPA A;  1X6D A;  2JIK A;  5EZ0 A;  1YBO A;  5G1D A;  1N6D A;  5FB8 C;  1VCW A;  1QLC A;  1W9E A;  1LCY A;  2KBS A;  1WI2 A;  3BPU A;  3PS4 A;  2K20 A;  2EEH A;  2RRM A;  1UEW A;  1WH1 A;  1N7T A;  2KQF A;  2KPL A;  4E34 A;  5DTH A;  2YUB A;  1L6O A;  1N6E A;  1QAV A;  2I0I A;  3PV5 A;  4WYU A;  3HPK A;  1WG6 A;  2EGN A;  2QBW A;  2EV8 A;  1VAE A;  4JJ3 A;  2H2C A;  3SUZ A;  1Y7N A;  2KOM A;  1X45 A;  2RCZ A;  2KJK A;  3QJN A;  2F5Y A;  2GZV A;  2IWN A;  1Q7X A;  3O5N A;  2L97 A;  2JSN A;  3SFJ A;  2HE2 A;  2YT7 A;  2QKV A;  4NNL A;  2KOJ A;  3CH8 A;  3R68 A;  1ZOK A;  4NMV A;  1V62 A;  2I6V A;  1UEP A;  1XZ9 A;  4AMH A;  4Q3H A;  3KZE A;  1V1T A;  2PNT A;  1PDR A;  1UJV A;  5A2P A;  3PV4 A;  2G2L A;  1X5Q A;  2H3M A;  2DB5 A;  1RGW A;  2OSG A;  3OU0 A;  4L8N A;  1VJ6 A;  1X9Z A;  3DJ3 A;  3SHU A;  2I04 A;  2DKR A;  4K78 A;  1P1D A;  3RLE A;  1B8Q A;  4P2A B;  3DIW A;  3EGH C;  3K1R A;  5B6L A;  2MHO A;  5GND A;  3RL7 A;  2OZF A;  4P0C A;  3PV2 A;  4Q6S A;  4YYX A;  4GHN A;  2EXG A;  2Q9V A;  5E1Y A;  2ZPL A;  2VSP A;  2VRF A;  2JOA A;  1UM7 A;  3GJ9 A;  1WJL A;  2V1W A;  5HFB A;  2KJP A;  2LA8 A;  1T2M A;  4JOH A;  2EGO A;  2EHR A;  2EJY A;  2IWQ A;  5HFE A;  3KZD A;  3HPM A;  5ILB A;  2LC7 A;  2DAZ A;  5HET A;  3O46 A;  2M0U A;  1IU2 A;  3QIK A;  2REY A;  1GM1 A;  4NMS A;  2M0V A;  4H11 A;  2I1N A;  4Q2Q A;  4NNM A;  4IC6 A;  5HEY A;  1NF3 C;  3QDO A;  4JOE A;  3SHW A;  3GDS A;  4GVD A;  3I4W A;  2FCF A;  2AWX A;  1RGR A;  1X5N A;  5HJ1 A;  2R4H A;  1R6J A;  2YTW A;  3VQG A;  5B42 A;  2JRE A;  1W9Q A;  2KV8 A;  3WKM A;  1SOT A;  2D92 A;  5HEB A;  2AWW A;  3TSZ A;  3OTP A;  3MH4 A;  1N7E A;  3ID4 A;  5E11 A;  2DM8 A;  4JOR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...